BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25498_g6_i2 len=2209 path=[1942:0-307 19471:308-382 2325:383-406
21610:407-421 22613:422-462 19867:463-498 2441:499-536
@21741@!:537-1019 2962:1020-1028 2971:1029-1079 3022:1080-1199
3142:1200-1225 3168:1226-1288 3231:1289-1344 3287:1345-1376
3319:1377-1420 3363:1421-1493 3436:1494-1530 3473:1531-1589
3532:1590-1591 3534:1592-1672 3615:1673-1720 3663:1721-1761
8141:1762-1826 8206:1827-2208]

Length=2209
                                                                      Score     E

ref|XP_006350417.1|  PREDICTED: cytochrome P450 71D7-like               464   7e-152   
ref|XP_006350394.1|  PREDICTED: cytochrome P450 71D6-like               463   1e-151   
ref|XP_004237369.1|  PREDICTED: premnaspirodiene oxygenase              462   3e-151   
sp|P93530.1|C71D6_SOLCH  RecName: Full=Cytochrome P450 71D6             461   7e-151   Solanum chacoense
sp|P93531.1|C71D7_SOLCH  RecName: Full=Cytochrome P450 71D7             461   1e-150   Solanum chacoense
ref|XP_006350393.1|  PREDICTED: cytochrome P450 71D7-like               461   1e-150   
sp|A6YIH8.1|C7D55_HYOMU  RecName: Full=Premnaspirodiene oxygenase...    459   4e-150   Hyoscyamus muticus
emb|CAC24711.1|  cytochrome P450                                        458   1e-149   Solanum tuberosum [potatoes]
ref|XP_006350396.1|  PREDICTED: premnaspirodiene oxygenase-like         457   3e-149   
dbj|BAN58140.1|  putative premaspirodiene oxygenase                     455   2e-148   
ref|XP_009612725.1|  PREDICTED: premnaspirodiene oxygenase-like         453   7e-148   
ref|XP_009625417.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxylase    452   3e-147   
gb|ABC69397.1|  CYP71D48v1                                              451   4e-147   Nicotiana tabacum [American tobacco]
ref|XP_006350395.1|  PREDICTED: premnaspirodiene oxygenase-like         451   6e-147   
ref|XP_006339044.1|  PREDICTED: premnaspirodiene oxygenase-like         449   3e-146   
gb|ABC69396.1|  CYP71D48v2                                              449   5e-146   Nicotiana tabacum [American tobacco]
ref|XP_004249520.2|  PREDICTED: premnaspirodiene oxygenase-like         449   1e-145   
ref|XP_009801864.1|  PREDICTED: LOW QUALITY PROTEIN: 5-epiaristol...    447   3e-145   
sp|Q94FM7.2|C71DK_TOBAC  RecName: Full=5-epiaristolochene 1,3-dih...    445   1e-144   Nicotiana tabacum [American tobacco]
ref|XP_006361940.1|  PREDICTED: premnaspirodiene oxygenase-like         445   2e-144   
ref|XP_011082249.1|  PREDICTED: premnaspirodiene oxygenase-like         446   2e-144   
ref|XP_009771988.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    444   5e-144   
gb|ABC69421.1|  CYP71D20v2                                              443   6e-144   Nicotiana tabacum [American tobacco]
gb|AIZ01224.1|  epi-aristolochene dihydroxylase                         441   9e-144   
gb|ABC69395.1|  CYP71D47v2                                              442   2e-143   Nicotiana tabacum [American tobacco]
ref|XP_004233564.1|  PREDICTED: premnaspirodiene oxygenase-like         441   3e-143   
ref|XP_004250027.1|  PREDICTED: cytochrome P450 71D7                    441   5e-143   
ref|XP_009766832.1|  PREDICTED: premnaspirodiene oxygenase-like         441   7e-143   
ref|XP_009776868.1|  PREDICTED: premnaspirodiene oxygenase-like         440   9e-143   
ref|XP_009765480.1|  PREDICTED: premnaspirodiene oxygenase-like         440   2e-142   
gb|ABC69394.1|  CYP71D47v1                                              439   2e-142   Nicotiana tabacum [American tobacco]
ref|XP_009769208.1|  PREDICTED: premnaspirodiene oxygenase-like         439   3e-142   
ref|XP_004228511.1|  PREDICTED: premnaspirodiene oxygenase-like         435   5e-141   
ref|XP_009758268.1|  PREDICTED: premnaspirodiene oxygenase              436   7e-141   
ref|XP_009611155.1|  PREDICTED: premnaspirodiene oxygenase-like         435   7e-141   
gb|AAF27282.1|AF122821_1  cytochrome P450                               435   8e-141   Capsicum annuum
gb|ABC69405.1|  CYP71D51v3                                              436   8e-141   Nicotiana tabacum [American tobacco]
ref|XP_009780029.1|  PREDICTED: premnaspirodiene oxygenase-like         435   9e-141   
ref|XP_009606204.1|  PREDICTED: premnaspirodiene oxygenase-like         435   2e-140   
ref|XP_009765039.1|  PREDICTED: premnaspirodiene oxygenase-like         434   4e-140   
ref|XP_009598320.1|  PREDICTED: premnaspirodiene oxygenase-like         433   5e-140   
gb|ABC69403.1|  CYP71D51v1                                              432   2e-139   Nicotiana tabacum [American tobacco]
ref|XP_006339043.1|  PREDICTED: premnaspirodiene oxygenase-like         431   3e-139   
ref|XP_006339046.1|  PREDICTED: premnaspirodiene oxygenase-like         431   4e-139   
ref|XP_004228509.1|  PREDICTED: premnaspirodiene oxygenase-like         430   5e-139   
ref|XP_009796910.1|  PREDICTED: premnaspirodiene oxygenase-like         430   6e-139   
ref|XP_009793271.1|  PREDICTED: premnaspirodiene oxygenase-like         430   9e-139   
ref|XP_009794009.1|  PREDICTED: premnaspirodiene oxygenase-like         428   5e-138   
ref|XP_009772938.1|  PREDICTED: premnaspirodiene oxygenase-like         427   7e-138   
dbj|BAC53923.1|  cytochrome P450                                        426   2e-137   Petunia x hybrida [garden petunia]
gb|KHN42024.1|  Cytochrome P450 71D8                                    425   2e-137   
ref|XP_011082374.1|  PREDICTED: premnaspirodiene oxygenase-like         427   3e-137   
ref|XP_004245943.1|  PREDICTED: premnaspirodiene oxygenase-like         426   3e-137   
ref|XP_004241764.1|  PREDICTED: premnaspirodiene oxygenase-like         426   3e-137   
ref|XP_006365938.1|  PREDICTED: premnaspirodiene oxygenase-like         426   4e-137   
ref|XP_009608635.1|  PREDICTED: premnaspirodiene oxygenase-like         426   4e-137   
ref|XP_004246079.1|  PREDICTED: cytochrome P450 71D7-like               424   2e-136   
emb|CDP18841.1|  unnamed protein product                                424   2e-136   
ref|XP_009794007.1|  PREDICTED: premnaspirodiene oxygenase-like         424   2e-136   
ref|XP_006355983.1|  PREDICTED: premnaspirodiene oxygenase-like         424   3e-136   
ref|XP_006355212.1|  PREDICTED: premnaspirodiene oxygenase-like         423   4e-136   
gb|AAD47832.1|  cytochrome P450                                         423   4e-136   Nicotiana tabacum [American tobacco]
ref|XP_009624010.1|  PREDICTED: premnaspirodiene oxygenase-like i...    423   4e-136   
gb|EYU21988.1|  hypothetical protein MIMGU_mgv1a004711mg                423   6e-136   
ref|XP_009624011.1|  PREDICTED: premnaspirodiene oxygenase-like i...    421   7e-136   
ref|XP_003516583.1|  PREDICTED: cytochrome P450 71D8-like               422   1e-135   
ref|XP_004511998.1|  PREDICTED: cytochrome P450 71D8-like               422   1e-135   
ref|XP_004242036.1|  PREDICTED: premnaspirodiene oxygenase-like         421   2e-135   
ref|XP_004228510.1|  PREDICTED: premnaspirodiene oxygenase-like         421   2e-135   
ref|XP_009622900.1|  PREDICTED: cytochrome P450 71D7-like               421   2e-135   
ref|XP_009619866.1|  PREDICTED: premnaspirodiene oxygenase-like         421   3e-135   
ref|XP_011081934.1|  PREDICTED: cytochrome P450 71D95-like              421   3e-135   
ref|XP_009587552.1|  PREDICTED: premnaspirodiene oxygenase-like         421   5e-135   
gb|ABC69399.1|  CYP71D49v1                                              421   5e-135   Nicotiana tabacum [American tobacco]
ref|XP_003611886.1|  Cytochrome P450                                    420   5e-135   
ref|XP_009612417.1|  PREDICTED: premnaspirodiene oxygenase-like         419   8e-135   
gb|ABC69398.1|  CYP71D5v3                                               419   1e-134   Nicotiana tabacum [American tobacco]
ref|XP_009764618.1|  PREDICTED: cytochrome P450 71D7-like isoform X1    419   1e-134   
gb|ABC69402.1|  CYP71D5v2                                               419   1e-134   Nicotiana tabacum [American tobacco]
gb|KHN36162.1|  Cytochrome P450 71D8                                    417   1e-134   
gb|AJD25162.1|  cytochrome P450 CYP71D374                               419   1e-134   
ref|XP_004242219.2|  PREDICTED: cytochrome P450 71D7-like               419   2e-134   
gb|AGN04217.1|  cytochrome P450                                         419   2e-134   
ref|XP_006365962.1|  PREDICTED: cytochrome P450 71D7-like               418   3e-134   
gb|ABC69400.1|  CYP71D49v3                                              418   3e-134   Nicotiana tabacum [American tobacco]
ref|XP_003516584.1|  PREDICTED: cytochrome P450 71D8-like               418   4e-134   
emb|CDP07879.1|  unnamed protein product                                417   1e-133   
ref|XP_006365979.1|  PREDICTED: premnaspirodiene oxygenase-like         417   1e-133   
gb|AHH25653.1|  cytochrome P450 CYP71D                                  416   1e-133   
emb|CDP20259.1|  unnamed protein product                                417   1e-133   
ref|XP_009619325.1|  PREDICTED: premnaspirodiene oxygenase-like         417   1e-133   
ref|XP_009803037.1|  PREDICTED: premnaspirodiene oxygenase-like         417   1e-133   
gb|AJD25166.1|  cytochrome P450 CYP71D413                               416   2e-133   
emb|CDP07872.1|  unnamed protein product                                416   2e-133   
gb|KDP39256.1|  hypothetical protein JCGZ_01013                         415   3e-133   
ref|XP_007213422.1|  hypothetical protein PRUPE_ppa025696mg             414   6e-133   
ref|XP_003517259.1|  PREDICTED: cytochrome P450 71D8-like               414   8e-133   
ref|XP_011081935.1|  PREDICTED: cytochrome P450 71D95-like              414   2e-132   
ref|XP_011077043.1|  PREDICTED: premnaspirodiene oxygenase-like         414   2e-132   
gb|KHN36164.1|  Cytochrome P450 71D8                                    414   2e-132   
ref|XP_007156881.1|  hypothetical protein PHAVU_002G025000g             413   2e-132   
ref|XP_003537457.1|  PREDICTED: cytochrome P450 71D8-like               413   3e-132   
ref|XP_003537455.1|  PREDICTED: cytochrome P450 71D8-like               412   4e-132   
ref|XP_006339045.1|  PREDICTED: premnaspirodiene oxygenase-like         413   5e-132   
ref|XP_004249519.1|  PREDICTED: premnaspirodiene oxygenase-like         412   1e-131   
ref|XP_009770332.1|  PREDICTED: premnaspirodiene oxygenase-like         412   2e-131   
emb|CDP07887.1|  unnamed protein product                                410   2e-131   
ref|XP_009612418.1|  PREDICTED: premnaspirodiene oxygenase-like         410   2e-131   
ref|XP_011073878.1|  PREDICTED: premnaspirodiene oxygenase-like         411   2e-131   
sp|O81974.1|C71D8_SOYBN  RecName: Full=Cytochrome P450 71D8; AltN...    410   6e-131   Glycine max [soybeans]
ref|XP_003610580.1|  Cytochrome P450                                    409   1e-130   
emb|CDP07882.1|  unnamed protein product                                410   3e-130   
gb|KHN42275.1|  Cytochrome P450 71D8                                    408   5e-130   
ref|XP_003529672.2|  PREDICTED: cytochrome P450 71D8-like               408   5e-130   
emb|CDP08465.1|  unnamed protein product                                407   5e-130   
gb|KEH34013.1|  cytochrome P450 family 71 protein                       407   5e-130   
ref|XP_006357930.1|  PREDICTED: cytochrome P450 71D7-like               406   9e-130   
ref|XP_009606841.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    402   1e-129   
ref|XP_009794456.1|  PREDICTED: premnaspirodiene oxygenase-like         405   2e-129   
ref|XP_011082254.1|  PREDICTED: premnaspirodiene oxygenase              406   3e-129   
emb|CDP20312.1|  unnamed protein product                                404   4e-129   
gb|KDP39254.1|  hypothetical protein JCGZ_01011                         405   4e-129   
ref|XP_006452553.1|  hypothetical protein CICLE_v10008076mg             404   6e-129   
ref|XP_010064672.1|  PREDICTED: cytochrome P450 71D11-like              404   1e-128   
ref|XP_008227138.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    404   1e-128   
emb|CDP17903.1|  unnamed protein product                                403   1e-128   
ref|XP_011081964.1|  PREDICTED: premnaspirodiene oxygenase-like         404   2e-128   
ref|XP_007156882.1|  hypothetical protein PHAVU_002G025100g             403   2e-128   
ref|XP_004512032.1|  PREDICTED: cytochrome P450 71D8-like               402   4e-128   
ref|XP_006367966.1|  PREDICTED: premnaspirodiene oxygenase-like         403   5e-128   
ref|XP_003611884.1|  Cytochrome P450                                    402   5e-128   
gb|KCW68417.1|  hypothetical protein EUGRSUZ_F02067                     401   5e-128   
ref|XP_006359503.1|  PREDICTED: premnaspirodiene oxygenase-like         402   6e-128   
gb|EYU31465.1|  hypothetical protein MIMGU_mgv1a004885mg                402   9e-128   
ref|XP_003520239.1|  PREDICTED: cytochrome P450 71D8-like               401   1e-127   
ref|XP_004249812.1|  PREDICTED: premnaspirodiene oxygenase-like         401   1e-127   
ref|XP_006365912.1|  PREDICTED: premnaspirodiene oxygenase-like         401   2e-127   
gb|EYU21953.1|  hypothetical protein MIMGU_mgv1a025918mg                400   2e-127   
gb|KEH34014.1|  cytochrome P450 family 71 protein                       400   3e-127   
sp|D5JBX1.1|GAO_BARSP  RecName: Full=Germacrene A oxidase; Short=...    400   4e-127   
gb|KHN08718.1|  Cytochrome P450 71D8                                    400   4e-127   
gb|KEH25843.1|  cytochrome P450 family 71 protein                       399   5e-127   
ref|XP_006452554.1|  hypothetical protein CICLE_v10008073mg             399   1e-126   
ref|XP_004243471.1|  PREDICTED: premnaspirodiene oxygenase-like         399   1e-126   
gb|KHN48844.1|  Cytochrome P450 71D8                                    399   1e-126   
gb|AEX07771.1|  cytochrome P450                                         398   2e-126   
gb|EYU21978.1|  hypothetical protein MIMGU_mgv1a004623mg                399   2e-126   
ref|XP_007214747.1|  hypothetical protein PRUPE_ppa025066mg             398   2e-126   
ref|XP_011081932.1|  PREDICTED: cytochrome P450 71D95-like              398   3e-126   
gb|KCW76838.1|  hypothetical protein EUGRSUZ_D01192                     398   3e-126   
gb|KEH25835.1|  cytochrome P450 family 71 protein                       397   3e-126   
ref|XP_003535170.1|  PREDICTED: cytochrome P450 71D8-like               397   4e-126   
ref|XP_003537212.1|  PREDICTED: cytochrome P450 71D8-like               397   4e-126   
gb|AIS36971.1|  (-)-limonene 3-hydroxylase-like cytochrome p450-d...    397   4e-126   
gb|EYU39554.1|  hypothetical protein MIMGU_mgv1a004505mg                398   4e-126   
ref|XP_004511999.1|  PREDICTED: cytochrome P450 71D8-like               397   4e-126   
ref|XP_006452556.1|  hypothetical protein CICLE_v10008047mg             397   8e-126   
ref|XP_003611883.1|  Cytochrome P450                                    396   1e-125   
ref|XP_003600339.1|  Cytochrome P450                                    396   1e-125   
ref|XP_007020554.1|  Cytochrome P450 71D10, putative                    397   1e-125   
emb|CDP18847.1|  unnamed protein product                                396   1e-125   
ref|XP_010644547.1|  PREDICTED: premnaspirodiene oxygenase-like         396   2e-125   
ref|XP_003535171.1|  PREDICTED: cytochrome P450 71D8-like               395   2e-125   
gb|KCW68415.1|  hypothetical protein EUGRSUZ_F02064                     394   2e-125   
sp|Q9XHE7.1|C71DD_MENPI  RecName: Full=Cytochrome P450 71D13; Alt...    395   2e-125   Mentha x piperita
ref|XP_003535169.1|  PREDICTED: cytochrome P450 71D8-like               395   3e-125   
ref|XP_004506687.1|  PREDICTED: cytochrome P450 71D11-like              395   4e-125   
ref|XP_003529194.2|  PREDICTED: cytochrome P450 71D11-like              395   6e-125   
ref|XP_007020553.1|  Cytochrome P450 71D10, putative                    395   6e-125   
sp|D5J9U8.1|GAO_LACSA  RecName: Full=Germacrene A oxidase; Short=...    394   6e-125   
ref|XP_003520242.1|  PREDICTED: cytochrome P450 71D8-like               394   7e-125   
ref|XP_010061471.1|  PREDICTED: cytochrome P450 71D11-like              394   8e-125   
ref|XP_006363816.1|  PREDICTED: premnaspirodiene oxygenase-like i...    393   1e-124   
ref|XP_007154033.1|  hypothetical protein PHAVU_003G085400g             393   1e-124   
ref|XP_006367127.1|  PREDICTED: premnaspirodiene oxygenase-like i...    393   1e-124   
sp|D5JBW9.1|GAO_SAUCO  RecName: Full=Germacrene A oxidase; Short=...    392   2e-124   
dbj|BAM68809.1|  putative CYP71AV1 ortholog                             392   2e-124   
ref|XP_003517257.1|  PREDICTED: cytochrome P450 71D8-like               393   2e-124   
dbj|BAM68810.1|  putative CYP71AV1 ortholog                             392   2e-124   
ref|XP_010061472.1|  PREDICTED: cytochrome P450 71D11-like              393   2e-124   
ref|XP_004511997.1|  PREDICTED: cytochrome P450 71D8-like               393   2e-124   
emb|CDP07886.1|  unnamed protein product                                392   2e-124   
ref|XP_008246006.1|  PREDICTED: cytochrome P450 71D11-like              393   3e-124   
gb|KCW68416.1|  hypothetical protein EUGRSUZ_F02065                     393   3e-124   
dbj|BAM68815.1|  cytochrome P450 monooxygenase CYP71AV2                 392   3e-124   
gb|ADA70806.1|  cytochrome P450 CYP71D177                               392   4e-124   Scoparia dulcis [escobilla]
ref|XP_007033123.1|  Cytochrome P450 71D10, putative                    392   4e-124   
gb|KHN37234.1|  Cytochrome P450 71D11                                   392   4e-124   
ref|XP_006421138.1|  hypothetical protein CICLE_v10004785mg             392   5e-124   
gb|KDP25063.1|  hypothetical protein JCGZ_22598                         392   5e-124   
ref|XP_010644548.1|  PREDICTED: premnaspirodiene oxygenase-like         392   6e-124   
ref|XP_009595834.1|  PREDICTED: premnaspirodiene oxygenase-like i...    392   6e-124   
gb|KDP39287.1|  hypothetical protein JCGZ_01044                         392   6e-124   
gb|AHN62855.1|  germacrene A oxidase                                    391   6e-124   
gb|AGO03790.1|  costunolide                                             391   6e-124   
gb|AIA09035.1|  germacrene A oxidase                                    390   8e-124   
ref|XP_006596106.1|  PREDICTED: cytochrome P450 71D11-like              392   8e-124   
gb|KHN39921.1|  Cytochrome P450 71D8                                    391   9e-124   
ref|XP_003615865.1|  Cytochrome P450                                    391   9e-124   
gb|KHN01537.1|  Cytochrome P450 71D11                                   391   1e-123   
ref|XP_004305992.1|  PREDICTED: cytochrome P450 71D11-like              391   1e-123   
gb|ABG49366.1|  P450 monooxygenase                                      390   1e-123   Artemisia annua [sweet Annie]
gb|AIA09036.1|  germacrene A oxidase                                    390   1e-123   
ref|XP_009623936.1|  PREDICTED: premnaspirodiene oxygenase-like i...    391   1e-123   
emb|CDP07881.1|  unnamed protein product                                401   2e-123   
ref|XP_006493509.1|  PREDICTED: cytochrome P450 71D11-like              390   2e-123   
ref|XP_006474921.1|  PREDICTED: cytochrome P450 71D11-like isofor...    390   3e-123   
ref|XP_003549267.1|  PREDICTED: cytochrome P450 71D11-like              390   4e-123   
gb|AHN62856.1|  costunolide synthase                                    389   4e-123   
ref|XP_003535173.1|  PREDICTED: cytochrome P450 71D8-like               389   5e-123   
gb|KDP39257.1|  hypothetical protein JCGZ_01014                         389   5e-123   
ref|XP_003537216.1|  PREDICTED: cytochrome P450 71D8-like               389   6e-123   
ref|XP_003532742.2|  PREDICTED: cytochrome P450 71D10                   389   7e-123   
gb|KDP39016.1|  hypothetical protein JCGZ_00773                         387   7e-123   
gb|KHN36161.1|  Cytochrome P450 71D8                                    387   8e-123   
ref|XP_008779150.1|  PREDICTED: premnaspirodiene oxygenase-like         389   8e-123   
gb|AIA09038.1|  costunolide synthase                                    388   9e-123   
gb|AGO03789.1|  germacrene A oxidase                                    388   9e-123   
ref|XP_004295868.1|  PREDICTED: cytochrome P450 71D11-like              389   1e-122   
gb|AFK45297.1|  unknown                                                 388   1e-122   
ref|XP_004231934.1|  PREDICTED: premnaspirodiene oxygenase-like         388   1e-122   
sp|Q6WKY9.1|C7D95_MENGR  RecName: Full=Cytochrome P450 71D95; Alt...    387   2e-122   Mentha x gracilis [ginger mint]
gb|ABQ24001.1|  limonene hydroxylase                                    387   3e-122   Mentha arvensis [field mint]
dbj|BAM68811.1|  putative CYP71AV1 ortholog                             387   4e-122   
gb|AIA09039.1|  costunolide synthase                                    386   4e-122   
gb|KHN12340.1|  Cytochrome P450 71D10                                   386   5e-122   
gb|AED99878.1|  cytochrome P450                                         387   7e-122   
sp|Q6IV13.1|C7D95_MENSP  RecName: Full=Cytochrome P450 71D95; Alt...    386   7e-122   Mentha spicata
ref|XP_010104090.1|  Cytochrome P450 71D10                              386   9e-122   
sp|E1B2Z9.1|C7AV8_CICIN  RecName: Full=Cytochrome P450 71AV8; Alt...    385   9e-122   
sp|G3GBK0.1|C7BL3_CICIN  RecName: Full=Costunolide synthase; Shor...    385   9e-122   
ref|XP_008807778.1|  PREDICTED: premnaspirodiene oxygenase-like         385   1e-121   
ref|XP_003550472.2|  PREDICTED: cytochrome P450 71D8-like               387   1e-121   
gb|ACD42776.1|  cytochrome P450 71D1                                    385   2e-121   Catharanthus roseus [chatas]
gb|KDP42338.1|  hypothetical protein JCGZ_02811                         385   2e-121   
gb|AAO32822.1|  cytochrome P450 71D1                                    385   2e-121   Catharanthus roseus [chatas]
ref|XP_004295869.1|  PREDICTED: cytochrome P450 71D11-like              385   2e-121   
dbj|BAM68816.1|  putative cytochrome P450 monooxygenase CYP71AV1        385   2e-121   
ref|XP_010653207.1|  PREDICTED: cytochrome P450 71D9-like               385   2e-121   
gb|KDP39024.1|  hypothetical protein JCGZ_00781                         386   2e-121   
ref|XP_007033124.1|  Cytochrome P450 71D10, putative                    385   2e-121   
ref|XP_004248582.1|  PREDICTED: premnaspirodiene oxygenase-like i...    385   2e-121   
gb|ABO32531.1|  cytochrome P450-dependent monooxygenase-like protein    385   3e-121   Ammi majus [ameo mayor]
gb|AGO03787.1|  cytochrome P450                                         384   3e-121   
gb|KEH19671.1|  cytochrome P450 family 71 protein                       384   4e-121   
ref|XP_009616520.1|  PREDICTED: premnaspirodiene oxygenase-like         385   4e-121   
sp|D5JBW8.1|GAO_CICIN  RecName: Full=Germacrene A oxidase; Short=...    384   4e-121   
ref|XP_006361719.1|  PREDICTED: 5-epiaristolochene 1,3-dihydroxyl...    382   5e-121   
gb|KDP39288.1|  hypothetical protein JCGZ_01045                         382   5e-121   
emb|CDP11812.1|  unnamed protein product                                384   6e-121   
ref|XP_006341698.1|  PREDICTED: premnaspirodiene oxygenase-like         384   8e-121   
ref|XP_009623934.1|  PREDICTED: premnaspirodiene oxygenase-like         383   1e-120   
ref|XP_003636315.1|  Cytochrome P450                                    383   1e-120   
ref|XP_010910607.1|  PREDICTED: premnaspirodiene oxygenase-like         383   1e-120   
ref|XP_009595835.1|  PREDICTED: premnaspirodiene oxygenase-like i...    383   1e-120   
ref|XP_009345818.1|  PREDICTED: cytochrome P450 71D9-like               382   2e-120   
ref|XP_006352953.1|  PREDICTED: premnaspirodiene oxygenase-like         382   3e-120   
ref|XP_006345633.1|  PREDICTED: premnaspirodiene oxygenase-like         382   3e-120   
gb|EYU32748.1|  hypothetical protein MIMGU_mgv1a004746mg                382   5e-120   
dbj|BAM68808.1|  cytochrome P450 monooxygenase CYP71AV1                 381   5e-120   
ref|XP_011097779.1|  PREDICTED: cytochrome P450 71D11-like              381   6e-120   
ref|XP_009357363.1|  PREDICTED: premnaspirodiene oxygenase-like         381   6e-120   
ref|XP_003589691.1|  Cytochrome P450                                    381   6e-120   
sp|Q6WKZ1.1|C71DI_MENGR  RecName: Full=Cytochrome P450 71D18; Alt...    380   7e-120   Mentha x gracilis [ginger mint]
gb|ABG91755.1|  amorpha-4,11-diene C-12 oxidase                         380   8e-120   Artemisia annua [sweet Annie]
ref|XP_010655870.1|  PREDICTED: cytochrome P450 71D10-like              381   8e-120   
gb|ABE57266.1|  amorpha-4,11-diene monooxygenase                        380   8e-120   Artemisia annua [sweet Annie]
sp|Q1PS23.1|AMO_ARTAN  RecName: Full=Amorpha-4,11-diene 12-monoox...    380   9e-120   Artemisia annua [sweet Annie]
sp|F8S1I0.1|C7BL2_LACSA  RecName: Full=Costunolide synthase; Shor...    380   9e-120   
gb|ABR15423.1|  (-)P450 limonene-3-hydroxylase                          380   9e-120   
sp|Q9XHE6.1|C71DF_MENPI  RecName: Full=Cytochrome P450 71D15; Alt...    380   9e-120   Mentha x piperita
gb|AFO64615.1|  cytochrome P450 mono-oxygenase                          380   9e-120   
gb|KDP39285.1|  hypothetical protein JCGZ_01042                         380   1e-119   
ref|XP_004512033.1|  PREDICTED: cytochrome P450 71D8-like               381   1e-119   
ref|XP_006351653.1|  PREDICTED: premnaspirodiene oxygenase-like         380   1e-119   
ref|XP_003617704.1|  Cytochrome P450                                    380   1e-119   
gb|AFP19100.1|  amorphadiene oxidase                                    380   1e-119   
gb|ABC41927.1|  amorpha-4,11-diene monooxygenase                        380   1e-119   Artemisia annua [sweet Annie]
ref|XP_009615716.1|  PREDICTED: premnaspirodiene oxygenase-like         380   2e-119   
ref|XP_007146291.1|  hypothetical protein PHAVU_006G028100g             380   2e-119   
ref|XP_007148448.1|  hypothetical protein PHAVU_006G209700g             380   2e-119   
gb|KDP39022.1|  hypothetical protein JCGZ_00779                         378   2e-119   
ref|XP_008778500.1|  PREDICTED: premnaspirodiene oxygenase-like         380   2e-119   
dbj|BAM68812.1|  cytochrome P450 monooxygenase CYP71AV10                379   3e-119   
gb|ABI31728.1|  amorpha-4,11-diene C-12 oxidase                         379   3e-119   
ref|XP_006367128.1|  PREDICTED: premnaspirodiene oxygenase-like i...    377   3e-119   
ref|XP_007020552.1|  Cytochrome P450 71D10, putative                    379   4e-119   
ref|XP_006341719.1|  PREDICTED: premnaspirodiene oxygenase-like         379   4e-119   
ref|XP_007156884.1|  hypothetical protein PHAVU_002G025300g             379   5e-119   
gb|KDO37182.1|  hypothetical protein CISIN_1g010699mg                   379   5e-119   
gb|AHK60843.1|  CYP71D2                                                 379   7e-119   
gb|KHG00772.1|  Cytochrome P450                                         378   9e-119   
ref|XP_007213458.1|  hypothetical protein PRUPE_ppa024556mg             378   9e-119   
ref|XP_008385924.1|  PREDICTED: premnaspirodiene oxygenase-like         378   9e-119   
gb|ABG49365.1|  P450 monooxygenase                                      377   1e-118   
ref|XP_009617877.1|  PREDICTED: premnaspirodiene oxygenase-like         378   1e-118   
ref|XP_007153130.1|  hypothetical protein PHAVU_003G009200g             378   1e-118   
gb|ADU25498.1|  cytochrome P450 monooxygenase                           377   1e-118   
gb|ACF74516.1|  amorpha-4,11-diene monooxygenase                        377   2e-118   
gb|KHN27239.1|  Cytochrome P450 71D11                                   375   3e-118   
ref|XP_006452560.1|  hypothetical protein CICLE_v10008075mg             377   3e-118   
ref|XP_004247352.1|  PREDICTED: premnaspirodiene oxygenase-like         376   4e-118   
ref|XP_007147597.1|  hypothetical protein PHAVU_006G138100g             377   4e-118   
ref|XP_003600322.1|  Cytochrome P450                                    376   5e-118   
ref|XP_002522903.1|  cytochrome P450, putative                          377   6e-118   
gb|KDP29297.1|  hypothetical protein JCGZ_19400                         377   6e-118   
ref|XP_003617706.1|  Cytochrome P450 71D10                              376   7e-118   
gb|AIS36970.1|  (-)-limonene 6-hydroxylase-like cytochrome p450-d...    375   7e-118   
gb|ADD84654.1|  CYP71D175                                               376   7e-118   
ref|XP_008779112.1|  PREDICTED: premnaspirodiene oxygenase-like         375   8e-118   
gb|KHN08403.1|  Cytochrome P450 71D8                                    373   9e-118   
ref|XP_008345750.1|  PREDICTED: cytochrome P450 71D8-like               376   1e-117   
gb|KDP36253.1|  hypothetical protein JCGZ_09818                         375   1e-117   
ref|XP_010104087.1|  Premnaspirodiene oxygenase                         375   1e-117   
gb|KDP39284.1|  hypothetical protein JCGZ_01041                         373   2e-117   
ref|XP_007022417.1|  Cytochrome P450 71D10, putative                    375   2e-117   
ref|XP_003615871.1|  Cytochrome P450                                    374   2e-117   
ref|XP_003600327.1|  Cytochrome P450                                    374   3e-117   
ref|XP_007148447.1|  hypothetical protein PHAVU_006G209600g             374   3e-117   
ref|XP_007148446.1|  hypothetical protein PHAVU_006G209500g             374   3e-117   
ref|XP_002513342.1|  cytochrome P450, putative                          375   4e-117   
ref|XP_009385309.1|  PREDICTED: premnaspirodiene oxygenase-like         374   4e-117   
ref|XP_006590052.1|  PREDICTED: cytochrome P450 71D8-like               373   4e-117   
gb|AGC29947.1|  CYP71BE30                                               373   5e-117   
gb|AES70585.2|  cytochrome P450 family 71 protein                       377   6e-117   
gb|KEH29697.1|  cytochrome P450 family 71 protein                       373   6e-117   
gb|AET00662.2|  cytochrome P450 family 71 protein                       373   7e-117   
ref|XP_003600330.1|  Cytochrome P450                                    373   7e-117   
ref|XP_003617715.1|  Cytochrome P450                                    373   8e-117   
ref|XP_009385126.1|  PREDICTED: premnaspirodiene oxygenase-like         373   8e-117   
ref|XP_002522721.1|  cytochrome P450, putative                          373   9e-117   
sp|D5JBX0.1|GAO_HELAN  RecName: Full=Germacrene A oxidase; Short=...    372   1e-116   
ref|XP_006364814.1|  PREDICTED: premnaspirodiene oxygenase-like         374   1e-116   
ref|XP_008777955.1|  PREDICTED: premnaspirodiene oxygenase-like         372   1e-116   
sp|Q6WKZ0.1|C7D94_MENGR  RecName: Full=Cytochrome P450 71D94            372   1e-116   
gb|AJD25165.1|  cytochrome P450 CYP71D412                               372   1e-116   
ref|XP_008219722.1|  PREDICTED: premnaspirodiene oxygenase-like         373   1e-116   
ref|XP_006575708.1|  PREDICTED: cytochrome P450 71D10-like              372   2e-116   
ref|XP_003617705.1|  Cytochrome P450                                    372   2e-116   
ref|XP_008807779.1|  PREDICTED: premnaspirodiene oxygenase-like         372   2e-116   
emb|CDP13734.1|  unnamed protein product                                382   2e-116   
gb|KDP39286.1|  hypothetical protein JCGZ_01043                         369   2e-116   
gb|KHN03535.1|  Cytochrome P450 71D8                                    369   3e-116   
ref|XP_007146604.1|  hypothetical protein PHAVU_006G054100g             372   3e-116   
gb|KCW76837.1|  hypothetical protein EUGRSUZ_D01190                     370   4e-116   
ref|XP_003600328.1|  Cytochrome P450                                    371   4e-116   
gb|KHG11859.1|  Cytochrome P450                                         371   4e-116   
gb|KDP26294.1|  hypothetical protein JCGZ_22279                         372   4e-116   
ref|XP_004491658.1|  PREDICTED: uncharacterized protein LOC101503808    385   4e-116   
ref|XP_004304108.1|  PREDICTED: cytochrome P450 71D11-like              372   4e-116   
ref|XP_002514827.1|  cytochrome P450, putative                          372   5e-116   
ref|XP_007212707.1|  hypothetical protein PRUPE_ppa018666mg             370   6e-116   
ref|XP_004516744.1|  PREDICTED: cytochrome P450 71D10-like              370   7e-116   
emb|CDP10756.1|  unnamed protein product                                370   9e-116   
ref|XP_010061478.1|  PREDICTED: cytochrome P450 71D9-like               370   1e-115   
ref|XP_007156883.1|  hypothetical protein PHAVU_002G025200g             370   1e-115   
gb|KCW76836.1|  hypothetical protein EUGRSUZ_D01189                     369   2e-115   
gb|AED99871.1|  cytochrome P450                                         370   2e-115   
gb|KEH34016.1|  cytochrome P450 family 71 protein                       368   2e-115   
ref|XP_010052766.1|  PREDICTED: premnaspirodiene oxygenase-like         370   2e-115   
ref|XP_003551494.1|  PREDICTED: cytochrome P450 71D10-like              369   3e-115   
ref|XP_009775980.1|  PREDICTED: premnaspirodiene oxygenase-like         369   3e-115   
ref|XP_009626802.1|  PREDICTED: cytochrome P450 71D7-like               369   3e-115   
ref|XP_008370832.1|  PREDICTED: premnaspirodiene oxygenase-like         367   3e-115   
ref|XP_002523467.1|  cytochrome P450, putative                          369   4e-115   
ref|XP_010052765.1|  PREDICTED: premnaspirodiene oxygenase-like         369   4e-115   
gb|KDP39110.1|  hypothetical protein JCGZ_00867                         367   4e-115   
ref|XP_011014080.1|  PREDICTED: cytochrome P450 71D11-like              369   4e-115   
ref|XP_006452551.1|  hypothetical protein CICLE_v10010293mg             369   4e-115   
ref|XP_008385787.1|  PREDICTED: cytochrome P450 71D11-like              369   5e-115   
ref|XP_011087047.1|  PREDICTED: premnaspirodiene oxygenase-like         368   5e-115   
gb|KDP25064.1|  hypothetical protein JCGZ_22599                         368   6e-115   
ref|XP_007161221.1|  hypothetical protein PHAVU_001G052100g             368   7e-115   
gb|AGN04218.1|  cytochrome P450                                         368   9e-115   
gb|AIM47558.1|  CYP726A4                                                367   9e-115   
ref|XP_004516745.1|  PREDICTED: cytochrome P450 71D10-like              367   9e-115   
ref|XP_004516743.1|  PREDICTED: cytochrome P450 71D10-like              367   1e-114   
ref|XP_006380104.1|  hypothetical protein POPTR_0008s21950g             367   1e-114   
emb|CDP07805.1|  unnamed protein product                                365   1e-114   
ref|XP_004506715.1|  PREDICTED: cytochrome P450 71D9-like               367   1e-114   
ref|XP_003617701.1|  Cytochrome P450                                    368   2e-114   
ref|XP_011097781.1|  PREDICTED: premnaspirodiene oxygenase-like         367   2e-114   
ref|XP_004232610.1|  PREDICTED: premnaspirodiene oxygenase-like         367   2e-114   
emb|CDP08464.1|  unnamed protein product                                363   3e-114   
ref|XP_010067806.1|  PREDICTED: premnaspirodiene oxygenase-like         366   3e-114   
ref|XP_009347232.1|  PREDICTED: cytochrome P450 71D11-like              367   3e-114   
emb|CDP10758.1|  unnamed protein product                                366   3e-114   
ref|XP_004304107.1|  PREDICTED: cytochrome P450 71D11-like              364   3e-114   
ref|XP_007020557.1|  Cytochrome P450, putative                          366   3e-114   
gb|KCW66019.1|  hypothetical protein EUGRSUZ_G03311                     366   3e-114   
ref|XP_002514826.1|  cytochrome P450, putative                          366   4e-114   
dbj|BAM68819.1|  putative cytochrome P450 monooxygenase CYP71AV1        366   4e-114   
ref|XP_006474922.1|  PREDICTED: cytochrome P450 71D11-like isofor...    365   5e-114   
gb|KEH34024.1|  cytochrome P450 family 71 protein                       366   5e-114   
ref|XP_006341699.1|  PREDICTED: premnaspirodiene oxygenase-like         365   7e-114   
ref|XP_010027347.1|  PREDICTED: premnaspirodiene oxygenase-like         366   7e-114   
gb|KCW62217.1|  hypothetical protein EUGRSUZ_H04878                     366   7e-114   
ref|XP_007020556.1|  Cytochrome P450 71D10, putative                    365   8e-114   
gb|KEH26493.1|  cytochrome P450 family 71 protein                       365   9e-114   
gb|KEH34017.1|  cytochrome P450 family 71 protein                       365   9e-114   
ref|XP_002310636.2|  hypothetical protein POPTR_0007s07310g             365   9e-114   
ref|XP_006346274.1|  PREDICTED: premnaspirodiene oxygenase-like         365   1e-113   
ref|XP_006377819.1|  hypothetical protein POPTR_0011s13430g             365   1e-113   
gb|KDO38617.1|  hypothetical protein CISIN_1g045050mg                   365   1e-113   
ref|XP_003617703.1|  Cytochrome P450                                    372   1e-113   
dbj|BAJ89686.1|  predicted protein                                      365   1e-113   
ref|XP_011047545.1|  PREDICTED: cytochrome P450 71D11-like isofor...    365   1e-113   
ref|XP_010655881.1|  PREDICTED: cytochrome P450 71D10-like              365   1e-113   
ref|XP_002310634.2|  hypothetical protein POPTR_0007s07300g             365   1e-113   
gb|KCW55753.1|  hypothetical protein EUGRSUZ_I01583                     364   2e-113   
gb|KDO69448.1|  hypothetical protein CISIN_1g010315mg                   365   2e-113   
emb|CDP21437.1|  unnamed protein product                                364   2e-113   
dbj|BAM68817.1|  putative cytochrome P450 monooxygenase CYP71AV1        363   3e-113   
ref|XP_010030713.1|  PREDICTED: premnaspirodiene oxygenase-like         363   3e-113   
ref|XP_009344943.1|  PREDICTED: premnaspirodiene oxygenase-like         365   4e-113   
ref|XP_008791005.1|  PREDICTED: premnaspirodiene oxygenase-like         363   4e-113   
ref|XP_009780363.1|  PREDICTED: premnaspirodiene oxygenase-like         364   4e-113   
gb|KDP42346.1|  hypothetical protein JCGZ_02819                         367   4e-113   
ref|XP_007146606.1|  hypothetical protein PHAVU_006G054300g             363   5e-113   
ref|XP_007099625.1|  Cytochrome P450 71D10, putative                    368   5e-113   
ref|XP_003600334.1|  Cytochrome P450                                    366   6e-113   
emb|CDM81270.1|  unnamed protein product                                363   6e-113   
emb|CDP20311.1|  unnamed protein product                                367   6e-113   
gb|KHN43883.1|  Cytochrome P450 71D10                                   362   7e-113   
ref|XP_009402814.1|  PREDICTED: premnaspirodiene oxygenase-like         363   7e-113   
ref|XP_007153133.1|  hypothetical protein PHAVU_003G009500g             363   7e-113   
ref|XP_006476912.1|  PREDICTED: cytochrome P450 71A1-like               363   8e-113   
gb|KDP27295.1|  hypothetical protein JCGZ_20283                         362   8e-113   
ref|NP_001236165.1|  cytochrome P450 71D10                              362   1e-112   
gb|KDP42339.1|  hypothetical protein JCGZ_02812                         362   1e-112   
dbj|BAK03820.1|  predicted protein                                      362   1e-112   
gb|AJD25161.1|  cytochrome P450 CYP71BE37                               362   1e-112   
gb|KCW76712.1|  hypothetical protein EUGRSUZ_D01067                     362   2e-112   
gb|EYU27425.1|  hypothetical protein MIMGU_mgv1a024069mg                362   2e-112   
ref|XP_003519623.2|  PREDICTED: cytochrome P450 71D10-like              362   2e-112   
gb|KCW62218.1|  hypothetical protein EUGRSUZ_H04879                     360   2e-112   
emb|CDP11811.1|  unnamed protein product                                362   2e-112   
ref|XP_008337945.1|  PREDICTED: cytochrome P450 71D9-like               362   2e-112   
ref|XP_002513337.1|  cytochrome P450, putative                          362   2e-112   
ref|XP_002513331.1|  cytochrome P450, putative                          361   3e-112   
gb|KCW62216.1|  hypothetical protein EUGRSUZ_H04877                     361   3e-112   
sp|O22307.1|C71DB_LOTJA  RecName: Full=Cytochrome P450 71D11            361   3e-112   
gb|KDO62257.1|  hypothetical protein CISIN_1g038414mg                   360   3e-112   
ref|XP_007226700.1|  hypothetical protein PRUPE_ppa020463mg             360   3e-112   
ref|XP_002276558.2|  PREDICTED: cytochrome P450 71A1-like               361   4e-112   
ref|XP_004506686.1|  PREDICTED: cytochrome P450 71D9-like               360   4e-112   
ref|XP_002522762.1|  cytochrome P450, putative                          361   4e-112   
ref|XP_006435925.1|  hypothetical protein CICLE_v10031280mg             361   4e-112   
gb|KHM99472.1|  Cytochrome P450 71D11                                   361   5e-112   
ref|XP_006474923.1|  PREDICTED: cytochrome P450 71D11-like              361   5e-112   
ref|XP_010932987.1|  PREDICTED: premnaspirodiene oxygenase-like         360   5e-112   
gb|KHN33492.1|  Cytochrome P450 71D10-like protein                      360   6e-112   
ref|XP_007020549.1|  Cytochrome P450                                    360   6e-112   
ref|XP_003530792.1|  PREDICTED: cytochrome P450 71D9-like               360   7e-112   
gb|KEH34023.1|  cytochrome P450 family 71 protein                       357   8e-112   
gb|EYU21982.1|  hypothetical protein MIMGU_mgv1a026917mg                359   1e-111   
ref|XP_010027348.1|  PREDICTED: cytochrome P450 CYP71D312-like          360   1e-111   
ref|XP_004973458.1|  PREDICTED: premnaspirodiene oxygenase-like         360   1e-111   
gb|AHM24032.1|  cytochrome P450                                         359   1e-111   
ref|XP_010102938.1|  Cytochrome P450 71A1                               359   1e-111   
gb|KHN43881.1|  Cytochrome P450 71D10                                   357   2e-111   
ref|XP_003545101.1|  PREDICTED: cytochrome P450 71D10-like              359   2e-111   
ref|XP_007146612.1|  hypothetical protein PHAVU_006G054900g             358   2e-111   
ref|XP_004288803.1|  PREDICTED: cytochrome P450 71D11-like              359   2e-111   
emb|CDP21848.1|  unnamed protein product                                356   2e-111   
ref|XP_006452552.1|  hypothetical protein CICLE_v10010406mg             358   2e-111   
ref|XP_006427937.1|  hypothetical protein CICLE_v10025671mg             356   2e-111   
dbj|BAM68818.1|  putative cytochrome P450 monooxygenase CYP71AV1        358   2e-111   
ref|XP_004981824.1|  PREDICTED: premnaspirodiene oxygenase-like         358   3e-111   
gb|KDO62258.1|  hypothetical protein CISIN_1g0123662mg                  355   3e-111   
ref|XP_009594272.1|  PREDICTED: premnaspirodiene oxygenase-like         358   3e-111   
gb|KHG19246.1|  Cytochrome P450                                         358   3e-111   
gb|AED99873.1|  cytochrome P450                                         358   4e-111   
ref|XP_011047544.1|  PREDICTED: cytochrome P450 71D11-like isofor...    358   4e-111   
ref|XP_011012702.1|  PREDICTED: cytochrome P450 71D11-like              358   5e-111   
gb|AAO32823.1|  cytochrome P450 71D2                                    355   5e-111   
ref|XP_007037782.1|  Cytochrome P450 71A1                               358   5e-111   
ref|XP_010054541.1|  PREDICTED: premnaspirodiene oxygenase-like         358   5e-111   
ref|XP_002513339.1|  cytochrome P450, putative                          357   6e-111   
sp|H2DH20.1|C7D13_PANGI  RecName: Full=Cytochrome P450 CYP71D313        358   6e-111   
gb|KHM99028.1|  Cytochrome P450 71D11                                   357   6e-111   
ref|XP_008227173.1|  PREDICTED: cytochrome P450 71D9-like               356   9e-111   
ref|XP_007146610.1|  hypothetical protein PHAVU_006G054700g             357   9e-111   
ref|XP_006475119.1|  PREDICTED: premnaspirodiene oxygenase-like         357   9e-111   
ref|XP_009419189.1|  PREDICTED: premnaspirodiene oxygenase-like         357   9e-111   
dbj|BAJ39894.1|  P450 mono-oxygenase                                    357   1e-110   
ref|XP_009410239.1|  PREDICTED: premnaspirodiene oxygenase-like         357   1e-110   
ref|XP_002513345.1|  cytochrome P450, putative                          356   1e-110   
ref|XP_006605460.1|  PREDICTED: cytochrome P450 71D11-like              357   1e-110   
sp|P24465.2|C71A1_PERAE  RecName: Full=Cytochrome P450 71A1; AltN...    357   1e-110   
ref|XP_003617772.1|  Cytochrome P450                                    357   1e-110   
gb|KEH25844.1|  cytochrome P450 family 71 protein                       357   1e-110   
gb|KHG02344.1|  Cytochrome P450                                         357   1e-110   
gb|AED99876.1|  cytochrome P450                                         357   1e-110   
dbj|BAM68821.1|  putative cytochrome P450 monooxygenase CYP71AV11v2     357   1e-110   
gb|KHG24310.1|  Cytochrome P450                                         354   1e-110   
ref|XP_007146605.1|  hypothetical protein PHAVU_006G054200g             357   1e-110   
gb|KEH15784.1|  cytochrome P450 family 71 protein                       357   2e-110   
gb|AES70567.2|  cytochrome P450 family 71 protein                       356   2e-110   
gb|ADC94830.1|  (-)-limonene-7-hydroxylase                              355   2e-110   



>ref|XP_006350417.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   464 bits (1193),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 231/458 (50%), Positives = 326/458 (71%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L G  + H  LRDL+K++G  LMHLQLGEV AVV +S ++AK  LK HD+ FA+
Sbjct  41    IGSMHHLAG-GLSHRVLRDLAKKYGP-LMHLQLGEVSAVVATSPDMAKQVLKIHDIAFAS  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA D + Y+  DI F PYGEYWRQMRK+C+ E+L A+ VRSFS IR+DE  RL+D 
Sbjct  99    RPSLLATDIICYNRRDIAFIPYGEYWRQMRKICVMEVLGAKNVRSFSSIRRDEVVRLIDS  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++SSS +G P+N  +++  F +S+ CR+AFG+ L   E  +K + E++ +   F VAD F
Sbjct  159   IQSSSFSGEPVNFTEKIIWFTSSMTCRSAFGQVLKEQEVFIKLIREVISLTEGFDVADIF  218

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+K LH   G K +++   ++ D I+ D+IKEH+ NL + +      G ED+VDVL++L
Sbjct  219   PSYKFLHGFGGAKKQLLNAHRKVDSIVEDVIKEHKKNL-ATRKSDDSIGGEDLVDVLLRL  277

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +  SL   I +DNIKA+I+D+F    +TS+T TV AM EM KNP +L+KAQAEVRE F+
Sbjct  278   MNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMAEMFKNPTLLSKAQAEVREAFR  337

Query  1200  GRVE--ESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +V+  E++V+ L YL LVIKET+R+H P P++  RE  +++ + GYTIP +T+V++N W
Sbjct  338   NKVKFGENDVEDLKYLKLVIKETLRIHAPIPLLVPRECREETKINGYTIPMKTKVMVNVW  397

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW++ ESFKPERFE+  MDF   + F+++PFG G+R+CPGISFGLA++Y PLA
Sbjct  398   ALGRDPKYWDNAESFKPERFEECSMDFV-GNNFEFLPFGGGRRICPGISFGLANIYLPLA  456

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP GI P  L L EL R+    K D++ I
Sbjct  457   QLLYHFDWKLPTGIEPRDLDLIELSRITASRKGDLYLI  494



>ref|XP_006350394.1| PREDICTED: cytochrome P450 71D6-like [Solanum tuberosum]
Length=501

 Score =   463 bits (1191),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 239/458 (52%), Positives = 329/458 (72%), Gaps = 6/458 (1%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L G  +PH  LRDL+K++G  LMHLQLGEV AVVV+S ++AK  LKTHD+ FA+
Sbjct  41    IGSMHHLAG-GLPHRVLRDLAKKYGP-LMHLQLGEVSAVVVTSPDIAKQILKTHDIAFAS  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA D + YD  DI FSPYGEYW+QMRK+C+ E+LSA++VRSFS IR DE  RL+D 
Sbjct  99    RPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVMEVLSAKSVRSFSSIRCDEVVRLIDS  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++SSS +G  +N+ + V  F +S+ CR+AFG+     +  +K + E++ +   F VAD F
Sbjct  159   IQSSSSSGELVNLTERVIWFTSSMTCRSAFGQVPKEQDMFIKLIREVISLAEGFDVADIF  218

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+K LH     K +++ V ++ D I+ D+I EH+ N  + K      G ED+VDVL++L
Sbjct  219   PSYKFLHVFGRAKRKLLNVHRKVDAIVEDVINEHKKNFSTRKNDDHALGGEDLVDVLLRL  278

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +  SL   I +DNIKAII+DMF    +TS+T TV AM EM+KNP VLAKAQAEVRE F+
Sbjct  279   MNDKSLQFPINNDNIKAIIIDMFAAGTETSSTTTVWAMAEMLKNPSVLAKAQAEVREAFR  338

Query  1200  GRV--EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +V  +E++V++L YL LVIKETMRLH P P++  RE  +++ + GYTIP +T+V++N W
Sbjct  339   NKVTLDENDVEELKYLKLVIKETMRLHAPIPLLVPRECREETEINGYTIPVKTKVMVNVW  398

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA
Sbjct  399   ALGRDPKYWDDVESFKPERFEQCSIDFI-GNNFEYLPFGGGRRICPGISFGLANVYLPLA  457

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LL  FDW+LP G+ P  L LTEL  M++  K D++ I
Sbjct  458   QLLCRFDWKLPAGMEPKDLDLTELAGMSVARKGDLYLI  495



>ref|XP_004237369.1| PREDICTED: premnaspirodiene oxygenase [Solanum lycopersicum]
Length=501

 Score =   462 bits (1189),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 233/458 (51%), Positives = 328/458 (72%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  +VG  +PH  LRDL+K++G  LMHLQLGEV AVVV+S ++AK  LKTHD+ FA+
Sbjct  42    LGSMLHMVG-GLPHHVLRDLAKKYGP-LMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA + V Y  SDI F PYG+YWRQMRK+C+ ELLSA+ VRS+S IR+DE  RL++ 
Sbjct  100   RPKLLAPEIVCYSRSDIAFCPYGDYWRQMRKICVLELLSAKNVRSYSSIRRDEVDRLVNF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RSSS    P+N  + +  F +S+ CR+AFGK     ++ ++ + E++ +   F VAD F
Sbjct  160   IRSSSSFREPVNFTERLFLFTSSMTCRSAFGKVFKEQDKFIQLIKEVIGLAGGFDVADIF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G K ++V    + D I+ D+I EH+ N+ +    +G  G ED++DVL++L
Sbjct  220   PSLKFLHVLSGMKGKIVNAHHKVDAIVEDVINEHKKNI-AMGKTNGALGGEDLIDVLLRL  278

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +   L   IT+DNIKAII DMF    +TS++  V AMV+++KNP V AKAQAEVRE FK
Sbjct  279   MNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQLMKNPSVFAKAQAEVREAFK  338

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              R   +E++V++L YL LVIKET+RLHPP P++  RE  +++ + GYT+P +T+V++N W
Sbjct  339   DRETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREETDINGYTVPVKTKVMVNVW  398

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA
Sbjct  399   ALGRDPKYWDDAESFKPERFEQSSVDFI-GNNFEYLPFGGGRRICPGISFGLANVYLPLA  457

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP+G+ P  L LTEL  +    K+D+  +
Sbjct  458   QLLYHFDWKLPNGMEPKDLNLTELVGVTAARKDDLILV  495



>sp|P93530.1|C71D6_SOLCH RecName: Full=Cytochrome P450 71D6 [Solanum chacoense]
 gb|AAB61964.1| putative cytochrome P450 [Solanum chacoense]
Length=501

 Score =   461 bits (1186),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 240/458 (52%), Positives = 327/458 (71%), Gaps = 6/458 (1%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L G   PH  LRDL+K++G  LMHLQLGEV AVVV+S ++AK  LKTHD+ FA+
Sbjct  41    IGSMHHLAGGR-PHRVLRDLAKKYGP-LMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFAS  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA D + YD  DI FSPYGEYW+QMRK+C+TE+LSA++VRSFS IR DE  RL+D 
Sbjct  99    RPKLLAMDIICYDRCDIAFSPYGEYWKQMRKICVTEVLSAKSVRSFSSIRCDEVVRLIDS  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++SSS +G  +N  + V  F +S+ CR+AFG+     +  +K + E++ +   F VAD F
Sbjct  159   IQSSSSSGELVNFKERVIWFTSSMTCRSAFGQLPKEQDMFIKLIREVIRLAEGFDVADIF  218

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+K LH     K +++ V ++ D I+ D+I EH+ N  + K      G E+++DVL+KL
Sbjct  219   PSYKFLHVFGRAKRKLLNVHRKVDAIVEDVINEHKKNFATRKNDDHALGGENLIDVLLKL  278

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +  SL   I +DNIKAII+DMF    +TS+T TV AMVEM+KNPRVLAKAQAEVRE F+
Sbjct  279   MNDKSLQFPINNDNIKAIIIDMFAAGTETSSTTTVWAMVEMLKNPRVLAKAQAEVREAFR  338

Query  1200  GRV--EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +V  +E++V+ L YL LVIKETMRLH P P++  RE  K++ + GYTIP +T+V++N W
Sbjct  339   NKVTFDENDVEDLKYLKLVIKETMRLHAPIPLLVPRECRKETEINGYTIPVKTKVMVNVW  398

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D E FKPERFE   +DF   + F+Y+PFG G+R+CPG SFGLA+ Y PLA
Sbjct  399   ALGRDPKYWDDVECFKPERFEQCSIDFI-GNNFEYLPFGGGRRICPGTSFGLANDYLPLA  457

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LL HFDW+LP G+ P  L LTEL  M+   K+D++ I
Sbjct  458   QLLCHFDWKLPTGMEPKDLDLTELAGMSAASKDDLYLI  495



>sp|P93531.1|C71D7_SOLCH RecName: Full=Cytochrome P450 71D7 [Solanum chacoense]
 gb|AAB61965.1| putative cytochrome P450 [Solanum chacoense]
Length=500

 Score =   461 bits (1185),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 233/458 (51%), Positives = 324/458 (71%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG ++ L G  +PH  LRDL++++G  LMHLQLGEV AVVV+S E+AK  LKTHD+ FA+
Sbjct  41    IGGMHHLAG-GLPHRVLRDLAEKYGP-LMHLQLGEVSAVVVTSPEMAKQVLKTHDIAFAS  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA D + Y+  DI FSPYG+YWRQMRK+CI E+LSA++VRSFS IR DE  RL+D 
Sbjct  99    RPKLLAMDIICYNRRDIAFSPYGDYWRQMRKICIMEVLSAKSVRSFSSIRHDEVVRLIDS  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++    +G  +N  + +  F +S+ CR+AFG+ L   E  +K + E++ +   F VAD F
Sbjct  159   IQPCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKEQEVFIKLIREVISLAEGFDVADIF  218

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+K LH   G K +++   ++ D I+ D+IKEH+ NL + +      G ED+VD L++L
Sbjct  219   PSYKFLHGFGGAKQKLLNAHRKVDSIVEDVIKEHKKNL-ATRKSDDAIGGEDLVDALVRL  277

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +  SL   I +DNIKA+I+D+F    +TS+T TV AM EM+KNP V AKAQA+VRE F+
Sbjct  278   MNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMAEMLKNPSVFAKAQAKVREAFR  337

Query  1200  GRV--EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +V  +E++V++L YL LVIKETMRLH P P++  RE  +++ + GYTIP +T+V++N W
Sbjct  338   DKVTFDENDVEELKYLKLVIKETMRLHAPVPLLVPRECREETEINGYTIPVKTKVMVNVW  397

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA
Sbjct  398   ALGRDPKYWDDAESFKPERFEQCSIDFI-GNNFEYLPFGGGRRICPGISFGLANVYLPLA  456

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP G+ P  L LTE   +    K D++ I
Sbjct  457   QLLYHFDWKLPTGMEPKDLDLTESAGITAARKGDLYLI  494



>ref|XP_006350393.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=500

 Score =   461 bits (1185),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 234/458 (51%), Positives = 325/458 (71%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L G  +PH  LRDL++++G  LMHLQLGEV AVVV+S E+AK  LKTHD+ FA+
Sbjct  41    IGSMHHLAG-GLPHRVLRDLAEKYGP-LMHLQLGEVSAVVVTSPEMAKQVLKTHDIAFAS  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA D + Y+  DI FSPYGEYWRQMRK+CI E+LSA+ VRSFS IR DE  RL+D 
Sbjct  99    RPKLLAMDIICYNRRDIAFSPYGEYWRQMRKICIMEVLSAKNVRSFSSIRHDEVVRLIDS  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++    +G  +N  + +  F +S+ CR+AFG+ L   E  +K + E++ +   F VAD F
Sbjct  159   IQPCFTSGELVNFTERIIWFTSSMTCRSAFGQVLKEQEVFIKLIREVISLAEGFDVADIF  218

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+K LH   G K +++   ++ D I+ D+IKEH+ N+ + +      G ED+VDVL++L
Sbjct  219   PSYKFLHGFGGAKKKLLNAHRKVDSIVEDVIKEHKKNI-ATRKSDDAIGGEDLVDVLLRL  277

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +  SL   I +DNIKA+I+D+F    +TS+T TV AM EM+KNP V AKAQAEVRE F+
Sbjct  278   MNDKSLQFPINNDNIKAVIIDLFAAGTETSSTTTVWAMAEMLKNPSVFAKAQAEVREAFR  337

Query  1200  GRV--EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +V  + ++V++L YL LVIKETMRLH P P++  RE  +++ + GYTIP +T+V++N W
Sbjct  338   DKVTFDGNDVEELKYLKLVIKETMRLHAPVPLLVPRECREETEINGYTIPVKTKVMVNVW  397

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA
Sbjct  398   ALGRDPKYWDDAESFKPERFEQCSIDFI-GNNFEYLPFGGGRRICPGISFGLANVYFPLA  456

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP G+ P  L LTE   + +  K D++ I
Sbjct  457   QLLYHFDWKLPTGMEPKDLDLTESAGITVARKGDLYLI  494



>sp|A6YIH8.1|C7D55_HYOMU RecName: Full=Premnaspirodiene oxygenase; Short=HPO; AltName: 
Full=Cytochrome P450 71D55 [Hyoscyamus muticus]
 gb|ABS00393.1| cytochrome P450 hydroxylase [Hyoscyamus muticus]
Length=502

 Score =   459 bits (1181),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 234/458 (51%), Positives = 330/458 (72%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  +VG  +PH  LRDL+K++G  LMHLQLGEV AVVV+S ++AK  LKTHD+ FA+
Sbjct  42    LGSMLHMVG-GLPHHVLRDLAKKYGP-LMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA + V Y+ SDI F PYG+YWRQMRK+C+ E+LSA+ VRSFS IR+DE  RL++ 
Sbjct  100   RPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLEVLSAKNVRSFSSIRRDEVLRLVNF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             VRSS+    P+N  + +  F +S+ CR+AFGK     E  ++ + E++ +   F VAD F
Sbjct  160   VRSST--SEPVNFTERLFLFTSSMTCRSAFGKVFKEQETFIQLIKEVIGLAGGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH LTG + +++K   + D I+ D+I EH+ NL +    +G  G ED++DVL++L
Sbjct  218   PSLKFLHVLTGMEGKIMKAHHKVDAIVEDVINEHKKNL-AMGKTNGALGGEDLIDVLLRL  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +   L   IT+DNIKAII DMF    +TS++  V AMV+M++NP +LAKAQAEVRE FK
Sbjct  277   MNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQMMRNPTILAKAQAEVREAFK  336

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LVIKET+RLHPP P++  RE  +++ + GYTIP +T+V++N W
Sbjct  337   GKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREETEINGYTIPVKTKVMVNVW  396

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ++FKPERFE   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA
Sbjct  397   ALGRDPKYWDDADNFKPERFEQCSVDFI-GNNFEYLPFGGGRRICPGISFGLANVYLPLA  455

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP G+ P  L LTEL  +    K+D+  +
Sbjct  456   QLLYHFDWKLPTGMEPKDLDLTELVGVTAARKSDLMLV  493



>emb|CAC24711.1| cytochrome P450 [Solanum tuberosum]
Length=502

 Score =   458 bits (1178),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 233/458 (51%), Positives = 327/458 (71%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  + G  +PH  LRDL+K++G  LMHLQLGEV AVVV+S ++AK  LKTHD+ FA+
Sbjct  42    LGSMLHMAG-GLPHHVLRDLAKKYGP-LMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA + V Y+ SDI F PYG+YWRQMRK+C+ ELLSA+ VRS+  IR+DE  RL++ 
Sbjct  100   RPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSAKNVRSYGSIRRDEVDRLVNF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RSSS  G P+N  + +  F +S+ CR+AFGK     ++ ++ + E++ +   F VAD F
Sbjct  160   IRSSS--GEPVNFTERLFLFTSSMTCRSAFGKVFKEQDKFIQLIKEVIGLAGGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G K +++    + D I+ D+I EH+    +    +G  G ED++DVLI+L
Sbjct  218   PSLKFLHVLSGMKGKIMNAHHKVDAIVEDVINEHKKKF-AIGKTNGALGGEDLIDVLIRL  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +   L   IT+DNIKAII DMF    +TS++  V AMV+M+KNP V+AKAQAEVRE FK
Sbjct  277   MNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTLVWAMVQMMKNPSVIAKAQAEVREAFK  336

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +   +E++V++L YL LVIKET+RLHPP P++  RE  +++ + GYTIP +T+V++N W
Sbjct  337   DKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREETDINGYTIPVKTKVMVNVW  396

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA
Sbjct  397   ALGRDPKYWDDAESFKPERFEQRSVDFV-GNNFEYLPFGGGRRICPGISFGLANVYLPLA  455

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             HLLYHFDW+LP G+ P  L LTEL  +    K+D+  +
Sbjct  456   HLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDDLILV  493



>ref|XP_006350396.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   457 bits (1176),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 233/458 (51%), Positives = 328/458 (72%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  + G  +PH  LRDL+K++G  LMHLQLGEV AVVV+S ++AK  LKTHD+ FA+
Sbjct  42    LGSMLHMAG-GLPHHVLRDLAKKYGP-LMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA + V Y+ SDI F PYG+YWRQMRK+C+ ELLSA+ VRS+  IR+DE  RL++ 
Sbjct  100   RPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLELLSAKNVRSYGSIRRDEVDRLVNF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RSSS  G P+N  + +  F +S+ CR+AFGK     ++ ++ + E++ +   F VAD F
Sbjct  160   IRSSS--GEPVNFTERLFLFTSSMTCRSAFGKVFKEQDKFIQLIKEVIGLAGGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G K +++    + D I+ D+I EH+ N+ +    +G  G ED++DVLI+L
Sbjct  218   PSLKFLHVLSGMKGKIMNAHDKVDAIVEDVINEHKKNI-AMGKTNGALGGEDLIDVLIRL  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +   L   IT++NIKAII DMF    +TS++  V AMV+M+KNP V AKAQAEVRE FK
Sbjct  277   MNDGGLQFPITNNNIKAIIFDMFAAGTETSSSTLVWAMVQMMKNPSVFAKAQAEVREAFK  336

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +   +E++V++L YL LVIKET+RLHPP P++  RE  +++ +  YTIP +T+V++N W
Sbjct  337   DKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREETDINSYTIPVKTKVMVNVW  396

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE   +DF   + F+Y+PFGSG+R+CPGISFGLA+VY PLA
Sbjct  397   ALGRDPKYWDDAESFKPERFEQRSVDFV-GNNFEYLPFGSGRRICPGISFGLANVYLPLA  455

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             HLLYHFDW+LP G+ P  L LTEL  +    K+D+  +
Sbjct  456   HLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDDLILV  493



>dbj|BAN58140.1| putative premaspirodiene oxygenase [Hyoscyamus albus]
Length=502

 Score =   455 bits (1170),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 232/458 (51%), Positives = 328/458 (72%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  +VG  +PH  LRDL+K++G  LMHLQLGEV AVVV+S ++AK  LKTHD+ FA+
Sbjct  42    LGSMLHMVG-GLPHHVLRDLAKKYGP-LMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA + V Y+ SDI F PYG+YWRQMRK+C+ E+LSA+ VRSFS IR+DE  RL++ 
Sbjct  100   RPKLLAPEIVCYNRSDIAFCPYGDYWRQMRKICVLEVLSAKNVRSFSSIRRDEVLRLVNF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             VRS +   +P+N  + +  F +S+ CR+AFGK     E  ++ + E++ +   F VAD F
Sbjct  160   VRSCT--SKPVNFTERLFLFTSSMTCRSAFGKVFKEQETFIQLIKEVIGLAGGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH LTG + +++K   + D I+ D+I EH+ NL +    +G  G ED++DVL++L
Sbjct  218   PSLKFLHVLTGMEGKIMKAHHKVDAIVEDVINEHKKNL-AMGKTNGALGGEDLIDVLLRL  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +   L   IT++NIKAII DMF    +TS++  V AMV+M++NP +LAKAQ EVRE FK
Sbjct  277   MNDGGLQFPITNNNIKAIIFDMFAAGTETSSSTLVWAMVQMMRNPTILAKAQEEVREAFK  336

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LVIKET+RLHPP P++  RE  +++ + GYTIP +T+V++N W
Sbjct  337   GKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREETEIDGYTIPVKTKVMVNVW  396

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YWED + FKPERFE   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA
Sbjct  397   ALGRDPKYWEDADDFKPERFEQCSVDFI-GNNFEYLPFGGGRRICPGISFGLANVYLPLA  455

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP G+ P  L LTEL  +    K+D+  +
Sbjct  456   QLLYHFDWKLPTGMEPKDLDLTELVGVTAARKSDLMLV  493



>ref|XP_009612725.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=503

 Score =   453 bits (1166),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 230/461 (50%), Positives = 339/461 (74%), Gaps = 11/461 (2%)
 Frame = +3

Query  300   IGNLYRLV--GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDF  473
             IG+L+ L   GP +PH  L++L+K++G  LMHLQLG++P +V+SS ++AK  LKTHDL F
Sbjct  42    IGSLHHLAVAGP-LPHHGLKNLAKRYGP-LMHLQLGQIPTLVISSPQMAKEVLKTHDLAF  99

Query  474   ATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLL  653
             ATRP+++  D + YDS+DI FSPYGEYWRQ+RK+CI ELLSA+ V+ FS IRQDE  +++
Sbjct  100   ATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKMV  159

Query  654   DRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
               +R++     P+N+ D++  F +S+ICR+A GK     ++L+ F+ EI+ +   FS+AD
Sbjct  160   SYIRTTPNL--PVNLTDKIFWFTSSVICRSALGKICGDQDKLIIFMREIISLAGGFSIAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FP+WK++H + G KS++VK  ++ DEI+ +++ EH+ N   GK G+GE G ED++DVL+
Sbjct  218   FFPTWKMIHDIDGSKSKLVKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGEDLIDVLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++++S  + + ITDDNIK+I++DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+ 
Sbjct  278   RVRESGEIQIPITDDNIKSILIDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQA  337

Query  1194  FKGR---VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLI  1361
              KG+    +E ++DKL YL LVIKET+R+HPP P++  RE  +D+ + GY IP +TRV++
Sbjct  338   LKGKKISFQEIDIDKLKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIV  397

Query  1362  NAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYT  1541
             NAWAI RDPQ W+DPESF PERFE++ +DF   +  +++PFG+G+R+CPG+ FGLA+V  
Sbjct  398   NAWAIGRDPQSWDDPESFTPERFENNSIDFL-GNHHQFIPFGAGRRICPGMLFGLANVGQ  456

Query  1542  PLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             PLA LLYHFDW+LP+G T     +TE P ++   K+D+  I
Sbjct  457   PLAQLLYHFDWKLPNGQTHQNFDMTESPGISATRKDDLILI  497



>ref|XP_009625417.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase [Nicotiana tomentosiformis]
Length=504

 Score =   452 bits (1162),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 235/457 (51%), Positives = 327/457 (72%), Gaps = 7/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  +VG   PH  LRDL+K++G  LMHLQ GE+ AVVV+S E+AK  LKTHD+ FA+
Sbjct  42    LGSMLHMVGGE-PHHVLRDLAKKYGP-LMHLQFGEISAVVVTSREMAKEVLKTHDVVFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA D + Y+ SDI FSPYG++WRQMRK+C+ ELL+A+ VRSFS IR+DE  RL+D 
Sbjct  100   RPKILAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIRRDEVVRLIDS  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RS S +G  +N    +  F +S+ CR+AFG+ L   +   K + E++ +   F VAD F
Sbjct  160   IRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDVFAKKIREVIGLAEGFDVADIF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+K LH L+G K +++    + D I+ D+I EH+ NL +    +G  G ED++DVL++L
Sbjct  220   PSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNL-ATGKTNGALGGEDLIDVLLRL  278

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +  SL   IT+DNIKAII+DMF    +TS+T TV AM EM+KNP V  KAQAEVRE FK
Sbjct  279   MNDTSLQFPITNDNIKAIIVDMFAAGTETSSTTTVWAMAEMMKNPSVFTKAQAEVREAFK  338

Query  1200  GRV--EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +V  +E++ ++L YL LVIKET+RLHPP P++  RE  +D+ + GYTIP +T+V++N W
Sbjct  339   NKVTFDENDAEELKYLKLVIKETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVW  398

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE   +DF   + F+++PFG G+R+CPG+SFGLA++Y PLA
Sbjct  399   ALGRDPKYWDDAESFKPERFEQCSVDFF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLA  457

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFF  1661
              LLYHFDW+LP G+ P  L LTEL  + +  K DI+ 
Sbjct  458   QLLYHFDWKLPTGMKPRDLDLTELAGITIARKGDIYL  494



>gb|ABC69397.1| CYP71D48v1 [Nicotiana tabacum]
Length=504

 Score =   451 bits (1161),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 229/461 (50%), Positives = 339/461 (74%), Gaps = 11/461 (2%)
 Frame = +3

Query  300   IGNLYRLV--GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDF  473
             IG+L+ L   GP +PH  L++L+K++G  LMHLQLG++P +V+SS ++AK  LKTHDL F
Sbjct  42    IGSLHHLAVAGP-LPHHGLKNLAKRYGP-LMHLQLGQIPTLVISSPQMAKEVLKTHDLAF  99

Query  474   ATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLL  653
             ATRP+++  D + YDS+DI FSPYGEYWRQ+RK+CI ELLSA+ V+ FS IRQDE  +++
Sbjct  100   ATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKMV  159

Query  654   DRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
               +R++     P+N+ D++  F +S+ICR+A GK     ++L+ F+ EI+ +   FS+AD
Sbjct  160   SSIRTTPNL--PVNLTDKIFWFTSSVICRSALGKICGDQDKLIIFMREIISLAGGFSIAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FP+WK++H + G KS++VK  ++ DEI+ +++ EH+ N   GK G+GE G ED++DVL+
Sbjct  218   FFPTWKMIHDIDGSKSKLVKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGEDLIDVLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++++S  + + ITDDNIK+I++DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+ 
Sbjct  278   RVRESGEVQIPITDDNIKSILIDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQA  337

Query  1194  FKGR---VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLI  1361
              KG+    +E ++DKL YL LVIKET+R+HPP P++  RE  +D+ + GY IP +TRV++
Sbjct  338   LKGKKISFQEIDIDKLKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIV  397

Query  1362  NAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYT  1541
             NAWAI RDPQ W+DPESF PERFE++ +DF   +  +++PFG+G+R+CPG+ FGLA+V  
Sbjct  398   NAWAIGRDPQSWDDPESFTPERFENNSIDFL-GNHHQFIPFGAGRRICPGMLFGLANVGQ  456

Query  1542  PLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             PLA LLYHFDW+LP+G +     +TE P ++   K+D+  I
Sbjct  457   PLAQLLYHFDWKLPNGQSHENFDMTESPGISATRKDDLVLI  497



>ref|XP_006350395.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=502

 Score =   451 bits (1160),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 231/458 (50%), Positives = 328/458 (72%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  +VG  +PH  LRDL+K++G  LMHLQLGEV AVVV+S ++AK  LKTHD+ FA+
Sbjct  42    LGSMLHMVG-GLPHHVLRDLAKKYGP-LMHLQLGEVSAVVVTSPDMAKEVLKTHDIAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA + V Y+ SDI F PYG+YWRQM K+C+ ELLSA+ VRS+  IR+DE  RL++ 
Sbjct  100   RPKLLAPEIVCYNRSDIAFCPYGDYWRQMHKICVLELLSAKNVRSYGSIRRDEVDRLVNL  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RSSS  G P+N ++ +  F +S+ CR+AFGK     ++ ++ + E++ +   F VAD F
Sbjct  160   IRSSS--GEPVNFIERLFLFTSSMTCRSAFGKVFKEQDKFIQLIKEVIGLAGGFDVADLF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+LH L+G K +++    + D I+ D+I EH+ N+ +    +G  G ED++DVLI+L
Sbjct  218   PSLKLLHVLSGMKGKIMNAHHKIDAIVEDVINEHKKNI-AMGKTNGALGGEDLIDVLIRL  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +   L   IT+ NIKAII DMF    +TS++    AMV+M+KNP V+AKAQAEVRE FK
Sbjct  277   MNDGGLQFPITNVNIKAIIFDMFAAETETSSSTLDWAMVQMMKNPSVIAKAQAEVREAFK  336

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +   +E++V++L YL LVIKET+RLHPP P++  RE  +++ + GYTIP +T+V++N W
Sbjct  337   DKETFDENDVEELKYLKLVIKETLRLHPPVPLLVPRECREETDINGYTIPVKTKVMVNVW  396

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE   +DF   + F+Y+PFG G+R+CPGISFGLA+VY PLA
Sbjct  397   ALGRDPKYWDDAESFKPERFEQCSVDFI-GNNFEYLPFGGGRRICPGISFGLANVYLPLA  455

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP G+ P  L LTEL  +    K+D+  +
Sbjct  456   QLLYHFDWKLPIGMEPKDLNLTELVGVTAARKDDLILV  493



>ref|XP_006339044.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   449 bits (1156),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 235/459 (51%), Positives = 330/459 (72%), Gaps = 7/459 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             +G+L+ L +   +PH  L +L K++G   MHLQLGE   VVVSS ++A+  +KTHDL FA
Sbjct  46    LGSLHHLALEGGLPHHALTNLGKKYGP-FMHLQLGETSMVVVSSLDMAREVMKTHDLAFA  104

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
             +RP++++ D + Y S+DI FS YGEYWRQMRK+C+ EL +A+ VRSFS IR+DE+  L+ 
Sbjct  105   SRPKLVSLDIIFYKSTDIAFSSYGEYWRQMRKICVLELFTAKNVRSFSSIRRDEASSLVQ  164

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              +RSS+  G PIN+ ++++ + +S   RAAFGK L   E+ +  V E++ + S FSVAD 
Sbjct  165   FIRSST-RGEPINVTEQISWYESSNTSRAAFGKLLKDQEKFIGLVKELVELASGFSVADF  223

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS KILH L+G +SR++KV +  D I+ D+I EH+ N+ SGK G+G  G ED+VDVL++
Sbjct  224   FPSIKILHVLSGVRSRILKVHKNVDAIVEDVINEHKKNIASGKKGNGAFGGEDLVDVLLR  283

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             LK+S  L + IT+DNIKAI++D+FG   +TS T  + AM EM++NP VLAKAQAEVRE F
Sbjct  284   LKESRELKIPITNDNIKAIMIDLFGAGTETSGTTIIWAMSEMMRNPSVLAKAQAEVREAF  343

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINA  1367
             KG+    E  +++L YL  V+KET RLHPP P +I RE  +++ + GYTIP +TRV++N 
Sbjct  344   KGKETFNEDVIEELKYLKQVVKETFRLHPPAPLLIPRECREETSINGYTIPLKTRVIVNV  403

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             +A+ RDP+YWED ESF PERFE   +DF   + FKY+PFG+G+RMCPGI FGL +VY PL
Sbjct  404   YAMGRDPKYWEDAESFIPERFEQISVDFM-GNNFKYLPFGAGRRMCPGILFGLINVYLPL  462

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A+LLYHFDW+LP G+    + +TE   +    K++++ I
Sbjct  463   ANLLYHFDWKLPDGVKLEDVDMTEFFGITAARKSELYLI  501



>gb|ABC69396.1| CYP71D48v2 [Nicotiana tabacum]
Length=503

 Score =   449 bits (1154),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 228/461 (49%), Positives = 337/461 (73%), Gaps = 11/461 (2%)
 Frame = +3

Query  300   IGNLYRLV--GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDF  473
             IG+L+ L   GP +PH  L++L+K++G  LMHLQLG++P +V+SS ++AK  LKTHDL F
Sbjct  42    IGSLHHLAVAGP-LPHHGLKNLAKRYGP-LMHLQLGQIPTLVISSPQMAKEVLKTHDLAF  99

Query  474   ATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLL  653
             ATRP+++  D + YDS+DI  SPYGEYWRQ+RK+CI ELLSA+ V+ FS IRQDE  +++
Sbjct  100   ATRPKLVVADIIHYDSTDIALSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKMV  159

Query  654   DRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
               +R++     P+N+ D++  F +S+ICR+A GK     ++L+ F+ EI+ +   FS+AD
Sbjct  160   SSIRTTPNL--PVNLTDKIFWFTSSVICRSALGKICGDQDKLIIFMREIISLAGGFSIAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FP+WK++H + G KS++VK  ++ DEI+ +++ EH+ N   GK G+GE G ED++DVL+
Sbjct  218   FFPTWKMIHDIDGSKSKLVKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGEDLIDVLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++++S  + + ITDDNIK+I++DMF    +TS+T  + A+ EM+K P VLAKAQAEV + 
Sbjct  278   RVRESGEVQIPITDDNIKSILIDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVSQA  337

Query  1194  FKGR---VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLI  1361
              KG+    +E ++DKL YL LVIKET+R+HPP P++  RE  +D+ + GY IP +TRV++
Sbjct  338   LKGKKISFQEIDIDKLKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIV  397

Query  1362  NAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYT  1541
             NAWAI RDPQ W+DPESF PERFE++ +DF   +  +++PFG+G+R+CPG+ FGLA+V  
Sbjct  398   NAWAIGRDPQSWDDPESFTPERFENNSIDFL-GNHHQFIPFGAGRRICPGMLFGLANVGQ  456

Query  1542  PLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             PLA LLYHFDW+LP+G T     +TE P ++   K+D+  I
Sbjct  457   PLAQLLYHFDWKLPNGQTHQNFDMTESPGISATRKDDLILI  497



>ref|XP_004249520.2| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=536

 Score =   449 bits (1155),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 235/459 (51%), Positives = 329/459 (72%), Gaps = 7/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G+L+ L    +PH  L  L K++G  LMHLQLGE+  VVVSS ++A+  LKTHDL FA+
Sbjct  73    LGSLHHLAIGGLPHHALTKLGKKYGP-LMHLQLGEISTVVVSSMDMAREVLKTHDLAFAS  131

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++ + D + Y S+DI+FSPYGEYWRQMRKVC+ ELL+A+ VRSFS I  DE+ RL+  
Sbjct  132   RPKLASIDIICYKSTDIVFSPYGEYWRQMRKVCVMELLTAKNVRSFSSILHDEASRLVQF  191

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFG-KTLNRTEELVKFVNEILIMVSSFSVADT  836
             ++SS+  G PINI + +  + +SI C+ AFG + L   E+ ++ V +++ + S FS+AD 
Sbjct  192   IQSST-HGEPINITERILWYTSSITCKTAFGDQLLKDQEKFIQMVKKLVELASGFSLADI  250

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS KIL  LTG +SR++KV +  D I+ D+I EH+ NL SGK G+G  G E++VDVLI+
Sbjct  251   FPSIKILGVLTGARSRILKVHKNVDAIVEDVINEHKKNLASGKKGNGAFGGENLVDVLIR  310

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             L  S  L + IT+DNIKAI++D+F    +TS+T    AM EM++NPRVL KAQAEVRE F
Sbjct  311   LMGSGELKIPITNDNIKAIMVDLFSAGTETSSTTATWAMTEMMRNPRVLKKAQAEVREAF  370

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
             KG+   +E  +++L YL  V+KET+RLHPP P++  RE  +++ + GYTIP +TRV++N 
Sbjct  371   KGKETFDEDVIEELKYLRQVVKETLRLHPPVPLLAPRECREETNINGYTIPLKTRVMVNV  430

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             W++ RDP+YWED ESF PERF    +DF   + F+Y+PFG+G+RMCPGI+FGL +VY PL
Sbjct  431   WSMGRDPKYWEDAESFIPERFARSSVDFL-GNNFEYLPFGAGRRMCPGITFGLFNVYLPL  489

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP G  P  + +TEL  +    K++++ I
Sbjct  490   AKLLYHFDWKLPDGQKPEDVDMTELSAITAARKSELYLI  528



>ref|XP_009801864.1| PREDICTED: LOW QUALITY PROTEIN: 5-epiaristolochene 1,3-dihydroxylase-like 
[Nicotiana sylvestris]
Length=504

 Score =   447 bits (1149),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 229/457 (50%), Positives = 328/457 (72%), Gaps = 7/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  ++G   PH  LRDL+K++G  LMHLQLGE+ AVVV+S ++AK  LKTHD+ FA+
Sbjct  42    LGSMLHMIGGE-PHHVLRDLAKKYGP-LMHLQLGEISAVVVTSRDMAKEVLKTHDVVFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+++A D + Y+ SDI FSPYG++WRQMRK+C+ ELL+A+ VRSFS IR+DE  RL+D 
Sbjct  100   RPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIRRDEVVRLIDS  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RS S +G  +N    +  F +S+ CR+AFG+ L   +   K + E++ +   F V D F
Sbjct  160   IRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDIFAKKIREVIGLAEGFDVVDIF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             P++K LH L+G K +++    + D I+ D+I EH+ NL +    +G  G ED++DVL++L
Sbjct  220   PTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNL-AAGKSNGALGGEDLIDVLLRL  278

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +  SL   IT+DNIKA+++DMF    +TS+T TV AM EM+KNP V  KAQAEVRE F+
Sbjct  279   MNDTSLQFPITNDNIKAVVVDMFAAGTETSSTTTVWAMAEMMKNPSVFTKAQAEVREAFR  338

Query  1200  GRV--EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +V  +E++V++L YL LVIKET+RLHPP P++  RE  +D+ + GYTIP +T+V++N W
Sbjct  339   DKVSFDENDVEELKYLKLVIKETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVW  398

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE   +DF   + F+++PFG G+R+CPG+SFGLA++Y PLA
Sbjct  399   ALGRDPKYWDDAESFKPERFEQCSVDFF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLA  457

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFF  1661
              LLYHFDW+LP GI P  L LTEL  + +  K D++ 
Sbjct  458   QLLYHFDWKLPTGIKPRDLDLTELSGITIARKGDLYL  494



>sp|Q94FM7.2|C71DK_TOBAC RecName: Full=5-epiaristolochene 1,3-dihydroxylase; Short=NtEAH; 
AltName: Full=Cytochrome P450 71D20 [Nicotiana tabacum]
 gb|AAK62342.2| elicitor-inducible cytochrome P450 [Nicotiana tabacum]
Length=504

 Score =   445 bits (1145),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 229/457 (50%), Positives = 327/457 (72%), Gaps = 7/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  ++G   PH  LRDL+K++G  LMHLQLGE+ AVVV+S ++AK  LKTHD+ FA+
Sbjct  42    LGSMLHMIGGE-PHHVLRDLAKKYGP-LMHLQLGEISAVVVTSRDMAKEVLKTHDVVFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+++A D + Y+ SDI FSPYG++WRQMRK+C+ ELL+A+ VRSFS IR+DE  RL+D 
Sbjct  100   RPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIRRDEVVRLIDS  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RS S +G  +N    +  F +S+ CR+AFG+ L   +   K + E++ +   F V D F
Sbjct  160   IRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDIFAKKIREVIGLAEGFDVVDIF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             P++K LH L+G K +++    + D I+ D+I EH+ NL +    +G  G ED++DVL++L
Sbjct  220   PTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNL-AAGKSNGALGGEDLIDVLLRL  278

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +  SL   IT+DNIKA+I+DMF    +TS+T TV AM EM+KNP V  KAQAEVRE F+
Sbjct  279   MNDTSLQFPITNDNIKAVIVDMFAAGTETSSTTTVWAMAEMMKNPSVFTKAQAEVREAFR  338

Query  1200  GRV--EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +V  +E++V++L YL LVIKET+RLHPP P++  RE  +D+ + GYTIP +T+V++N W
Sbjct  339   DKVSFDENDVEELKYLKLVIKETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVW  398

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE   +DF   + F+++PFG G+R+CPG+SFGLA++Y PLA
Sbjct  399   ALGRDPKYWDDAESFKPERFEQCSVDFF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLA  457

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFF  1661
              LLYHFDW+LP GI P  L LTEL  + +  K  ++ 
Sbjct  458   QLLYHFDWKLPTGIMPRDLDLTELSGITIARKGGLYL  494



>ref|XP_006361940.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   445 bits (1144),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 233/460 (51%), Positives = 335/460 (73%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLV--GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDF  473
             IG+L+ L   GP +PH  L++L+K +G  LMHLQLGE+P V++SS  +AK  LKTHDL F
Sbjct  42    IGSLHHLAVAGP-LPHHGLKNLAKCYGA-LMHLQLGEIPTVIISSPRMAKEVLKTHDLVF  99

Query  474   ATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLL  653
             ATRP+++  D V YDS+DI FSPYGEYWRQ+RK+CI ELLSA+ V+ FS IRQDE  +++
Sbjct  100   ATRPKLVVADIVHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKMV  159

Query  654   DRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
               +R+      P+N+ D++  F +S+ CR+A GK     ++L+ F+ EI+ +   FSVAD
Sbjct  160   SSIRTMPN-NLPVNLTDKIFWFTSSVTCRSALGKICCDQDKLIIFMREIISLAGGFSVAD  218

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FP+WK+LH + G K+R+VK  ++ DEI+ +++ EH+ N   GK G+GE G ED++DVL+
Sbjct  219   FFPTWKMLHDVGGSKTRLVKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGEDLIDVLL  278

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++++S  + + ITDDNIKAI++DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+V
Sbjct  279   RVRESGEVQIPITDDNIKAILVDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQV  338

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
              K +   ++ ++D+L YL LVIKET+R+HPP P++  RE  +D+ + GY IP +TRV++N
Sbjct  339   LKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVN  398

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP+ W+DPESF PERFE+  +DF   S  +++PFG+G+R+CPG+ FGLA+V  P
Sbjct  399   AWAIGRDPESWDDPESFSPERFENSSIDFL-GSHHQFIPFGAGRRICPGMLFGLANVGQP  457

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFDW+LP+G +   L LTE P ++   K+D+  I
Sbjct  458   LAQLLYHFDWKLPNGQSHENLDLTESPGISATRKDDLVLI  497



>ref|XP_011082249.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=530

 Score =   446 bits (1146),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 231/457 (51%), Positives = 326/457 (71%), Gaps = 7/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L  +VG ++PH +LRDLS ++G  LMHL+ GEV  +VVSS +VAK  LKT D   A 
Sbjct  71    IGHLLHVVG-SLPHHSLRDLSNKYGP-LMHLKFGEVSTIVVSSPKVAKEVLKTVDPACAD  128

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+ LA   + Y+  DI FSPYGEYWRQMRK+CI ELLS + VRSF YIR+DE+ RL++ 
Sbjct  129   RPQSLASQIMWYNYIDIAFSPYGEYWRQMRKICILELLSVKNVRSFDYIRKDEASRLVES  188

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R+SSG  RPIN+ D+   F ++I CRAAFGK L   E L+  + E +++   F +AD F
Sbjct  189   IRASSG--RPINLTDKTFLFTSAITCRAAFGKVLKDRETLISLLKEAVVLAGGFDMADLF  246

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS KIL+ +   K +++K+R + D I+  +I EH++NL + K G+GE GSED+VDVL++L
Sbjct  247   PSLKILNIINWNKYKLLKMRSKMDAILDRLIDEHKDNLATSKKGNGEMGSEDLVDVLLRL  306

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K S      I ++NIKA++ DMF    +TS+T    AM E+++NP VLAKAQAEVRE FK
Sbjct  307   KQSGEFEFPIANNNIKAVLFDMFSAGTETSSTTVDWAMAELMRNPHVLAKAQAEVRETFK  366

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
             G+  +EE +V  L YL LVIKET+R+HPP P++ R   ++  V GYTIP + +V++N WA
Sbjct  367   GKETIEECDVHALKYLKLVIKETLRMHPPIPLLPRACREECEVEGYTIPLKAKVMVNTWA  426

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             + RDP YW  PE+FKPERFE++ +D+   + ++Y+PFGSG+R+CPG++FGLA+V  PLA 
Sbjct  427   MGRDPNYWPQPENFKPERFEENSIDYL-GAHYQYLPFGSGRRICPGMTFGLANVELPLAQ  485

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHFDW+LP+G+ P  + + +   +A+G K+++  I
Sbjct  486   LLYHFDWKLPNGMKPSDMDMADAEGIAVGRKHNLLVI  522



>ref|XP_009771988.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like [Nicotiana 
sylvestris]
Length=504

 Score =   444 bits (1141),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 230/458 (50%), Positives = 326/458 (71%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  ++G   PH  LRDL+K++G  +MHLQ GE+ AVVV+S E+AK  LKTHD+ FA+
Sbjct  42    LGSMLHMLGGE-PHHILRDLAKKYGP-IMHLQFGEISAVVVTSREMAKEVLKTHDVVFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA D + Y+ SDI FSPYG++WRQMRK+C+ ELL+A+ VRSFS IR+DE  RL+D 
Sbjct  100   RPKILAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIRRDEVVRLIDS  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RS S +G  +N    +  F +S+ CR+AFG+ L   +   K + E++ +   F VAD F
Sbjct  160   IRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDVFAKKIREVIGLAEGFDVADIF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+K LH L+G K +++    + D I+ D+I EH+ NL +    +G  G ED++DVL++L
Sbjct  220   PSYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNL-ATGKTNGALGGEDLIDVLLRL  278

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +  SL   IT+D IKA+I+DMF    +TS+T TV AM EM+KNP V  KAQAEVRE FK
Sbjct  279   MNDTSLQFPITNDKIKAVIVDMFAAGTETSSTTTVWAMAEMMKNPNVFNKAQAEVRETFK  338

Query  1200  GRV--EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +V  +E + ++L YL LVIKET+RLHPP P++  RE  +D+ + GYTIP +T+V++N W
Sbjct  339   DKVTFDEIDAEELEYLKLVIKETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVW  398

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE   +DF   + F+++PFG G+R+CPG+SFGLA++Y PLA
Sbjct  399   ALGRDPKYWDDAESFKPERFEQCSVDFF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLA  457

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP G+ P  L LTEL  + +  K D++ +
Sbjct  458   QLLYHFDWKLPSGMMPGDLDLTELAGITIARKGDLYLM  495



>gb|ABC69421.1| CYP71D20v2 [Nicotiana tabacum]
Length=504

 Score =   443 bits (1140),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 229/457 (50%), Positives = 327/457 (72%), Gaps = 7/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  ++G   PH  LRDL+K+ G  LMHLQLGE+ AVVV+S ++AK  LKTHD+ FA+
Sbjct  42    LGSMLHMIGGE-PHHVLRDLAKKDGP-LMHLQLGEISAVVVTSRDMAKEVLKTHDVVFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+++A D + Y+ SDI FSPYG++WRQMRK+C+ ELL+A+ VRSFS IR+DE  RL+D 
Sbjct  100   RPKIVAMDIICYNQSDIAFSPYGDHWRQMRKICVMELLNAKNVRSFSSIRRDEVVRLIDS  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RS S +G  +N    +  F +S+ CR+AFG+ L   +   K + E++ +   F V D F
Sbjct  160   IRSDSSSGELVNFTQRIIWFASSMTCRSAFGQVLKGQDIFAKKIREVIGLAEGFDVVDIF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             P++K LH L+G K +++    + D I+ D+I EH+ NL +    +G  G ED++DVL++L
Sbjct  220   PTYKFLHVLSGMKRKLLNAHLKVDAIVEDVINEHKKNL-AAGKSNGALGGEDLIDVLLRL  278

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +  SL   IT+DNIKA+++DMF    +TS+T TV AM EM+KNP V AKAQAEVRE F+
Sbjct  279   MNDTSLQFPITNDNIKAVVVDMFAAGTETSSTTTVWAMAEMMKNPSVFAKAQAEVREAFR  338

Query  1200  GRV--EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +V  +E++V++L YL LVIKET+RLHPP P++  RE  +D+ + GYTIP +T+V++N W
Sbjct  339   DKVSFDENDVEELKYLKLVIKETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVW  398

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE   +D    + F+++PFG G+R+CPG+SFGLA++Y PLA
Sbjct  399   ALGRDPKYWDDAESFKPERFEQCSVDIF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLA  457

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFF  1661
              LLYHFDW+LP GI P  L LTEL  + +  K D++ 
Sbjct  458   QLLYHFDWKLPTGIKPRDLDLTELSGITIARKGDLYL  494



>gb|AIZ01224.1| epi-aristolochene dihydroxylase, partial [Nicotiana benthamiana]
Length=438

 Score =   441 bits (1133),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 225/432 (52%), Positives = 316/432 (73%), Gaps = 6/432 (1%)
 Frame = +3

Query  336   PHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFATRPRVLACDEVMY  515
             PH  LRDL+K++G  LMHLQLGE+ AVVV+S ++AK  LKTHD+ FA+RP+++A D + Y
Sbjct  9     PHHVLRDLAKKYGP-LMHLQLGEISAVVVTSRDMAKEVLKTHDVVFASRPKIVAMDIICY  67

Query  516   DSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDRVRSSSGAGRPIN  695
             + SDI FSP+G++WRQMRK+C+ ELL+A+ VRSFS IR+DE  RL+D +RS S +G  +N
Sbjct  68    NQSDIAFSPHGDHWRQMRKICVMELLNAKNVRSFSSIRRDEVVRLIDSIRSDSSSGELVN  127

Query  696   IVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTFPSWKILHFLTGE  875
                 +  F +S+ CR+AFG+ L   +   K + E++ +   F V D FP++K LH L+G 
Sbjct  128   FTQRIIWFASSMTCRSAFGQVLKGQDIFAKKIREVIGLAEGFDVVDIFPTYKFLHVLSGM  187

Query  876   KSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKLKDSDSLPMSITD  1055
             K +++    + D I+ D+I EH+ NL +    +G  G ED++DVL++L +  SL   IT+
Sbjct  188   KRKLLNAHLKVDAIVEDVINEHKKNL-AAGKSNGALGGEDLIDVLLRLMNDTSLQFPITN  246

Query  1056  DNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDK  1229
             DNIKA+I+DMF    +TS+T TV AM EM+KNPRV  KAQAEVRE F+ +V  +E++V++
Sbjct  247   DNIKAVIVDMFAAGTETSSTTTVWAMAEMMKNPRVFTKAQAEVREAFRDKVSFDENDVEE  306

Query  1230  LAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDP  1406
             L YL LVIKET+RLHPP P++  RE  +D+ + GYTIP +T+V++N WA+ RDP+YW+D 
Sbjct  307   LKYLKLVIKETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVWALGRDPKYWDDA  366

Query  1407  ESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPH  1586
             ESFKPERFE   +DF   + F+++PFG G+R+CPG+SFGLA++Y PLA LLYHFDW+LP 
Sbjct  367   ESFKPERFEQCSLDFY-GNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLYHFDWKLPT  425

Query  1587  GITPHTLKLTEL  1622
             G+ P  L LTEL
Sbjct  426   GMKPRDLDLTEL  437



>gb|ABC69395.1| CYP71D47v2 [Nicotiana tabacum]
Length=503

 Score =   442 bits (1136),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 224/460 (49%), Positives = 337/460 (73%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLV--GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDF  473
             IG+L+ L   GP +PH  L++L+K++G  LMHLQLG++P +++SS ++AK  LKTHDL F
Sbjct  42    IGSLHHLAVAGP-LPHHGLKNLAKRYGP-LMHLQLGQIPTLIISSPQMAKEVLKTHDLAF  99

Query  474   ATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLL  653
             ATRP+++A D + YDS+DI FSPYGEYWRQ+RK+CI ELLSA+ V+ FS IRQDE  ++L
Sbjct  100   ATRPKLVAADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKML  159

Query  654   DRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
               +R++      +N+ D++  F +S+ CR+A GK     ++L+ F+ EI+ +   FS+AD
Sbjct  160   SSIRTTPNL--TVNLTDKIFWFTSSVTCRSALGKICGDQDKLIIFMREIISLAGGFSIAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FP+WK++H + G KS++VK  ++ DEI+G+++ EH+ N   GK G+GE G ED++DVL+
Sbjct  218   FFPTWKMIHDIDGSKSKLVKAHRKIDEILGNVVDEHKKNRADGKKGNGEFGGEDLIDVLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++++S  + + IT+DNIK+I++DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+ 
Sbjct  278   RVRESGEVQIPITNDNIKSILIDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQA  337

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
              K +   ++ ++D+L YL LVIKET+R+HPP P++  RE  +D+ + GY IP +TRV++N
Sbjct  338   LKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVN  397

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP+ W+DPESF PERFE+  +DF   +  +++PFG+G+R+CPG+ FGLA+V  P
Sbjct  398   AWAIGRDPESWDDPESFMPERFENSSIDFL-GNHHQFIPFGAGRRICPGMLFGLANVGQP  456

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFDW+LP+G +     +TE P ++   K+D+  I
Sbjct  457   LAQLLYHFDWKLPNGQSHENFDMTESPGISATRKDDLVLI  496



>ref|XP_004233564.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   441 bits (1135),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 230/460 (50%), Positives = 337/460 (73%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLV--GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDF  473
             IG+L+ L   GP +PH  L++L+K++G  L++LQLGE+P V++SS  +AK  LKTHDL F
Sbjct  42    IGSLHHLALAGP-LPHHGLKNLAKRYGA-LIYLQLGEIPTVIISSPRMAKEVLKTHDLVF  99

Query  474   ATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLL  653
             ATRP+++  D V YDSSDI FSPYGEYWRQ+RK+CI ELLSA+ V+ FS IRQDE  +++
Sbjct  100   ATRPKLVVADIVHYDSSDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKMV  159

Query  654   DRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
               +R+      P+N+ D++  F +S+ CR+A GK     ++L+ F+ EI+ +   FSVAD
Sbjct  160   SSIRTMPN-NHPVNLTDKIFWFTSSVTCRSALGKICCDQDKLIIFMREIISLAGGFSVAD  218

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FP+WK+LH + G K+R++K  ++ DEI+ +++ EH+ N   GK G+GE G ED++DVL+
Sbjct  219   FFPTWKMLHDVGGSKTRLLKAHRKIDEILENVVNEHKQNRADGKKGNGEFGGEDLIDVLL  278

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++++S  + + ITDDNIK+I++DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+V
Sbjct  279   RVRESGEVQIPITDDNIKSILVDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQV  338

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
              K +   ++ ++D+L YL LVIKET+R+HPP P++  RE  +D+ + GY IP +TRV++N
Sbjct  339   LKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVN  398

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP+ W+DPESF PERFE+  +DF   S  +++PFG+G+R+CPG+ FGLA+V  P
Sbjct  399   AWAIGRDPESWDDPESFSPERFENSSVDFL-GSHHQFIPFGAGRRICPGMLFGLANVGQP  457

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFDW+LP+G +  +L LTE P ++   K+D+  I
Sbjct  458   LAQLLYHFDWKLPNGQSHESLDLTESPGISATRKDDLVLI  497



>ref|XP_004250027.1| PREDICTED: cytochrome P450 71D7 [Solanum lycopersicum]
Length=508

 Score =   441 bits (1134),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 233/463 (50%), Positives = 330/463 (71%), Gaps = 11/463 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ +VG   PH  LRDL+K++G  LMHLQLGEV  VVV+S+E+AK   KTHDL FA+
Sbjct  43    IGSIHHIVG-GYPHHVLRDLAKKYGP-LMHLQLGEVCVVVVTSSEMAKQIFKTHDLAFAS  100

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++L  D + Y+S DI FSPYG+YW+QMRK+ + ELL+A+ VRSFS IR DE   L+D 
Sbjct  101   RPKLLVMDIITYNSRDIAFSPYGDYWKQMRKISVMELLNAKNVRSFSSIRHDEVVHLIDS  160

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVS-SFSVADT  836
             +RSSS +G P+N  + V  F +S++CR+AFGK     +  +K V ++L + +  F +AD 
Sbjct  161   IRSSSSSGEPVNFSERVLWFASSMLCRSAFGKLPKDQDIFIKLVRQVLRLSNQGFDMADI  220

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHR----NNLgsgktgsgesgseDIVD  1004
             FPS+K LH L G K +++ V  + D I+ D+I EH+    N+  +    +   G ED++D
Sbjct  221   FPSYKFLHGLGGLKKKILDVHYKIDSIVEDVINEHKKSFANHKRTSDDDALGGGDEDLID  280

Query  1005  VLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEV  1184
             VL++L    SL   I +  IKAII+D+F G  DT++ I V AM EM++NP +LAKAQAEV
Sbjct  281   VLLRLMKDKSLQFPINNHTIKAIIVDIFAGGTDTTSIIIVWAMAEMMRNPSILAKAQAEV  340

Query  1185  REVFKGRV--EESNVDKLAYLNLVIKETMRLHPPGPV-IYRENNKDSVVCGYTIPPRTRV  1355
             RE FKG+V  ++ +V++L YL LV+KET+RLHP  P+ + RE  +++ + GYTIP +T++
Sbjct  341   REAFKGKVKFDKYDVEELKYLKLVVKETLRLHPSVPLSVPRECREETDINGYTIPLKTKI  400

Query  1356  LINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASV  1535
             LIN WA+ RDP+YW+DPESFKPERFE   +DF   + F+++PFGSG+R+CPGISFGLA++
Sbjct  401   LINVWALGRDPEYWDDPESFKPERFEQCSVDFI-GNNFEFLPFGSGRRVCPGISFGLANI  459

Query  1536  YTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             Y+ LA  LYHFDW+LP+G+ P  L LTE    + G+KND++ I
Sbjct  460   YSSLAQSLYHFDWKLPNGMDPTDLDLTESDGGSTGMKNDLYLI  502



>ref|XP_009766832.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=503

 Score =   441 bits (1133),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 223/460 (48%), Positives = 336/460 (73%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLV--GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDF  473
             IG+L+ L   GP +PH  L++L+K++G  LMHLQLG++P +++SS ++AK  LKTHDL F
Sbjct  42    IGSLHHLAVAGP-LPHHGLKNLAKRYGP-LMHLQLGQIPTLIISSPQMAKEVLKTHDLAF  99

Query  474   ATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLL  653
             ATRP+++  D + YDS+DI FSPYGEYWRQ+RK+CI ELLSA+ V+ FS IRQDE  +++
Sbjct  100   ATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKMV  159

Query  654   DRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
               +R++      +N+ D++  F +S+ CR+A GK     ++L+ F+ EI+ +   FS+AD
Sbjct  160   SSIRTTPNL--TVNLTDKIFWFTSSVTCRSALGKICGDQDKLIIFMREIISLAGGFSIAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FP+WK++H + G KS++VK  ++ DEI+G+++ EH+ N   GK G+GE G ED++DVL+
Sbjct  218   FFPTWKMIHDIDGSKSKLVKAHRKIDEILGNVVDEHKKNRADGKKGNGEFGGEDLIDVLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++++S  + + ITDDNIK+I++DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+ 
Sbjct  278   RVRESGEVQIPITDDNIKSILIDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQA  337

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
              K +   ++ ++D+L YL LVIKET+R+HPP P++  RE  +D+ + GY IP +TRV++N
Sbjct  338   LKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVN  397

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP+ W+DPESF PERFE+  +DF   +  +++PFG+G+R+CPG+ FGLA+V  P
Sbjct  398   AWAIGRDPESWDDPESFMPERFENSSIDFL-GNHHQFIPFGAGRRICPGMLFGLANVGQP  456

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFDW+LP+G +     +TE P ++   K+D+  I
Sbjct  457   LAQLLYHFDWKLPNGQSHENFDMTESPGISATRKDDLVLI  496



>ref|XP_009776868.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   440 bits (1132),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 236/458 (52%), Positives = 317/458 (69%), Gaps = 12/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG++  L+G  +PH  LRDL+K++G  +MHLQLGEV  VV+SS E+AK  LKTHDL FA+
Sbjct  42    IGSMLHLLG-GLPHHVLRDLAKKYGP-IMHLQLGEVSLVVISSPEMAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP ++A   V Y+ +DI FSPYG YWRQMRK+C+ ELLSA+ V+SF+ IRQDE HR+++ 
Sbjct  100   RPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDEVHRMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSS   G+P+N+      F +S+ CR+AFG+     +E  + V ++  ++  F VAD F
Sbjct  160   FRSS--PGKPVNVTKRFALFTSSMTCRSAFGQEYKEQDEFARLVKKVSNLMEGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH LTG K++++    E DEI+ +II EH+         + ESGSE I+DVL++L
Sbjct  218   PSLKFLHVLTGMKAKVMDAHNELDEILDNIITEHKK----VAKTNCESGSEGIIDVLLRL  273

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII DMF    +TS T    AMVEM+KNP V AK QAEVR++ +
Sbjct  274   MKEGGLQFPITNDNIKAIIFDMFAAGTETSATTINWAMVEMMKNPSVFAKTQAEVRKILR  333

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLH-PPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+    E +VD+  YL +VIKET RLH P   ++ RE  +++ + GYTIP +T+V++N W
Sbjct  334   GKETFGEIDVDEFKYLKMVIKETFRLHPPLPLLLPRECREETDLNGYTIPLKTKVVVNVW  393

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE++ MD+T  + F+Y+PFGSG+R+CPGISFGLA+VY PLA
Sbjct  394   AMGRDPKYWDDVESFKPERFENNSMDYT-GNNFEYLPFGSGRRICPGISFGLANVYFPLA  452

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP  I P  L LTE    A   KND+  I
Sbjct  453   QLLYHFDWKLPTEINPSELDLTEAAGAACARKNDLHLI  490



>ref|XP_009765480.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=511

 Score =   440 bits (1131),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 229/446 (51%), Positives = 320/446 (72%), Gaps = 5/446 (1%)
 Frame = +3

Query  336   PHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFATRPRVLACDEVMY  515
             PH  L +L+K++G DLMHLQLGE+  VVVSS ++A+  LKTHDL FA+RP++LA + + Y
Sbjct  59    PHHALANLAKKYGPDLMHLQLGEISTVVVSSLDMAREVLKTHDLAFASRPKLLALEIIFY  118

Query  516   DSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDRVRSSSGAGRPIN  695
              S+DI FS YG+YWRQMRKV + ELLSA+ VRSF+ IR+DE+ RL+  +RSS     PIN
Sbjct  119   KSTDIAFSAYGDYWRQMRKVAVLELLSAKNVRSFTSIRRDEASRLIQIIRSSP-TDEPIN  177

Query  696   IVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTFPSWKILHFLTGE  875
             + + +  + +S+ C+AAFG+ L   ++ +  V E+  +   FSVAD FPS KILH L+G 
Sbjct  178   VTERILWYESSMTCKAAFGELLKDQKKFILIVRELTELSGGFSVADIFPSIKILHLLSGM  237

Query  876   KSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKLKDSDSLPMSITD  1055
             K R++   +  D I+ D+I EH  NL +GK G+G  G ED+VDVL++LK+S  L + IT+
Sbjct  238   KGRILNTHKRVDAIVEDVINEHIKNLANGKAGNGALGGEDLVDVLLRLKESGELQIPITN  297

Query  1056  DNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDK  1229
             DNIKA+++D+F    +TS+T T+ AM EM++NP+V AKAQAEVREVFKG+  ++E N+++
Sbjct  298   DNIKAVMIDLFSAGTETSSTTTIWAMTEMMRNPKVYAKAQAEVREVFKGKETIDEDNIEE  357

Query  1230  LAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDP  1406
             L YL  V+KET     P   ++ RE  +++ + GYTIP +TRV++NAWAI RDP+YWED 
Sbjct  358   LKYLKQVVKETLRLHPPLPLLLPRECREETNINGYTIPLKTRVMVNAWAIGRDPKYWEDA  417

Query  1407  ESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPH  1586
             E FKPERFE   +DF   + F+Y+PFGSG+RMCPGISFGL +V+ PLA LLYH DW+LP 
Sbjct  418   EQFKPERFEHGSVDFM-GNNFEYLPFGSGRRMCPGISFGLINVHLPLAKLLYHCDWKLPD  476

Query  1587  GITPHTLKLTELPRMAMGVKNDIFFI  1664
             G+ P  L +TE   +    K++++ I
Sbjct  477   GVKPEDLDMTEFTAITAARKSELYLI  502



>gb|ABC69394.1| CYP71D47v1 [Nicotiana tabacum]
Length=503

 Score =   439 bits (1130),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 223/460 (48%), Positives = 336/460 (73%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLV--GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDF  473
             IG+L+ L   GP +PH  L++L+K++G  LMHLQLG++P +++SS ++AK  LKTHDL F
Sbjct  42    IGSLHHLAVAGP-LPHHGLKNLAKRYGP-LMHLQLGQIPTLIISSPQMAKEVLKTHDLAF  99

Query  474   ATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLL  653
             ATRP+++  D + YDS+DI FSPYGEYWRQ+RK+CI ELLSA+ V+ FS IRQDE  ++L
Sbjct  100   ATRPKLVVADIIHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSKML  159

Query  654   DRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
               +R++      +N+ D++  F +S+ CR+A GK     ++L+ F+ EI+ +   FS+AD
Sbjct  160   SSIRTTPNL--TVNLTDKIFWFTSSVTCRSALGKICGDQDKLIIFMREIISLAGGFSIAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FP+WK++H + G KS++VK  ++ DEI+G+++ EH+ N   GK G+GE G ED++DVL+
Sbjct  218   FFPTWKMIHDIDGSKSKLVKAHRKIDEILGNVVDEHKKNRADGKKGNGEFGGEDLIDVLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++++S  + + IT+DNIK+I++DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+ 
Sbjct  278   RVRESGEVQIPITNDNIKSILIDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQA  337

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
              K +   ++ ++D+L YL LVIKET+R+HPP P++  RE  +D+ + GY IP +TRV++N
Sbjct  338   LKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMEDTKIDGYNIPFKTRVIVN  397

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP+ W+DPESF PERFE+  +DF   +  +++PFG+G+R+CPG+ FGLA+V  P
Sbjct  398   AWAIGRDPESWDDPESFMPERFENSSIDFL-GNHHQFIPFGAGRRICPGMLFGLANVGQP  456

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFDW+LP+G +     +TE P ++   K+D+  I
Sbjct  457   LAQLLYHFDWKLPNGQSHENFDMTESPGISATRKDDLVLI  496



>ref|XP_009769208.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   439 bits (1129),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 234/458 (51%), Positives = 317/458 (69%), Gaps = 12/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG++  L+G  +PH  LRDL+K++G  +MHLQLGEV  VV++S E+AK  LKTHDL FA+
Sbjct  42    IGSMLHLLG-GLPHHVLRDLAKKYGP-IMHLQLGEVSLVVITSPEMAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP ++A   V Y+ +DI FSPYG YWRQMRK+C+ ELLSA+ V+SF+ IRQDE HR+++ 
Sbjct  100   RPLLVAAKIVFYNGTDIAFSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDEVHRMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSS   G+P+N+      F +S+ CR+AFG+     +E  + V ++  ++  F VAD F
Sbjct  160   FRSS--PGKPVNVTKRFALFTSSMTCRSAFGQEYKEQDEFARLVKKVSNLMEGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH LTG K++++    E DEI+ +II EH+         + ESGSE I+DVL++L
Sbjct  218   PSLKFLHVLTGMKAKVMDAHNELDEILDNIITEHKK----VAKTNCESGSEGIIDVLLRL  273

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII DMF    +TS T    AMVEM+KNP V AK QAEVR++ +
Sbjct  274   MKEGGLQFPITNDNIKAIIFDMFAAGTETSATTINWAMVEMMKNPSVFAKTQAEVRKILR  333

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLH-PPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+    E +V++  YL +VIKET RLH P   ++ RE  +++ + GYTIP +T+V++N W
Sbjct  334   GKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREETDLNGYTIPLKTKVVVNVW  393

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE++ MD+T  + F+Y+PFGSG+R+CPGISFGLA+VY PLA
Sbjct  394   AMGRDPKYWDDVESFKPERFENNSMDYT-GNNFEYLPFGSGRRICPGISFGLANVYFPLA  452

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP  I P  L LTE    A   KND+  I
Sbjct  453   QLLYHFDWKLPTEINPSELDLTEAAGAACARKNDLHLI  490



>ref|XP_004228511.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=493

 Score =   435 bits (1119),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 233/458 (51%), Positives = 315/458 (69%), Gaps = 16/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +GN++ L+G   PH  LRDL+K++G  +MHLQLGEV  VVV+S ++AK  LKTHD+ FA+
Sbjct  44    LGNIFHLLG-GPPHRVLRDLAKKYG-SIMHLQLGEVSLVVVTSPDMAKQVLKTHDIAFAS  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP ++A + V Y+ SDI+FSPYG+YWRQMRK+CI ELLSA+ V+SFS IRQDE  R+++ 
Sbjct  102   RPMLIAAEIVCYNGSDIVFSPYGDYWRQMRKICIMELLSAKNVKSFSSIRQDEVLRMIEF  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSSS  G  +N    +  F +S+ CR+AFGK     +EL++ V ++  +   F VAD F
Sbjct  162   FRSSS--GETVNATRRIFQFASSMTCRSAFGKVFKEQDELIQLVKKVSRLTEGFDVADIF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L G KS+++ V  E D I+ +II EH+NN        GE G E +V  L++L
Sbjct  220   PSLKFLHVLCGMKSKIMDVHHELDAILENIINEHKNN--------GELGGEGLVSTLLRL  271

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII D+F    +TS+      MVEM++NP VL+KAQ EVR  FK
Sbjct  272   MKEGGLQFPITNDNIKAIIFDIFAAGTETSSATIDWIMVEMMRNPNVLSKAQEEVRNAFK  331

Query  1200  GR--VEESNVDKLAYLNLVIKETMR-LHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LV+KE+ R   P   ++ RE  ++  + GYTIP +T+V++NAW
Sbjct  332   GKETFDENDVEELKYLKLVVKESFRLHPPFPLLLPRECREEVEINGYTIPLKTKVMVNAW  391

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW+D ESFKPERFED+ MDF   + F+Y+PFGSG+R CPGISFGLA+VY PLA
Sbjct  392   AIGRDPKYWDDAESFKPERFEDNSMDFI-GNNFEYLPFGSGRRNCPGISFGLANVYFPLA  450

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP+GI    L LTE        KN+++ I
Sbjct  451   QLLYHFDWKLPNGINSSELDLTESAGSTCARKNNLYLI  488



>ref|XP_009758268.1| PREDICTED: premnaspirodiene oxygenase [Nicotiana sylvestris]
 gb|ABC69404.1| CYP71D51v2 [Nicotiana tabacum]
 gb|AGK30193.1| cytochrome P450 CYP71D51 [Nicotiana tabacum]
Length=514

 Score =   436 bits (1120),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 226/458 (49%), Positives = 321/458 (70%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  +VG  +PH  LRDL+K++G  LMHLQLGEV AVVV+S + AK  LKTHD+ FA+
Sbjct  54    LGSMLHMVG-GLPHHVLRDLAKKYGP-LMHLQLGEVSAVVVTSPDTAKEVLKTHDIAFAS  111

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA + V Y+ SD+ F PYG+YWRQMRK+C+ E+LSA+ VR+FS IR++E  RL++ 
Sbjct  112   RPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKNVRTFSSIRRNEVLRLINF  171

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RSSS  G PIN+ + +  F +S+ CR+AFG+     ++ ++ + E++++   F VAD F
Sbjct  172   IRSSS--GEPINVTERIFLFTSSMTCRSAFGQVFKEQDKFIQLIKEVILLAGGFDVADIF  229

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G K +++    + D I+ ++I EH+ NL +    +G  G ED++DVL++L
Sbjct  230   PSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNL-AIGKTNGALGGEDLIDVLLRL  288

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +   L   IT+DNIKAII DMF    +TS++  V AMVEMVKNP V AKAQAEVRE F+
Sbjct  289   MNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTIVWAMVEMVKNPAVFAKAQAEVREAFR  348

Query  1200  GR--VEESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LVIKET     P   ++ RE  +++ + GYTIP +T+V++N W
Sbjct  349   GKETFDENDVEELNYLKLVIKETLRLHPPVPLLLPRECREETNINGYTIPVKTKVMVNVW  408

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW D E+F PERFE    DF   + F+Y+PFG G+R+CPGISFGLA+ Y PLA
Sbjct  409   ALGRDPKYWNDAETFMPERFEQCSKDFV-GNNFEYLPFGGGRRICPGISFGLANAYLPLA  467

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP GI P  L LTEL  +    K+D++ +
Sbjct  468   QLLYHFDWKLPAGIEPSDLDLTELVGVTAARKSDLYLV  505



>ref|XP_009611155.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   435 bits (1119),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 232/458 (51%), Positives = 316/458 (69%), Gaps = 12/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  L+G + PH  LRDL+K++G  LMHLQLGEV  VVV+S E+AK  LKTHDL FA+
Sbjct  42    LGSMLHLLGGH-PHHVLRDLAKKYGP-LMHLQLGEVSLVVVTSPEMAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   V Y+ +DI+FSPYG YWRQMRK+C+ ELLSA+ V+SF+ IRQDE HR+++ 
Sbjct  100   RPLLLAAKIVCYNGTDIVFSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDEVHRMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSS   G+P+N+      F +S+ CR+AFG+     +E V+ V ++   +  F VAD F
Sbjct  160   FRSS--PGKPVNVTKRFALFTSSMTCRSAFGQEHKEKDEFVRLVKKVSNYMEGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH +TG K++++    E DEI  +II E +         + ES  E IVDVL++L
Sbjct  218   PSLKFLHVVTGLKAKVMDAHHELDEIFENIISERKK----VAKTNCESRGEGIVDVLLRL  273

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAI+ DMF    +TS+T    AMVEM+K P V AKAQAEVR++ +
Sbjct  274   MKEGGLQFPITNDNIKAIVFDMFAAGTETSSTTINWAMVEMMKKPSVFAKAQAEVRKILR  333

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLH-PPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E +V++  YL +VIKET RLH P   ++ RE  +++ + GYTIP +T+V++N W
Sbjct  334   GKETFDEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREETDLNGYTIPLKTKVVVNVW  393

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE++PMD+   + F+Y+PFG G+R+CPGISFGLA+VY PLA
Sbjct  394   AMGRDPKYWDDVESFKPERFENNPMDYI-GNNFEYLPFGGGRRICPGISFGLANVYFPLA  452

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              +LYHFDW+LP GI P  L LTE    A   KND+  I
Sbjct  453   QMLYHFDWKLPTGINPSELDLTEAAGAACARKNDLHLI  490



>gb|AAF27282.1|AF122821_1 cytochrome P450 [Capsicum annuum]
Length=502

 Score =   435 bits (1119),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 228/460 (50%), Positives = 333/460 (72%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLV--GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDF  473
             IG+L+ L   GP +PH  L++L+K +G  LMHL+LGE+P V++SS  +AK  LKTHDL F
Sbjct  42    IGSLHHLAVAGP-LPHHGLKNLAKLYGP-LMHLRLGEIPTVIISSPRMAKEVLKTHDLAF  99

Query  474   ATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLL  653
             ATRP+++  D V YDS+DI FSPYGEYWRQ+RK+CI ELLSA+ V+ FS IRQDE   ++
Sbjct  100   ATRPKLVVADIVHYDSTDIAFSPYGEYWRQIRKICILELLSAKMVKFFSSIRQDELSMMV  159

Query  654   DRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
               +R+      P+N+ D++  F +S+ CR+A GK     ++L+ F+ EI+ +   FS+AD
Sbjct  160   SSIRTMPNF--PVNLTDKIFWFTSSVTCRSALGKICRDQDKLIIFMREIISLTGGFSIAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FP+WK+LH + G K+R++K  ++ DEI+  ++ EH+ N   G+ G+GE G ED++DVL+
Sbjct  218   FFPTWKMLHDVGGSKTRLLKAHRKIDEILEHVVNEHKQNRADGQKGNGEFGGEDLIDVLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++++S  + +SITDDNIK+I++DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+V
Sbjct  278   RVRESGEVQISITDDNIKSILVDMFSAGSETSSTTIIWALAEMMKKPSVLAKAQAEVRQV  337

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
              K +   ++ ++D+L YL LVIKET+R+HPP P++  RE  KD+ + GY IP +TRV++N
Sbjct  338   LKEKKGFQQIDLDELKYLKLVIKETLRMHPPIPLLVPRECMKDTKIDGYNIPFKTRVIVN  397

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP+ W+DPESF PERFE+  +DF   S  +++PFG+G+R+CPG+ FGLA+V  P
Sbjct  398   AWAIGRDPESWDDPESFSPERFENSSVDFL-GSHHQFIPFGAGRRICPGMLFGLANVGQP  456

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFD +LP+G +   L +TE P ++   K+D+  I
Sbjct  457   LAQLLYHFDRKLPNGQSHENLDMTESPGISATRKDDLVLI  496



>gb|ABC69405.1| CYP71D51v3 [Nicotiana tabacum]
Length=514

 Score =   436 bits (1120),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 226/458 (49%), Positives = 321/458 (70%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  +VG  +PH  LRDL+K++G  LMHLQLGEV AVVV+S + AK  LKTHD+ FA+
Sbjct  54    LGSMLHMVG-GLPHHVLRDLAKKYGP-LMHLQLGEVSAVVVTSPDTAKEVLKTHDIAFAS  111

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA + V Y+ SD+ F PYG+YWRQMRK+C+ E+LSA+ VR+FS IR++E  RL++ 
Sbjct  112   RPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKNVRTFSSIRRNEVLRLINF  171

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RSSS  G PIN+ + +  F +S+ CR+AFG+     ++ ++ + E++++   F VAD F
Sbjct  172   IRSSS--GEPINVTERIFLFTSSMTCRSAFGQVFKEQDKFIQLIKEVILLAGGFDVADIF  229

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G K +++    + D I+ ++I EH+ NL +    +G  G ED++DVL++L
Sbjct  230   PSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNL-AIGKTNGALGGEDLIDVLLRL  288

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +   L   IT+DNIKAII DMF    +TS++  V AMVEMVKNP V AKAQAEVRE F+
Sbjct  289   MNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTIVWAMVEMVKNPAVFAKAQAEVREAFR  348

Query  1200  GR--VEESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LVIKET     P   ++ RE  +++ + GYTIP +T+V++N W
Sbjct  349   GKETFDENDVEELNYLKLVIKETLRLHPPVPLLLPRECREETNINGYTIPVKTKVMVNVW  408

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW D E+F PERFE    DF   + F+Y+PFG G+R+CPGISFGLA+ Y PLA
Sbjct  409   ALGRDPKYWNDAETFMPERFEQCSKDFV-GNNFEYLPFGGGRRICPGISFGLANAYLPLA  467

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP GI P  L LTEL  +    K+D++ +
Sbjct  468   QLLYHFDWKLPAGIEPSDLDLTELVGVTAARKSDLYLV  505



>ref|XP_009780029.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   435 bits (1118),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 233/458 (51%), Positives = 320/458 (70%), Gaps = 12/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  ++G  +PH  LRDL+K++G  +MHLQLGEV  VV+SS E+AK  LKTHDL FA 
Sbjct  42    LGSMLHMLG-GLPHHVLRDLAKKYGP-IMHLQLGEVSLVVISSPEMAKEVLKTHDLAFAN  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP ++A   V Y+ +DI FSPYG YWRQMRK+C+ ELLSA+TV+SF+ IRQDE HR+++ 
Sbjct  100   RPLLVAAKIVCYNGTDIAFSPYGNYWRQMRKICLLELLSAKTVKSFNSIRQDEVHRMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSSS  G+P+N+   +  F  S+ CR+AFG+   + +E V+ V ++  ++  F VAD F
Sbjct  160   FRSSS--GKPVNVTKRIALFTNSMTCRSAFGQEYKKQDEFVELVKKVSHLIEGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH LTG K++++ +  E D I+ +II EH+          GESG E I+ VL++L
Sbjct  218   PSLKFLHVLTGMKAKVMNIHNEIDAILENIINEHKKT----SKSDGESGGEGIIGVLLRL  273

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII D+FGG  +TS+T    AM EM+KNP V +KAQAEVR++ +
Sbjct  274   MKEGGLQFPITNDNIKAIIFDIFGGGTETSSTTINWAMAEMMKNPCVFSKAQAEVRKILR  333

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLH-PPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+    E +V++  YL +VIKET RLH P   ++ RE  ++  + GYTIP +T+V++NAW
Sbjct  334   GKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREEIDLNGYTIPLKTKVVVNAW  393

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE + MD+   + ++Y+PFGSG+R+CPGISFGLA+VY PLA
Sbjct  394   AMGRDPKYWDDVESFKPERFEHNSMDYI-GNNYEYLPFGSGRRICPGISFGLANVYFPLA  452

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LL HFDW+LP GI P  L LTE   +A   KND+  I
Sbjct  453   QLLNHFDWKLPTGINPSELDLTEAAGVACATKNDLHLI  490



>ref|XP_009606204.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=527

 Score =   435 bits (1119),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 229/457 (50%), Positives = 318/457 (70%), Gaps = 10/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G+++ L+G   PH  L DL+K++G  LMHLQLGEV  V V+S E+AK  LKTHDL FA+
Sbjct  68    LGSMFHLLG-GPPHHVLGDLAKKYGP-LMHLQLGEVSVVSVTSPEMAKEVLKTHDLAFAS  125

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   V Y+ +DI+FSPYG+YWRQMRK+C+ ELLSA+ VRSFS +R+DE   +++ 
Sbjct  126   RPLLLAAKIVCYNGTDIVFSPYGDYWRQMRKICLLELLSAKNVRSFSSVRRDEVFHMIEY  185

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSSS  G+P+N+   ++ F TS+ CR+AFG+     +E  + V ++  ++  F VAD F
Sbjct  186   FRSSS--GKPVNVSKRISLFTTSMTCRSAFGQEYKEQDEFARLVKKVSSLMEGFDVADIF  243

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G K++++    E D I+ +II EH+    +    + E G E ++DVL++L
Sbjct  244   PSLKFLHVLSGMKAKVMDAHHELDAILENIINEHKK--IATGKNNNELGGEGLIDVLLRL  301

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII DMFG   +TS+T    AMVEM+KNP V AKAQAEVRE F+
Sbjct  302   MKEGGLQFPITNDNIKAIIFDMFGAGTETSSTTIDWAMVEMIKNPSVFAKAQAEVREAFR  361

Query  1200  GR--VEESNVDKLAYLNLVIKETMR-LHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
              +   +E++V++L YL LVIKET R   P   ++ RE+ +++ + GYTIP +T++++N W
Sbjct  362   EKETFDENDVEELKYLKLVIKETFRLHPPFPLLLPRESREETDINGYTIPFKTKLMVNVW  421

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW+D ESFKPERFE + MDF   + F+Y+PFGSG+RMCPGISFGLA+VY PLA
Sbjct  422   AIGRDPKYWDDVESFKPERFEHNSMDFI-GNNFEYLPFGSGRRMCPGISFGLANVYLPLA  480

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFF  1661
              LLYHFDW+LP GI    L +TE   +    K+D++ 
Sbjct  481   QLLYHFDWKLPTGINSSDLDMTESSGVTCARKSDLYL  517



>ref|XP_009765039.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=501

 Score =   434 bits (1115),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 228/457 (50%), Positives = 317/457 (69%), Gaps = 10/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +GN++ L+G   PH  L DL+K++G  LMHLQLGEV  V V+S E+AK  LKTHDL FA+
Sbjct  42    LGNMFHLLG-GPPHHVLGDLAKKYGP-LMHLQLGEVSVVAVTSPEMAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   V Y+ +DI+FSPYG+YWRQMRK+C+ ELLSA+ VRSFS +R+DE  R+++ 
Sbjct  100   RPLLLAAKIVCYNGTDIVFSPYGDYWRQMRKICLLELLSAKNVRSFSSVRRDEVFRMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSSS  G+P+N+   ++ F +S+ CR+AFG+     +E  + V ++  ++  F +AD F
Sbjct  160   FRSSS--GKPVNVTKRISVFTSSMTCRSAFGQEYKEQDEFARLVKKVSSLMEGFDIADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G K++++    E D I+  II EH+    +    + E G E ++DVL++L
Sbjct  218   PSLKFLHVLSGMKAKVMDAHHELDAILEKIINEHKK--IATGKNNDELGGEGLIDVLLRL  275

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII DMFG   +TS+T    AMVEM+KNP V AKAQAEVR+ F+
Sbjct  276   MKEGGLQFPITNDNIKAIIFDMFGAGTETSSTTIDWAMVEMMKNPTVFAKAQAEVRKAFR  335

Query  1200  GR--VEESNVDKLAYLNLVIKETMR-LHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LVIKET R   P   ++ RE+ +++ + GYTI  +T++++N W
Sbjct  336   GKETFDENDVEELKYLKLVIKETFRLHPPFPLLLPRESREETDINGYTISLKTKLMVNVW  395

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW+D ESFKPERFE + MDF   + F+Y+PFGSG+RMCPGISFGLA+VY PLA
Sbjct  396   AIGRDPKYWDDVESFKPERFEHNSMDFI-GNNFEYLPFGSGRRMCPGISFGLANVYLPLA  454

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFF  1661
              LLYHFDW+LP GI P  L + E        K+D++ 
Sbjct  455   QLLYHFDWKLPTGINPCDLDMIESSGATCSRKSDLYL  491



>ref|XP_009598320.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=502

 Score =   433 bits (1114),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 226/458 (49%), Positives = 326/458 (71%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G+++ ++G  +PH  L +L+K++G  LMHLQLGE+  VVV+S E+AK  LKTHDL FA+
Sbjct  42    LGSMFHMLG-GLPHHVLTNLAKKYGP-LMHLQLGEMSVVVVTSPEMAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+++A D V Y+ +DI FSPYG+YWRQMRK+C+ ELLSA+ VRSF+ IR+DE   L++ 
Sbjct  100   RPKLVAVDIVGYNGTDIAFSPYGDYWRQMRKICVMELLSAKNVRSFNSIRRDEVCSLIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSS  AG P+N+   +  F +S+I R+AFGK +   +E ++ + ++  +V  F VAD F
Sbjct  160   FRSS--AGEPVNVTKRIYVFASSMIFRSAFGKVIKEQDECIRLIKDVSGLVGGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+LH L+G+K + + +  + D I+ ++I EH+ NL +    +G+ GSED++DVL++L
Sbjct  218   PSQKVLHVLSGKKGKTMYLHHKIDTIIENVINEHKQNL-ATGKFNGQLGSEDLIDVLLRL  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                 SL   IT DNIKAI +D+F G  +TS++    AMVEM+KNP +L KAQ+EVR+ FK
Sbjct  277   MKDGSLQFPITTDNIKAIFIDLFAGGTETSSSTVTWAMVEMMKNPSILIKAQSEVRDAFK  336

Query  1200  GR--VEESNVDKLAYLNLVIKETMR-LHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LVIKET R   P   +I RE  +++ + GYTIP +T +++N W
Sbjct  337   GKEAFDENDVEELKYLKLVIKETFRLHPPLPLLIPRECREETNINGYTIPLKTTIMVNVW  396

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW D E+FKPERF+   MDFT  + F+++PFGSG+R+CPGISFGLA++Y PLA
Sbjct  397   AMGRDPKYWVDAENFKPERFQHSTMDFT-GNNFEFLPFGSGRRICPGISFGLANIYLPLA  455

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW LP GI P  L L E   +A+  K+D + I
Sbjct  456   QLLYHFDWNLPTGINPSDLDLAESAGLAVLRKSDFYLI  493



>gb|ABC69403.1| CYP71D51v1 [Nicotiana tabacum]
Length=514

 Score =   432 bits (1110),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 225/458 (49%), Positives = 320/458 (70%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  +VG  +PH  LRDL+K++G  LMHLQLGEV AVVV+S + AK  LKTHD+ FA+
Sbjct  54    LGSMLHMVG-GLPHHVLRDLAKKYGP-LMHLQLGEVSAVVVTSPDTAKEVLKTHDIAFAS  111

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA + V Y+ SD+ F PYG+YWRQMRK+C+ E+LSA+ VR+FS IR++E  RL++ 
Sbjct  112   RPSLLAPEIVCYNRSDLAFCPYGDYWRQMRKICVLEVLSAKNVRTFSSIRRNEVLRLINF  171

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RSSS  G PIN+ + +  F +S+ CR+AFG+     ++ ++ + E++++   F VAD F
Sbjct  172   IRSSS--GEPINVTERIFLFTSSMTCRSAFGQVFKEQDKFIQLIKEVILLAGGFDVADIF  229

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G K +++    + D I+ ++I EH+ NL +    +G  G ED++DV ++L
Sbjct  230   PSLKFLHVLSGMKGKIMNAHHKVDAIVENVINEHKKNL-AIGKTNGALGGEDLIDVPLRL  288

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +   L   IT+DNIKAII DMF    +TS++  V AMVEMVKNP V AKAQAEVRE F+
Sbjct  289   MNDGGLQFPITNDNIKAIIFDMFAAGTETSSSTIVWAMVEMVKNPAVFAKAQAEVREAFR  348

Query  1200  GR--VEESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LVIKET     P   ++ RE  +++ + GYTIP +T+V++N W
Sbjct  349   GKETFDENDVEELNYLKLVIKETLRLHPPVPLLLPRECREETNINGYTIPVKTKVMVNVW  408

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW D E+F PERFE    DF   + F+Y+PFG G+R+CPGISFGLA+ Y PLA
Sbjct  409   ALGRDPKYWNDAETFMPERFEQCSKDFV-GNNFEYLPFGGGRRICPGISFGLANAYLPLA  467

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP GI P  L LTEL  +    K+D++ +
Sbjct  468   QLLYHFDWKLPAGIEPSDLDLTELVGVTAARKSDLYLV  505



>ref|XP_006339043.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=509

 Score =   431 bits (1109),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 223/459 (49%), Positives = 327/459 (71%), Gaps = 7/459 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             +G+++ LV    +PH  L +LSK++G  LMHLQLGE+  V+VSS ++A+  LKTHDL FA
Sbjct  46    LGSIHHLVLEGGLPHHALTNLSKKYGP-LMHLQLGEISTVIVSSTDMAREVLKTHDLAFA  104

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
             +RP++ + D + Y S+DI F+PYGEYWRQMRKVC+ ELL+A+ VRSFS IR+DE+  L+ 
Sbjct  105   SRPKLASVDTICYKSTDIAFTPYGEYWRQMRKVCVMELLTAKNVRSFSSIRKDEASGLVQ  164

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              ++SS+  G PIN+ + +  + +SI C+AAFG+ L   E+ ++ V E++ +   F++AD 
Sbjct  165   FIQSST-CGEPINVTERILWYQSSITCKAAFGELLKDQEKFIQMVKEVMELAGGFNLADI  223

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS KIL  L+G +SR++KV +  D I+ D+I EH+ N+ SGK G+G  G ED+VDVL++
Sbjct  224   FPSIKILQVLSGVRSRILKVHKNVDAIVEDVINEHKKNIASGKKGNGAFGGEDLVDVLLR  283

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             L +S  L + IT+DNIKAI++D+F    +TS+T    AM EM++NP VL KAQAEVRE F
Sbjct  284   LMESGELKIPITNDNIKAIMIDLFSAGTETSSTTATWAMTEMMRNPSVLKKAQAEVREAF  343

Query  1197  KGR--VEESNVDKLAYLNLVIKETMR-LHPPGPVIYRENNKDSVVCGYTIPPRTRVLINA  1367
             KG+   +E  +++L YL  V+KET R   P   ++ RE  +++ + GYTIP +TRV++N 
Sbjct  344   KGKETFDEDVIEELKYLKQVVKETFRLHPPLPLLVPRECREETNINGYTIPLKTRVMVNV  403

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             W++ RDP+YWED ESF PERFE   +DF   + F+++PFG+G+RMCPGI+FGL +V+ PL
Sbjct  404   WSMGRDPKYWEDAESFIPERFEQSSVDFM-GNNFEFLPFGAGRRMCPGITFGLINVHLPL  462

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP G     + +TE+  +    K++++ I
Sbjct  463   AKLLYHFDWKLPDGQKSEDMDMTEVSGITAARKSELYLI  501



>ref|XP_006339046.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   431 bits (1108),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 227/459 (49%), Positives = 326/459 (71%), Gaps = 7/459 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IG+++ L +   +PH  L +L K+ G   MHLQLGE+  +VVSS ++A+  LKTHDL FA
Sbjct  46    IGSVHHLPLEGGLPHHALTNLGKKHGP-FMHLQLGEISTIVVSSMDMAREVLKTHDLAFA  104

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
             +R ++LA D + Y S+DI FSPYG+YWRQM KVC+ ELL+ + VRSFS IR+DE+  L+ 
Sbjct  105   SRSKLLALDIICYKSTDIAFSPYGDYWRQMCKVCVLELLTTKNVRSFSSIRRDEASHLVQ  164

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              +RSS+    PIN+ + +  + +SI C+ AFG+ L   E+ +  + E++ +   FS+AD 
Sbjct  165   FIRSST-RDEPINVTERILWYQSSITCKTAFGELLKDQEKFLGILRELMEVAGGFSLADI  223

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS KIL  L+G KS+++KV +  D I+ D+I EH+ N+ SGK G+G  G E++VDVL++
Sbjct  224   FPSIKILQVLSGLKSKILKVHKNADVIVEDVINEHKKNIASGKKGNGAFGGENLVDVLLR  283

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             LK+S  L + IT+DNIKAII+D+F    +TS T T+ AM EM++ P VLAKAQAEVRE F
Sbjct  284   LKESGELKIPITNDNIKAIIIDLFSAGSETSGTTTIWAMSEMMRKPSVLAKAQAEVRETF  343

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINA  1367
             KG+   +E  +++L YL  V+KET+RLHPP P +I R+  +++ + GYTIP +TRV++N 
Sbjct  344   KGKETFDEDVIEELKYLKQVVKETLRLHPPVPLLIPRKCREETNINGYTIPLKTRVMVNV  403

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             +A+ RDP+YWED E F PERFE   +DF   + F+Y+PFG+G+RMCPGI+FGL +VY PL
Sbjct  404   YAMGRDPKYWEDAEIFIPERFEQSSVDFM-GNNFEYLPFGAGRRMCPGITFGLINVYLPL  462

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP G+ P  + +TE   +    K++++ I
Sbjct  463   AKLLYHFDWKLPDGLKPKYVDMTEFSGITAARKSELYLI  501



>ref|XP_004228509.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=495

 Score =   430 bits (1106),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 228/458 (50%), Positives = 310/458 (68%), Gaps = 16/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G  +PH   RDL+K++G  +MHLQLGEV  VVV+SA++AK  LKTHDL FA 
Sbjct  42    IGSMFHLLG-GLPHHVFRDLAKKYGP-IMHLQLGEVSLVVVTSADMAKQVLKTHDLAFAF  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++L  + + Y  +DI+FSPYG+YWRQMRK+C+ E LSA+ V+SF+ IRQDE H +++ 
Sbjct  100   RPKLLVGEILFYKGTDIVFSPYGDYWRQMRKICLLEFLSAKNVKSFNSIRQDEVHHMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSSS  G  IN+   +  F +S+ CR+ FGK      +L++   E    +  F VAD F
Sbjct  160   FRSSS--GETINVTKRIYQFSSSMTCRSVFGKVFKEQNKLMELAKEASRFLKGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L G K +++    E D I+ +II EH+NN        GE G E ++  L+ L
Sbjct  218   PSLKFLHVLCGMKGKIMDAHHELDAILENIINEHKNN--------GELGGEGLLVALLSL  269

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII DMF G  DTS+T+   AMVEM+KNP VL KAQ E+R  F 
Sbjct  270   MKEGGLQFPITNDNIKAIIFDMFAGGTDTSSTLIDWAMVEMMKNPSVLLKAQDEIRNAFT  329

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+    E++V++L YL LV+KET RLHPP P ++ RE  ++  + GY IP +T+VL+NA+
Sbjct  330   GKETFNENDVEELKYLKLVVKETFRLHPPAPLLVARECREEVDIDGYNIPLKTKVLVNAY  389

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW D E FKPERFE   +DF   + F+++PFGSG+R+CPGISFGLA+++ PLA
Sbjct  390   AIGRDPKYWIDAECFKPERFEQISVDFI-GNNFEFLPFGSGRRICPGISFGLANIFFPLA  448

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP GI P  L LTE   +A   K++++ I
Sbjct  449   KLLYHFDWKLPIGINPSDLDLTESAGIACARKSNLYLI  486



>ref|XP_009796910.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=502

 Score =   430 bits (1106),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 227/458 (50%), Positives = 323/458 (71%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  +VG  +PH  LRDL+K++G  LMHLQLGEV  VVV+S E+AK  LKTHDL FA+
Sbjct  42    LGSMLHMVG-GLPHRVLRDLAKKYGP-LMHLQLGEVSVVVVTSPEIAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA + V+YDSSD+ F+PYG+YWRQMRK+C+ E+LS + VRSFS IR+DE  RL++ 
Sbjct  100   RPKLLAAEIVLYDSSDVAFAPYGDYWRQMRKICVLEVLSTKNVRSFSSIRRDEVVRLIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSSS  G+P+N    ++ FM+ IICR+AFG      +E ++ + ++  ++  F VAD F
Sbjct  160   FRSSS--GKPVNFTKRISLFMSFIICRSAFGTVFKEQDEFIQVMKDVTALLEGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH LTG +++ + +  + D+I+ +II EH+ NL +    +G+ G ED++DVL++L
Sbjct  218   PSLKFLHVLTGMRAKAMNLHHKVDDIVDNIINEHKKNL-ATGKFNGQLGGEDLIDVLLRL  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             K        IT+DNIKAII DMF    +T++T    AMVEM++N  V AKAQAEVREVF 
Sbjct  277   KKDGGFQFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVEMIRNASVFAKAQAEVREVFN  336

Query  1197  -KGRVEESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
              K   +E++V++L YL LVIKET     P   ++ RE  +++ + GYTIP +++V++N W
Sbjct  337   RKETFDENDVEELKYLKLVIKETLRLHPPLPLMLPRECREETNINGYTIPLKSKVMVNVW  396

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+ W+D ESFKPERFE   +DF   + F+Y+PFGSG+R+CPGI FGLA++Y PLA
Sbjct  397   AIGRDPKNWDDAESFKPERFEQSSVDFV-GNNFEYLPFGSGRRICPGILFGLANIYLPLA  455

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLY+FDW+LP GI P  L +TE    +   K++++ I
Sbjct  456   QLLYYFDWKLPTGINPSDLDMTESDGASCARKSNLYLI  493



>ref|XP_009793271.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   430 bits (1105),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 231/458 (50%), Positives = 318/458 (69%), Gaps = 12/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  ++G  +PH  LRDL+K++G  +MHLQLGEV  VV+SS E+AK  LKTHDL FA 
Sbjct  42    LGSMLHMLG-GLPHHVLRDLAKKYGP-IMHLQLGEVSLVVISSPEMAKEVLKTHDLAFAN  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP ++A   V Y+  DI FSPYG YWRQMRK+C+ ELLSA+ V+SF+ IRQDE HR+++ 
Sbjct  100   RPLLVAAKIVSYNCMDIAFSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDEVHRMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSS   G+P+N+   ++ F  S+ CR+AFG+   + +E V+ V ++  ++  F VAD F
Sbjct  160   FRSS--PGKPVNVTKRISLFTNSMTCRSAFGQEYKKQDEFVELVKKVSHLIEGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH LTG K++++ +  E D I+ +II EH+          GESG E I+ VL++L
Sbjct  218   PSLKFLHVLTGMKAKVMNIHNEIDAILENIINEHKKT----SKSDGESGGEGIIGVLLRL  273

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII D+FGG  +TS+T    AM EM+KNP V +KAQAEVR++ +
Sbjct  274   MKEGGLQFPITNDNIKAIIFDIFGGGTETSSTTINWAMAEMMKNPCVFSKAQAEVRKILR  333

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLH-PPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+    E +V++  YL +VIKET RLH P   ++ RE  ++  + GYTIP +T+V++NAW
Sbjct  334   GKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREEIDLNGYTIPLKTKVVVNAW  393

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE + MD+   + ++Y+PFGSG+R+CPGISFGLA+VY PLA
Sbjct  394   AMGRDPKYWDDVESFKPERFEHNSMDYI-GNNYEYLPFGSGRRICPGISFGLANVYFPLA  452

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LL HFDW+LP GI P  L LTE   +A   KND+  I
Sbjct  453   QLLNHFDWKLPTGINPSELDLTEAAGVACATKNDLHLI  490



>ref|XP_009794009.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   428 bits (1100),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 230/458 (50%), Positives = 315/458 (69%), Gaps = 14/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ ++G  +PH  LR+L+K+FG  LMHLQLGE+  VVV+S E+AK  LKTHDL FA+
Sbjct  42    IGSMFHILG-GLPHHVLRNLAKKFGP-LMHLQLGEMSVVVVTSPEMAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA + V+Y+ SDI FSPYG+YWRQMRK+C+ ELLSA+ VRSFS IR+DE HR+++ 
Sbjct  100   RPKLLAAEIVIYNCSDIAFSPYGDYWRQMRKICMIELLSAKNVRSFSSIRRDEVHRMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSS+  G+ +N+   +  F +S+ CR+AFGK     +EL+  V     +V  F VAD F
Sbjct  160   FRSST--GKQVNVTKRIYQFASSMTCRSAFGKVFKEQDELILLVKRNTALVEGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G K++++ V  + D I+ +II E +         + E   E ++DVL++L
Sbjct  218   PSLKFLHVLSGMKTKVMDVHHKLDAILENIINERKK------IATDELADEGLIDVLLRL  271

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII D+F    DTS+     AMVEM+KN  +LAKAQAEVR+ F+
Sbjct  272   MKEGGLQFPITNDNIKAIIFDIFSAGTDTSSATVDWAMVEMMKNQSILAKAQAEVRKTFR  331

Query  1200  GR--VEESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E+NV++L YL LVIKET     P   ++ RE  +++ + GYTIP +T+V+IN W
Sbjct  332   GKETFDENNVEELKYLKLVIKETLRLHPPLPLLLPRECREETNINGYTIPLKTKVMINVW  391

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW+D E FKPERFE + MDFT  + F+Y+PFGSG+R CPGISFGLA+VY PLA
Sbjct  392   AIGRDPKYWDDAEIFKPERFEHNSMDFT-GNNFEYLPFGSGRRNCPGISFGLANVYFPLA  450

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP    P  L LTE        K++++ I
Sbjct  451   QLLYHFDWKLPTETNPSDLDLTESAGATCSRKSNLYLI  488



>ref|XP_009772938.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=502

 Score =   427 bits (1099),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 223/457 (49%), Positives = 319/457 (70%), Gaps = 9/457 (2%)
 Frame = +3

Query  303   GNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFATR  482
             G+   +VG  +PH  LRDL+K++G  LMHLQLGEV  VVV+S E+AK  LKTHDL FA+R
Sbjct  43    GSTLHMVG-GLPHRVLRDLAKKYGP-LMHLQLGEVSVVVVTSPEIAKEVLKTHDLAFASR  100

Query  483   PRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDRV  662
             P++LA + V+YDSSD+ F+PYG+YWRQMRK+C+ E+LS + VRSFS IR+DE  RL++  
Sbjct  101   PKLLAAEIVLYDSSDVAFAPYGDYWRQMRKICVLEVLSTKNVRSFSSIRRDEVFRLVEFF  160

Query  663   RSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTFP  842
             RSSS  G+P+N    ++ FM+ IICR+AFG      +E ++ +  +  ++  F VAD FP
Sbjct  161   RSSS--GKPVNYTKRISLFMSFIICRSAFGTVFKEQDEFIQVMKNVTALLEGFDVADIFP  218

Query  843   SWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKLK  1022
             S K LH +TG +++ + +  + D I+ ++I EH+ NL +    SG+ G ED++DVL++L 
Sbjct  219   SLKFLHVVTGMRAKAMNLHHKVDAIVDNVINEHKENL-ATGKFSGQLGGEDLIDVLLRLM  277

Query  1023  DSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF--  1196
                     IT+DNIKAII DMF    +T++T    AMVEM++N  V AKAQAEVREVF  
Sbjct  278   KDGGFQFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVEMIRNASVFAKAQAEVREVFSR  337

Query  1197  KGRVEESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
             K   +E++V+KL YL LVIKET     P   ++ +E  +++ + GYTIP +++V++N WA
Sbjct  338   KETFDENDVEKLKYLKLVIKETLRLHPPLPLMLPKECREETNINGYTIPLKSKVMVNVWA  397

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             I RDP+YW+D ESFKPER+E   +DF   + F+Y+PFGSG+R+CPGISFG+ ++Y PLA 
Sbjct  398   IGRDPKYWDDAESFKPERYEQSSVDFV-GNNFEYLPFGSGRRICPGISFGIVNIYLPLAQ  456

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLY+FDW+LP GI P  L +TE    +   K++++ +
Sbjct  457   LLYYFDWKLPTGINPSDLDMTESDGASCARKSNLYLV  493



>dbj|BAC53923.1| cytochrome P450 [Petunia x hybrida]
Length=502

 Score =   426 bits (1096),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 226/460 (49%), Positives = 326/460 (71%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLV--GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDF  473
             IG+L+ LV  GP +PH  L +L+K++G  LM LQLGE P V +SS ++AK  LKTHDL F
Sbjct  42    IGSLHHLVFAGP-LPHHGLTNLAKRYGP-LMLLQLGEQPTVFISSPQMAKEVLKTHDLAF  99

Query  474   ATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLL  653
             ATRP++   + + Y S+DI FSPYGEYWRQ+RK+C+ ELLSA+ V SFS IR+DE   ++
Sbjct  100   ATRPKLTFAEIIKYGSTDIAFSPYGEYWRQIRKICVMELLSAKMVNSFSSIREDELSNMI  159

Query  654   DRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
               +R       P+N+ ++V  F +S++CR+A GK      +L+  + EIL +  S + AD
Sbjct  160   SWIRLRPNI--PVNLTEKVKWFTSSVVCRSALGKICKDQNKLIILMREILSLAISVNFAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FP WK LH L G K+R++K   + DEI+ DI+ EH+ N  +GK G+GE G ED++DVL+
Sbjct  218   FFPRWKFLHDLGGSKTRLLKEHHKIDEILQDIVNEHKQNRVNGKMGNGEFGGEDLIDVLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++++S    + ITDDNIKA+I+DMF    +TS+T  + A+ EM+K P VLAKAQAEVR+ 
Sbjct  278   RVRESGQHQLPITDDNIKAVIVDMFSAGTETSSTTIIWALAEMMKKPSVLAKAQAEVRQA  337

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLIN  1364
              KG+   +  ++D+L YL LVIKET+R+HPP P +I RE  +++ + G+ IP +TRV++N
Sbjct  338   MKGKKGFQLIDLDELKYLKLVIKETLRMHPPIPLLIPRECMEETKINGFNIPLKTRVIVN  397

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              WAI R+P+ WEDPESF PERFE++P+DFT  +  +++PFG+G+RMCPG+ FGL +V   
Sbjct  398   IWAIGRNPESWEDPESFMPERFENNPIDFT-GNHHQFIPFGAGRRMCPGMLFGLTNVAQL  456

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LL+HFDW+LP+G +P  L +TE P ++   K+D+ F+
Sbjct  457   LAQLLHHFDWKLPNGQSPQDLDMTESPGVSATRKDDLVFV  496



>gb|KHN42024.1| Cytochrome P450 71D8 [Glycine soja]
Length=459

 Score =   425 bits (1092),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 210/452 (46%), Positives = 323/452 (71%), Gaps = 9/452 (2%)
 Frame = +3

Query  321   VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFATRPRVLAC  500
              GP +PH  LR+L+ ++G  LMHLQLGE+ AVVVSS  +AK   KTHD+ F  RP++++ 
Sbjct  7     AGP-LPHRALRELAHKYGP-LMHLQLGEISAVVVSSPNMAKEITKTHDVAFVQRPQIISA  64

Query  501   DEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDRVRSSSGA  680
               + Y   D++F+PYG+YWRQMRKV ++ELLSA+ V+SFS+IR+DE+ +L+D +R+S G+
Sbjct  65    QILSYGGLDVVFAPYGDYWRQMRKVFVSELLSAKRVQSFSFIREDEAAKLIDSIRASEGS  124

Query  681   GRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTFPSWKILH  860
               PIN+  ++ + +++ + RAA G      +E + +V +++  V  F +AD FPS K +H
Sbjct  125   --PINLTRKIFSLVSASVSRAAIGNKSKDQDEFMYWVQKVIGSVGGFELADLFPSMKFIH  182

Query  861   FLTGEKSRMVKVRQETDEIMGDIIKEH-RNNLgsgktgsgesgseDIVDVLIKLKDSDSL  1037
             F+TG K+++ K+    D ++ +I++EH    + + +        ED+VDVLI+++ +D+L
Sbjct  183   FITGTKAKLEKLLNRVDRVLENIVREHLERQIRAKEGRILVDEDEDLVDVLIRVQQADTL  242

Query  1038  PMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VE  1211
              + +T  ++KA+ILD+F G +DTS +    AM EM+KNPRV  KAQAE+R+ F+ +  + 
Sbjct  243   DIKMTTRHVKALILDVFAGGIDTSASTLEWAMTEMMKNPRVREKAQAELRQAFREKKIIH  302

Query  1212  ESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINAWAISRDP  1388
             ES++++L YL LVIKET+RLHPP P +I RE ++++++ GY IP +T+V+IN WAI RDP
Sbjct  303   ESDIEQLTYLKLVIKETLRLHPPTPLLIPRECSEETIIAGYEIPVKTKVMINVWAICRDP  362

Query  1389  QYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHF  1568
             +YW D E F PERFED  +DF + + F+Y+PFG+G+R+CPGISFGLAS+  PLA LL +F
Sbjct  363   KYWTDAERFVPERFEDSSIDF-KGNNFEYLPFGAGRRICPGISFGLASIMLPLAQLLLYF  421

Query  1569  DWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             +WELP+G+ P ++ +TE   +A+G KND+  I
Sbjct  422   NWELPNGMKPESIDMTERFGLAIGRKNDLCLI  453



>ref|XP_011082374.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=517

 Score =   427 bits (1097),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 221/470 (47%), Positives = 320/470 (68%), Gaps = 21/470 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ +    +P  + RDL+KQ+G  +MHL+LGEVP +VVSS E+AK  L+ HD +FA 
Sbjct  46    IGDLHLISA--LPFRSFRDLAKQYGP-IMHLKLGEVPTIVVSSPEIAKEVLREHDPNFAD  102

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  +A   + Y+  DI FSPYG+YWRQMRK+CI ELL+A+ VRSFS IR DE  RL+  
Sbjct  103   RPEAIAMKIMWYNYIDIAFSPYGDYWRQMRKICIIELLNAKNVRSFSSIRNDEVSRLIKS  162

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R SSG   P+N+ +++ +  +SI CRAAFGK    ++ L+K + E + M   F +AD F
Sbjct  163   IRLSSG--EPVNLTEKIFSLTSSITCRAAFGKVCKDSDALIKLLKEGIQMAGGFEIADLF  220

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesg-----------  986
             PS KI++ L+  K R+V +R++ D I+ DIIKEH+ NL      +G+             
Sbjct  221   PSSKIINALSWSKLRLVMMRRKLDVILDDIIKEHKENLAKMARENGDGEGKESARRGNGE  280

Query  987   --seDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRV  1160
               +ED+VDV +++++S  L   I +DNIKA+I DMF    +TS+T     M E+V+NPRV
Sbjct  281   FGNEDLVDVFLRIQESGELEFPIGNDNIKAVIYDMFSAGTETSSTAIDWTMAELVRNPRV  340

Query  1161  LAKAQAEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYT  1334
             +AKAQAEVRE F G   ++E++V KL YL LVI+E++RLHPP P++ R + ++  + GYT
Sbjct  341   MAKAQAEVREFFNGSEIIQENDVQKLKYLKLVIRESLRLHPPVPILPRASREEREISGYT  400

Query  1335  IPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGI  1514
             IP + +VL+N WA+ RDP+YW +PE+F+PERFE+  +DF   + F+Y+PFG+G+RMCPG+
Sbjct  401   IPAKVKVLVNNWAMQRDPKYWTNPETFEPERFENQSLDFL-GADFQYLPFGTGRRMCPGM  459

Query  1515  SFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             +FGLASV  PLA LLY F+W+LP G+    L + E P +    K+++F +
Sbjct  460   TFGLASVELPLAQLLYSFNWKLPDGVKAEDLDMIENPGITASRKDNLFVV  509



>ref|XP_004245943.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=499

 Score =   426 bits (1095),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 219/458 (48%), Positives = 328/458 (72%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G  +PH  LR+LSK++G  +MHL+LGE+  VVVSSA +AK  LK HDL FA 
Sbjct  42    IGSMHHLIGV-LPHHVLRNLSKKYGP-IMHLKLGEIDTVVVSSAHMAKQVLKVHDLCFAA  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +++ D V Y+ +DI+F+ YG+YW+QMRK+CI+ELLSA+ V+SFS IRQDE H L+  
Sbjct  100   RPELMSSDIVFYNQNDIVFAKYGDYWKQMRKICISELLSAKMVKSFSLIRQDEVHDLVAS  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RS+      +NI +++    +S+ICR+AFGK  +  + L+  + E+L +   F VAD F
Sbjct  160   IRSTPNV--VVNISEKILRLTSSVICRSAFGKVWDDRDNLLMLMREVLSLSGGFDVADLF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSW +LH + G ++R+  + Q+ D I+  II EH+ N  +GK G+ E G ED++DVL+++
Sbjct  218   PSWTLLHGIGGMRNRLKSLHQKIDVILEKIIHEHKENRANGKKGNSEFGGEDLIDVLLRV  277

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              ++  L   IT+D++KA++LD+F G  +TS+ I   A+ E++KNP+V+AKAQAEVR V K
Sbjct  278   MENGELQFPITNDSVKAVVLDLFFGGTETSSVIIQWALSELMKNPKVMAKAQAEVRRVCK  337

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVI-YRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+  + ++ V++L YL LVI ET+RLHP  P++  R+  +++ + GYTIP +++V++N W
Sbjct  338   GKKDLNDNVVEELKYLKLVINETLRLHPASPLLGLRQCREETKIDGYTIPLKSQVVVNGW  397

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+ W+DPE+F PERFE + +DF   + F+Y+PFG+G RMCPG+ FGLA+V  PLA
Sbjct  398   AIARDPESWDDPEAFVPERFEKNSVDFN-GNHFQYIPFGAGSRMCPGMHFGLANVVYPLA  456

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP+G  P  L +TE   ++   KND+  I
Sbjct  457   QLLYHFDWKLPYGQQPEDLDMTETLGISATRKNDLNLI  494



>ref|XP_004241764.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=513

 Score =   426 bits (1096),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 217/460 (47%), Positives = 316/460 (69%), Gaps = 8/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGP-NVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IG+L+ L G  + PH TL++L+ ++G  +M+LQLGE+PAV+VSS  + K  LKTH+L FA
Sbjct  47    IGSLHHLRGALSFPHRTLKNLATKYGP-IMYLQLGEIPAVIVSSPIMVKEILKTHELAFA  105

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
             T+P++ + D   Y+  DI F+PYG+ WRQMR +C+TELL  +TV+SFS IR+DE  RLL 
Sbjct  106   TKPQLTSIDITTYNYKDIAFAPYGDKWRQMRNICVTELLGTKTVKSFSSIRKDEITRLLS  165

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              +RS++G  R +N+ + +  +  S+ CR+AFGK       L+  + ++L  +  F V+D 
Sbjct  166   SIRSTNGT-RLVNLTELILRYTNSVTCRSAFGKVCTNQHHLINLLRDVLDTLGGFDVSDL  224

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNN--LgsgktgsgesgseDIVDVL  1010
             FPSWK+LH ++G KS ++++ ++ DE + +I+ EH  N  LG    G    G ED+VDVL
Sbjct  225   FPSWKLLHKMSGVKSELLRMHKKVDEALENIVNEHIKNRALGCKGNGDKLIGGEDLVDVL  284

Query  1011  IKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVRE  1190
             +++K++  L   IT D+IKAII DMF    +TS    + A+ EM++ P+++AKAQ EVR+
Sbjct  285   LRIKENGELQFPITSDHIKAIISDMFAAGTETSAATIIWALSEMMRKPKIMAKAQNEVRQ  344

Query  1191  VFKGRVE--ESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLIN  1364
             VFKG++   E ++DKL YL LVIKET+RLHPP  ++ RE  K + + GYTIPP+TRVLIN
Sbjct  345   VFKGKITFYEDDLDKLTYLKLVIKETLRLHPPSTLLPRECRKQTYINGYTIPPKTRVLIN  404

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              WA+ RD + W+DPESF PERFE+ P+D+   + +K++PFGSG+R+CPG+ FGL +V  P
Sbjct  405   TWALGRDSESWDDPESFIPERFENSPVDYM-GNYYKFIPFGSGRRICPGMQFGLTNVKHP  463

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFDW LP+G  P  L + E   ++     D+  I
Sbjct  464   LAQLLYHFDWVLPYGANPEDLDMIEKNGLSAAKHRDLCLI  503



>ref|XP_006365938.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=514

 Score =   426 bits (1095),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 220/458 (48%), Positives = 318/458 (69%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL+ L+G  +PH   R LS+++G  LM+LQLGEVP VV+SS  +AK  L+THD  FA 
Sbjct  51    IGNLHHLIGGGLPHHIFRKLSQRYGP-LMYLQLGEVPTVVISSTTIAKEILRTHDHAFAC  109

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++ + + + Y+S DI FSPYG+YWRQMRK+C  EL S + ++ FS IR+DE   L+  
Sbjct  110   RPQLTSTNIIFYNSIDIAFSPYGDYWRQMRKICTLELFSIKMIKLFSAIREDELTSLISS  169

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RS  G+  P+N+  ++  F   IICR+AFGK      E +  + E+L++ + F +AD +
Sbjct  170   IRSMRGS--PVNMTKKIFLFTNCIICRSAFGKVCKDRGEFLTTLKEVLLLAAGFFMADLY  227

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+LH L GEK+RMV   ++ D +M +I+ EH  N  +GK G+GE G ED+VDVL+++
Sbjct  228   PSWKLLHNLRGEKTRMVNAHKKVDAVMEEILNEHIENKAAGKKGNGEFGDEDLVDVLLRV  287

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K++  L   IT+D+IKA+I D+F G   +S++  + A+ EM+KNP V+ KAQ+EVR+VFK
Sbjct  288   KENAELQYPITNDHIKAVIFDIFLGGTGSSSSTIIWALSEMIKNPNVMIKAQSEVRQVFK  347

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVI-YRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+    E  V+ L YL  VIKET+RLH P P++  RE  +  V+ GYTIP + RVL+NAW
Sbjct  348   GKQNFSEEEVENLTYLKSVIKETLRLHTPAPLLGSRECREQRVIDGYTIPLKARVLVNAW  407

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A++RDP+ W+DPE+F PERFE+  +DF   + F+++PFGSG+R+CPG+  G+A+V  PLA
Sbjct  408   ALARDPESWDDPENFIPERFENSSIDFM-GNHFEFIPFGSGRRVCPGLLLGVANVIHPLA  466

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHF+WELP+G  P  L +TE   +    K +++ I
Sbjct  467   QLLYHFEWELPNGTNPEDLDMTETHGLTAEKKENLYLI  504



>ref|XP_009608635.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=511

 Score =   426 bits (1095),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 221/458 (48%), Positives = 319/458 (70%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L+G  VPH TLR L++++G  LM+LQLG+ P V++SS  +AK  LKTHDL FA 
Sbjct  48    IGSLHHLMGREVPHRTLRSLAQKYGP-LMYLQLGQAPTVIISSPSMAKQVLKTHDLAFAN  106

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             R ++ + + + Y++ DI+FS Y +YWRQMRK+CI ELLS + V+SFS IRQDE   L+  
Sbjct  107   RAQLTSSNIIFYNNKDIVFSQYSDYWRQMRKICILELLSTKMVKSFSAIRQDELSSLISS  166

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RS  G+  P+N+ +++     SI  RAAFG       E +K + E+L +   F VAD F
Sbjct  167   IRSMRGS--PVNLTEKIFQLTNSITGRAAFGNVFKDRHEFMKLMKEVLELAGGFDVADLF  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+LH ++G KSR+V   ++ DEIM DI+ EH  N  +G  G GE G ED+VDV +++
Sbjct  225   PSWKLLHKMSGVKSRLVNAHRKVDEIMEDILNEHIENKAAGNKGIGEFGGEDLVDVFLRI  284

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K++  L   IT+DNIKA+I D+F    +TS+T  + A+ EM+KNP ++AKAQ+EVR+VFK
Sbjct  285   KENAELQFPITNDNIKAVIFDIFLAGSETSSTAIIWALSEMIKNPNIMAKAQSEVRQVFK  344

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVI-YRENNKDSVVCGYTIPPRTRVLINAW  1370
             G  + +E +++KL YLNLVIKET+RLHP   ++  RE  + + + GYTIP +TR+++NAW
Sbjct  345   GKKKYDEEDLEKLTYLNLVIKETLRLHPSVSLLPPRECREQTDIDGYTIPLKTRIIVNAW  404

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+ W DPESF PERF++  ++FT  + F+++PFG+G+RMCPGI FGL +V  PLA
Sbjct  405   ALGRDPESWHDPESFIPERFKNSSIEFT-GNHFEFIPFGAGRRMCPGIQFGLVNVGLPLA  463

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LL HF+WELPH      L +TE   ++   + D++ +
Sbjct  464   QLLQHFEWELPHETNSQDLDMTETRGLSAAKQKDLYLV  501



>ref|XP_004246079.1| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   424 bits (1090),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 222/458 (48%), Positives = 317/458 (69%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL+ L G  +PH  LRDL+++ G  LM+LQLGEVP VV+SS  +AK  LKTHDL FAT
Sbjct  44    IGNLHHLKG-KLPHHNLRDLARKHGP-LMYLQLGEVPVVVISSPRIAKAVLKTHDLAFAT  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+ +A D V Y S DI F+PYG+YWRQMRKV   ELL+ + V+S++ IR+DE  +LL  
Sbjct  102   RPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLNNKMVKSYNMIRKDELSKLLSS  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R ++G+   +NI +++  F + + CR AFGK  N  +EL+  + EIL +   F V D F
Sbjct  162   IRLATGSA--VNITEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILALSGGFDVCDLF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+L  ++  K+R+  V  + D+IM +II EH+ N  +G  G+ E G ED++D L++ 
Sbjct  220   PSWKLLQNMSNMKARLTNVHHKYDQIMENIINEHKQNHAAGIKGNNEFGGEDMIDALLRA  279

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K+++ L   I +DN+KA+ILD+F    +TS T  + A+ EM+K+P V+AKAQAEVR+VFK
Sbjct  280   KENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALTEMMKHPNVMAKAQAEVRQVFK  339

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
                  +E+++DKL YL  VIKET+R+HPP P++  RE  + + + GYT+P   RV++NAW
Sbjct  340   DNENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEIDGYTVPLNARVMVNAW  399

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+ WEDPESFKPERFE+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA
Sbjct  400   AIGRDPESWEDPESFKPERFENVAVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLA  458

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
               LY FDW+LP  +  +  + TE  R+    K+D++ I
Sbjct  459   QFLYQFDWKLPDKVNANDFRTTETSRVFAASKDDLYLI  496



>emb|CDP18841.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   424 bits (1090),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 242/482 (50%), Positives = 329/482 (68%), Gaps = 9/482 (2%)
 Frame = +3

Query  237   RQWMKPKSgrklppgp---rklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGev  407
             ++WMK K+       P   +K+P IGNL+ L+G ++PH  L  L+K+ G DLMHLQLGEV
Sbjct  22    KKWMKSKTVNATQKLPPGPKKIPFIGNLHNLLG-SLPHHALAKLAKKHG-DLMHLQLGEV  79

Query  408   pavvvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITE  587
              AVVVSS   AK  LKTHD  F  RP +L    + YDSS I FS YG+YWRQMRK+C  E
Sbjct  80    SAVVVSSPHSAKEILKTHDHVFVDRPEILVGKIICYDSSSIAFSQYGDYWRQMRKICAME  139

Query  588   LLSARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNR  767
             +LSA++VRSF  IRQDE   L+  +R S+  G+PIN+ +E+++F +S+ICRAA GK    
Sbjct  140   VLSAKSVRSFGSIRQDEVLHLISSIRGSTIGGQPINLTEEISSFTSSMICRAACGKVFRE  199

Query  768   TEELVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRN  947
                L++ + E+L   S F ++D FPS KILH L+  K  + K+  + D I+  +I EH  
Sbjct  200   RITLIELMKEVLSRTSGFDISDLFPSKKILHHLSSMKPTLQKLHHKIDVILESVINEHIE  259

Query  948   NLgsgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVC  1127
             NL   KT +GE G ED++DVL+++K+S  L   IT+  IKAI+ DMF G  +TS T+   
Sbjct  260   NLARSKTVNGEFGQEDLIDVLLRIKESGDLQFPITNKTIKAIMFDMFTGGTETSATLVEW  319

Query  1128  AMVEMVKNPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIYR-  1298
             AM EM++NP V++KAQ E+R+ F G  ++EE +++ L YL LVIKET+RLHPP P++   
Sbjct  320   AMSEMIRNPNVMSKAQNEIRKAFLGKEKIEEMDIEGLRYLKLVIKETLRLHPPLPLLVPM  379

Query  1299  ENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYM  1478
             E  K   + GY IP +TRV +NAWAI RDP+YW+DPESFKPERF ++P+DFT  +QF+Y+
Sbjct  380   ECRKQCEIDGYIIPSKTRVFVNAWAIQRDPKYWDDPESFKPERFHNNPVDFT-GTQFEYL  438

Query  1479  PFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIF  1658
             PFG G+R+CPGISFGLA+V  PLA LLY+FDW+LP GI  + L +TE   +    KN + 
Sbjct  439   PFGGGRRICPGISFGLANVEFPLAQLLYNFDWKLPGGINSNGLDMTETCGITAPRKNKLC  498

Query  1659  FI  1664
              +
Sbjct  499   LV  500



>ref|XP_009794007.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=497

 Score =   424 bits (1089),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 227/458 (50%), Positives = 315/458 (69%), Gaps = 14/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ ++G + PH  L +L+K++G  LMHLQLGE+P VVV+S E+AK  LKTHDL FA+
Sbjct  42    IGSMFHMLGGH-PHHVLTNLAKKYGP-LMHLQLGEMPVVVVTSPEMAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+ LA + V Y+ SDI F PYG+YWRQMRK+C+ ELL+A+ VRSFS IRQDE HR+++ 
Sbjct  100   RPKFLATEIVFYNCSDIAFCPYGDYWRQMRKICVIELLTAKNVRSFSAIRQDEVHRMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSS+   + IN+   +  F +S+ CR+AFGK +   +E +  V     +V  F VAD F
Sbjct  160   FRSST--DQQINVTKRICQFTSSMTCRSAFGKVIKEQDEFILLVKRNTALVEGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G+K+R++ V  + D I+ +II E +         +GE G + ++DVL++L
Sbjct  218   PSLKFLHVLSGKKARVMDVHHKIDAILENIINERKE------IATGELGGKGLIDVLLRL  271

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII DMF    +TS+     AMVEM+KNP VLAKAQ EVR+ F+
Sbjct  272   MKEGGLQFPITNDNIKAIIFDMFAAGTETSSVAIDWAMVEMMKNPNVLAKAQTEVRKAFR  331

Query  1200  GR--VEESNVDKLAYLNLVIKETMR-LHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LVIKET R   P   ++ RE  +++ + GYTIP + +V++N W
Sbjct  332   GKETFDENDVEELKYLKLVIKETFRLHPPFPLLLPRECREETDINGYTIPLKAKVMVNVW  391

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW+D E FKPERFE + MDF   + F+Y+PFGSG+R CPGISFGLA+VY PLA
Sbjct  392   AIGRDPKYWDDAEIFKPERFEHNSMDFV-GNNFEYLPFGSGRRNCPGISFGLANVYFPLA  450

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHF+W+LP GI P  L LTE    +   K++++  
Sbjct  451   QLLYHFNWKLPTGINPSELDLTESAGASCARKSNLYLF  488



>ref|XP_006355983.1| PREDICTED: premnaspirodiene oxygenase-like, partial [Solanum 
tuberosum]
Length=514

 Score =   424 bits (1089),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 220/460 (48%), Positives = 323/460 (70%), Gaps = 7/460 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IG+L+ L+ G  +PH   R+L++++G  +M+LQLGE+P V++SS  +A+  L+THDL FA
Sbjct  47    IGSLHHLIIGGQLPHRVFRNLARRYGP-IMYLQLGEIPVVIISSPTIAQEILRTHDLAFA  105

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP+ ++ + + Y++ DI+FS YG+YWRQMRK+C+ ELLS + V+SFS IRQDE   L+ 
Sbjct  106   DRPQFVSTNIIFYNNKDIVFSQYGDYWRQMRKICMVELLSVKMVKSFSGIRQDELSSLIS  165

Query  657   RVRSS-SGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
              + S+  GA   IN+ ++V  F+ S+ CR+AFGK     +E +  + E+L     F VAD
Sbjct  166   SICSTRGGATVLINMSEKVFRFINSVTCRSAFGKICKGKDEFITLMKEVLFFAGGFDVAD  225

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPSWK+LH ++G KSR++   Q+ D IM +II EH  N   GK  +GE G ED+VDVL+
Sbjct  226   LFPSWKLLHNISGVKSRLMNAHQKVDAIMENIINEHIENKAIGKKRNGEFGDEDLVDVLL  285

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++K++  L   IT+D+IKA+I D+F    + S+   + A+ EM++NP V+AKAQ EVR+V
Sbjct  286   RIKENSQLQFPITNDHIKAVITDIFIAGTEASSLTIIWALSEMMRNPNVMAKAQHEVRQV  345

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             FKG+   +E +++KL YL LVIKET+RLH PGP++  RE  +++ + GY IP +TRVL+N
Sbjct  346   FKGKKNYDEKDIEKLTYLKLVIKETLRLHTPGPLMGPRECRENTNIDGYIIPQKTRVLVN  405

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              WA++RDP+YW++P SF PERFE+  +DF   + F+++PFGSG+RMCPGI F LA+V   
Sbjct  406   VWALARDPKYWQNPTSFIPERFENSSIDFM-GNDFEFIPFGSGRRMCPGIQFALANVGFS  464

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+G+ P  L +TE   +    K D++ I
Sbjct  465   LAQLLYHFEWELPNGVNPKDLDMTETHGLTASKKKDLYLI  504



>ref|XP_006355212.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=504

 Score =   423 bits (1088),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 222/458 (48%), Positives = 319/458 (70%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L G  +PH  LRDL+++ G  LM+LQLGEVP VV+SS  +AK  LKTHDL FAT
Sbjct  44    IGSLHHLKG-KLPHHNLRDLARKHGP-LMYLQLGEVPVVVISSPRIAKAVLKTHDLAFAT  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+ +A D V Y S DI F+PYG+YWRQMRKV   ELLS + ++S++ IR+DE  +LL  
Sbjct  102   RPQFMASDIVFYKSRDISFAPYGDYWRQMRKVLTQELLSNKMLKSYNMIRKDELSKLLSS  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R S+G+   +NI +++  F + + CR AFGK  N  +EL+  + EIL +   F V D F
Sbjct  162   IRLSTGSA--VNITEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILALSGGFDVCDLF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+LH ++  K+R+  V  + D+IM +II EH+ N  +G  G+ E G ED++D L+++
Sbjct  220   PSWKLLHNMSNMKARLTNVHHKYDQIMENIINEHKENHAAGIKGNNEFGGEDMIDALLRV  279

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K+++ L   I +DN+KA+ILD+F    +TS T  + A+ EM+K+  V+AKAQAEVR+VFK
Sbjct  280   KENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSEMMKHQNVMAKAQAEVRQVFK  339

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +  ++E+++DKL YL  VIKET+R+HPP P++  RE  + + + GYT+P   RV++NAW
Sbjct  340   EKENLDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEIDGYTVPLNARVMVNAW  399

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+ WEDPESFKPERFE+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA
Sbjct  400   AIGRDPESWEDPESFKPERFENISVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLA  458

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
               LY FDW+LP  +  +    TE  R+    K+D++ I
Sbjct  459   QFLYQFDWKLPDKVNANDFSTTETSRVFAASKDDLYLI  496



>gb|AAD47832.1| cytochrome P450 [Nicotiana tabacum]
Length=499

 Score =   423 bits (1087),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 229/458 (50%), Positives = 311/458 (68%), Gaps = 12/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  ++G  +PH  LRDL+K++G  +MHLQLGEV  VV+SS  +AK  LKTHDL FA 
Sbjct  42    LGSMLHMLG-GLPHHVLRDLAKKYGP-IMHLQLGEVSLVVISSPGMAKEVLKTHDLAFAN  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP ++A     Y+  DI  SPYG YWRQMRK+C+ ELLSA+ V+SF+ IRQDE HR++  
Sbjct  100   RPLLVAAKIFSYNCMDIALSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDEVHRMIKF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSS   G+P+N+   ++ F  S+ CR+AFG+     +E V+ V ++  ++  F VAD F
Sbjct  160   FRSS--PGKPVNVTKRISLFTNSMTCRSAFGQEYKEQDEFVQLVKKVSNLIEGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH LTG K++++    E D I+ +II EH+          GESG E I+ VL++L
Sbjct  218   PSLKFLHVLTGMKAKVMNTHNELDAILENIINEHKKT----SKSDGESGGEGIIGVLLRL  273

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII D+FGG  +TS+T    AMVEM+KNP V +KAQAEVRE+ +
Sbjct  274   MKEGGLQFPITNDNIKAIISDIFGGGTETSSTTINWAMVEMMKNPSVFSKAQAEVREILR  333

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLH-PPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+    E +V++  YL +VIKET RLH P   ++ RE  ++  + GYTIP +T+V++NAW
Sbjct  334   GKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLLPRECREEIDLNGYTIPLKTKVVVNAW  393

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE + MD+   + ++Y+PFGSG+R+CPGISFGLA+VY PLA
Sbjct  394   AMGRDPKYWDDVESFKPERFEHNSMDYI-GNNYEYLPFGSGRRICPGISFGLANVYFPLA  452

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LL HFDW+LP GI P    LTE    A   KND+  I
Sbjct  453   QLLNHFDWKLPTGINPRNCDLTEAAGAACARKNDLHLI  490



>ref|XP_009624010.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=502

 Score =   423 bits (1087),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 223/459 (49%), Positives = 325/459 (71%), Gaps = 11/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  +VG  +PH  LRDL+K++G  LMHL+LGEV  VVV+S E+AK  LKTHDL FA+
Sbjct  42    LGSMLHMVG-GLPHRILRDLAKKYGP-LMHLKLGEVSVVVVTSPEIAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA + V+Y+SSDI F+PYG+YWRQMRK+C+ E+L+ + VRSFS IR+DE  RL++ 
Sbjct  100   RPKLLAAEIVLYNSSDIAFAPYGDYWRQMRKICVLEVLNTKNVRSFSSIRRDEVFRLIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSSS  G+P+N    ++ F + IICR+AFG      +E ++ +  +  ++    VAD F
Sbjct  160   FRSSS--GKPVNFTKRISLFTSFIICRSAFGTVFKEQDEFIQVMKNVTALLEGLDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH LTG++++++ +  + D I+ ++I EH+ NL +    +G+ G ED++DVL++L
Sbjct  218   PSLKFLHVLTGKRAKVMNLHHKVDSIVDNVINEHKKNL-ATGKFNGQLGGEDLIDVLLRL  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII DMF    +T++T    AMVE+++N  V AKAQAEVREVF+
Sbjct  277   MKDGDLQFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVELIRNASVFAKAQAEVREVFR  336

Query  1200  GRVE---ESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINA  1367
              R+E   E++V++L YL LVIKET     P   ++ RE  +++ + G+TIP +++V++N 
Sbjct  337   -RIETFDENDVEELKYLKLVIKETLRLHPPLPLMLPRECREETNINGFTIPLKSKVMVNV  395

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP+YW+D E+FKPERFE   +DFT  + F+Y+PFGSG+R+CPGI FGLA++Y PL
Sbjct  396   WAIGRDPKYWDDAENFKPERFEQSSVDFT-GNNFEYLPFGSGRRICPGILFGLANIYLPL  454

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLY+FDW+LP GI P  L LTE    +   K++++ I
Sbjct  455   AQLLYYFDWKLPTGINPSDLDLTESDGASCARKSNLYLI  493



>gb|EYU21988.1| hypothetical protein MIMGU_mgv1a004711mg [Erythranthe guttata]
Length=513

 Score =   423 bits (1087),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 220/467 (47%), Positives = 317/467 (68%), Gaps = 16/467 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L    +P  + R+LSK++G  LMHL+LG+V  +VVSS E+AK  LK HD  FA 
Sbjct  47    IGDLHHLTA--LPFRSFRELSKKYGP-LMHLKLGQVSTIVVSSPEIAKQMLKEHDPSFAD  103

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RPR +  + + YD ++I FSPYG YWRQMRK+C+ ELLS ++VRSF+ IR+DE   L+D 
Sbjct  104   RPRSVGIEIMWYDYTNIAFSPYGNYWRQMRKICVIELLSPKSVRSFASIRKDEVSGLVDS  163

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R  + +G PIN+ D++ + M+SI CRAAFGK     E L+K + E + M S F ++D F
Sbjct  164   LRRCAASGEPINLTDKIFSLMSSITCRAAFGKVSKDNEALIKLLKEGIEMASGFEISDLF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesg---------se  992
             P  KI++ L+  + +++K+R++ DEI+  II EH+ NL    T + ES          +E
Sbjct  224   PGSKIINALSKGRFKLLKMRRKLDEILDSIIDEHKANLAKMATENAESAVKRGNGDDGNE  283

Query  993   DIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKA  1172
             D+VDV ++++++  L   I ++NIKA++ DMF    DTS+T     M E+++NPRV+AKA
Sbjct  284   DLVDVFLRIQENGELEFPIGNNNIKAVLQDMFSAGTDTSSTAIEWTMTELMRNPRVMAKA  343

Query  1173  QAEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPR  1346
             QAEVRE FK    ++E N   L YL +VIKE++RLHPP P++ R + +++VV GYTIP  
Sbjct  344   QAEVREAFKETEPIDEGNTQHLKYLKMVIKESLRLHPPVPLLPRASREETVVNGYTIPAN  403

Query  1347  TRVLINAWAISRDPQYWEDPESFKPERFE-DDPMDFTRSSQFKYMPFGSGKRMCPGISFG  1523
              +VL+N WAI RDP++WE+P+SF+PERFE  +  DF     F+Y+PFGSGKRMCPGI+F 
Sbjct  404   VKVLVNNWAIQRDPKHWENPDSFEPERFEKKNSRDFL-GGDFEYLPFGSGKRMCPGITFS  462

Query  1524  LASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LASV   LA LLY F+W+LP G+ P  + LTE P +    K +++ +
Sbjct  463   LASVELFLAQLLYSFNWKLPDGVNPGNMDLTENPGITAQRKENLYVV  509



>ref|XP_009624011.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=458

 Score =   421 bits (1082),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 222/456 (49%), Positives = 322/456 (71%), Gaps = 11/456 (2%)
 Frame = +3

Query  309   LYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFATRPR  488
             +  +VG  +PH  LRDL+K++G  LMHL+LGEV  VVV+S E+AK  LKTHDL FA+RP+
Sbjct  1     MLHMVG-GLPHRVLRDLAKKYGP-LMHLKLGEVSVVVVTSPEIAKEVLKTHDLAFASRPK  58

Query  489   VLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDRVRS  668
             +LA + V+Y+SSDI F+PYG+YWRQMRK+C+ E+L+ + VRSFS IR+DE  RL++  RS
Sbjct  59    LLAAEIVLYNSSDIAFAPYGDYWRQMRKICVLEVLNTKNVRSFSSIRRDEVFRLIEFFRS  118

Query  669   SSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTFPSW  848
             SS  G+P+N    ++ F + IICR+AFG      +E ++ +  +  ++    VAD FPS 
Sbjct  119   SS--GKPVNFTKRISLFTSFIICRSAFGTVFKEQDEFIQVMKNVTALLEGLDVADIFPSL  176

Query  849   KILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKLKDS  1028
             K LH LTG++++++ +  + D I+ ++I EH+ NL +    +G+ G ED++DVL++L   
Sbjct  177   KFLHVLTGKRAKVMNLHHKVDSIVDNVINEHKKNL-ATGKFNGQLGGEDLIDVLLRLMKD  235

Query  1029  DSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV  1208
               L   IT+DNIKAII DMF    +T++T    AMVE+++N  V AKAQAEVREVF+ R+
Sbjct  236   GDLQFPITNDNIKAIIYDMFAAGTETTSTTIDWAMVELIRNASVFAKAQAEVREVFR-RI  294

Query  1209  E---ESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWAI  1376
             E   E++V++L YL LVIKET     P   ++ RE  +++ + G+TIP +++V++N WAI
Sbjct  295   ETFDENDVEELKYLKLVIKETLRLHPPLPLMLPRECREETNINGFTIPLKSKVMVNVWAI  354

Query  1377  SRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHL  1556
              RDP+YW+D E+FKPERFE   +DFT  + F+Y+PFGSG+R+CPGI FGLA++Y PLA L
Sbjct  355   GRDPKYWDDAENFKPERFEQSSVDFT-GNNFEYLPFGSGRRICPGILFGLANIYLPLAQL  413

Query  1557  LYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LY+FDW+LP GI P  L LTE    +   K++++ I
Sbjct  414   LYYFDWKLPTGINPSDLDLTESDGASCARKSNLYLI  449



>ref|XP_003516583.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=506

 Score =   422 bits (1085),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 216/460 (47%), Positives = 323/460 (70%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L +  ++PH TLRDL+ ++G  LMHLQLGE+ +VVVSS  +AK  +KTHDL F 
Sbjct  46    IGNLHQLAMAGSLPHRTLRDLALKYGP-LMHLQLGEISSVVVSSPNMAKEIMKTHDLAFV  104

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP+ L    + Y  SDI F+PYG+YWRQM+K+C++ELLSA+ V+SFS IR+DE+ + ++
Sbjct  105   QRPQFLPAQILTYGQSDIAFAPYGDYWRQMKKICVSELLSAKRVQSFSDIREDETAKFIE  164

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              VR+S G+  P+N+ +++ + ++S I R AFG      EE V  V E++++ + F + D 
Sbjct  165   SVRTSEGS--PVNLTNKIYSLVSSAISRVAFGNKCKDQEEFVSLVKELVVVGAGFELDDL  222

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsge-sgseDIVDVLI  1013
             FPS K LH + G K+++ K++++ D+I+ +I+KEH+      +         ED+VDVL+
Sbjct  223   FPSMK-LHLINGRKAKLEKMQEQVDKIVDNILKEHQEKRERARREGRVDLEEEDLVDVLL  281

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++ SD+L + IT  NIKAIILD+F    DTS +    AM EM++NPRV  KAQAEVR+ 
Sbjct  282   RIQQSDNLEIKITTTNIKAIILDVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQA  341

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F+    + E++V++L YL LVIKET+RLH P P++  RE +K +++ GY IP +T+V+IN
Sbjct  342   FRELKIINETDVEELIYLKLVIKETLRLHTPSPLLLPRECSKRTIIDGYEIPVKTKVMIN  401

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI+RDPQYW D E F PERF+   +DF + + F+Y+PFG+G+RMCPG++ GLA++  P
Sbjct  402   AWAIARDPQYWTDAERFVPERFDGSSIDF-KGNNFEYLPFGAGRRMCPGMTLGLANIMLP  460

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + P  + + E   + +G KN++  I
Sbjct  461   LALLLYHFNWELPNEMKPEYMDMVENFGLTVGRKNELCLI  500



>ref|XP_004511998.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   422 bits (1084),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 217/460 (47%), Positives = 323/460 (70%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L +   +PH  L++LS ++G  LMHLQLGE+  V+VSS ++AK  +KTHD+ FA
Sbjct  44    IGNLHQLAMSKKLPHYALKELSHKYGP-LMHLQLGEISTVIVSSPKLAKEVMKTHDVAFA  102

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP++L+ + + Y S DI+FSPYG+YWRQMRK+C+ ELL+A+ V+SFSYIR+DE+++ + 
Sbjct  103   NRPKLLSPEIMAYGSKDIVFSPYGDYWRQMRKICVLELLNAKRVQSFSYIREDETNKFIK  162

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              ++SS      IN+   + + ++S I RAAFG      +E V  V +++ +   F V D 
Sbjct  163   SIQSSIDTT--INLTSRILSMVSSTISRAAFGDKSKDQDEFVDLVRKVVELSGGFDVDDL  220

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgs-gktgsgesgseDIVDVLI  1013
             FPS K LH +TG + ++ K+ +  D IMG+I+++H  N G   +  + +  +ED+VDVL+
Sbjct  221   FPSMKFLHVITGMRPKLEKIHKRADTIMGNIVRQHEENRGRPKEDNNIDVQNEDLVDVLL  280

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++ S SL + IT +NIKA+I D+F    DT+ TI    M E++KNP V  KAQAE+R+V
Sbjct  281   RVQQSGSLDVQITTNNIKAVIWDVFVAGTDTTATIIEWTMSELMKNPSVREKAQAELRKV  340

Query  1194  FKGRVEESNVD--KLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
              +G+ + S +D  +L YLNLVIKETMRLHPP P++  RE ++ +++ GY IP  T+V+IN
Sbjct  341   LRGKEKISEIDLHELTYLNLVIKETMRLHPPSPLLVPRECSESTIIGGYEIPKNTKVMIN  400

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWA++RDP+YW D E F PERF+   +DF + + F+Y+PFG+G+RMCPG+SFGLAS+  P
Sbjct  401   AWALARDPEYWSDAERFIPERFDGSFIDF-KGNNFEYIPFGAGRRMCPGMSFGLASIMLP  459

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + PH   + E   +A+G KN++  I
Sbjct  460   LALLLYHFNWELPNHMKPHDFDMIEHFGLAVGRKNELSLI  499



>ref|XP_004242036.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   421 bits (1083),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 223/458 (49%), Positives = 321/458 (70%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL+ L+G  +PH  LRDLS+++G  +M+LQLG+VP VV++S  +A+  LKTHDL FA 
Sbjct  39    IGNLHHLIGGGLPHRVLRDLSQRYGP-IMYLQLGQVPTVVITSPTIAQEILKTHDLAFAD  97

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++++ + + Y++ D+ FS YG+YWRQMRK+CI ELLS + V+SFS IRQDE   L+  
Sbjct  98    RPQLVSTNIIFYNNKDVAFSQYGDYWRQMRKICIVELLSTKMVKSFSGIRQDELSSLISS  157

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RS+ G    IN+ ++V  F   + CR+AFGK      E V  + +IL+    F +AD F
Sbjct  158   IRSTRGT--TINMTEKVFQFTNCVTCRSAFGKICKDRNEFVALLKKILVFAGGFDLADLF  215

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+LH ++G KSR+VK  Q+ D IM +II EH  N  +GK G+GE G ED+VDV +++
Sbjct  216   PSWKLLHNISGVKSRLVKAHQKIDAIMENIINEHIENKVAGKKGNGEFGDEDLVDVFLRV  275

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K++  L   IT ++IKA+I D+F    +TS+   + A+ E++KNP V+AKAQ+EVR+V K
Sbjct  276   KENAELQFPITKEHIKAVISDIFIAGTETSSATIIWALSELMKNPNVMAKAQSEVRQVLK  335

Query  1200  GRVE--ESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G+    E +++KL YL LVIKET+RLH P P+I  RE  + + + GYTIP   RVL+NAW
Sbjct  336   GKKNYGEEDIEKLTYLKLVIKETLRLHTPVPLIGPRECREKTNIDGYTIPHNARVLVNAW  395

Query  1371  AISRDPQYWE-DPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             A++RDP+ W+ +PESF PERFE+  +DF   + F+++PFG+G+R+CPGI FGLA+V  PL
Sbjct  396   ALARDPKNWDKNPESFIPERFENSSIDFM-GNHFEFIPFGAGRRICPGIQFGLANVALPL  454

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFF  1661
             A LLYHF+WELP+G+ P  L ++E   +      D++ 
Sbjct  455   AQLLYHFEWELPYGVNPKDLDMSETHGLTASKAKDLYL  492



>ref|XP_004228510.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   421 bits (1083),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 225/458 (49%), Positives = 327/458 (71%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G+++ ++G  +PH  LRDL+K++G  ++HLQLGEV  VVV+S  +AK  LKTHDL FA+
Sbjct  43    VGSMFHMIG-GLPHRVLRDLAKKYG-SILHLQLGEVSLVVVTSPIMAKQVLKTHDLAFAS  100

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RPR+LA + V+Y+ +DI F PYG+YWRQMRK+C+ E+LS + VRSF  IRQDE+ RL++ 
Sbjct  101   RPRLLAAEIVLYNCTDIAFCPYGDYWRQMRKICVLEVLSGKNVRSFGSIRQDETIRLVEF  160

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSSS +  P+N+   ++ F + IICR+AFG      +E ++ +  +  ++  F+VAD F
Sbjct  161   FRSSS-SSEPVNVTKRISLFTSFIICRSAFGTIFKEQDEFIQVMKGVTSLLEGFNVADIF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G KS+ + +  + D I+ ++I EH+ NL      +GE G ED++DVL++L
Sbjct  220   PSLKFLHVLSGMKSKTMYLHHKVDTIVENVINEHKKNL-VNGKTNGELGGEDLIDVLLRL  278

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +   L   IT+DNIKAI+ DMF    +T++T    AMVEM+KN  +L KAQ EVREVF+
Sbjct  279   MEDGDLQFPITNDNIKAIVYDMFAAGTETTSTTIDWAMVEMIKNSSILVKAQKEVREVFR  338

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LV+KET+RLHPP P++     ++ V + GYTIP +T++++N W
Sbjct  339   GKDTFDENDVEELKYLKLVVKETLRLHPPLPLMLPRECREEVDIDGYTIPSKTKLIVNVW  398

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW+D ESFKPERFE   +DF   + F+++PFGSG+R+CPGISFGLA+VY PLA
Sbjct  399   AIGRDPKYWDDAESFKPERFEQSSLDFV-GNNFEFLPFGSGRRICPGISFGLANVYLPLA  457

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             +LLYHFDW+LP GI P  L +TE    +   K++++ I
Sbjct  458   NLLYHFDWKLPPGIKPSDLDMTESDGASCTRKSNLYLI  495



>ref|XP_009622900.1| PREDICTED: cytochrome P450 71D7-like [Nicotiana tomentosiformis]
 gb|ABC69401.1| CYP71D49v2 [Nicotiana tabacum]
Length=505

 Score =   421 bits (1082),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 222/458 (48%), Positives = 319/458 (70%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L G  +PH  LRDL++++G  LM+LQLGEVP VV+SS  +AK  LKTHDL FAT
Sbjct  44    IGSLHHLKG-KLPHHHLRDLARKYGP-LMYLQLGEVPVVVISSPRIAKAVLKTHDLAFAT  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RPR ++ D V Y S DI F+PYG+YWRQMRK+   ELLS + ++SFS IR+DE  +LL  
Sbjct  102   RPRFMSSDIVFYKSRDISFAPYGDYWRQMRKILTQELLSNKMLKSFSTIRKDELSKLLSS  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R ++ A   +NI +++  F + + CR AFGK  N  +EL+  + EIL +   F V D F
Sbjct  162   IRLAT-ASSAVNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILALSGGFDVCDLF  220

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+LH ++  K+R+  V  + + IM +II EH+ N  +G  G+ E G ED++D L+++
Sbjct  221   PSWKLLHNMSNMKARLTNVHHKYNLIMENIINEHKENHAAGIKGNNEFGGEDMIDALLRV  280

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K+++ L   I +DN+KA+ILD+F    +TS T  + A+ E++K+P V+AKAQAEVR+VFK
Sbjct  281   KENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFK  340

Query  1200  --GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
                 ++E+++DKL YL  VIKET+R+HPP P++  RE  + + + GYT+P + RV++NAW
Sbjct  341   ENENLDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEIDGYTVPLKARVMVNAW  400

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+ WEDPESFKPERFE+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA
Sbjct  401   AIGRDPESWEDPESFKPERFENISVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLA  459

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLY FDW+ PH +       TE  R+    K+D++ I
Sbjct  460   QLLYFFDWKFPHKVNAADFHTTETSRVFAASKDDLYLI  497



>ref|XP_009619866.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=499

 Score =   421 bits (1081),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 230/458 (50%), Positives = 313/458 (68%), Gaps = 12/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G++  L+G + PH  LRDL+K++G  LMHLQLGEV  VVV+S E+AK  LKTHDL FA+
Sbjct  42    LGSMLHLLGGH-PHHVLRDLAKKYG-PLMHLQLGEVSLVVVTSPEMAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP ++A   V Y+ +DI+FSPYG YWRQMRK+C+ ELLSA+ V+SF+ IRQDE HR+++ 
Sbjct  100   RPLLVAAKIVCYNGTDIVFSPYGNYWRQMRKICLLELLSAKNVKSFNSIRQDEVHRMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSS   G+P+N+      F +S+ CR+AFG+     +E V+ V ++  ++  F VA+ F
Sbjct  160   FRSS--PGKPVNVTKRFALFTSSMTCRSAFGQEHKEQDEFVRLVKKVSNLMEGFDVANIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS   LH LTG K++++ V  E DEI+ +II EH+           ESG E IVDVL++L
Sbjct  218   PSLNFLHVLTGMKAKVMNVHHELDEILENIITEHKK----VAKTICESGGEGIVDVLLRL  273

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAI+ DMF    +TS+T    AMVEM+K P V AKAQAEVR++ +
Sbjct  274   MKEGGLQFPITNDNIKAIVFDMFAAGTETSSTTINWAMVEMMKKPSVFAKAQAEVRKILR  333

Query  1200  GR--VEESNVDKLAYLNLVIKETMR-LHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+    E +V++  YL +VIKET R   P   +I R+  +++ + GYTIP +T V++N W
Sbjct  334   GKETFGEIDVEEFKYLKMVIKETFRLHPPLPLLIPRKCREETDLNGYTIPLKTTVVVNVW  393

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERFE++ MD+   + F+Y+PFGSG+R+ PGISFGLA+VY PLA
Sbjct  394   AMGRDPKYWDDVESFKPERFENNSMDYI-GNNFEYLPFGSGRRIYPGISFGLANVYFPLA  452

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFD +LP GI P  L LTE    A   KND+  I
Sbjct  453   QLLYHFDGKLPSGINPSALDLTEATGAACARKNDLHLI  490



>ref|XP_011081934.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=501

 Score =   421 bits (1082),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 229/481 (48%), Positives = 330/481 (69%), Gaps = 16/481 (3%)
 Frame = +3

Query  237   RQWMKPKSgrklpp---gprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGev  407
             R WMKPKS RK       P +LP+IG+L+ LVG  +PH  LR +++++G  +++L+LGEV
Sbjct  24    RAWMKPKSPRKYEKLPPSPPQLPVIGHLHHLVG-GLPHHALRRVAQKYGP-VLYLKLGEV  81

Query  408   pavvvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITE  587
              AVV+SS E  K  +K  D   A RP  +    + YD +DI FS Y EYWRQMRK+CI E
Sbjct  82    SAVVISSREATKEVVKVQDPACADRPESIGSKIMWYDYTDIAFSAYNEYWRQMRKICILE  141

Query  588   LLSARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNR  767
             LLSA+ V+SF  IRQDE  RL+  ++SSSG  + IN+ ++V  F +SI CRAAFGK +  
Sbjct  142   LLSAKNVKSFGSIRQDEVSRLMKSLQSSSG--QAINLTEKVFAFTSSITCRAAFGKVMRD  199

Query  768   TEELVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRN  947
              + L+  + + + M   F +AD FPS K+LH L+  K +++++R++ D I+  I++EH+ 
Sbjct  200   RDVLIAMLKKAVTMAGGFELADLFPSSKLLHVLSWNKYKLLRMRRKLDTILDAILEEHK-  258

Query  948   NLgsgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVC  1127
                     SGE G EDIVDVL++++ +  L   IT+DN+KA+I DMF    +TS+T    
Sbjct  259   -----LKQSGEFGGEDIVDVLLRMQKTGELQFPITNDNVKAVIFDMFSAGTETSSTTIDW  313

Query  1128  AMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRE  1301
             AM E+++NPRV+AK QAEVRE FKG+  VEES+V  L YL LVIKET RLHPP P++ R 
Sbjct  314   AMAELMRNPRVMAKVQAEVREAFKGKTTVEESDVQALKYLKLVIKETFRLHPPIPLLPRA  373

Query  1302  NNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMP  1481
                +  V GYTIP +++V+IN WA+ RDP YW+ P++F+PERF+++ +DF   + F+Y+P
Sbjct  374   CRDECKVNGYTIPLKSKVMINIWAMGRDPAYWDQPDTFQPERFDNNSIDFL-GNNFEYIP  432

Query  1482  FGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFF  1661
             FG+G+R+CPG++FGLA+V  PLA LLYHFDW++P G+TP  + +TE   +A+  +N +  
Sbjct  433   FGAGRRICPGMNFGLANVELPLAQLLYHFDWKMPKGMTPDDIDMTEAEGIAVSRRNALLL  492

Query  1662  I  1664
             +
Sbjct  493   V  493



>ref|XP_009587552.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=512

 Score =   421 bits (1081),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 217/457 (47%), Positives = 319/457 (70%), Gaps = 8/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L+G + PH   RDL++++G  +M+L+LGEVP V++SS   AK  LKTHDL FA 
Sbjct  51    IGSLHHLIGAH-PHRIFRDLARKYGP-VMYLELGEVPTVIISSPSAAKETLKTHDLAFAN  108

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+  +   VMY++ DI FS YG+YW+QMRK+CI ELLSAR V+SFS IR+DE   LL  
Sbjct  109   RPQFTSTYIVMYNNKDIAFSEYGDYWKQMRKICIMELLSARMVKSFSSIRKDEISNLLSS  168

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             V S  G    +N+ +++  +   + CR  FGK     E L+  + ++L++     V D F
Sbjct  169   VHSVKGTSE-VNMTEKIVRYACFVTCRLVFGKLGKDREVLIDLMKKMLLLAGG-DVCDLF  226

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+L+ +TG KSR+VK+ Q  D ++ +I+ EH  +  +G  G+GE G ED+VDV +++
Sbjct  227   PSWKLLYKMTGAKSRLVKMHQVVDSVLENIVNEHIRSRAAGNKGNGEYGGEDLVDVFLRI  286

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             +++D L   IT+D+IKA+I DMF    +TS+T  V A+ E++KNP V+AKAQ+EVR+ FK
Sbjct  287   QENDQLQFPITNDHIKAVIFDMFTAGTETSSTAIVWALSELMKNPNVMAKAQSEVRQAFK  346

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
             G+   +E ++D L YL LV+KET+RLH PG +++R+  + + + GYTIP R  VL+N WA
Sbjct  347   GKSSFDEEDLDNLPYLMLVVKETLRLHAPG-ILHRQCREQTCIDGYTIPSRATVLVNTWA  405

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             I RDP+ W DPESF PERFE+  +D+   + F+++PFGSGKR+CPG+ FGLA+   PLA 
Sbjct  406   IGRDPEVWHDPESFIPERFENSSIDYM-GNHFEFIPFGSGKRICPGMQFGLANFRYPLAR  464

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHF+WELP+G +P  L ++++P M++  + D++ I
Sbjct  465   LLYHFNWELPYGTSPKDLDMSQIPGMSVAKEKDLYLI  501



>gb|ABC69399.1| CYP71D49v1 [Nicotiana tabacum]
Length=505

 Score =   421 bits (1081),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 222/458 (48%), Positives = 319/458 (70%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L G  +PH  LRDL++++G  LM+LQLGEVP VV+SS  +AK  LKTHDL FAT
Sbjct  44    IGSLHHLKG-KLPHHHLRDLARKYGP-LMYLQLGEVPVVVISSPRIAKAVLKTHDLAFAT  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RPR ++ D V Y S DI F+PYG+YWRQMRK+   ELLS + ++SFS IR+DE  +LL  
Sbjct  102   RPRFMSSDIVFYKSRDISFAPYGDYWRQMRKILTQELLSNKMLKSFSTIRKDELSKLLSS  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R ++ A   +NI +++  F + + CR AFGK  N  +EL+  + EIL +   F V D F
Sbjct  162   IRLAT-ASSAVNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILALSGGFDVCDLF  220

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+LH ++  K+R+  V  + + IM +II EH+ N  +G  G+ E G ED++D L+++
Sbjct  221   PSWKLLHNMSNMKARLTNVHHKYNLIMENIINEHKENHAAGIKGNNEFGGEDMIDALLRV  280

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K+++ L   I +DN+KA+ILD+F    +TS T  + A+ E++K+P V+AKAQAEVR+VFK
Sbjct  281   KENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFK  340

Query  1200  --GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
                 ++E+++DKL YL  VIKET+R+HPP P++  RE  + + + GYT+P + RV++NAW
Sbjct  341   ENENLDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEIDGYTVPLKARVMVNAW  400

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+ WEDPESFKPERFE+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA
Sbjct  401   AIGRDPESWEDPESFKPERFENISVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLA  459

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLY FDW+ PH +       TE  R+    K+D++ I
Sbjct  460   QLLYLFDWKFPHKVNAADFHTTETSRVFAASKDDLYLI  497



>ref|XP_003611886.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94844.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=505

 Score =   420 bits (1080),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 221/460 (48%), Positives = 324/460 (70%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL +L +    PH  L +LS ++G  LMH+QLGE+  V+VSS ++AK  +KTHD  FA
Sbjct  44    IGNLPQLAMSKKRPHHALHELSHKYGP-LMHIQLGEISTVIVSSPKLAKEIMKTHDAAFA  102

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP++L+ + + Y S DI+FSPYG++WRQMRK+C+ ELLSA+ V+SFSYIR+DE+ +L+ 
Sbjct  103   NRPKLLSPEIMAYGSKDIVFSPYGDFWRQMRKICVFELLSAKRVQSFSYIREDETKKLIQ  162

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              ++SS+G+   IN+   + + ++S I RAAFG      +E V  V +++ M S F V D 
Sbjct  163   SIQSSTGST--INLTSRIFSMVSSNISRAAFGDKSKDQDEFVDLVRKVVEMSSGFGVDDL  220

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgkt-gsgesgseDIVDVLI  1013
             FPS K LH L+G K ++ K+ +  D+I+ +II++H+      K   + E  +ED++DVL+
Sbjct  221   FPSIKPLHILSGMKPKLEKIHKRVDKIIENIIRQHQEKRERAKEDDNNEVDNEDLLDVLL  280

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++ SD+L + IT +NIKA+I D+F    DT++T    AM EM+KNP V  KAQAE+RE 
Sbjct  281   RVQQSDNLDIKITTNNIKAVIWDVFVAGTDTTSTTIEWAMSEMMKNPSVREKAQAELREA  340

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             FKG+  + ES++++L Y  LVIKETMRLHPP P++  RE  + +++ GY IP  T+V+IN
Sbjct  341   FKGKKIISESDLNELTYFKLVIKETMRLHPPSPLLVPRECTELTIIDGYEIPKNTKVMIN  400

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWA++RDPQYW D E F PERF+   +DF + + F+Y+PFG+G+RMCPG+SFG+ASV  P
Sbjct  401   AWAVARDPQYWTDAEMFIPERFDGSLIDF-KGNNFEYIPFGAGRRMCPGMSFGIASVMLP  459

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + P  L +TE   +A+G +N++  I
Sbjct  460   LALLLYHFNWELPNQMKPEDLDMTENVGLAVGRENELCLI  499



>ref|XP_009612417.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   419 bits (1078),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 222/443 (50%), Positives = 309/443 (70%), Gaps = 14/443 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G+++ ++G + PH  L +L+K++G  L+HLQLGE+  VVV+S E+AK  LKTHDL FA+
Sbjct  42    LGSMFHMLGGH-PHHVLTNLAKKYGP-LVHLQLGEMSVVVVTSPEMAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+ LA + V Y+ SDI F PYG+YWRQMRK+C+ ELL+A+ VRSFS IR+DE HR+++ 
Sbjct  100   RPKFLASEIVFYNCSDIAFCPYGDYWRQMRKICMIELLTAKNVRSFSSIRRDEVHRMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSS    + +N+   +  F +S+ CR+AFGK     +E +  V     ++  F VAD F
Sbjct  160   FRSS--IDQQVNVTKRIYQFTSSMTCRSAFGKVFKEQDEFILLVKRNTALMEGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G+K+R++ V  + D I+ +II E +         +GE G + ++DVL++L
Sbjct  218   PSKKFLHVLSGKKARVMDVHHKIDAILENIINERKK------IATGEVGGKGLIDVLLRL  271

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII DMF    +TS+     AMVEM+KNP VLAKAQAEVR+ F+
Sbjct  272   MKEGGLQFPITNDNIKAIIFDMFAAGTETSSVTIDWAMVEMMKNPSVLAKAQAEVRKAFR  331

Query  1200  GR--VEESNVDKLAYLNLVIKETMR-LHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LVIKE  R   P   ++ RE  +++ + GYTIP + +V++N W
Sbjct  332   GKETFDENDVEELNYLKLVIKEAFRLHPPFPLLLPRECREETDINGYTIPLKAKVMVNVW  391

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW+D ESFKPERFE + MDF   + F+Y+PFGSG+R CPGISFGLA+VY PLA
Sbjct  392   AIGRDPKYWDDAESFKPERFEHNSMDFV-GNNFEYLPFGSGRRNCPGISFGLANVYYPLA  450

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
              LLYHFDW+LP+GI P+ L LTE
Sbjct  451   QLLYHFDWKLPNGINPNELDLTE  473



>gb|ABC69398.1| CYP71D5v3 [Nicotiana tabacum]
Length=504

 Score =   419 bits (1078),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 220/458 (48%), Positives = 318/458 (69%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L G  +PH  LRDL++++G  LM+LQLGE+P VV+SS  VAK  LKTHDL FAT
Sbjct  44    IGSLHHLKG-KLPHHNLRDLARKYGP-LMYLQLGEIPVVVISSPRVAKAVLKTHDLAFAT  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RPR ++ D V Y S DI F+P+G+YWRQMRK+   ELLS + ++S+S IR+DE  +LL  
Sbjct  102   RPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIRKDELSKLLSS  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R  +G+   +NI +++  F + + CR AFGK  N  +EL+  + EIL +   F V D F
Sbjct  162   IRLETGSA--VNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILTLSGGFDVGDLF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+LH ++  K+R+  V  + D +M +II EH+ N  +G  G+ E G ED++D L++ 
Sbjct  220   PSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFGGEDMIDALLRA  279

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K+++ L   I +DN+KA+ILD+F    +TS T  + A+ E++K+P V+AKAQAEVR+VFK
Sbjct  280   KENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFK  339

Query  1200  --GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
                  +E+++DKL YL  VIKET+R+HPP P++  RE    + + GYT+P + RV++NAW
Sbjct  340   ENENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECRDQTEIDGYTVPIKARVMVNAW  399

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+ WEDPESFKPERFE+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA
Sbjct  400   AIGRDPESWEDPESFKPERFENTSVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLA  458

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLY FDW+LP  +  +  + TE  R+    K+D++ I
Sbjct  459   QLLYCFDWKLPDKVNANDFRTTETSRVFAASKDDLYLI  496



>ref|XP_009764618.1| PREDICTED: cytochrome P450 71D7-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009764619.1| PREDICTED: cytochrome P450 71D7-like isoform X2 [Nicotiana sylvestris]
Length=504

 Score =   419 bits (1078),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 220/458 (48%), Positives = 318/458 (69%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L G  +PH  LRDL++++G  LM+LQLGE+P VV+SS  VAK  LKTHDL FAT
Sbjct  44    IGSLHHLKG-KLPHHNLRDLARKYGP-LMYLQLGEIPVVVISSPRVAKAVLKTHDLAFAT  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RPR ++ D V Y S DI F+P+G+YWRQMRK+   ELLS + ++S+S IR+DE  +LL  
Sbjct  102   RPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIRKDELSKLLSS  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R  +G+   +NI +++  F + + CR AFGK  N  +EL+  + EIL +   F V D F
Sbjct  162   IRLETGSA--VNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILTLSGGFDVGDLF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+LH ++  K+R+  V  + D +M +II EH+ N  +G  G+ E G ED++D L++ 
Sbjct  220   PSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFGGEDMIDALLRA  279

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K+++ L   I +DN+KA+ILD+F    +TS T  + A+ E++K+P V+AKAQAEVR+VFK
Sbjct  280   KENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFK  339

Query  1200  --GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
                  +E+++DKL YL  VIKET+R+HPP P++  RE    + + GYT+P + RV++NAW
Sbjct  340   ENENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECRDQTEIDGYTVPIKARVMVNAW  399

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+ WEDPESFKPERFE+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA
Sbjct  400   AIGRDPESWEDPESFKPERFENTSVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLA  458

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLY FDW+LP  +  +  + TE  R+    K+D++ I
Sbjct  459   QLLYCFDWKLPDKVNANDFRTTETSRVFAASKDDLYLI  496



>gb|ABC69402.1| CYP71D5v2 [Nicotiana tabacum]
Length=504

 Score =   419 bits (1078),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 220/458 (48%), Positives = 318/458 (69%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L G  +PH  LRDL++++G  LM+LQLGE+P VV+SS  VAK  LKTHDL FAT
Sbjct  44    IGSLHHLKG-KLPHHNLRDLARKYGP-LMYLQLGEIPVVVISSPRVAKAVLKTHDLAFAT  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RPR ++ D V Y S DI F+P+G+YWRQMRK+   ELLS + ++S+S IR+DE  +LL  
Sbjct  102   RPRFMSSDIVFYKSRDISFAPFGDYWRQMRKILTQELLSNKMLKSYSLIRKDELSKLLSS  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R  +G+   +NI +++  F + + CR AFGK  N  +EL+  + EIL +   F V D F
Sbjct  162   IRLETGSA--VNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILTLSGGFDVGDLF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+LH ++  K+R+  V  + D +M +II EH+ N  +G  G+ E G ED++D L++ 
Sbjct  220   PSWKLLHNMSNMKARLTNVHHKYDLVMENIINEHQENHAAGIKGNNEFGGEDMIDALLRA  279

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K+++ L   I +DN+KA+ILD+F    +TS T  + A+ E++K+P V+AKAQAEVR+VFK
Sbjct  280   KENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFK  339

Query  1200  --GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
                  +E+++DKL YL  VIKET+R+HPP P++  RE    + + GYT+P + RV++NAW
Sbjct  340   ENENFDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECRDQTEIDGYTVPIKARVMVNAW  399

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+ WEDPESFKPERFE+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA
Sbjct  400   AIGRDPESWEDPESFKPERFENTSVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLA  458

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLY FDW+LP  +  +  + TE  R+    K+D++ I
Sbjct  459   QLLYCFDWKLPDKVNANDFRTTETSRVFAASKDDLYLI  496



>gb|KHN36162.1| Cytochrome P450 71D8 [Glycine soja]
Length=453

 Score =   417 bits (1073),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 211/449 (47%), Positives = 315/449 (70%), Gaps = 9/449 (2%)
 Frame = +3

Query  330   NVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFATRPRVLACDEV  509
             ++PH TLRDL+ ++G  LMHLQLGE+ +VVVSS  +AK  +KTHDL F  RP+ L    +
Sbjct  4     SLPHRTLRDLALKYGP-LMHLQLGEISSVVVSSPNMAKEIMKTHDLAFVQRPQFLPAQIL  62

Query  510   MYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDRVRSSSGAGRP  689
              Y  SDI F+PYG+YWRQM+K+C++ELLSA+ V+SFS IR+DE+ + ++ VR+S G+  P
Sbjct  63    TYGQSDIAFAPYGDYWRQMKKICVSELLSAKRVQSFSDIREDETAKFIESVRTSEGS--P  120

Query  690   INIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTFPSWKILHFLT  869
             +N+ +++ + ++S I R AFG      EE V  V E++++ + F + D FPS K LH + 
Sbjct  121   VNLTNKIYSLVSSAISRVAFGNKCKDQEEFVSLVKELVVVGAGFELDDLFPSMK-LHLIN  179

Query  870   GEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsge-sgseDIVDVLIKLKDSDSLPMS  1046
             G K+++ K++++ D+I+ +I+KEH+      +         ED+VDVL++++ SD+L + 
Sbjct  180   GRKAKLEKMQEQVDKIVDNILKEHQEKRERARREGRVDLEEEDLVDVLLRIQQSDNLEIK  239

Query  1047  ITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESN  1220
             IT  NIKAIILD+F    DTS +    AM EM++NPRV  KAQAEVR+ F+    + E++
Sbjct  240   ITTTNIKAIILDVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKIINETD  299

Query  1221  VDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYW  1397
             V++L YL LVIKET+RLH P P++  RE +K +++ GY IP +T+V+INAWAI+RDPQYW
Sbjct  300   VEELIYLKLVIKETLRLHTPSPLLLPRECSKRTIIDGYEIPVKTKVMINAWAIARDPQYW  359

Query  1398  EDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWE  1577
              D E F PERF+   +DF + + F+Y+PFG+G+RMCPG++ GLA++  PLA LLYHF+WE
Sbjct  360   TDAERFVPERFDGSSIDF-KGNNFEYLPFGAGRRMCPGMTLGLANIMLPLALLLYHFNWE  418

Query  1578  LPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LP+ + P  + + E   + +G KN++  I
Sbjct  419   LPNEMKPEYMDMVENFGLTVGRKNELCLI  447



>gb|AJD25162.1| cytochrome P450 CYP71D374 [Salvia miltiorrhiza]
Length=502

 Score =   419 bits (1077),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 232/481 (48%), Positives = 324/481 (67%), Gaps = 16/481 (3%)
 Frame = +3

Query  237   RQWMKPKSgrklpp---gprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGev  407
             + W KPKS +        P KLP+IG+++ LVG ++PH  L+  +++ G  +MHLQLGEV
Sbjct  25    KAWTKPKSPKAHQNLPPSPPKLPVIGHIHLLVG-DLPHKALQRQAQKHGP-VMHLQLGEV  82

Query  408   pavvvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITE  587
             PAVV+SS E  +  LK  D   A RP  +A   + YD +DI FS Y EYWRQMRK+CI E
Sbjct  83    PAVVISSREATREVLKVQDPACADRPESIASKILWYDYTDIAFSAYNEYWRQMRKICIVE  142

Query  588   LLSARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNR  767
             LLS++ V+SF +IR+DES RL+  +  SSG    I++ D++ TF ++I CRAAFGK +  
Sbjct  143   LLSSKNVKSFGHIRRDESSRLMKSLECSSGNA--IDLTDKIFTFTSTITCRAAFGKVMTD  200

Query  768   TEELVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRN  947
              + L+    E + M   F +AD FPSWK+L+ L+  K R+ ++R + D I+  II EH+ 
Sbjct  201   RDGLIALFKEAVAMAGGFELADLFPSWKLLNVLSWSKYRLWRMRGKLDAILDGIIDEHK-  259

Query  948   NLgsgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVC  1127
                     SGE G EDIVDVLI+++ +  L   IT DNIKA+I DMF    +TS+T TV 
Sbjct  260   -----LKQSGEFGGEDIVDVLIRMQQTGELKFPITTDNIKAVIFDMFVAGTETSSTTTVW  314

Query  1128  AMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRE  1301
             AM EM++NPRV+ KAQAEVR   KG+  VEES+V +L YL LVIKET RLHPP P++ R+
Sbjct  315   AMSEMMRNPRVMEKAQAEVRAALKGKAAVEESDVQELKYLKLVIKETFRLHPPIPLLPRQ  374

Query  1302  NNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMP  1481
               ++  V GY+IP +T+V++N W++ RDPQYWE PE F+PERFE+ P DF   + F+Y+P
Sbjct  375   TREECKVDGYSIPIKTKVMLNIWSMGRDPQYWEQPEKFQPERFENSPKDFI-GNDFEYIP  433

Query  1482  FGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFF  1661
             FG+G+R+CPG++FGLA++  PLA +LYHFDW+LP G++   L ++E   + +  K  +  
Sbjct  434   FGAGRRICPGLNFGLANIELPLAKILYHFDWKLPKGMSYERLDMSEGEGLTVSRKKPLII  493

Query  1662  I  1664
             I
Sbjct  494   I  494



>ref|XP_004242219.2| PREDICTED: cytochrome P450 71D7-like [Solanum lycopersicum]
Length=504

 Score =   419 bits (1076),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/458 (46%), Positives = 320/458 (70%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L+  + PH   RDL++++G  +M+L+LGEVP V++SS   +K  LKTHDL FA+
Sbjct  40    IGSLHHLISGHNPHRIFRDLARKYGP-VMYLELGEVPTVIISSPSTSKQVLKTHDLAFAS  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+  + D VMY++ DI F+ YG+YW+QMRK+CI ELLSA+ V+SFS IR+DE   +L  
Sbjct  99    RPQFTSTDIVMYNNKDIAFAEYGDYWKQMRKICIMELLSAKMVKSFSSIRKDELSSVLSS  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S  G    +N+ + +  F +S+ CR  FGK     +EL+  + + L +V  F + D F
Sbjct  159   IDSVRGCCE-VNMTEIIVRFTSSVTCRLVFGKLCRDRDELINLMKDALFLVGGFDIGDFF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+L+ ++G KS++VK+ Q+ D ++  I+ EH  N  +G  G+G  G ED+VDV +++
Sbjct  218   PSWKLLYKMSGAKSKLVKMHQKVDSVLERIVNEHIKNREAGIKGNGAHGGEDLVDVFLRI  277

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K++D L   IT+D+IKA+ILDMF    +TS+T  + A+ E++K+P V+AKAQ+EVR+ FK
Sbjct  278   KENDQLQFPITNDHIKAVILDMFTAGTETSSTAIIWALSELMKHPNVMAKAQSEVRQAFK  337

Query  1200  GRV--EESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
              ++  +E ++D L YL LVIKET+RLH P  +++RE  +++ V GYTIP +  VL+N WA
Sbjct  338   EKIDFDEEDLDNLPYLKLVIKETLRLHAPS-IVHRECREETTVDGYTIPAKATVLVNTWA  396

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             + RDP+ W+DPESF PERFE+ P+D+   + ++++PFG+GKR+CPG+ FG+A+V  PLA 
Sbjct  397   MGRDPEVWDDPESFIPERFENSPIDYL-GNNYEFLPFGAGKRICPGMQFGIANVKQPLAR  455

Query  1554  LLYHFDWELPHGI-TPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHF+W LP+G   P  L ++E   ++   + D++ I
Sbjct  456   LLYHFNWGLPYGTNNPKHLDMSEKSGLSAAKEKDLYLI  493



>gb|AGN04217.1| cytochrome P450 [Salvia miltiorrhiza]
Length=502

 Score =   419 bits (1076),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 232/481 (48%), Positives = 324/481 (67%), Gaps = 16/481 (3%)
 Frame = +3

Query  237   RQWMKPKSgrklpp---gprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGev  407
             + W KPKS +        P KLP+IG+++ LVG ++PH  L+  +++ G  +MHLQLGEV
Sbjct  25    KAWTKPKSPKAHQNLPPSPPKLPVIGHIHLLVG-DLPHKALQRQAQKHGP-VMHLQLGEV  82

Query  408   pavvvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITE  587
             PAVV+SS E  +  LK  D   A RP  +A   + YD +DI FS Y EYWRQMRK+CI E
Sbjct  83    PAVVISSREATREVLKVQDPACADRPESIASKILWYDYTDIAFSAYNEYWRQMRKICIVE  142

Query  588   LLSARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNR  767
             LLS++ V+SF +IR+DES RL+  +  SSG    I++ D++ TF ++I CRAAFGK +  
Sbjct  143   LLSSKNVKSFGHIRRDESSRLMKNLECSSGNA--IDLTDKIFTFTSTITCRAAFGKVMTD  200

Query  768   TEELVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRN  947
              + L+    E + M   F +AD FPSWK+L+ L+  K R+ ++R + D I+  II EH+ 
Sbjct  201   RDGLIALFKEAVAMAGGFELADLFPSWKLLNVLSWSKYRLWRMRGKLDAILDGIIDEHK-  259

Query  948   NLgsgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVC  1127
                     SGE G EDIVDVLI+++ +  L   IT DNIKA+I DMF    +TS+T TV 
Sbjct  260   -----LKQSGEFGGEDIVDVLIRMQQTGELKFPITTDNIKAVIFDMFVAGTETSSTTTVW  314

Query  1128  AMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRE  1301
             AM EM++NPRV+ KAQAEVR   KG+  VEES+V +L YL LVIKET RLHPP P++ R+
Sbjct  315   AMSEMMRNPRVMEKAQAEVRAALKGKAAVEESDVQELKYLKLVIKETFRLHPPIPLLPRQ  374

Query  1302  NNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMP  1481
               ++  V GY+IP +T+V++N W++ RDPQYWE PE F+PERFE+ P DF   + F+Y+P
Sbjct  375   TREECKVDGYSIPIKTKVMLNIWSMGRDPQYWEQPEMFQPERFENSPKDFI-GNDFEYIP  433

Query  1482  FGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFF  1661
             FG+G+R+CPG++FGLA++  PLA +LYHFDW+LP G++   L ++E   + +  K  +  
Sbjct  434   FGAGRRICPGLNFGLANIELPLAKMLYHFDWKLPKGMSCERLDMSEGEGLTVSRKKPLII  493

Query  1662  I  1664
             I
Sbjct  494   I  494



>ref|XP_006365962.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=504

 Score =   418 bits (1075),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 210/458 (46%), Positives = 321/458 (70%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L+  + PH   RDL++++G  + +L+LGEVP V++SS   +K  LKTHDL FA+
Sbjct  40    IGSLHHLISGHNPHRIFRDLARKYGP-VTYLELGEVPTVIISSPSTSKQVLKTHDLAFAS  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+  + D VMY++ DI F+ YG+YW+QMRK+CI ELLSA+ V+SFS IR+DE   +L  
Sbjct  99    RPQFTSTDIVMYNNKDIAFAEYGDYWKQMRKICIMELLSAKMVKSFSSIRKDELSSVLSS  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S  G+   +N+ +++  F +S+ CR  FGK     +EL+  + + L +V  F V D F
Sbjct  159   MDSVGGSCE-VNMTEKIVRFTSSVTCRLVFGKLCRDRDELINLMKDALFLVGGFDVGDFF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+L+ ++G KS++VK+ Q  D ++  I+ EH  N  +G  G+G  G ED+VD+ +++
Sbjct  218   PSWKLLYKMSGAKSKLVKMHQNIDLVLERIVNEHIKNRVAGIKGNGAYGGEDLVDIFLRI  277

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K++D L   I +D+IKA+ILDMF    +TS+T  + A+ E++K+P V+AKAQ+EVR+ FK
Sbjct  278   KENDQLQFPIINDHIKAVILDMFTAGTETSSTTIIWALSELMKHPNVMAKAQSEVRQAFK  337

Query  1200  GRV--EESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
              ++  +E ++D L YL LVIKET+RLH P  +++RE  ++++V GYTIP +  VL+N WA
Sbjct  338   EKIDFDEEDLDNLPYLKLVIKETLRLHAPS-IVHRECREETIVDGYTIPAKATVLVNTWA  396

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             + RDP+ W+DPESF PERFE+ P+D+   + ++++PFG+GKR+CPG+ FGLA+V  PLA 
Sbjct  397   MGRDPEVWDDPESFIPERFENSPIDYL-GNNYEFLPFGAGKRICPGMQFGLANVKQPLAR  455

Query  1554  LLYHFDWELPHGI-TPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHF+W LP GI TP  L ++E   ++   + D++ I
Sbjct  456   LLYHFNWGLPCGINTPKDLDMSEKSGLSAAKEKDLYLI  493



>gb|ABC69400.1| CYP71D49v3 [Nicotiana tabacum]
Length=505

 Score =   418 bits (1075),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 221/458 (48%), Positives = 318/458 (69%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L G  +PH  LRDL++++G  LM+LQLGEVP VV+SS  +AK  LKTHDL FAT
Sbjct  44    IGSLHHLKG-KLPHHHLRDLARKYGP-LMYLQLGEVPVVVISSPRIAKAVLKTHDLAFAT  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RPR ++ D V Y S DI F+PYG+YWRQMRK+   ELLS + ++SFS IR+D   +LL  
Sbjct  102   RPRFMSSDIVFYKSRDISFAPYGDYWRQMRKILTQELLSNKMLKSFSTIRKDGLSKLLSS  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R ++ A   +NI +++  F + + CR AFGK  N  +EL+  + EIL +   F V D F
Sbjct  162   IRLAT-ASSAVNINEKLLWFTSCMTCRLAFGKICNDRDELIMLIREILALSGGFDVCDLF  220

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+LH ++  K+R+  V  + + IM +II EH+ N  +G  G+ E G ED++D L+++
Sbjct  221   PSWKLLHNMSNMKARLTNVHHKYNLIMENIINEHKENHAAGIKGNNEFGGEDMIDALLRV  280

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K+++ L   I +DN+KA+ILD+F    +TS T  + A+ E++K+P V+AKAQAEVR+VFK
Sbjct  281   KENNELQFPIENDNMKAVILDLFIAGTETSYTAIIWALSELMKHPSVMAKAQAEVRKVFK  340

Query  1200  --GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
                 ++E+++DKL YL  VIKET+R+HPP P++  RE  + + + GYT+P + RV++NAW
Sbjct  341   ENENLDENDLDKLPYLKSVIKETLRMHPPVPLLGPRECREQTEIDGYTVPLKARVMVNAW  400

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+ WEDPESFKPERFE+  +D T  + ++++PFGSG+RMCPG+SFGL +   PLA
Sbjct  401   AIGRDPESWEDPESFKPERFENISVDLT-GNHYQFIPFGSGRRMCPGMSFGLVNTGHPLA  459

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLY FDW+ PH +       TE  R+    K+D++ I
Sbjct  460   QLLYFFDWKFPHKVNAADFHTTETSRVFAASKDDLYLI  497



>ref|XP_003516584.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN36163.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   418 bits (1074),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 212/459 (46%), Positives = 325/459 (71%), Gaps = 8/459 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGN+++L V  ++PH  L+ L+  +G  LMHLQLGE+ AVVVSS  +AK   KTHD+ F 
Sbjct  45    IGNMHQLAVAGSLPHRALQKLAHIYGP-LMHLQLGEISAVVVSSPNMAKEITKTHDVAFV  103

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP++++   + Y   D++F+PYG+YWRQMRKV ++ELLSA+ V+SFS+IR+DE+ + +D
Sbjct  104   QRPQIISAQILSYGGLDVVFAPYGDYWRQMRKVFVSELLSAKRVQSFSFIREDETAKFID  163

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              +R+S G+  PIN+  +V + +++ + RAA G      +E + ++ +++  V  F +AD 
Sbjct  164   SIRASEGS--PINLTRKVFSLVSASVSRAAIGNKSKDQDEFMYWLQKVIGSVGGFDLADL  221

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS K +HF+TG K+++ K+    D+++ +I++EH       K G  E   ED+VDVL++
Sbjct  222   FPSMKSIHFITGSKAKLEKLLNRVDKVLENIVREHLERQIRAKDGRVEVEDEDLVDVLLR  281

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             ++ +D+L + +T  ++KA+ILD+F   +DTS +    AM EM+KN RV  KAQAE+R+VF
Sbjct  282   IQQADTLDIKMTTRHVKALILDVFAAGIDTSASTLEWAMTEMMKNSRVREKAQAELRKVF  341

Query  1197  --KGRVEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINA  1367
               K  + ES++++L YL LVIKET+RLHPP P +I RE ++++++ GY IP +T+V+IN 
Sbjct  342   GEKKIIHESDIEQLTYLKLVIKETLRLHPPTPLLIPRECSEETIIGGYEIPVKTKVMINV  401

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP+YW D E F PERFED  +DF + + F+Y+PFG+G+R+CPGI+FGLAS+  PL
Sbjct  402   WAICRDPKYWTDAERFVPERFEDSSIDF-KGNNFEYLPFGAGRRICPGITFGLASIMLPL  460

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LL HF+WELP G+ P ++ +TE   +A+G K+D+  I
Sbjct  461   AQLLLHFNWELPDGMKPESIDMTERFGLAIGRKHDLCLI  499



>emb|CDP07879.1| unnamed protein product [Coffea canephora]
Length=511

 Score =   417 bits (1072),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 212/444 (48%), Positives = 320/444 (72%), Gaps = 7/444 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G + PH  LR L++++G  LM++QLG++ A+VV+S  +AK  +KTHDL FA 
Sbjct  43    IGHMHHLLG-SPPHHALRKLAQKYGP-LMNIQLGQMTAIVVTSPRLAKEIMKTHDLAFAD  100

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             R   L+   + YD SDI    YG+YWRQMRK+C  ELLSA++VRSF  +RQDE+  L+  
Sbjct  101   RAEFLSGKIMCYDCSDIACCRYGDYWRQMRKICTLELLSAKSVRSFVSVRQDEALHLISS  160

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGK-TLNRTEELVKFVNEILIMVSSFSVADT  836
             ++  +GA  PI++ ++V+++ +S++CRAAFGK + +     ++ + E L + S+F ++D 
Sbjct  161   IKVLAGAREPIDLTEKVSSYTSSVVCRAAFGKVSKDDHAAFLQLMKEALPIASAFDISDL  220

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
              PS+KILH L   +S+++K+  + DEI+  II +H +N       +GE G ED++DVL++
Sbjct  221   LPSFKILHPLLSVESKLLKMHDKEDEILEKIIDQHIDNQARRNISTGEYGQEDLIDVLLR  280

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             +K+S  L   IT +NIKA+I D+FG   +TS++I   AM EM++NP V+AKAQ+E+R  F
Sbjct  281   VKESGELQFPITKNNIKAVIHDVFGAGTETSSSIVDWAMSEMIRNPGVMAKAQSEIRNAF  340

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINA  1367
             +G+  +EE+++ +L YL  VIKET+RLHPP P +I RE  ++  + GY IP +T++L+NA
Sbjct  341   RGKNTIEETDIQQLQYLRSVIKETLRLHPPIPLLIPRECREECEIDGYIIPVKTKILVNA  400

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP+YW+DPE FKPERFE+ P+DFT  S+F+++PFG+G+R+CPGISFGLA+V   L
Sbjct  401   WAIGRDPEYWDDPECFKPERFEESPIDFT-GSRFEFLPFGAGRRICPGISFGLANVEVAL  459

Query  1548  AHLLYHFDWELPHGITPHTLKLTE  1619
             A LLYHFDW+LP+G+    L + E
Sbjct  460   ALLLYHFDWKLPNGLDTKDLDMKE  483



>ref|XP_006365979.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=521

 Score =   417 bits (1073),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 214/460 (47%), Positives = 314/460 (68%), Gaps = 8/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNV-PHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IG+L+ L G  + PH TL++L+ ++G  +M+LQLGE+ AV+VSS  + K  LKTH+L FA
Sbjct  55    IGSLHHLRGALLFPHRTLKNLATKYGP-IMYLQLGEIRAVIVSSPNMVKEILKTHELAFA  113

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
             T+P++ + D   Y+  DI F+PYG+ WRQMR +C+TELLS + V+SFS I++DE  RLL 
Sbjct  114   TKPQLTSIDITTYNYKDIAFAPYGDKWRQMRNICVTELLSTKMVKSFSSIQKDEIMRLLS  173

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              +RS++G+   +N+ + +  +  S+ CR+AFGK     ++L+  + ++L  +  F VAD 
Sbjct  174   SIRSTNGS-HLVNLTELILRYTNSVTCRSAFGKVYTNQDQLINLLRDVLDTLGGFDVADL  232

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNN--LgsgktgsgesgseDIVDVL  1010
             FPSWK+LH ++G KS+++K+ ++ DE + +I+ EH  N  LG    G    G ED+VDVL
Sbjct  233   FPSWKLLHKMSGVKSKLLKMHKKVDEALENIVNEHIKNRSLGCKGNGEKLVGGEDLVDVL  292

Query  1011  IKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVRE  1190
             +++K++  L   IT D+IKAII DMF    +TS    + A+ EM++ P ++AKAQ EVR+
Sbjct  293   LRVKENGELQFPITSDHIKAIISDMFAAGTETSAATIIWALSEMMRRPNIMAKAQNEVRQ  352

Query  1191  VFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLIN  1364
             VFKG   + E ++DKL YL LVIKET+RLHPP  ++ RE  K + + GYTIPP+TRVLIN
Sbjct  353   VFKGNTTINEDDLDKLIYLKLVIKETLRLHPPSTLLPRECRKQTYINGYTIPPKTRVLIN  412

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              WA+ RD + W+D ESF PERFE+  +D+   + F+++PFGSG+R+CPG+ FGL +V  P
Sbjct  413   TWALGRDSESWDDTESFIPERFENSHVDYM-GNYFEFIPFGSGRRICPGMQFGLTNVKHP  471

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFDW LP+G  P  L + E   ++     D+  I
Sbjct  472   LAQLLYHFDWVLPYGANPEDLDMIEKNGLSAAKHKDLCLI  511



>gb|AHH25653.1| cytochrome P450 CYP71D [Nicotiana tabacum]
Length=497

 Score =   416 bits (1070),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 223/458 (49%), Positives = 313/458 (68%), Gaps = 14/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G+++ ++G + PH  L +L+K++G  L+HLQLGE+  VVV+S E+AK  LKTHDL FA+
Sbjct  42    LGSMFHMLGGH-PHHVLTNLAKKYGP-LVHLQLGEMSVVVVTSPEMAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+ LA + V Y+ SDI F PYG+YWRQMRK+C+ ELL+A+ VRSFS IR+DE HR+++ 
Sbjct  100   RPKFLASEIVFYNCSDIAFCPYGDYWRQMRKICMIELLTAKNVRSFSSIRRDEVHRMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSS    + +N+   +  F +S+ CR+AFGK     +E +  V     ++  F VAD F
Sbjct  160   FRSS--IDQQVNVTKRIYQFTSSMTCRSAFGKVFKEQDEFILLVKRNTALMEGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G+K+R++ V  + D I+ +II E +         +GE G + ++DVL++L
Sbjct  218   PSKKFLHVLSGKKARVMDVHHKIDAILENIINERKK------IATGEVGGKGLIDVLLRL  271

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII D F    +TS+     AMVEM+KNP VLAKAQAEVR+ F+
Sbjct  272   MKEGGLQFPITNDNIKAIIFDTFAAGTETSSVTIDWAMVEMMKNPSVLAKAQAEVRKAFR  331

Query  1200  GR--VEESNVDKLAYLNLVIKETMR-LHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LVIKE  R   P   ++ RE  +++ + GYTIP + +V++N W
Sbjct  332   GKETFDENDVEELNYLKLVIKEAFRLHPPFPLLLPRECREETDINGYTIPLKAKVMVNVW  391

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW+D ESFKPERFE + MDF   + F+Y+PFGSG+R CPGISFGLA+VY PLA
Sbjct  392   AIGRDPKYWDDVESFKPERFEHNSMDFV-GNNFEYLPFGSGRRNCPGISFGLANVYYPLA  450

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP+GI P+ L LTE        K+++  I
Sbjct  451   QLLYHFDWKLPNGINPNELDLTESAGATCARKSNLHLI  488



>emb|CDP20259.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   417 bits (1071),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 239/460 (52%), Positives = 324/460 (70%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL+ L+G ++PH  L +L+K+ G DLMHLQLGEV A+VVSS   AK  LKTHDL FA 
Sbjct  46    IGNLHNLLG-SLPHQALTNLAKKHG-DLMHLQLGEVSAIVVSSPRSAKEILKTHDLAFAD  103

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP VL    + YD S I F PYGEYWRQMRK+C  ELLSA+ VRSF  IRQDE   LL  
Sbjct  104   RPEVLVGKIICYDYSSIAFCPYGEYWRQMRKICTLELLSAKMVRSFGSIRQDEVLHLLSS  163

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE-LVKFVNEILIMVSSFSVADT  836
             +R+S+G G+PIN+ +EV++F +S++CR+AFGK        L++ V E+L   S F ++D 
Sbjct  164   IRASTGGGKPINLTEEVSSFTSSMVCRSAFGKMFGEKNTILIQLVKEVLSRTSGFDISDL  223

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS KILH L+  K  ++KV  + D I+ +II EH  NL  GK G+GESG ED++D+L++
Sbjct  224   FPSQKILHHLSWMKPTLLKVHHKIDVILDNIINEHIRNLARGKGGNGESGQEDLIDILLR  283

Query  1017  LKDSDS-LPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +K+S   L   IT+  +KAI+ DMF  A +TS T+   AM EM++NP V++KAQ E+R+ 
Sbjct  284   IKESGGDLRFPITNKIVKAIMFDMFTAATETSATVVEWAMSEMIRNPDVMSKAQNEIRKA  343

Query  1194  F--KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIYR-ENNKDSVVCGYTIPPRTRVLIN  1364
             F  K ++EE +++ L YL  VIKET+RLHPP P++   E  +  V+ GY IP +TRVL+N
Sbjct  344   FMGKAKIEEMDIEGLIYLKSVIKETLRLHPPLPLLVPMECREQRVLDGYVIPIKTRVLVN  403

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP+YW+ PESFKPERF+++P+DFT  + F Y+PFG G+R+CPGISFGLA+V  P
Sbjct  404   AWAIHRDPKYWDYPESFKPERFDNNPVDFT-GTHFHYLPFGGGRRICPGISFGLANVELP  462

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLY+FDW+LP G     L +TE   + +  K+++  +
Sbjct  463   LAQLLYNFDWKLPPG--KDGLDMTEAFGITVARKSNLHLV  500



>ref|XP_009619325.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=509

 Score =   417 bits (1071),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 216/460 (47%), Positives = 325/460 (71%), Gaps = 11/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L+G  +PH +L+ L++++G  LM+LQLG+VP +++SS  +AK  LKTHDL FA 
Sbjct  49    IGSLHHLIGGELPHRSLKKLAQKYGP-LMYLQLGQVPTIIISSPRIAKEVLKTHDLAFAN  107

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++ +   + Y++ D++FS YG+YWRQMRK+CI ELLS++ V+SFS IR+ E   L+  
Sbjct  108   RPQLTSSTIIFYNNIDMVFSQYGDYWRQMRKICIVELLSSKMVKSFSGIREKELSSLISS  167

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RS +     +NI +++  F  S+ CR+AFGK      E    + E+L++   F VAD F
Sbjct  168   IRSMT----EVNITEKIFMFTNSVTCRSAFGKICKDRGEFRTLLKEVLLLAGGFFVADLF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             P WK+LH L+G +SR+V   ++ DEIM +II EH  N  +G   +GE G ED+VDV +++
Sbjct  224   PCWKLLHNLSGMESRLVNAHRKVDEIMENIINEHIANRAAGNKRNGEFGDEDLVDVFLRI  283

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K+ D L   IT+D+IKA++ D+F G  +TS+T+ + A+ E++KNP V+AKAQ+EVR+VFK
Sbjct  284   KEKDQLHFPITNDHIKAMLFDIFLGGTETSSTVLIWALAELMKNPNVMAKAQSEVRQVFK  343

Query  1200  GRV---EESN-VDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             G+    EE N V+KL+YL LVI ET+RLH P P++  RE  +++ + GY IP +T+VL+N
Sbjct  344   GKKIYDEEDNIVEKLSYLKLVIMETLRLHTPAPLMGPRECREETNIAGYNIPNKTKVLVN  403

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWA++RD + W DPESF PERF++  +DF   + F+Y+PFG+G+R+CPGI FGLA++  P
Sbjct  404   AWALARDVESWNDPESFIPERFDNSSIDFM-GNYFEYIPFGTGRRICPGIQFGLANIGVP  462

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLY+F+W+LP+GI P  L +TE   +    + D++ +
Sbjct  463   LAQLLYNFEWKLPYGINPQDLDMTETHGLTGAKQKDLYLV  502



>ref|XP_009803037.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=512

 Score =   417 bits (1071),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 217/457 (47%), Positives = 320/457 (70%), Gaps = 8/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L+G + PH   RDL++++G  +M+L+LGEVP V++SS   AK  LKTHDL F+ 
Sbjct  51    IGSLHHLIGAH-PHRIFRDLARKYGP-VMYLELGEVPTVIISSPSAAKETLKTHDLAFSN  108

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+  +   VMY++ DI F+ YG+YW+QMRK+CI ELLSAR V+SFS IR+DE   LL  
Sbjct  109   RPQFTSTYIVMYNNKDIAFAEYGDYWKQMRKICIMELLSARMVKSFSSIRKDELSSLLSS  168

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             V+S  G    +N+ +++  F +S+ CR  FGK     E L++ + + L++     V D F
Sbjct  169   VQSVKGTSE-VNMTEKIVRFASSVTCRLVFGKLSKDRELLIELMKKTLLLAGG-DVGDLF  226

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+L+ ++G KSR+VK+ QE D ++ +I+ EH  +   G  G+GE G ED+VDV +++
Sbjct  227   PSWKLLYKMSGAKSRLVKMHQEVDSVLDNIVNEHIRSRADGNKGNGEYGGEDLVDVFLRI  286

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             +++D L   IT+D+IKA+ILDMF    +TS+T  + AM E++KNP V+AKAQ+EVR+ FK
Sbjct  287   QENDQLQFPITNDHIKAVILDMFTAGTETSSTAIIWAMSELMKNPNVMAKAQSEVRQAFK  346

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
             G+   +E ++D L YL LV+KET+RLH P  +++RE  + + + GYTIP +  VL+N WA
Sbjct  347   GKSSFDEEDLDNLPYLMLVVKETLRLHAPS-ILHRECREQTCIDGYTIPSKATVLVNTWA  405

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             I RDP+ W +PESF PERFE+  +D+   + F+++PFGSGKR+CPG+ FGLA+   PLA 
Sbjct  406   IGRDPEVWNNPESFIPERFENSFIDYL-GNHFEFIPFGSGKRICPGMQFGLANFRYPLAR  464

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHF+WELP+G +P  L ++E P M+   + D++ I
Sbjct  465   LLYHFNWELPYGTSPKDLDMSEKPGMSAAKEKDLYVI  501



>gb|AJD25166.1| cytochrome P450 CYP71D413 [Salvia miltiorrhiza]
Length=511

 Score =   416 bits (1070),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 219/458 (48%), Positives = 321/458 (70%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ ++GP   H  LR+L+ ++G  LMHL+ GEV A++VSSAEVA+  LKTHD   A 
Sbjct  44    IGHLHHIIGPLPHHYPLRNLASKYGP-LMHLKFGEVTAIIVSSAEVAEKVLKTHDPACAD  102

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+ +A   + Y+ SDI+FSPYG+YWRQMRK+CI ELLSA+ VRSF YIR+DE+  L++ 
Sbjct  103   RPKSVATQIMWYNYSDIVFSPYGDYWRQMRKICILELLSAKNVRSFEYIRKDEASLLIES  162

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++S+ GA  P ++ +++  FM S+ CRAAFG         +K + + + +   F +AD F
Sbjct  163   IQSTRGA--PFDLTEKIFLFMNSMTCRAAFGNASMDRAAAIKLIKKAICLAGHFDLADLF  220

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+   LT  +  ++K+R++ D+I+ D+I EH  NL S K G GE G+ED+VDVL++L
Sbjct  221   PSIKLFDLLTWNRFELLKLRRKLDKILDDVIDEHERNLASTKMGYGELGTEDLVDVLLRL  280

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K S  L +SIT+D+IK++I DMF    ++S+T    AM E+++NPRV+AKA+ E+R+ F+
Sbjct  281   KGSGELELSITNDSIKSVIFDMFAAGTESSSTTVDWAMAELMRNPRVMAKARDEIRQAFR  340

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINAW  1370
             GR  ++ES +  L YL +VI ET+RLHPP  +I R   ++ + + GY IP    V++N W
Sbjct  341   GRETIKESEIRTLKYLKMVINETLRLHPPVSIIPRACREEELEIDGYHIPLNANVIVNIW  400

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             +I RDP+YW D ESF+PERFE++P+DF   S F+Y+PFGSGKR+CPG++FG+A+V   LA
Sbjct  401   SIGRDPKYWHDAESFEPERFEENPIDFL-GSHFEYIPFGSGKRICPGMAFGVANVEFVLA  459

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDWELP G++   L + E   +A+  K+++  I
Sbjct  460   QLLYHFDWELPLGVSRDDLDMAEAAGIAVSRKSNLRLI  497



>emb|CDP07872.1| unnamed protein product [Coffea canephora]
Length=504

 Score =   416 bits (1069),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 317/444 (71%), Gaps = 7/444 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L G + PH  LR L++++G  LMH+QLGE+ ++VV+S  +AK  +KTHDL FA 
Sbjct  43    IGHMHHLSG-SPPHHALRKLAQKYGP-LMHIQLGEISSIVVTSPRLAKEIMKTHDLAFAN  100

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             R   LA   ++Y+ SDI   PYG+YWRQMRK+C  ELLS+++VRS   IRQ+E+  L+  
Sbjct  101   RGETLAGKIMLYNCSDIACCPYGDYWRQMRKICTLELLSSKSVRSCGSIRQEEALHLVSS  160

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTE-ELVKFVNEILIMVSSFSVADT  836
             +++ + AG+ I++ ++++++ ++++ RAAFGK  N       + + E   + S+F V+D 
Sbjct  161   IKALANAGKSIDVTEKMSSYASAVLYRAAFGKVSNDDHFAFFQLIKESSSIASAFDVSDL  220

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
              PS+KILH     K++M+ +R + D+++  II +H +NL   K  +G S +EDI+DVL++
Sbjct  221   LPSFKILHPFLSVKNKMLNIRYKLDKVLDKIIDQHMDNLARTKIATGASDNEDIIDVLLR  280

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             +K+S  L + +T DNIKA++ D+F G  +TS+T    AM EM++NP V+AKAQ+E+R  F
Sbjct  281   VKESGELQIPLTKDNIKAVLSDVFAGGTETSSTTVEWAMSEMIRNPGVMAKAQSEIRNAF  340

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINA  1367
             +G+  +EE+++ +L YL  VIKET+RLHPP P +I RE  ++  + GY IP +TRVL+NA
Sbjct  341   RGKNTIEETDIQRLQYLRSVIKETLRLHPPIPLLIPRECREECEIDGYIIPVKTRVLVNA  400

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP+YW+D ESFKPERFE+  +DF   S F+Y+PFG+G+R+CPGI+FGLA+V  PL
Sbjct  401   WAIGRDPEYWDDAESFKPERFENSSIDFN-GSHFEYLPFGAGRRICPGIAFGLANVELPL  459

Query  1548  AHLLYHFDWELPHGITPHTLKLTE  1619
             A LLYHFDW LP+G+  + L +TE
Sbjct  460   ALLLYHFDWRLPNGLDSNDLDMTE  483



>gb|KDP39256.1| hypothetical protein JCGZ_01013 [Jatropha curcas]
Length=488

 Score =   415 bits (1067),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 217/458 (47%), Positives = 322/458 (70%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN++ LVG ++PH  L++L+K++G  LMHLQLGEV  +VV+SAE+AK  ++ HD+ F+ 
Sbjct  27    IGNIHNLVG-SLPHHRLQNLAKKYG-PLMHLQLGEVTTIVVTSAEIAKEVMRAHDIVFSN  84

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA + + Y+++ I+FSPYGEYWRQ+RK+C+ ELLSA+ V+SF  IR++E   ++ R
Sbjct  85    RPSILAANIISYNATSIVFSPYGEYWRQLRKICVLELLSAKRVQSFKSIREEEVSNIVRR  144

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + SSS +   IN+   + +   SI  RAAFGK     E  +  V EI+ +   FS+AD F
Sbjct  145   ISSSSDS--LINLSRMLFSLTYSITSRAAFGKIRKEQEAFIPLVEEIIEVGGGFSIADLF  202

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+L+ + G KSR+ ++ QE D+I+ +II EHR +  +      +  ++D+VDVL+ +
Sbjct  203   PSIKLLNRINGMKSRVERLHQEADKILENIINEHRAS-KARAKPGSKGEADDLVDVLLNI  261

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             ++   L  ++T +NIKA+ILD+F    +TS+T    AM E++KN  V+ KAQAE+R+VF 
Sbjct  262   QEQGDLGFALTTNNIKAVILDLFIAGSETSSTTVEWAMSELLKNTSVMKKAQAELRQVFK  321

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              KG V+E  V +L YL L++KET+RLHPP P++  REN++   + GY IP ++RVLIN W
Sbjct  322   NKGYVDEEGVCELNYLKLIVKETLRLHPPVPLLVPRENSELCEINGYFIPVKSRVLINVW  381

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP YW++PE F PERF D+ +D+ + S F+++PFG+G+R+CPGI FG+A+V  PLA
Sbjct  382   AIGRDPNYWKEPERFNPERFLDNSIDY-KGSNFEFIPFGAGRRICPGILFGIANVELPLA  440

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             +LLYHFDW+LP  I P  L++TE   +A+  KND+  I
Sbjct  441   NLLYHFDWKLPGEINPENLEMTEASGIAVRRKNDLNLI  478



>ref|XP_007213422.1| hypothetical protein PRUPE_ppa025696mg [Prunus persica]
 gb|EMJ14621.1| hypothetical protein PRUPE_ppa025696mg [Prunus persica]
Length=475

 Score =   414 bits (1064),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 218/434 (50%), Positives = 307/434 (71%), Gaps = 10/434 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L G ++PH  LRDL+K++G  LMHL+LGEV  VVVSSAE AK  +KTHDL FA+
Sbjct  48    IGNLHQLAG-SLPHQRLRDLAKKYG-PLMHLKLGEVSTVVVSSAEFAKEVMKTHDLIFAS  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP VLA   + YD + I+F+PYGEYWR++RK+C  ELLSA+ VRS+  IR++E  +L+  
Sbjct  106   RPHVLAPRILSYDFTSIVFAPYGEYWRKLRKICTLELLSAKRVRSYRPIREEEVRKLIKL  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  +S AG PIN+  E+ +   +I  RAAFGK     E+ +  V E+    S F++AD F
Sbjct  166   I--ASRAGSPINLTQEIYSSTFTITSRAAFGKKNRDQEKFIYIVKEVAKAASGFALADVF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS  +LH L+G + ++ ++ +E D IMG+IIKEH+ ++      S     ED+VDVL+K 
Sbjct  224   PSVSLLHLLSGMRHKIERLHKEADRIMGNIIKEHQRDM-VTTKSSEGEAEEDLVDVLLKF  282

Query  1020  KD-SDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
              +  +    S+T +NIKA+I D+F    +TS+T    A+ EM+KNPRV+  AQ EVREVF
Sbjct  283   HEHGNEREFSLTTENIKAVIFDIFAAGSETSSTAVDWAIAEMIKNPRVMNMAQNEVREVF  342

Query  1197  --KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
               KG+V+E+ + ++ YLNLVIKET+RLHPPGP++  RE  +   + G+ IP +++V++NA
Sbjct  343   NRKGQVDETCIREMKYLNLVIKETLRLHPPGPLLVPRECGEKCEIDGHEIPVKSKVIVNA  402

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP YW +PESF P RF D+ +D+ + + F+Y+PFG+G+RMCPG+SFGLA+V  PL
Sbjct  403   WAIGRDPNYWNEPESFNPNRFLDNSIDY-KGTNFEYIPFGAGRRMCPGVSFGLANVELPL  461

Query  1548  AHLLYHFDWELPHG  1589
             A LLYHFDW+LP G
Sbjct  462   ALLLYHFDWKLPMG  475



>ref|XP_003517259.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=503

 Score =   414 bits (1065),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 218/458 (48%), Positives = 323/458 (71%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L +  ++P   L+ L +++G  LMHLQLGE+ A+VVSS ++A   +KTHD+ F 
Sbjct  43    IGNLHQLALAASLPDQALQKLVRKYGP-LMHLQLGEISALVVSSPKMAMEVMKTHDVHFV  101

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP++LA   ++Y ++DI+F+PYG+YWRQ+RK+C  ELLSA+ V+SFS+IRQDE+ +L+ 
Sbjct  102   QRPQLLAPQFMVYGATDIVFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENRKLIQ  161

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              + SS+G+   I++  ++ + + + + RAAFGK  +  +EL+  V + + M   F + D 
Sbjct  162   SIHSSAGSS--IDLSGKLFSLLGTTVSRAAFGKENDDQDELMSLVRKAITMTGGFELDDM  219

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS K LH LT +K+++  V Q  D+I+ DI+++H      GK GS E+  ED+VDVL++
Sbjct  220   FPSLKPLHLLTRQKAKVEHVHQRADKILEDILRKHMEKRTIGKEGSNEAEQEDLVDVLLR  279

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             LK+S SL + +T +NIKA+I ++F    DT  +    AM EM+KNPRV  KAQAE+R+ F
Sbjct  280   LKESGSLEVPMTMENIKAVIWNIFASGTDTPASTLEWAMSEMMKNPRVREKAQAELRQTF  339

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             KG+  + E+++++L+YL  VIKET+RLHPP  +I RE  K + + GY IP +T+V+IN W
Sbjct  340   KGKEIIRETDLEELSYLKSVIKETLRLHPPSQLIPRECIKSTNIDGYDIPIKTKVMINTW  399

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDPQYW D E F PERF+D  +DF + + F+Y+PFG+G+RMCPGI+FGLAS+  PLA
Sbjct  400   AIGRDPQYWSDAERFIPERFDDSSIDF-KGNSFEYIPFGAGRRMCPGITFGLASITLPLA  458

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHF+WELP+ + P  L + EL  + +  KN +F I
Sbjct  459   LLLYHFNWELPNKMKPADLDMDELFGLTVVRKNKLFLI  496



>ref|XP_011081935.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=506

 Score =   414 bits (1064),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 229/481 (48%), Positives = 328/481 (68%), Gaps = 16/481 (3%)
 Frame = +3

Query  237   RQWMK---PKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGev  407
             R W K   PK   KLPP P KLP+IG+L+ LVG  +PH  LR +++++G  +++L+LGEV
Sbjct  29    RAWEKLNSPKKYEKLPPSPPKLPVIGHLHHLVG-GLPHHALRRVAQKYGP-VLYLKLGEV  86

Query  408   pavvvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITE  587
              AVV+SS E  K  +K  D   A RP  +    + YD +DI FS Y EYWRQMRK+CI E
Sbjct  87    SAVVISSREATKEVVKLQDPACADRPESIGSKIMWYDYTDIAFSAYNEYWRQMRKICILE  146

Query  588   LLSARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNR  767
             LLSA+ V+SF  IRQDE  RL+  ++SSSG  + IN+ ++V  F +SI CRAAFGK +  
Sbjct  147   LLSAKNVKSFGSIRQDEVSRLMKSLQSSSG--QAINLTEKVFAFTSSITCRAAFGKVMRD  204

Query  768   TEELVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRN  947
              + L+  + + + M   F +AD FPS K+LH L+  K +++++R++ D I+  I++EH+ 
Sbjct  205   RDVLIAMLKKAVTMAGGFELADLFPSSKLLHVLSWNKYKLLRMRRKLDTILDAILEEHK-  263

Query  948   NLgsgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVC  1127
                     SGE G EDIVDVL++++ +  L   IT+DNIKA+I DMF    +TS+T    
Sbjct  264   -----LKQSGEFGGEDIVDVLLRMQKTGELQFPITNDNIKAVIFDMFSAGTETSSTTIDW  318

Query  1128  AMVEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRE  1301
             AM E+++NPRV+AK QAE +E FKG+  VEES+V  L YL LVIKET RLHPP P++ R 
Sbjct  319   AMAELMRNPRVMAKVQAEQKEAFKGKTTVEESDVQALKYLKLVIKETFRLHPPIPLLPRA  378

Query  1302  NNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMP  1481
                +  V GYTIP +++V+IN W + RDP+YW  PE+F+PERF+++ +DF   + F+Y+P
Sbjct  379   CRDECKVNGYTIPLKSKVMINIWGMGRDPEYWHQPETFQPERFDNNSIDFL-GNNFEYIP  437

Query  1482  FGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFF  1661
             FG+G+R+CPG++FGLA+V  PLA LLYHFDW++P G+TP  + +TE   +A+  +N +  
Sbjct  438   FGAGRRICPGMNFGLANVELPLAKLLYHFDWKMPKGMTPDDIDMTEAEGIAVSRRNGLVL  497

Query  1662  I  1664
             +
Sbjct  498   V  498



>ref|XP_011077043.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=504

 Score =   414 bits (1063),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 224/461 (49%), Positives = 311/461 (67%), Gaps = 18/461 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+   G N PH TLRDL+K++G  LMHLQLGEV  +V SS+E A+ FLKTHD+DFA+
Sbjct  47    IGSLHLFAGSNPPHRTLRDLAKKYGP-LMHLQLGEVNIIVASSSETARQFLKTHDIDFAS  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             R  VL  +   Y + DI+F+PY EYWRQMRK+C  ELLSA+ V SF  IR++E   L   
Sbjct  106   RSTVLMSEICCYGNKDIVFAPYSEYWRQMRKICTLELLSAKRVESFRPIREEEMSDLCRW  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKF---VNEILIMVSSFSVA  830
             +    G+  PIN+  ++      I+ RA FGK   +TEE VKF   V E +  +S+F +A
Sbjct  166   IVLQEGS--PINLTQKLCMANYEIMARATFGK---KTEEHVKFIAIVKEGMEFMSTFHIA  220

Query  831   DTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVL  1010
             D +PS K+L ++TG K ++ +V Q+TD I+G+II+EHR         +     ED+ DVL
Sbjct  221   DVYPSLKLLSWITGLKRKLERVHQQTDRIIGNIIEEHRR-----VDAADRGNHEDLADVL  275

Query  1011  IKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVRE  1190
             ++++DS SL + +T +NIKA++ DMFGG ++  TT    AM EMV+NP VL KAQ EVR+
Sbjct  276   LRVRDSGSLELPLTIENIKAVLADMFGGGIEAPTTTIDWAMAEMVRNPSVLIKAQDEVRQ  335

Query  1191  VF--KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLI  1361
             VF  KGRV E+  D+L YL LVIKET+RLHPPG ++  R+N +   + GY IP R+RVL+
Sbjct  336   VFDGKGRVNEAYFDELKYLKLVIKETLRLHPPGALLLPRQNKERYEINGYEIPARSRVLV  395

Query  1362  NAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYT  1541
             N WAI  D +YWED E FKPERF +  +DF + +  +++PFG+G+R+CPGISF +A+V  
Sbjct  396   NVWAIGTDSEYWEDAEEFKPERFLEKQVDF-QGNCLEFIPFGAGRRICPGISFAIANVEL  454

Query  1542  PLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LA LLYHFDW LP+G+ P  + +TE   ++   K +++ I
Sbjct  455   ALAMLLYHFDWILPNGMKPEEMDMTEFSGVSARRKANLYVI  495



>gb|KHN36164.1| Cytochrome P450 71D8 [Glycine soja]
Length=503

 Score =   414 bits (1063),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 216/458 (47%), Positives = 322/458 (70%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L +  ++P   L+ L +++G  LMHLQLGE+  +VVSS ++A   +KTHD+ F 
Sbjct  43    IGNLHQLALAASLPDQALQKLVRKYGP-LMHLQLGEISTLVVSSPKMAMEVMKTHDVHFV  101

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP++LA   ++Y ++DI+F+PYG+YWRQ+RK+C  ELLSA+ V+SFS+IRQDE+ +L+ 
Sbjct  102   QRPQLLAPQFMVYGATDIVFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENRKLIQ  161

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              + SS+G+   I++  ++ + + + + RAAFGK  +  +EL+  V + + M   F + D 
Sbjct  162   SIHSSAGSS--IDLSGKLFSLLGTTVSRAAFGKENDDQDELMSLVRKAITMTGGFELDDM  219

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS K LH LT +K+++  V Q  D+I+ DI+++H      GK GS E+  ED+VDVL++
Sbjct  220   FPSLKPLHLLTRQKAKVEHVHQRADKILEDILRKHMEKRTIGKEGSNEAEQEDLVDVLLR  279

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             LK+S SL + +T +NIKA+I ++F    DT  +    AM EM+KNPRV  KAQAE+R+ F
Sbjct  280   LKESGSLEVPMTMENIKAVIWNIFASGTDTPASTLEWAMSEMMKNPRVREKAQAELRQTF  339

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             KG+  + E+++++L+YL  VIKET+RLHPP  +I RE  K + + GY IP +T+V+IN W
Sbjct  340   KGKEIIRETDLEELSYLKSVIKETLRLHPPSQLIPRECIKSTNIDGYDIPIKTKVMINTW  399

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDPQYW D E F PERF+D  +DF + + F+Y+PFG+G+RMCPGI+FGLAS+  PLA
Sbjct  400   AIGRDPQYWSDAERFIPERFDDSSIDF-KGNSFEYIPFGAGRRMCPGITFGLASITLPLA  458

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              +LYHF+WELP+ + P  L + EL  + +  KN +F I
Sbjct  459   LILYHFNWELPNKMKPADLDMDELFGLTVVRKNKLFLI  496



>ref|XP_007156881.1| hypothetical protein PHAVU_002G025000g [Phaseolus vulgaris]
 gb|ESW28875.1| hypothetical protein PHAVU_002G025000g [Phaseolus vulgaris]
Length=504

 Score =   413 bits (1062),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 210/460 (46%), Positives = 318/460 (69%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L V  ++PH  L+ LS ++G  LMHLQLGE+ AVV SS E+ K   KTHD+ F 
Sbjct  45    IGNLHQLAVAGSLPHRALQKLSHEYGP-LMHLQLGEISAVVASSPEMVKEITKTHDVAFL  103

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP+ ++   + Y   D++F+PYG+YWRQMRK+ ++ELLS + V+SFS+IR+DE+ + +D
Sbjct  104   QRPQFISGQILSYGGIDVVFAPYGDYWRQMRKIFVSELLSTKRVQSFSFIREDETEKFID  163

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              +R+S  AG PIN+   + + +++ + RAAFG       E +  + +++  V  F +AD 
Sbjct  164   SIRTS--AGSPINLSSRIFSLVSTSVSRAAFGNISKDHIEFMLLIKKVMGSVGGFDLADL  221

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS K +HF+TG+K+++ K+  + D  +  I++EH+      K G  +   ED+VDVL+ 
Sbjct  222   FPSMKSIHFITGKKAKLEKLLNQVDRFLESIVREHQEKQRRAKEGRVQIKDEDLVDVLLT  281

Query  1017  LKDSD-SLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
              + +D +L + +T  N+KA+ILD+F G +DTS +    AM EM+++PRV+ KAQAE+RE 
Sbjct  282   FQQTDAALDIKMTTRNVKALILDIFAGGIDTSGSTIEWAMTEMMRSPRVMKKAQAELREA  341

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLIN  1364
              + +  + E ++++L YL LV+KET+RLHPP P +I RE ++ +++ GY IP +T+V+IN
Sbjct  342   LREKEIIHEKDLEQLPYLKLVVKETLRLHPPTPLLIPRECSERTIIDGYEIPVKTKVMIN  401

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              WAI RDP+YW D E F PERFE   +DF + + F+Y+PFG+G+R+CPGISFGLAS+  P
Sbjct  402   VWAICRDPKYWSDAEKFVPERFEGSSIDF-KGNNFEYLPFGAGRRICPGISFGLASIMLP  460

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ +TP ++   E   MA+G KND+  I
Sbjct  461   LARLLYHFNWELPNSMTPESIDTIERFGMAIGRKNDLCLI  500



>ref|XP_003537457.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42026.1| Cytochrome P450 71D8 [Glycine soja]
Length=505

 Score =   413 bits (1062),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 221/477 (46%), Positives = 331/477 (69%), Gaps = 9/477 (2%)
 Frame = +3

Query  249   KPKSgrklppgprklplIGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvs  425
             KPKS  KLPPGP KLP+IGNL+++ +  ++PH  L+ L++++G  LMHLQLGE+  +VVS
Sbjct  26    KPKSSHKLPPGPWKLPIIGNLHQVALAASLPHHALQKLARKYGP-LMHLQLGEISTLVVS  84

Query  426   saevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSART  605
             S ++A   +KTHDL F  RP++LA   + Y ++DI F+PYGEYWRQMRK+C  ELLSA+ 
Sbjct  85    SPKMAMEIMKTHDLAFVQRPQLLAPQYMAYGATDIAFAPYGEYWRQMRKICTLELLSAKR  144

Query  606   VRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVK  785
             V+SFS+IRQDE+ +L+  ++SS  AG PI++  ++ + + + + RAAFG   +  +E + 
Sbjct  145   VQSFSHIRQDENRKLIQSIQSS--AGSPIDLSSKLFSLLGTTVSRAAFGNKNDDQDEFMS  202

Query  786   FVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEH--RNNLgs  959
              V + + M   F + D FPS K LH LTG+K+++ ++ +  D I+ DI+++H  +     
Sbjct  203   LVRKAVAMTGGFELDDMFPSLKPLHLLTGQKAKVEEIHKRADRILEDILRKHVEKRTRAK  262

Query  960   gktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVE  1139
              +  + E+  ED+VDVL++++ S SL + +T  ++KA+I D+F    DTS +    AM E
Sbjct  263   EEGNNSEAQQEDLVDVLLRIQQSGSLEVQMTTGHVKAVIWDIFAAGTDTSASTLEWAMAE  322

Query  1140  MVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKD  1313
             M+KNPRV  KAQA +R+ FKG+  + E+++++L+YL  VIKET+RLHPP  +I RE  K 
Sbjct  323   MMKNPRVREKAQAVIRQAFKGKETIRETDLEELSYLKSVIKETLRLHPPSQLIPRECIKS  382

Query  1314  SVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSG  1493
             + + GY IP +++V+IN WAI RDPQYW D E F PERF+   +DF + + ++Y+PFG+G
Sbjct  383   TNIDGYEIPIKSKVMINTWAIGRDPQYWSDAERFIPERFDGSYIDF-KGNSYEYIPFGAG  441

Query  1494  KRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             +RMCPG++FGLAS+  PLA LLYHF+WELP+ + P  L + E   M +G KN +  I
Sbjct  442   RRMCPGMTFGLASITLPLALLLYHFNWELPNKMKPEDLDMNEHFGMTVGRKNKLCLI  498



>ref|XP_003537455.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN42025.1| Cytochrome P450 71D8 [Glycine soja]
Length=504

 Score =   412 bits (1060),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 213/459 (46%), Positives = 317/459 (69%), Gaps = 8/459 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L +  ++P   L+ L +++G  LMHLQLGE+  +VVSS ++A   +KTHD+ F 
Sbjct  43    IGNLHQLALAASLPDQALQKLVRKYGP-LMHLQLGEISTLVVSSPKMAMEMMKTHDVHFV  101

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP++LA   ++Y ++DI F+PYG+YWRQ+RK+C  ELLSA+ V+SFS+IRQDE+ +L+ 
Sbjct  102   QRPQLLAPQFMVYGATDIAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQ  161

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              + SS  AG PI++  ++ + + + + RAAFGK  +  +E +  V + + M   F V D 
Sbjct  162   SIHSS--AGSPIDLSGKLFSLLGTTVSRAAFGKENDDQDEFMSLVRKAITMTGGFEVDDM  219

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEH-RNNLgsgktgsgesgseDIVDVLI  1013
             FPS K LH LT +K+++  V Q  D+I+ DI+++H        +    E+  ED+VDVL+
Sbjct  220   FPSLKPLHLLTRQKAKVEHVHQRADKILEDILRKHMEKRTRVKEGNGSEAEQEDLVDVLL  279

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +LK+S SL + +T +NIKA+I ++F    DTS +    AM EM+KNP+V  KAQAE+R++
Sbjct  280   RLKESGSLEVPMTMENIKAVIWNIFAAGTDTSASTLEWAMSEMMKNPKVKEKAQAELRQI  339

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINA  1367
             FKG+  + E+++++L+YL  VIKET+RLHPP  +I RE  K + + GY IP +T+V+IN 
Sbjct  340   FKGKEIIRETDLEELSYLKSVIKETLRLHPPSQLIPRECIKSTNIDGYEIPIKTKVMINT  399

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDPQYW D + F PERF D  +DF + + F+Y+PFG+G+RMCPG++FGLAS+  PL
Sbjct  400   WAIGRDPQYWSDADRFIPERFNDSSIDF-KGNSFEYIPFGAGRRMCPGMTFGLASITLPL  458

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHF+WELP+ + P  L + E   M +  KN +F I
Sbjct  459   ALLLYHFNWELPNKMKPEDLDMDEHFGMTVARKNKLFLI  497



>ref|XP_006339045.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=510

 Score =   413 bits (1061),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 228/459 (50%), Positives = 322/459 (70%), Gaps = 7/459 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             +G+++ L +   +PH  L  L K+ G   MHLQLGE+  +VVSS E+A+  +K HDL FA
Sbjct  46    LGSIHHLALEGGLPHHALTKLGKKHGP-FMHLQLGEISTIVVSSLEMAREVMKIHDLAFA  104

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
             +RP++++ D + Y+S+DI+FSPYG+YWRQMRK+C  EL SA+ VRSFS IR++E+  L+ 
Sbjct  105   SRPKLVSLDVICYNSTDIVFSPYGDYWRQMRKICFLELFSAKNVRSFSSIRREEASSLVQ  164

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              +  SS  G  IN+ + ++ + +S  C+AAFG+ L   E+ +  V E+  +   FSVA+ 
Sbjct  165   FI-GSSPRGETINVTERISWYESSNTCKAAFGELLKDQEKFIGIVRELAELTGGFSVANI  223

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS KILH L+G +SR++KV +  D I+ DII EH+ N+ SGK G+G  G ED+VDVL++
Sbjct  224   FPSIKILHVLSGLRSRIMKVHKNVDVIVEDIINEHKKNIASGKKGNGAFGGEDLVDVLLR  283

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             L++S  L   IT+DNIKAI++D+F    +TSTT T+  M EM++NP VLAKAQ EVRE F
Sbjct  284   LRESGELKTPITNDNIKAIMIDLFAAGTETSTTTTIWTMTEMMRNPSVLAKAQVEVREAF  343

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
             KG+    E  ++ L YL  V+KE++RLHPP P++  RE  +++ + GYTIP +TRVL+N 
Sbjct  344   KGKETFNEDIIEDLKYLKQVVKESLRLHPPAPLLVPRECREETNINGYTIPLKTRVLVNV  403

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
              AI RDPQYWED ESF PERFE   +DF   + F+Y+PFG+G+RMCP I+FGL +VY PL
Sbjct  404   SAIMRDPQYWEDAESFIPERFEQSSVDFM-GNNFEYLPFGAGRRMCPAITFGLINVYLPL  462

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP G+ P  L +TE   +    K++++ I
Sbjct  463   AKLLYHFDWKLPDGLKPENLDMTECDGINASRKSELYLI  501



>ref|XP_004249519.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=510

 Score =   412 bits (1058),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 224/460 (49%), Positives = 326/460 (71%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IG+++ L +   +PH  L  L K+ G  LMHLQLGE+  +VVSS E+A+  +K HDL FA
Sbjct  46    IGSIHHLALEDGLPHHALTKLGKKHGP-LMHLQLGEISTIVVSSMEMAREVMKIHDLAFA  104

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
             +RP++++ D ++Y S+DI F  YG+YWRQMRK+C+ EL +A+ VRSFS IR++E   L+ 
Sbjct  105   SRPKLVSLDIILYKSTDIAFCSYGDYWRQMRKICVLELFTAKNVRSFSSIRREEGSNLVQ  164

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              +RSS+  G PIN+  +++ + +SI C+AAFG+ L   E+ +  V E+  +   FSVA+ 
Sbjct  165   FIRSST-RGEPINVTKQISWYESSITCKAAFGELLKDQEKFIGIVRELAELTGGFSVANI  223

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS KILH L+G +SR++KV +  D I+ DII +H+ N+ SGK G+G  G ED+VDVL++
Sbjct  224   FPSIKILHVLSGVRSRILKVHENVDAIVEDIISDHKRNIASGKRGNGAFGGEDLVDVLLR  283

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             L +S +L + IT+DNIKAI++D+F    +TSTT T+ AM EM++NP VLAKAQ EVRE F
Sbjct  284   LMESGALKIPITNDNIKAIMIDLFSAGTETSTTTTIWAMTEMIRNPSVLAKAQTEVREAF  343

Query  1197  KGRVEESN---VDKLAYLNLVIKETMR-LHPPGPVIYRENNKDSVVCGYTIPPRTRVLIN  1364
             KG+ E SN   +++L YL  V+KET R   P   +I RE  +++ + GYTIP +TRV++N
Sbjct  344   KGK-ETSNEDVIERLKYLKQVVKETFRLHPPLPLLIPRECREETNINGYTIPLKTRVVVN  402

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              +++ RDP+YWED ESF PERFE   +DF   + F+Y+PFG+G+R+CPGI+FGL +VY P
Sbjct  403   VYSMGRDPKYWEDAESFIPERFEGSSVDFM-GNNFEYLPFGAGRRICPGITFGLINVYLP  461

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA+LLYHFDW+LPHG+    + + E   +    K++++ I
Sbjct  462   LANLLYHFDWKLPHGVKLEDVDMNEFSGITAARKSELYLI  501



>ref|XP_009770332.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=523

 Score =   412 bits (1058),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 223/459 (49%), Positives = 321/459 (70%), Gaps = 7/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVP-HVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL+  +   +P H TLR LS+++G  + HL+LGE+  +VVSS E+AK  +KT DL FA
Sbjct  61    IGNLHLFMNGRLPVHHTLRSLSRRYGP-IFHLRLGEISIIVVSSPEMAKEIMKTQDLRFA  119

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
             TRP  +A D + Y+ +DI+  PYG++WR MRKVCI ELLSA+ V+SF+ IRQ E   L+ 
Sbjct  120   TRPEFMAGDIIFYNYTDIITCPYGDHWRNMRKVCIVELLSAKMVKSFNSIRQAEMSSLIS  179

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              V S       IN+ D++  F +S+ CR+AFGK ++  ++L+  V +I  + + F +AD 
Sbjct  180   SVNSMPDDSL-INLSDKMFWFTSSVTCRSAFGKVIHDQDKLIMLVKDISSLAAGFDLADM  238

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS K LH +TG KS+M+KV ++ D I+ +I+ EH+ +  +GK  +GE+G ED++DVL++
Sbjct  239   FPSRKWLHKITGLKSKMLKVHKKVDAILENILNEHQESRANGKKSNGETGGEDLIDVLLR  298

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             + +S  L   IT++NIK++I DMF    +TS T  + AM EM++NP V+AKAQ EVREV 
Sbjct  299   VMESGELGTPITNENIKSVIFDMFLAGAETSATTIIWAMAEMIRNPSVMAKAQLEVREVL  358

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINA  1367
             KG+   E+ ++++L YLNLVIKET+RLHPP P +I RE  +++ +  Y IP +TRVL+N 
Sbjct  359   KGKRTFEDIDLEELKYLNLVIKETLRLHPPVPLLIPRECREETKIDKYIIPIKTRVLVNV  418

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI R+   W +PESF PERFE++ +DF R + F+++PFG+G+RMCPG+ FGL +V  PL
Sbjct  419   WAIGRESTNWHNPESFIPERFENNSIDF-RGNHFEFIPFGAGRRMCPGLLFGLVNVGHPL  477

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+ PHGI P  L +TE   +A G K+D+  I
Sbjct  478   AQLLYHFDWKTPHGIAPDNLNMTETIGVAGGRKDDLCLI  516



>emb|CDP07887.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   410 bits (1054),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 226/464 (49%), Positives = 327/464 (70%), Gaps = 30/464 (6%)
 Frame = +3

Query  237   RQWMKPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpav  416
             ++W + K+ +KLPP P KLP+IGN++ LVG + PH  LR L++Q G  LM+LQLGE+ ++
Sbjct  22    KEWKRSKAAQKLPPSPSKLPVIGNMHHLVG-SPPHHALRKLARQHGA-LMYLQLGEISSI  79

Query  417   vvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLS  596
             VVSS  +AK  +KTHDL FA R   L    +MY+SSDI   PYG+YWRQMRK+C  ELLS
Sbjct  80    VVSSPHLAKEIMKTHDLAFANRAEFLTSKILMYNSSDIACCPYGDYWRQMRKICTLELLS  139

Query  597   ARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGK-TLNRTE  773
             A+ VRSF  IRQDE+  LL  V++ + AG+ INI +++ ++ +S++CRAAFGK + +   
Sbjct  140   AKNVRSFGSIRQDEASHLLASVQALAAAGKLINISEKLYSYTSSMVCRAAFGKVSKDLHR  199

Query  774   ELVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNL  953
             E ++  +E   + S+F ++D FPS+KILH L   KS++VK+  + D+++G+II +H +N 
Sbjct  200   EFLQLTSESAPLSSTFDISDLFPSFKILHPLLSVKSQLVKIHLKMDKLLGNIIDQHVDNR  259

Query  954   gsgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAM  1133
                   +GESG+ED++DVL+++K+S  L   IT++NIKAI++D+F    +TS+T    AM
Sbjct  260   ARTNMATGESGNEDLIDVLLRVKESGDLQFPITNNNIKAIVIDVFSAGTETSSTTVEWAM  319

Query  1134  VEMVKNPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENN  1307
              EMV+NP V+AKAQ+E+R  FKG  ++EE+++ +L       KE   +            
Sbjct  320   SEMVRNPNVMAKAQSEIRTAFKGKKKIEETDIQEL-------KEQCEIE-----------  361

Query  1308  KDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFG  1487
                   GYTIP +TRVL+NAWAI RDP+YW+DPESFKP+RF+ +P+DFT  + F+Y+PFG
Sbjct  362   ------GYTIPVKTRVLVNAWAIGRDPEYWDDPESFKPDRFKTNPVDFT-GTHFEYLPFG  414

Query  1488  SGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTE  1619
             +G+RMCPGISFGLA+V  PLA LLYHF+W+LP+G+ P  L ++E
Sbjct  415   AGRRMCPGISFGLANVDLPLALLLYHFNWKLPNGLDPCDLDMSE  458



>ref|XP_009612418.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=497

 Score =   410 bits (1055),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 223/458 (49%), Positives = 311/458 (68%), Gaps = 14/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G+++ ++G  +PH  L +L+K++G  LMHLQLGE+  VVV+S E+AK  LKTHDL FA+
Sbjct  42    LGSMFHILG-GLPHHVLTNLAKKYGP-LMHLQLGEMSVVVVTSPEMAKEVLKTHDLAFAS  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA + V+Y+ SDI F PYG+YWRQMRK+C+ ELLSA+ V+SFS IR+DE H +++ 
Sbjct  100   RPKLLAAEIVIYNCSDIAFCPYGDYWRQMRKICMIELLSAKNVKSFSSIRRDEVHGMIEF  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              RSS+  G+ +NI   +  F +S+ CR+AFGK     +EL+  V     +V  F VAD F
Sbjct  160   FRSST--GKQVNITKRIYQFASSMTCRSAFGKVFKEQDELILLVKRNTALVEGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G K++++ V  + D I+ +II E +         + E G E ++DVL++L
Sbjct  218   PSLKFLHVLSGMKAKVMDVHHKLDVILENIINERKK------IATDELGDEGLIDVLLRL  271

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                  L   IT+DNIKAII D+F    +TS+     AMVEM+KN  +LAKAQAEVR+ F+
Sbjct  272   MKEGGLQFPITNDNIKAIIFDIFSAGTETSSATVDWAMVEMMKNQSILAKAQAEVRKTFR  331

Query  1200  GR--VEESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+   +E++V++L YL LVIKET     P   ++ RE  +++ + GYTIP +T+V+IN W
Sbjct  332   GKETFDENDVEELKYLKLVIKETLRLHPPFPLLLPRECREETDINGYTIPFKTKVMINVW  391

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW D E FKPERFE + MDF   + F+Y+PFGSG+R CPGISFGLA+VY PLA
Sbjct  392   AIGRDPKYWNDAEIFKPERFEHNSMDFV-GNNFEYLPFGSGRRNCPGISFGLANVYFPLA  450

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP GI    L  TE        K++++ I
Sbjct  451   QLLYHFDWKLPTGINSSELDFTESAGATCSRKSNLYLI  488



>ref|XP_011073878.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=519

 Score =   411 bits (1057),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 219/458 (48%), Positives = 307/458 (67%), Gaps = 18/458 (4%)
 Frame = +3

Query  333   VPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFATRPRVLACDEVM  512
             +P  + + L+K +G D+MHL+LGEV  +V+SS  +AK  LKT D  FA RP  +A   + 
Sbjct  58    LPFRSFKTLAKTYG-DIMHLKLGEVSTIVISSPAIAKEALKTRDPMFADRPESVAAKIMW  116

Query  513   YDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDRVRSSSGAGRPI  692
             YD  DI FSPY EYWRQMRK+CI ELLSA+ VRSF  IR DE   L+  +RSS  AG  I
Sbjct  117   YDYVDIAFSPYNEYWRQMRKICIVELLSAKNVRSFGSIRNDEIALLMQTIRSS--AGSVI  174

Query  693   NIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTFPSWKILHFLTG  872
             ++ + +    +SI CRAA+GK     + L+K +N+ ++    F +AD FPS K+L+ L+ 
Sbjct  175   DLTERIFKLTSSITCRAAYGKVCRDRDALIKLMNDSIVFAGGFMLADLFPSSKLLNVLSW  234

Query  873   EKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesg------------seDIVDVLIK  1016
              K R+V++R++ D I+ DII EH+ NL   ++                  +ED+VDVL++
Sbjct  235   NKMRLVRMRRKLDVILDDIINEHKVNLARIRSTEVSEKGDVTRRGNGELGNEDLVDVLLR  294

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             L+ S  L   I +DNIKA+I DMF GA +TS++    AMVE+V+NPRV AKAQAEVR+ F
Sbjct  295   LQGSGELKFPIANDNIKAVIYDMFSGATETSSSTLDWAMVELVRNPRVRAKAQAEVRQAF  354

Query  1197  K-GR-VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             K GR ++E+ V KL YL LV+KE +RLHP  P++ R + +DS + GY IP +T+VL+N W
Sbjct  355   KDGRSIDENEVGKLKYLKLVVKEVLRLHPATPLVPRASREDSEINGYYIPAKTKVLVNNW  414

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
              + R+P Y+ + ESF+PERFE + +DF   + F+Y+PFG+GKRMCPG++FGLASV  PLA
Sbjct  415   GMGRNPNYFPNAESFEPERFESNGIDFN-GANFEYLPFGAGKRMCPGMTFGLASVELPLA  473

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             HLLY+F+WELP GI P  L +TE P ++   K+ +  +
Sbjct  474   HLLYNFNWELPKGIKPSDLDMTENPGISAPRKHHLHIV  511



>sp|O81974.1|C71D8_SOYBN RecName: Full=Cytochrome P450 71D8; AltName: Full=Cytochrome 
P450 CP7 [Glycine max]
 emb|CAA71517.1| putative cytochrome P450 [Glycine max]
Length=504

 Score =   410 bits (1053),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 212/459 (46%), Positives = 316/459 (69%), Gaps = 8/459 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L +  ++P   L+ L +++G  LMHLQLGE+  +VVSS ++A   +KTHD+ F 
Sbjct  43    IGNLHQLALAASLPDQALQKLVRKYGP-LMHLQLGEISTLVVSSPKMAMEMMKTHDVHFV  101

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP++LA   ++Y ++DI F+PYG+YWRQ+RK+C  ELLSA+ V+SFS+IRQDE+ +L+ 
Sbjct  102   QRPQLLAPQFMVYGATDIAFAPYGDYWRQIRKICTLELLSAKRVQSFSHIRQDENKKLIQ  161

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              + SS  AG PI++  ++ + + + + RAAFGK  +  +E +  V + + M   F V D 
Sbjct  162   SIHSS--AGSPIDLSGKLFSLLGTTVSRAAFGKENDDQDEFMSLVRKAITMTGGFEVDDM  219

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEH-RNNLgsgktgsgesgseDIVDVLI  1013
             FPS K LH LT +K+++  V Q  D+I+ DI+++H        +    E+  ED+VDVL+
Sbjct  220   FPSLKPLHLLTRQKAKVEHVHQRADKILEDILRKHMEKRTRVKEGNGSEAEQEDLVDVLL  279

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +LK+S SL + +T +NIKA+I ++F    DTS +    AM EM+KNP+V  KAQAE+R++
Sbjct  280   RLKESGSLEVPMTMENIKAVIWNIFAAGTDTSASTLEWAMSEMMKNPKVKEKAQAELRQI  339

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINA  1367
             FKG+  + E+++++L+YL  VIKET+RLHPP  +I RE    + + GY IP +T+V+IN 
Sbjct  340   FKGKEIIRETDLEELSYLKSVIKETLRLHPPSQLIPRECIISTNIDGYEIPIKTKVMINT  399

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDPQYW D + F PERF D  +DF + + F+Y+PFG+G+RMCPG++FGLAS+  PL
Sbjct  400   WAIGRDPQYWSDADRFIPERFNDSSIDF-KGNSFEYIPFGAGRRMCPGMTFGLASITLPL  458

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHF+WELP+ + P  L + E   M +  KN +F I
Sbjct  459   ALLLYHFNWELPNKMKPEDLDMDEHFGMTVARKNKLFLI  497



>ref|XP_003610580.1| Cytochrome P450 [Medicago truncatula]
 gb|AES92777.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=503

 Score =   409 bits (1051),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 214/462 (46%), Positives = 314/462 (68%), Gaps = 16/462 (3%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L +G ++PH TLRDLS ++G  LM+LQLGE+ AVVVSS ++AK  +KTHDL F 
Sbjct  47    IGNLHQLALGGSLPHHTLRDLSNKYGP-LMYLQLGEISAVVVSSPDLAKEIMKTHDLSFV  105

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP +LA   + YDS+DI+++PYG+YWRQMRK+C ++LLSA+ V  FS IR++E  +L+ 
Sbjct  106   QRPELLAPKILSYDSTDIVYAPYGDYWRQMRKICTSQLLSAKRVHYFSSIREEEVQKLIQ  165

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              ++ S     P+N+     + +++ + RAAFGK     +EL+  + + + M S F  AD 
Sbjct  166   SIQVS--LSLPLNVTKTAFSLVSTFVSRAAFGKKSKYEDELLSLLKQTVEMASGFDPADL  223

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS+K +H +T  K+++  ++++ D+I+  IIKEH++N             E++VDVL++
Sbjct  224   FPSFKPIHLITRTKAKLQNMQKKLDKILESIIKEHQSN------SIHGKQGENLVDVLLR  277

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             ++ SD+  + ITDDN+KA++ DMF    DTS T+   AM E++KN RV+ KAQ+E+RE  
Sbjct  278   VQQSDNFDIPITDDNVKAVLWDMFAAGSDTSATVIEWAMSELMKNSRVMKKAQSEIREAV  337

Query  1197  KG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             KG  R+ ES++ +L+YL  VIKETMRLHPP  ++ RE  +   + GY IP +T V++NAW
Sbjct  338   KGKKRIYESDLHELSYLKSVIKETMRLHPPFTLLPRECREACNIDGYEIPIKTSVIVNAW  397

Query  1371  AISRDPQYWEDPESFKPERFEDDP-MDFTR---SSQFKYMPFGSGKRMCPGISFGLASVY  1538
             AI RDP++W D + F PERF D    DF +   ++ F YMPFG G+RMCPGIS GLA++ 
Sbjct  398   AIGRDPKHWYDAKKFIPERFNDSTGFDFNKLNNNNSFDYMPFGGGRRMCPGISLGLANIE  457

Query  1539  TPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              PLA LLYHF+WELP+G+ P  L +TE    A   +N ++ I
Sbjct  458   LPLAALLYHFNWELPNGMKPEDLDMTEAFGAAAARRNGLYLI  499



>emb|CDP07882.1| unnamed protein product [Coffea canephora]
Length=556

 Score =   410 bits (1053),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 225/465 (48%), Positives = 332/465 (71%), Gaps = 8/465 (2%)
 Frame = +3

Query  237   RQWMKPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpav  416
             ++W + ++ +KLPP P KLP+IGN++ L+G   PH  L  L+++ G  LMHLQLGE+ ++
Sbjct  22    KEWRRSQAAKKLPPSPSKLPIIGNMHHLIGSQ-PHQALTKLAQKHGA-LMHLQLGEISSI  79

Query  417   vvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLS  596
             +VSS+ +AK  +KTHDL FA R  +L    +MY+SSDI F PYG+Y RQ+RK+C  ELLS
Sbjct  80    IVSSSHLAKEIMKTHDLSFANRSEILLSKIIMYNSSDIGFCPYGDYLRQVRKICALELLS  139

Query  597   ARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGK-TLNRTE  773
             A+ V+SF  IRQDE+  L+  +R+ + AG  I+  D+V ++  S +CRAAFGK + +   
Sbjct  140   AKKVQSFGSIRQDEALHLVKSIRNLADAGEVIHFTDKVHSYTCSTVCRAAFGKVSKDVHS  199

Query  774   ELVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNL  953
             + ++ + EI+ + S+F ++D  PS+K+LH L   K ++VK+  + D ++ +II +H NNL
Sbjct  200   KFLQLMCEIVPLSSTFDISDLLPSFKMLHPLLSVKRQLVKIHLKMDRLLVNIIDQHTNNL  259

Query  954   gsgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAM  1133
                   +GE G+ED++DVL+++K S  L + IT+DNIKAI++D+F    +TS+T    AM
Sbjct  260   -QRNMSTGEYGNEDLIDVLLRVKHSGDLQIPITNDNIKAIVIDVFSAGTETSSTTVDWAM  318

Query  1134  VEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVIKET-MRLHPPGPVIYREN  1304
              EM++NP V+AKAQ+E+R  FKG+   EE +V +L YL LVI+ET     P   ++ RE 
Sbjct  319   SEMIRNPSVMAKAQSEIRTAFKGKQMFEEDDVQELKYLKLVIRETLRLHPPLPLLVPREC  378

Query  1305  NKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPF  1484
              ++  + GY IP +TRVL+NAWA+ RDPQYW+DPESFKPERFE++P+DF   + F+Y+PF
Sbjct  379   REECEIDGYVIPVQTRVLVNAWAMGRDPQYWDDPESFKPERFENNPVDFA-GTHFEYLPF  437

Query  1485  GSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTE  1619
             G+G+RMCPGI FGLA+VY PLA LLYHF+W+LP+G+ P+ L ++E
Sbjct  438   GAGRRMCPGIQFGLANVYVPLAFLLYHFNWKLPNGLDPNDLDMSE  482



>gb|KHN42275.1| Cytochrome P450 71D8 [Glycine soja]
Length=511

 Score =   408 bits (1048),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 214/460 (47%), Positives = 322/460 (70%), Gaps = 14/460 (3%)
 Frame = +3

Query  300   IGNLYRLVGPN-VPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L G   +PH TL++LS+++G  LMHLQLGE+ AVVVSS+++AK  +KTHDL+F 
Sbjct  47    IGNLHQLAGAGTLPHHTLQNLSRKYGP-LMHLQLGEISAVVVSSSDMAKEIMKTHDLNFV  105

Query  477   TRPRVLACDEVM-YDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLL  653
              RP +L C ++M YDS+DI F+PYG+YWRQMRK+C  ELLSA+ V+SFS+IR++E  +L+
Sbjct  106   QRPELL-CPKIMAYDSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSFIREEEVAKLI  164

Query  654   DRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
               ++  + AG P+N+   V   ++++I RAAFGK     ++L+  + + + +   F +AD
Sbjct  165   QSIQLCACAGSPVNVSKSVFFLLSTLISRAAFGKKSEYEDKLLALLKKAVELTGGFDLAD  224

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS K +H +T  K+++  +++E D+I+ +II +H++N             E++VDVL+
Sbjct  225   LFPSMKPIHLITRMKAKLEDMQKELDKILENIINQHQSN------HGKGEAEENLVDVLL  278

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++ S SL + +T +NIKA+I D+FG   DTS T+   AM E++KNPRV+ KAQAE+RE 
Sbjct  279   RVQKSGSLEIQVTINNIKAVIWDIFGAGTDTSATVLEWAMSELMKNPRVMKKAQAEIREA  338

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMR-LHPPGPVIYRENNKDSVVCGYTIPPRTRVLIN  1364
             F+G+  + ES+V +L+YL  VIKETMR   P   ++ RE  +   + GY IP +T+V++N
Sbjct  339   FRGKKTIRESDVYELSYLKSVIKETMRLHPPVPLLLPRECREPCKIGGYEIPIKTKVIVN  398

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWA+ RDP++W D E F PERF+    DF + S F+Y+PFG+G+RMCPGI  G+A+V  P
Sbjct  399   AWALGRDPKHWYDAEKFIPERFDGTSNDF-KGSNFEYIPFGAGRRMCPGILLGIANVELP  457

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             L  LLYHFDWELP+G+ P  L +TE    A+G KN+++ +
Sbjct  458   LVALLYHFDWELPNGMKPEDLDMTEGFGAAVGRKNNLYLM  497



>ref|XP_003529672.2| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=522

 Score =   408 bits (1048),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 214/460 (47%), Positives = 322/460 (70%), Gaps = 14/460 (3%)
 Frame = +3

Query  300   IGNLYRLVGPN-VPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L G   +PH TL++LS+++G  LMHLQLGE+ AVVVSS+++AK  +KTHDL+F 
Sbjct  58    IGNLHQLAGAGTLPHHTLQNLSRKYG-PLMHLQLGEISAVVVSSSDMAKEIMKTHDLNFV  116

Query  477   TRPRVLACDEVM-YDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLL  653
              RP +L C ++M YDS+DI F+PYG+YWRQMRK+C  ELLSA+ V+SFS+IR++E  +L+
Sbjct  117   QRPELL-CPKIMAYDSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSFIREEEVAKLI  175

Query  654   DRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
               ++  + AG P+N+   V   ++++I RAAFGK     ++L+  + + + +   F +AD
Sbjct  176   QSIQLCACAGSPVNVSKSVFFLLSTLISRAAFGKKSEYEDKLLALLKKAVELTGGFDLAD  235

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS K +H +T  K+++  +++E D+I+ +II +H++N             E++VDVL+
Sbjct  236   LFPSMKPIHLITRMKAKLEDMQKELDKILENIINQHQSN------HGKGEAEENLVDVLL  289

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++ S SL + +T +NIKA+I D+FG   DTS T+   AM E++KNPRV+ KAQAE+RE 
Sbjct  290   RVQKSGSLEIQVTINNIKAVIWDIFGAGTDTSATVLEWAMSELMKNPRVMKKAQAEIREA  349

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMR-LHPPGPVIYRENNKDSVVCGYTIPPRTRVLIN  1364
             F+G+  + ES+V +L+YL  VIKETMR   P   ++ RE  +   + GY IP +T+V++N
Sbjct  350   FRGKKTIRESDVYELSYLKSVIKETMRLHPPVPLLLPRECREPCKIGGYEIPIKTKVIVN  409

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWA+ RDP++W D E F PERF+    DF + S F+Y+PFG+G+RMCPGI  G+A+V  P
Sbjct  410   AWALGRDPKHWYDAEKFIPERFDGTSNDF-KGSNFEYIPFGAGRRMCPGILLGIANVELP  468

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             L  LLYHFDWELP+G+ P  L +TE    A+G KN+++ +
Sbjct  469   LVALLYHFDWELPNGMKPEDLDMTEGFGAAVGRKNNLYLM  508



>emb|CDP08465.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   407 bits (1047),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 214/459 (47%), Positives = 322/459 (70%), Gaps = 9/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG ++ L+G ++PH  L++L++++G  LMHLQLGEV  ++V+S  +AK  +KTHDL FAT
Sbjct  49    IGCMHHLIG-SLPHRCLKNLAQKYG-SLMHLQLGEVSLIIVTSPNLAKEIMKTHDLSFAT  106

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   + YD+ DI FSPYG+YWRQMRK+ + ELLSA++VRSF  IRQDE   L++ 
Sbjct  107   RPELLAFKIICYDTKDIAFSPYGDYWRQMRKISVLELLSAKSVRSFENIRQDEVLHLVEA  166

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTE-ELVKFVNEILIMVSSFSVADT  836
             +R    AG+ +N+ ++V ++ +S++CRAAFG+     + E V+ + ++  +   F +AD 
Sbjct  167   IRPL--AGKKVNLTEQVFSYASSMVCRAAFGQVSKEDQYEFVQLMKQVAALAGGFDIADL  224

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS+KILH LTG K +++K+  + D I   +I+EH  N    K    +S  ED++DVL++
Sbjct  225   FPSYKILHVLTGMKPKLLKIHHKMDSIFEKLIEEHIKNQTRNKKLVADSNQEDLIDVLLR  284

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             ++DS +L   IT++NIKAII DMF    +TS++    AM EM++NP V+AKAQ E+R+ F
Sbjct  285   IRDSGNLQFPITNNNIKAIIFDMFAAGTETSSSTVEWAMSEMIRNPDVMAKAQREIRQSF  344

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINA  1367
             KG+  ++E++V  L YL LVIKET+RLHPP P++     ++   + GYTIP +T+V+IN 
Sbjct  345   KGKQNIDEADVQGLRYLKLVIKETLRLHPPFPLLLPRECREQCELNGYTIPIKTKVMINF  404

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP++W DPESF PERF+++P+DFT  + F+++PFG+G+R+CPG+SF LA+V  PL
Sbjct  405   WAIGRDPEHWSDPESFVPERFDNNPVDFT-GNHFEFVPFGAGRRICPGMSFALANVELPL  463

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LL HF+W LP G+    L + E   +    KN+++ +
Sbjct  464   ALLLCHFNWRLPDGMKSRELDMLENNGITATRKNNLYLV  502



>gb|KEH34013.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=509

 Score =   407 bits (1047),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 217/458 (47%), Positives = 309/458 (67%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN++ L+    PH  L DL+K++G  LMHLQLGEV  +V+SSAE AK  +KTHD+ FAT
Sbjct  47    IGNIHNLLSSQ-PHRKLSDLAKKYGP-LMHLQLGEVSTIVISSAEFAKEVMKTHDIHFAT  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+VLA D + Y+S+ I FSPYG+YWRQ RK+C  ELLS + V S+  IR++    L+  
Sbjct  105   RPKVLAIDIMSYNSTSISFSPYGDYWRQARKICTLELLSLKRVNSYQPIREEVFSNLIKS  164

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S +G+  PIN  + V + + +I+ RAAFG      E+ +  V E + + + F + D+F
Sbjct  165   IASENGS--PINFTEAVLSSIYTIVSRAAFGNKCKDQEKFISVVKESVKIAAGFDLGDSF  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K L ++TG + ++ K  Q+TDEI+ +II EH+    +   G     +ED+VD+L+K 
Sbjct  223   PSSKWLQYVTGLRPKIEKFHQQTDEILENIIDEHKREKYTKVKGDQGEVAEDLVDILLKY  282

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             +D      S+T DNIKAIILD+FGG  +TS + T  AM+EM++NPR++ KAQ EVR+V  
Sbjct  283   EDGSDQDFSLTKDNIKAIILDIFGGGGETSASTTDWAMIEMIRNPRIMKKAQDEVRDVIK  342

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              KGRV+E  +++L+YL  V+KET+RLHP  P++  RE  K   + GY IP +T+V+INAW
Sbjct  343   MKGRVDEKCINELSYLKSVVKETLRLHPSVPLLLPRECGKACEIHGYHIPVKTKVIINAW  402

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP YW +PE F PERF D+ +D+ + S F+Y+PFG G+R+CPG +FGL +V   LA
Sbjct  403   AIARDPNYWTEPEKFYPERFIDNGIDY-KGSNFEYIPFGGGRRICPGSTFGLRNVELALA  461

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP GI    L +TE   + M  K+D+  +
Sbjct  462   MLLYHFDWKLPGGIKCDELDMTEQFGVTMRRKDDLLLL  499



>ref|XP_006357930.1| PREDICTED: cytochrome P450 71D7-like [Solanum tuberosum]
Length=498

 Score =   406 bits (1044),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 214/460 (47%), Positives = 317/460 (69%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L+G    H  LR+L++++G  LM+LQLGE+P V++SS+ +AK  L THDL FA 
Sbjct  41    IGSLHHLIGRGHLHPNLRNLAQRYGP-LMYLQLGEIPVVIISSSTIAKELLTTHDLAFAD  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+  +   + Y++ DI+FSPY  Y +QMRK+C  +L SA+ V+SFS IR+DE   L+  
Sbjct  100   RPQSTSTTIIFYNNKDIVFSPYDNYCKQMRKICKVQLFSAKMVKSFSTIRKDEISSLISS  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RS+  +  PIN+ +++  F  S+ C AAFGK     +E +K + +ILI+ S F V D F
Sbjct  160   IRSTRDS--PINMTEKIFWFTNSVTCSAAFGKMFKDRDEFIKLLKDILILASGFCVTDLF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEH-RNNLgsgktgsgesgseDIVDVLIK  1016
             PSWK+LH L+G +SR++   ++ DEIM DI+KEH  N     K    + G ED+VDVL+K
Sbjct  218   PSWKLLHKLSGAESRLMNAHKKVDEIMEDILKEHLENKANRNKGIGDQFGGEDLVDVLLK  277

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             + +   L   IT+D+IKA+ILD+F    +TS+TIT+  + EM+KN  ++AKAQ EVR+V 
Sbjct  278   VMEDAELECPITNDHIKAVILDIFIAGSETSSTITIWVLSEMMKNSTIMAKAQKEVRQVL  337

Query  1197  KGRV---EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             +G+     E +++KL YL LVIKET+RLH P P++  RE  + + + GYTIP +T++L+N
Sbjct  338   RGKKNYDNEEDLEKLTYLKLVIKETLRLHTPAPLLGPRECREQTNIDGYTIPLKTKILVN  397

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWA++RDP+ W DPE F PERFE+  +DF   + F+++PFG+G+RMCPG+ FGL +V   
Sbjct  398   AWALARDPESWHDPECFIPERFENSSIDFL-GNHFEFIPFGAGRRMCPGVLFGLTNVELS  456

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+G+ P  L +TE   ++ G + D++ +
Sbjct  457   LAQLLYHFEWELPYGMKPKDLDMTETYGLSGGKQRDLYLV  496



>ref|XP_009606841.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like, partial 
[Nicotiana tomentosiformis]
Length=399

 Score =   402 bits (1034),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 272/382 (71%), Gaps = 5/382 (1%)
 Frame = +3

Query  525   DILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVD  704
             DI FSPYG+ WRQMRK+C+ ELL+A+ VRSFS IR+DE  RL+D +RSSS +G  +N   
Sbjct  9     DIAFSPYGDQWRQMRKICVMELLNAKNVRSFSSIRRDEVVRLIDSIRSSSSSGELVNFTQ  68

Query  705   EVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSR  884
              +  F +S+ CR+AFG+ L   +   K + E++ +   F V D FPS+K LH L+G K +
Sbjct  69    RIIWFASSMTCRSAFGQVLKGQDIFAKKIREVIGLAEGFDVVDIFPSYKFLHVLSGMKRK  128

Query  885   MVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNI  1064
             ++    + D I+ D+I EH+ NL +    +G  G ED++DVL++LK+  SL   IT++NI
Sbjct  129   LLNAHLKVDAIVEDVINEHKKNL-AAGKSNGALGGEDLIDVLLRLKNDTSLQFPITNNNI  187

Query  1065  KAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAY  1238
             KA+I+DMF    +TS+T TV AM EM+KNP V  KAQAEVRE F+ +V  +E++V++L Y
Sbjct  188   KAVIVDMFAAGTETSSTTTVWAMAEMMKNPSVFTKAQAEVREAFRDKVSFDENDVEELKY  247

Query  1239  LNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESF  1415
             L LVIKET+RLHPP P++  RE  +D+ + GYTIP +T+V++N WA+ RDP+YW+D ESF
Sbjct  248   LKLVIKETLRLHPPSPLLVPRECREDTDINGYTIPAKTKVMVNVWALGRDPKYWDDAESF  307

Query  1416  KPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGIT  1595
             KPERFE   MDF   + F+++PFG G+R+CPG+SFGLA++Y PLA LLYHFDW+LP GI 
Sbjct  308   KPERFEQCSMDFF-GNNFEFLPFGGGRRICPGMSFGLANLYLPLAQLLYHFDWKLPTGIK  366

Query  1596  PHTLKLTELPRMAMGVKNDIFF  1661
             P  L LTEL  + +  K D++ 
Sbjct  367   PRDLDLTELSGITIARKGDLYL  388



>ref|XP_009794456.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana sylvestris]
Length=499

 Score =   405 bits (1042),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 220/459 (48%), Positives = 318/459 (69%), Gaps = 9/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L    V H  LR+LS++FG  +M+LQLGEVP VVVSS  +AK  LKTHDL FA+
Sbjct  39    IGSVHHLTS-GVSHRVLRNLSQKFGP-IMYLQLGEVPTVVVSSPHMAKQILKTHDLAFAS  96

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP ++    + YD  DI FSPYG+YWR MRK+   ELLSA+ V+SFS IR+DE   LL  
Sbjct  97    RPEIMMGKIICYDCKDIAFSPYGDYWRHMRKLSTLELLSAKMVKSFSPIRRDELSSLLSS  156

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S      PIN+V+++  FM +  CR+AFGK     +EL+  ++    +   F +AD F
Sbjct  157   IESMGDL--PINLVEKLLWFMNAATCRSAFGKVCKDQKELITLIHRAQSLSGGFELADLF  214

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH ++G +S++++ R + D ++ +II  HR N  +GK  +GESG+ED +DV  ++
Sbjct  215   PSKKFLHGISGMRSKLMEARNKIDVVLDNIINVHRENRANGKCCNGESGAEDFIDVFQRV  274

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +S  LP  + +DNIKA+ILDMF    DTS++  + A+ EM+KNP V+AKAQAEVRE FK
Sbjct  275   MESGELPFPLENDNIKAVILDMFVAGSDTSSSTVIWALAEMIKNPSVMAKAQAEVREAFK  334

Query  1200  GRV---EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
             G+    E+++++KL+YLNLVIKET+RLHPP P++  RE  +++ + G+TIP +++VL+N 
Sbjct  335   GKKTCDEDTDLEKLSYLNLVIKETLRLHPPTPLLVPRECREETEIDGFTIPLKSKVLVNV  394

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP+ W +PE F PERFE+  ++FT  + F+ +PFG+G+R+CPGI FG+A V  PL
Sbjct  395   WAIGRDPENWGNPECFIPERFENSSIEFT-GNHFQLLPFGAGRRICPGIQFGMALVTLPL  453

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             AHLL++FDW+LP GI    L +TE   ++   + D++ I
Sbjct  454   AHLLHNFDWKLPEGINARDLDMTEANGISARREKDLYLI  492



>ref|XP_011082254.1| PREDICTED: premnaspirodiene oxygenase [Sesamum indicum]
Length=524

 Score =   406 bits (1044),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 211/459 (46%), Positives = 303/459 (66%), Gaps = 17/459 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ +   +VP  + RDL+K++G  +MHL+ GEVP +++SS E+AK  LK  D  FA 
Sbjct  47    IGHLHLIS--SVPFRSFRDLAKKYGP-IMHLKFGEVPGIIISSPEIAKKVLKEQDPVFAN  103

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  +A   + Y+  DI FSPYG+YWRQMRK+CI ELLS+++VRSF  IR DE   L+  
Sbjct  104   RPPAIAMQIMGYNYKDIGFSPYGDYWRQMRKICIMELLSSKSVRSFGSIRNDEVSSLVKF  163

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +++S  AG+P+N+ D++   M SI CRA+FG      + L+K + + + M   F +AD F
Sbjct  164   IQAS--AGKPVNLTDKIFWMMNSITCRASFGTVCKDNDALIKLLRDGMQMAGGFEIADVF  221

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS KI+  L+  K R+V + ++ D I+ DII EH+ NL             ++VDV ++L
Sbjct  222   PSSKIVSALSWTKWRLVMMGRKLDMILDDIINEHKVNLDKLARE-------NLVDVFLRL  274

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K+S  L   I +DNIKAI+ D+F  A +TS T     M E+++NP V+AKAQAEVR+VF 
Sbjct  275   KESGDLEFPIGNDNIKAILFDVFSAATETSATAIDWIMTELMRNPGVMAKAQAEVRQVFN  334

Query  1200  GR----VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINA  1367
             G     + E NV KL YL LVI+ET+RLHP  P + R + ++  + GYTIP   +VL+N+
Sbjct  335   GSRTTSINEDNVRKLNYLKLVIRETLRLHPSVPFLPRASREECTINGYTIPANVKVLVNS  394

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             W + RDP+YW +PESF+PERFE++ MDF     F+Y+PFGSG+RMCPGI+F LAS+  PL
Sbjct  395   WGMQRDPKYWTNPESFEPERFENNSMDFV-GGDFEYLPFGSGRRMCPGITFALASIELPL  453

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLY+F+W+LP G+ P  L + E P +    K+ ++ +
Sbjct  454   AQLLYNFNWKLPEGVKPENLDMIENPGLTASRKSKLYVV  492



>emb|CDP20312.1| unnamed protein product [Coffea canephora]
Length=469

 Score =   404 bits (1037),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 229/464 (49%), Positives = 318/464 (69%), Gaps = 46/464 (10%)
 Frame = +3

Query  237   RQWMKPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpav  416
             ++W + K+ +KLPP P KLP+IGN++ LVG + PH  LR L++Q G  LMHLQLGE+ ++
Sbjct  22    KEWKRSKAAQKLPPSPLKLPVIGNMHHLVG-SPPHHALRKLARQHGA-LMHLQLGEISSI  79

Query  417   vvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLS  596
             VVSS  +AK  +KTHDL FA R   L    +MY+SSDI   PYG+YWRQMRK+C  ELLS
Sbjct  80    VVSSPHLAKEIMKTHDLAFANRAEFLTSKILMYNSSDIACCPYGDYWRQMRKICTLELLS  139

Query  597   ARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE  776
             A+ VRSF  IRQDE+  L+  V++ + AG  INI +++ ++ +S+I              
Sbjct  140   AKNVRSFGSIRQDEASHLVASVQALATAGELINISEKLYSYTSSMI--------------  185

Query  777   LVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLg  956
                                       LH L   KS++VK+  + D+++G+II +H +NL 
Sbjct  186   --------------------------LHPLLSAKSQLVKIHLKMDKLLGNIIDQHIDNLA  219

Query  957   sgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMV  1136
                  +GESG+ED++DVL+++K+S  L   IT++NIKAI++D+F    +TS+T    AM 
Sbjct  220   RTNMATGESGNEDLIDVLLRVKESGDLQFPITNNNIKAIVIDVFSAGTETSSTTVEWAMS  279

Query  1137  EMVKNPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENN  1307
             EMV+NP V+AKAQ+E+R  FKG  ++EE+++ +L YL LVIKET+RLHPPGP++  RE  
Sbjct  280   EMVRNPNVMAKAQSEIRTAFKGKKKIEETDIQELKYLRLVIKETLRLHPPGPLLVPRECR  339

Query  1308  KDSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFG  1487
             ++  + GYTIP +TRVLINAWAI RDP YW DPESFKPERF+ +P+DFT  + F+Y+PFG
Sbjct  340   EECEIEGYTIPVKTRVLINAWAIGRDPDYWNDPESFKPERFKSNPVDFT-GTHFEYLPFG  398

Query  1488  SGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTE  1619
             +G+RMCPGISFGLA+V+ PLA LLYHFDW+LP G+ P  L ++E
Sbjct  399   AGRRMCPGISFGLANVHLPLALLLYHFDWKLPDGLDPCDLDMSE  442



>gb|KDP39254.1| hypothetical protein JCGZ_01011 [Jatropha curcas]
Length=510

 Score =   405 bits (1041),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 214/457 (47%), Positives = 310/457 (68%), Gaps = 10/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L+G ++PH +L+ LS ++G  LMHL+LGEV  V+VSS E+AK  LKTHDLDFA 
Sbjct  48    IGNVHQLLG-SLPHQSLQKLSGKYGP-LMHLKLGEVSTVIVSSPEIAKQVLKTHDLDFAE  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  LA   + YDS+ I+FSPYG YWRQ+RK+C  ELLS + V+SF +IR+DE   L+  
Sbjct  106   RPPNLAPKIISYDSTHIVFSPYGAYWRQLRKICTMELLSPKRVQSFRFIREDEVLNLIKT  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  SS  G  INI + + +    I  RAAFGK     E  ++ + E+  + + FSVAD +
Sbjct  166   I--SSLEGSLINISEMIFSLTYGITSRAAFGKKYEDQETFIQVITEVSKIAAGFSVADLY  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K L   +G + ++ K+ ++ D I+  I+KEHRN +   +    +    D+VDVL++L
Sbjct  224   PSIKFLEQASGLRPKLGKLHEKADGILERIVKEHRNKMNRSEEIQEDD---DLVDVLLEL  280

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             ++   L   ++DDNIK +ILDMF    +TS+T    AM EM+KNPR+L KAQ EVR+V+K
Sbjct  281   QEHGDLEFPLSDDNIKTVILDMFSAGSETSSTTVEWAMSEMLKNPRILEKAQNEVRQVYK  340

Query  1200  --GRVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
               G V+E+++ +L YLN +IKET+RLHPP P+I RE+     + GY IP +T+VL+NAWA
Sbjct  341   NKGTVDETSIHELKYLNSIIKETLRLHPPLPLIPRESRARVEIIGYDIPIKTKVLVNAWA  400

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             I RDP+ W +PE+F PERF D+ + + + + F+++PFGSG+R+CPGISF L ++  PLA 
Sbjct  401   IGRDPKNWTEPENFCPERFLDNAISY-KGTDFEFIPFGSGRRICPGISFALPNIELPLAQ  459

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHFDW+L +G+    L +TE   + +  K D+F +
Sbjct  460   LLYHFDWKLGNGMKNEDLDMTEGYGLTIRRKQDLFLV  496



>ref|XP_006452553.1| hypothetical protein CICLE_v10008076mg [Citrus clementina]
 ref|XP_006474925.1| PREDICTED: cytochrome P450 71D11-like [Citrus sinensis]
 gb|ESR65793.1| hypothetical protein CICLE_v10008076mg [Citrus clementina]
Length=502

 Score =   404 bits (1039),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 212/457 (46%), Positives = 309/457 (68%), Gaps = 13/457 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++LVG ++PH  L+DL+K++G  LMHLQLGEV  +VVSS E AK  +KTHD+ FA 
Sbjct  47    IGNLHQLVG-SLPHHGLKDLAKKYGP-LMHLQLGEVSTIVVSSPEFAKQLMKTHDVTFAL  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP VLA   + YD+S I+FSPYG+ WRQ+RK+C++ELLSA+ V+SF  IR+ E   L++ 
Sbjct  105   RPPVLAAKIMSYDNSGIIFSPYGDCWRQLRKICVSELLSAKRVQSFRSIREAEVCNLINW  164

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  SS  G  IN+ ++V + M  I  RAAFG   +  E  V  + E   ++S F++AD F
Sbjct  165   I--SSNEGSVINLTEKVFSLMYGITSRAAFGNKSSEQEAFVSVMEETTKVISGFNIADLF  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+++L ++TG +S   K+ Q+ D I+  II +H+         +      D+VDVL+K+
Sbjct  223   PSFELLQWVTGFRSHAEKLHQQADRIVESIINDHKK------CETKNESDRDLVDVLLKI  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             ++  +L + ++  NIKA+I D+FG   +TS T    AM EM+KNP V+ KAQAEVREVF 
Sbjct  277   QEDGNLELPLSTHNIKAVISDIFGAGSETSATTVDWAMCEMMKNPGVMKKAQAEVREVFN  336

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
              KG+++E+ + ++ YL LV+KET+RL P  P+I RE  +   + G+ IP + R+++N+WA
Sbjct  337   RKGKIDETGISEMKYLKLVVKETLRLRPSAPLIPRECGESCEINGFNIPVKARIIVNSWA  396

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
               RDP YW  PESF PERF D  +DF + S F+Y+PFG+G+R+CPG+ +GLA+V  PLA 
Sbjct  397   TGRDPMYWTQPESFIPERFIDHSVDF-KGSNFEYIPFGAGRRICPGMLYGLANVEFPLAM  455

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHFDW+LP+G+    L++TE   + +  K D+  I
Sbjct  456   LLYHFDWKLPNGMNHEDLEMTETFGVTVRRKQDLCMI  492



>ref|XP_010064672.1| PREDICTED: cytochrome P450 71D11-like [Eucalyptus grandis]
Length=506

 Score =   404 bits (1038),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 216/458 (47%), Positives = 309/458 (67%), Gaps = 10/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L+G +  H  L +L+K +G  LMH+Q GEVP VV+SSAE+AK  +KTHD+ FAT
Sbjct  46    IGNLHQLLG-SPAHCALWELAKIYGP-LMHMQFGEVPHVVISSAEMAKEVMKTHDITFAT  103

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RPR+LA + + Y S+DI F+PY EYWRQ+RK+C  ELLSA+ V+SF +IR++E   L+  
Sbjct  104   RPRLLATEVLSYGSTDIAFAPYSEYWRQLRKICTLELLSAKRVQSFRHIREEEISNLVKW  163

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             V  +S AG PIN+   + +        AAFGK +   EE +  V E + + + F V D F
Sbjct  164   V--ASNAGSPINLTQRLFSTNYGATSIAAFGKKVKEQEEFITIVKEAIRLAAGFEVGDVF  221

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH +TG K R+ K+RQ+ D IM ++I+E           S E+  + +VDVL++ 
Sbjct  222   PSLKWLHVITGMKPRLEKLRQQLDRIMNNLIREKEEE--RANRSSDETTLDGLVDVLLRF  279

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
              D       +T DN+KA++LD+F    +TS T    A+ EM+KNPR+L KAQAEVREVF 
Sbjct  280   ADPSGPDFFLTTDNVKAVLLDIFAAGSETSATQVDWALAEMMKNPRILKKAQAEVREVFD  339

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +G+ +E+ + +L YL LVIKE +RL P  P++  RE  +   + GY IP +TRVL+NAW
Sbjct  340   RRGKADETGLPELEYLKLVIKECLRLRPSIPLLLPRECTERCEINGYEIPVKTRVLVNAW  399

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW+DPESF PERF+D P+D+ + + F+Y+PFG+G+R+CPG++FG+A+V  PLA
Sbjct  400   AIGRDPKYWDDPESFYPERFKDSPVDY-KGTSFEYIPFGAGRRICPGMNFGIANVELPLA  458

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDWELP G+    + ++E   ++   K D++ +
Sbjct  459   MLLYHFDWELPEGMKSEEMDMSETLGVSQRRKRDLYVV  496



>ref|XP_008227138.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 71D9-like [Prunus 
mume]
Length=512

 Score =   404 bits (1038),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 221/459 (48%), Positives = 315/459 (69%), Gaps = 10/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L G ++PH  LRDL+K++G  LMHL+LGEV AVVVSSAE AK  +KTHDL FA+
Sbjct  48    IGNLHQLAG-SLPHHGLRDLAKKYGP-LMHLKLGEVSAVVVSSAEFAKEVMKTHDLIFAS  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+VLA   + Y S++I F+PYGEYWRQ+RK+C  ELLSA+ VRS+  IR++E   L+  
Sbjct  106   RPQVLAARILSYGSTNIAFAPYGEYWRQLRKICTIELLSAKRVRSYRPIREEEIRNLIKS  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  +S AG PIN+  E+ +   +I  RAAFGK     E+ +  + E     S F++AD F
Sbjct  166   I--ASRAGSPINLTQEICSSAFTITSRAAFGKKTRDQEKFIYIMKEAAKAASGFALADVF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS  +LH L+G + ++ ++ +E D IMG+IIKEH+ ++            ED+VDVL+K 
Sbjct  224   PSVSLLHLLSGMRPKLERLHKEADRIMGNIIKEHQRDM-VTTXCVEGEAEEDLVDVLLKF  282

Query  1020  KD-SDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
              +  + L +S+T +NIKA+I D+FG   +TS+T    A+VEM++NPRV+  AQ EVREVF
Sbjct  283   HEHGNELELSLTTENIKAVIFDIFGAGSETSSTAVDWAIVEMIRNPRVMNMAQNEVREVF  342

Query  1197  --KGRVEESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINA  1367
               KG+V+E+ + ++ YLNLVIKET     P   ++ RE  +   + GY IP +++V++NA
Sbjct  343   NRKGQVDETCIREMKYLNLVIKETLRLHPPVPLLLPRECGEKCEIDGYEIPVKSKVIVNA  402

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP YW +PESF P RF D  +D+ + + F+Y+PFG+G+RMCPG+SFGLA++  PL
Sbjct  403   WAIGRDPNYWNEPESFNPNRFLDSSIDY-KGTNFEYIPFGAGRRMCPGVSFGLANIELPL  461

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP+G+    L +TE    A+  K+D+  I
Sbjct  462   ALLLYHFDWKLPNGMKHEDLDMTEAFGAAVKRKDDLHLI  500



>emb|CDP17903.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   403 bits (1035),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 213/457 (47%), Positives = 315/457 (69%), Gaps = 31/457 (7%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN++ L G  +PH+ LRDL+K++G  L+HLQLGEV  VVVSSAE+AK  L THD  F  
Sbjct  49    IGNIHNLFG-GLPHIVLRDLAKKYGP-LLHLQLGEVSTVVVSSAEMAKEVLVTHDPVFTN  106

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  LA + + YD  D++F+PYG++WRQ+RK+CITELLS + VRSFSYIR+DE  +L++ 
Sbjct  107   RPDRLAINIMWYDKQDMIFTPYGDHWRQLRKICITELLSNKNVRSFSYIRKDEIMKLMES  166

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RSS G    +N+ +    + T + CRAAFG     TE ++K + E +++ + F  AD F
Sbjct  167   IRSSQGLS--VNVTEMFFRYATYMTCRAAFGTISKDTETMIKCLKEAMVLAAGFDAADVF  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS KIL  ++G K +++K+  + DEI+ D+I +H+ N  SGK G+  SG ED++DVL++L
Sbjct  225   PSLKILPLISGLKRKLLKMHDKMDEILDDVINQHKLNHKSGKMGNAVSGEEDLIDVLLRL  284

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             ++S +L M ITD NIK ++ D+F    DTS+  +  AM E++K+PRV+AKAQAEVR+V K
Sbjct  285   QESGNLQMPITDRNIKGVLFDIFTAGTDTSSVTSEWAMSELMKHPRVMAKAQAEVRQVCK  344

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
             G+  +EE ++ KL                      EN +   V GY IP ++ VL+NA+A
Sbjct  345   GKETIEEDDIQKLV---------------------ENRE---VKGYMIPNKSHVLVNAYA  380

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             I+RDP+YW+DPE FKPERF+   +D+T  S F+++PFG+G+RMCPG++FG+A++  PLAH
Sbjct  381   IARDPEYWDDPEMFKPERFDQKSVDYT-GSDFQFLPFGTGRRMCPGVTFGVANIELPLAH  439

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LL+HFDW LP+G+ P+ L + E   +++  KN+++ +
Sbjct  440   LLFHFDWSLPNGMKPNDLDMDEAAGLSINRKNNLYLV  476



>ref|XP_011081964.1| PREDICTED: premnaspirodiene oxygenase-like [Sesamum indicum]
Length=513

 Score =   404 bits (1037),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 210/462 (45%), Positives = 313/462 (68%), Gaps = 16/462 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ +    +PH + ++L+K++G  LMH +LGEV AVVVSS  ++K  LK HD  FA 
Sbjct  46    IGHLHHI--GTLPHRSFQELAKKYGP-LMHFKLGEVTAVVVSSPTLSKEVLKVHDPTFAD  102

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  +A + + Y+SS+I FS YG+YWRQMRK+CI ELLSA+ V+SF  IR DE   L+D 
Sbjct  103   RPENIAGEILWYNSSNISFSQYGDYWRQMRKICILELLSAKNVKSFGSIRNDEVSHLVDS  162

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + +SSGA  P+++ +++    +SI CRAAFGK     ++L++   E + +VS F V+D +
Sbjct  163   IGASSGA--PVDLTEKIFMLTSSITCRAAFGKVCRDKDQLIEMFKEGITLVSGFDVSDLY  220

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesg--------seD  995
             PS KIL  ++  + +++++R++ D I+ DII EHR NL                   +ED
Sbjct  221   PSSKILRAISCNRRKLLRMRRKLDLILDDIIGEHRRNLAKIAADKDNLERRGNGEFGNED  280

Query  996   IVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQ  1175
             +VDVL++++ S  L   ITDDNIKA+I D+F    +TS+T     M E+++NP V+ K Q
Sbjct  281   LVDVLLRVQQSGELEFPITDDNIKAVIYDIFAAGTETSSTTVDWIMAELIRNPHVMGKVQ  340

Query  1176  AEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRT  1349
              E+R+ FKG   +E+++V  L YL LVIKE +RLH P P+I R + +D+ + GY IP R 
Sbjct  341   NEIRQTFKGNKTIEDADVQNLKYLKLVIKEGLRLHAPIPLIPRVSREDTEIAGYLIPARA  400

Query  1350  RVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLA  1529
             +VL+NAW + RDP+ W +PESF+PERF+++  DFT  + F+Y+PFG+G+RMCPG++FGLA
Sbjct  401   KVLVNAWGMGRDPEIWSNPESFEPERFDNNSTDFT-GNHFEYIPFGAGRRMCPGMTFGLA  459

Query  1530  SVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDI  1655
             SV  PLAHLLY+FDW+LP G++P+ L + E P +    + ++
Sbjct  460   SVELPLAHLLYNFDWKLPDGMSPNDLDMVERPAITAARRQNL  501



>ref|XP_007156882.1| hypothetical protein PHAVU_002G025100g [Phaseolus vulgaris]
 gb|ESW28876.1| hypothetical protein PHAVU_002G025100g [Phaseolus vulgaris]
Length=506

 Score =   403 bits (1036),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 200/460 (43%), Positives = 320/460 (70%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGP-NVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L G  ++PH     L+ ++G  LMH QLGE+  V+ SS  +AK  +KT+D+ F 
Sbjct  45    IGNLHQLSGAASLPHHAFHKLAHKYGP-LMHFQLGEMSTVIASSPGMAKEIMKTNDIAFV  103

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP+ L  D + Y   +I+F+PYG++WRQ++K+C+ ELLSA+ V+SFS+IR+DE+ + +D
Sbjct  104   QRPQFLFGDILSYGGKNIVFAPYGDHWRQLKKICVLELLSAKRVKSFSFIREDETAKFID  163

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFG-KTLNRTEELVKFVNEILIMVSSFSVAD  833
              +R S  AG PIN+  ++ + +++ + RAAFG K  ++ E +V  + +++   + F   D
Sbjct  164   SIRKS--AGSPINLTAKIYSLVSASVFRAAFGGKNKDQDEFVVPLMRKVIEAAAGFDFVD  221

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS K +HF+TG+++++ +++++ D+++ +++KEH       K    E   ED VDVL+
Sbjct  222   FFPSLKFIHFITGKRAKLEELQKQVDDVLDNVVKEHEEKRKEAKEDGVEVEDEDFVDVLL  281

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++ +D+L + +T   IKA+ILD+F    DTS ++    + E++K+PRV+ KAQ+E+RE 
Sbjct  282   RIQQNDTLDIKMTTIQIKALILDVFVAGSDTSASVLEWVVAEIMKSPRVMEKAQSEIREA  341

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLIN  1364
             F+G+  + ES++D+L YL LVIKET+RLHPP P +I RE  K + + GY IP +T+V+IN
Sbjct  342   FRGKETIHESDLDELNYLKLVIKETLRLHPPVPLLIPRECTKLTNIGGYEIPKKTKVMIN  401

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWA+ RDP+YW D E F PERFE + +DF R + F+Y+PFG+G+RMCPG++FGLAS+  P
Sbjct  402   AWALGRDPEYWSDAERFIPERFEGNSVDF-RGNNFEYVPFGAGRRMCPGMTFGLASIMLP  460

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + P  + + E   + +G +N++  I
Sbjct  461   LALLLYHFNWELPNKMKPEDMDMVEHFGLVVGRENELRLI  500



>ref|XP_004512032.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=508

 Score =   402 bits (1034),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 212/460 (46%), Positives = 312/460 (68%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L     +PH  L+ LS ++G  LMHLQLGE+  V+VSS + AK  +KTHD+ FA
Sbjct  47    IGNLHQLAFASKLPHHALKILSHKYGP-LMHLQLGEISTVIVSSPKFAKEVMKTHDVVFA  105

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP++L+   + Y   DI+FSPYG+YWRQMRK+C+ E+LS + V+SFSYIR+DE+ + + 
Sbjct  106   NRPKLLSPQILAYGFKDIVFSPYGDYWRQMRKICVLEVLSVKRVQSFSYIREDETTKFIK  165

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              ++S SG+   IN+   + + + SII RAAFG      +E V  + + + +     + D 
Sbjct  166   SIKSFSGST--INLTSRIFSVINSIISRAAFGDKSEDQDEFVSLIRKAIALSGGLELDDL  223

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNN-LgsgktgsgesgseDIVDVLI  1013
             FPS K +H LTG KS+  K+ +  D+I+ +++++H      +      E+  ED+VDVL+
Sbjct  224   FPSMKPIHILTGMKSKFEKIHKRVDKILDNVVRKHEEKRAITKDEKKIEAEKEDLVDVLL  283

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++ S SL + +T +NIKA+I D+F    DTS+T    +M EM+KNPRV  KAQAE+RE 
Sbjct  284   RVQQSGSLDIQMTINNIKAVIWDIFVAGTDTSSTTIEWSMSEMMKNPRVRDKAQAELREA  343

Query  1194  FKG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F+G  ++ E+++ +L YLNLVIKET+RLHPP P++  RE  + + + GY IP +T +LIN
Sbjct  344   FRGKDKICETDMHQLTYLNLVIKETLRLHPPSPLLVPRECYELTNIDGYDIPKKTTILIN  403

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWA+ RDP++W D E F PERF+   +DF + + F+Y+PFG+G+RMCPG+SFGLASV  P
Sbjct  404   AWAMGRDPEHWSDAERFIPERFDGSFIDF-KGNNFEYIPFGAGRRMCPGMSFGLASVMFP  462

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + PH   + E   M +G KN++  I
Sbjct  463   LALLLYHFNWELPNHMKPHDFDMIEHFGMTVGRKNELCLI  502



>ref|XP_006367966.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=518

 Score =   403 bits (1035),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 205/458 (45%), Positives = 315/458 (69%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L+  ++PH +LR+LSK++G  +MHL+LG +  +V+SS+E+AK  +KT DL F  
Sbjct  57    IGNLHQLMS-DLPHRSLRNLSKKYGP-IMHLRLGNISTIVISSSEMAKEIMKTQDLHFVD  114

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++++   + YD +DI FS YG+YWR MRKVC+ ELLS + V+S + IRQ+E   L+  
Sbjct  115   RPQIMSTSIIFYDCTDIGFSSYGDYWRNMRKVCVLELLSTKMVKSLASIRQEEISNLISS  174

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RSS+     IN+ +++  F  ++ CRA  GK ++   + +  V +I  ++  F + D F
Sbjct  175   LRSST-PDSLINLSNKIFWFTNTVTCRAVSGKIIHDRNKFIMLVKDIYSLIGGFDLTDLF  233

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH ++G K ++ K   + DEI+  I+ +HR+N   G   +GESG+ED VD L+++
Sbjct  234   PSQKWLHNISGMKYKLSKAHSKVDEILEQIVNDHRDNRAKGTKYNGESGNEDFVDALLRV  293

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +S+     IT+ NIKA+ILDMF    +T++T  + A +E++KNPRV+ KAQ EVRE   
Sbjct  294   MESEEFGPRITNQNIKAVILDMFLAGTETASTTLIWAFLELIKNPRVMVKAQLEVRERLN  353

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+    ++++++L YL  VIKET+RLHPP P +I RE  +++ + GYTIP +T+VL+NAW
Sbjct  354   GKKTFNDTDLEELNYLQFVIKETLRLHPPAPLLIPRECREETKIDGYTIPVKTKVLVNAW  413

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             +I RDP+YW + ESF PERFE+  +DF R + F+++PFG+G+RMCPG+ FGL ++  PL+
Sbjct  414   SIGRDPKYWHNSESFIPERFENSSIDF-RGNHFEFIPFGAGRRMCPGMLFGLVNIAHPLS  472

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW++PHG+ P+ L   E   +    KND++ I
Sbjct  473   QLLYHFDWKVPHGVNPNDLDTIETEGLTARRKNDLYLI  510



>ref|XP_003611884.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94842.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=506

 Score =   402 bits (1034),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 214/460 (47%), Positives = 313/460 (68%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L     +PH  L+ LS+++G  LMHLQLGE+ AVVVSS+ +AK  +KTHD+ FA
Sbjct  45    IGNLHQLAFAGKLPHHGLQKLSQKYGP-LMHLQLGEINAVVVSSSNLAKEVMKTHDVVFA  103

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP++ +   + Y   DI+FSPYG+YWRQMRK+C+ E+LSA+ V+SFSYIR+DE+ + ++
Sbjct  104   NRPKLPSLKILAYGFKDIVFSPYGDYWRQMRKICVLEILSAKRVQSFSYIREDETKKFIE  163

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              ++S   AG  IN+   + + + SII RAA G      EE V  + + + + S   + D 
Sbjct  164   SIKSF--AGSKINLTTRIFSVINSIILRAALGDKSEDQEEFVSLIRKAVAVSSGLELIDL  221

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNN-LgsgktgsgesgseDIVDVLI  1013
             FPS K++H LTG K  + K+ +  D+I+ +++++H+       +    E   ED+VDVL+
Sbjct  222   FPSMKLIHVLTGMKKNVEKIHKRVDKILDNVVRKHQEKRARGNEGNKSEIEKEDLVDVLL  281

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++ S SL + +T +NIKA+I D+F    DTS+T    AM EM+KNPRV  KAQAE+R+ 
Sbjct  282   RVQQSGSLDVQLTINNIKAVIWDVFVAGTDTSSTTIEWAMSEMMKNPRVREKAQAELRQA  341

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F G+  + E++V+KL+YL LVIKET+RLHPP P++  R + + + + GY IP  T V IN
Sbjct  342   FNGKELIYETDVEKLSYLKLVIKETLRLHPPSPLLVPRLSTELTKIDGYDIPKNTTVFIN  401

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP+YW D E F PERF+D  +DF + + F+Y+PFG+G+RMCPG++FGLASV  P
Sbjct  402   AWAIGRDPKYWNDAERFIPERFDDSLIDF-KGNNFEYIPFGAGRRMCPGMTFGLASVIFP  460

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ +    L + E   + +G KN++  I
Sbjct  461   LALLLYHFNWELPNQMKSQDLDMIEDFGLTVGRKNELCLI  500



>gb|KCW68417.1| hypothetical protein EUGRSUZ_F02067, partial [Eucalyptus grandis]
Length=484

 Score =   401 bits (1031),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 214/443 (48%), Positives = 302/443 (68%), Gaps = 10/443 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L+G +  H  L +L+K +G  LMH+Q GEVP VV+SSAE+AK  +KTHD+ FAT
Sbjct  46    IGNLHQLLG-SPAHCALWELAKIYGP-LMHMQFGEVPHVVISSAEMAKEVMKTHDITFAT  103

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RPR+LA + + Y S+DI F+PY EYWRQ+RK+C  ELLSA+ V+SF +IR++E   L+  
Sbjct  104   RPRLLATEVLSYGSTDIAFAPYSEYWRQLRKICTLELLSAKRVQSFRHIREEEISNLVKW  163

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             V  +S AG PIN+   + +        AAFGK +   EE +  V E + + + F V D F
Sbjct  164   V--ASNAGSPINLTQRLFSTNYGATSIAAFGKKVKEQEEFITIVKEAIRLAAGFEVGDVF  221

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH +TG K R+ K+RQ+ D IM ++I+E           S E+  + +VDVL++ 
Sbjct  222   PSLKWLHVITGMKPRLEKLRQQLDRIMNNLIREKEEE--RANRSSDETTLDGLVDVLLRF  279

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
              D       +T DN+KA++LD+F    +TS T    A+ EM+KNPR+L KAQAEVREVF 
Sbjct  280   ADPSGPDFFLTTDNVKAVLLDIFAAGSETSATQVDWALAEMMKNPRILKKAQAEVREVFD  339

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +G+ +E+ + +L YL LVIKE +RL P  P++  RE  +   + GY IP +TRVL+NAW
Sbjct  340   RRGKADETGLPELEYLKLVIKECLRLRPSIPLLLPRECTERCEINGYEIPVKTRVLVNAW  399

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW+DPESF PERF+D P+D+ + + F+Y+PFG+G+R+CPG++FG+A+V  PLA
Sbjct  400   AIGRDPKYWDDPESFYPERFKDSPVDY-KGTSFEYIPFGAGRRICPGMNFGIANVELPLA  458

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
              LLYHFDWELP G+    + ++E
Sbjct  459   MLLYHFDWELPEGMKSEEMDMSE  481



>ref|XP_006359503.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=503

 Score =   402 bits (1032),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 220/459 (48%), Positives = 315/459 (69%), Gaps = 9/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L     PH  L +LS+++G  +M+LQLGEVP VVVSS  +AK  LKTHDL FA+
Sbjct  44    IGSVHHLTR-GTPHRVLGNLSQKYGP-IMYLQLGEVPTVVVSSPHMAKQILKTHDLAFAS  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             R   +    + Y+S+DI FSPYG+YWR MRK+ + ELLSA+ V+SFS IR DE   LL  
Sbjct  102   RSVTMLGKILCYNSTDIAFSPYGDYWRHMRKLSVLELLSAKMVKSFSSIRHDELSNLLSS  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +   S  G PIN+ +++  FM +  CR+ FGKT     ELV  +   + + S F +AD F
Sbjct  162   I--DSMVGSPINLSEKLFWFMNASTCRSTFGKTCKNQNELVTLIQRAMSLSSGFELADLF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS   LH ++G +S+++K R + D ++ +II  HR N  +GK  +GESG+ED++DV +++
Sbjct  220   PSKTFLHGISGMESKLMKARNKVDILLDNIINVHRENHTNGKNYNGESGTEDLIDVFLRV  279

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +S      +T+DNIKA+ILDMF    DTS+   + A+ EM+K+P V+AKAQAEVREVFK
Sbjct  280   MESGEFQFPLTNDNIKAVILDMFVAGSDTSSATVIWALSEMMKSPSVMAKAQAEVREVFK  339

Query  1200  GRV---EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
             G+    ++++++KL YL LVIKET+RLHPP P++  RE  +++ + G+TIP +++VL+N 
Sbjct  340   GKETCNDDTDLEKLNYLKLVIKETLRLHPPTPLLVPRECREETKIDGFTIPLKSKVLVNV  399

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP+ WE+PE F PERFE+  ++FT  + F+ +PFG+G+RMCPGI FG+A V  PL
Sbjct  400   WAIGRDPKSWENPECFIPERFENSSIEFT-GNCFQLLPFGAGRRMCPGIHFGIALVTLPL  458

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             AHLLY FDW+LP GI    L +TE   +    +ND++ I
Sbjct  459   AHLLYKFDWKLPEGIHVRDLDMTESNGITARRENDLYLI  497



>gb|EYU31465.1| hypothetical protein MIMGU_mgv1a004885mg [Erythranthe guttata]
Length=506

 Score =   402 bits (1032),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 212/458 (46%), Positives = 314/458 (69%), Gaps = 12/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ +VG  + H  LR +++++G  ++HL+LG+V  V++SSAE AK  LK  D   A 
Sbjct  50    IGHLHHIVGRGLAHHALRRVAEKYGP-VLHLKLGQVSTVLISSAEAAKQVLKDQDPGCAG  108

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  +A   + YD +D+ FSPY EYWRQMR++C+ ELLSA+ V+SF  IRQDE   L+  
Sbjct  109   RPESIALKIMWYDYTDLAFSPYNEYWRQMRRICVVELLSAKNVKSFGSIRQDEVSILIKS  168

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++   G G PIN+ ++V   ++SI CRA FG+ L   + LV  + E L M   F + D F
Sbjct  169   IKKLCG-GEPINLTEKVFGMISSITCRAVFGEVLKDRDSLVYLMKEGLSMAGGFQLVDLF  227

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSWK+L+ L+   +++ ++R++ D ++  +++EHR N       SGE G EDIVDVLI++
Sbjct  228   PSWKLLNILSWSNNKLWRMRRKVDLVLDALLEEHRLN------KSGEFGGEDIVDVLIRV  281

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             + +  L   IT+DNIKA+I DMF    ++S++    AM E+++NPRV+ K Q EVRE  K
Sbjct  282   QRNGELQFPITNDNIKAVIFDMFSAGTESSSSAIDWAMAELMRNPRVMEKVQREVREGLK  341

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINAW  1370
             G  RV++S+V+ L YL LV+KET+RLHPP P++ R   ++ V V GY+IP  +RV+I+ W
Sbjct  342   GKKRVDDSDVEGLKYLKLVVKETLRLHPPIPLLPRACREEGVKVNGYSIPINSRVMISIW  401

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP YW+DPE+F+PERFE+  +DFT +S F+Y+PFG+G+R+CPG++FGLASV  PLA
Sbjct  402   AMGRDPLYWDDPETFQPERFENSCIDFTGNS-FEYLPFGAGRRICPGMNFGLASVELPLA  460

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              +LYHF+W LP GI+   + +TE   + +  KN +F +
Sbjct  461   QILYHFNWTLPTGISFDHVDMTEQEGITVSRKNRLFLV  498



>ref|XP_003520239.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=503

 Score =   401 bits (1031),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 200/460 (43%), Positives = 315/460 (68%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L    ++PH  LRDL+K++G  LMHLQLGE+ AVV SS ++AK  +KTHD+ F 
Sbjct  42    IGNLHQLAEAGSLPHHALRDLAKKYGP-LMHLQLGEISAVVASSPKMAKEIVKTHDVSFL  100

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP ++    + Y    I F+PYG++WRQMRK+C TELLSA+ V+SF+ IR+DE+ + ++
Sbjct  101   QRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSAKRVQSFASIREDEAAKFIN  160

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE-LVKFVNEILIMVSSFSVAD  833
              +R +  AG PIN+  ++ + + + I R AFG      +E +V  + +I+     F +AD
Sbjct  161   SIREA--AGSPINLTSQIFSLICASISRVAFGGIYKEQDEFVVSLIRKIVESGGGFDLAD  218

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS   L+F+TG+ +++ K+ ++ D+++ +II+EH+      K    E   +D +D+L+
Sbjct  219   VFPSIPFLYFITGKMAKLKKLHKQVDKVLENIIREHQEKKKIAKEDGAEVEDQDFIDLLL  278

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             K++  D++ + +T +NIKA+ILD+F    DTS +    AM EM++NPRV  KAQAE+R+ 
Sbjct  279   KIQQDDTMDIEMTTNNIKALILDIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAELRQT  338

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F+ +  + ES++++L YL LVIKET R+HPP P++  RE ++ +++ GY IP +T+V++N
Sbjct  339   FREKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECSQPTIIDGYEIPTKTKVMVN  398

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             A+AI +DP+YW D E F PERFED  +DF + + F Y+PFG G+R+CPG++ GLAS+  P
Sbjct  399   AYAICKDPKYWTDAERFVPERFEDSSIDF-KGNNFNYLPFGGGRRICPGMTLGLASIMLP  457

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + P  + + E   +A+G KN++  +
Sbjct  458   LALLLYHFNWELPNKMKPEEMNMDEHFGLAIGRKNELHLV  497



>ref|XP_004249812.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
 ref|XP_010312277.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=511

 Score =   401 bits (1031),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 224/460 (49%), Positives = 320/460 (70%), Gaps = 8/460 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IG+++ L +   +PH  L +L K++G   MHLQ+GE+  VVVSS ++A+  LKTHDL FA
Sbjct  46    IGSVHHLALEGGLPHHALTNLGKKYGP-FMHLQVGEISTVVVSSMDMAREVLKTHDLAFA  104

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
             +R ++LA D ++Y S+DI F  YG+YWRQMRKVC+ ELL+ + VRSFS IR+DE+ RL+ 
Sbjct  105   SRHKILAFDIILYKSTDIGFCSYGDYWRQMRKVCVLELLTTKNVRSFSSIRRDEASRLVQ  164

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              +RSS+  G PIN+ + ++ + +SI C+ AFG+ L   E+ +  + E   +   FS AD 
Sbjct  165   FIRSST-CGEPINVTERISWYQSSITCKTAFGELLKDQEKFLGILREFTEVAGGFSTADI  223

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS KIL  L+G KSR++K  +  D I+ D+I EH+ NL SGK G+G  G E++VDVL++
Sbjct  224   FPSIKILQVLSGLKSRILKFHKNVDVIVEDVINEHKKNLASGKKGNGAFGGENLVDVLLR  283

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             LK+S  L + IT+DNIKAII+D+F    +T+TT T+ AM EM++NP VLAKAQ EVRE F
Sbjct  284   LKESGELKIPITNDNIKAIIIDLFIAGTETTTTTTIWAMTEMIRNPSVLAKAQTEVREAF  343

Query  1197  KGRVE---ESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLIN  1364
             KG+ E   E  +++L YL  V+KET     P   +I RE  +++ + GYTIP +TRV++N
Sbjct  344   KGKEEIFNEDVIEELKYLKQVVKETLRLHPPLPLLIPRECREETNINGYTIPLKTRVVVN  403

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              +++ RDP+YWED ESF PERFE   +DF   + F+Y+PFGSG+RMCP +SFGL +VY P
Sbjct  404   VYSMGRDPKYWEDAESFIPERFEGSSVDFM-GNNFEYLPFGSGRRMCPALSFGLINVYLP  462

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA+LLYHFDW+LP  +    + + E   +A   K++++ I
Sbjct  463   LANLLYHFDWKLPDCVKLEDMDMNEFSGIAAARKSELYLI  502



>ref|XP_006365912.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum tuberosum]
Length=512

 Score =   401 bits (1030),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 218/460 (47%), Positives = 318/460 (69%), Gaps = 7/460 (2%)
 Frame = +3

Query  300   IGNLYRLVG-PNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L     +PH TLR LS+++G  L HLQLGE+ A+VVSS E+AK  +KT D+ FA
Sbjct  48    IGNLHQLASHGGLPHHTLRTLSQKYGP-LTHLQLGEISAIVVSSPEMAKEIMKTQDVRFA  106

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
             TRP+ +    + Y+ SDI   PYG+YWR MRK+C+ ELLSA+ V+SF+ IRQ+E   L+ 
Sbjct  107   TRPQSMTGSIIFYNYSDIALCPYGDYWRNMRKICVLELLSAKMVKSFNSIRQEEMSSLVS  166

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              + +S+     +N+ +++  F  S+ CR+AFGK ++  ++L+  V E + + S F + D 
Sbjct  167   SIINSTPDESLVNLSNKIFWFTGSVTCRSAFGKVVHDQDKLIMLVKEAVSLSSGFDLTDL  226

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS K LH ++G KSR++K  ++ D I+  +I EH  N  +G  G+GESG+ED++DVL++
Sbjct  227   FPSHKWLHGISGMKSRLLKAHEKVDVILEKLINEHCENRANGNKGNGESGAEDLIDVLLR  286

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             + +S    M IT+ NIKA+I +MF    +TS+T  + A  EM+KNP V+AKAQ EVRE F
Sbjct  287   VMESGEFGMPITNQNIKAVIFEMFMAGAETSSTTIIWAFSEMIKNPGVMAKAQLEVREAF  346

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINA  1367
             KG+   E+ ++++L YL LVIKET+RLHP  P +I RE  +++ + GY IP +T+V++NA
Sbjct  347   KGKKTFEDIDLEELKYLKLVIKETLRLHPAAPLLIPRECREETQIDGYNIPIKTKVIVNA  406

Query  1368  WAISRDPQYW-EDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             WAI RD +YW +DPESF PERFE+  +DF R + F+++PFG+G+RMCPG+  GLA+V   
Sbjct  407   WAIGRDSRYWHDDPESFIPERFENSSIDF-RGNNFEFIPFGAGRRMCPGMLSGLATVGHS  465

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFDW+LP G++     +TE   +A   KND+  I
Sbjct  466   LAKLLYHFDWKLPDGVSVDDFDMTEAEGVAASRKNDLCLI  505



>gb|EYU21953.1| hypothetical protein MIMGU_mgv1a025918mg [Erythranthe guttata]
Length=498

 Score =   400 bits (1029),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 225/480 (47%), Positives = 328/480 (68%), Gaps = 15/480 (3%)
 Frame = +3

Query  243   WMKPKSgrk---lppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpa  413
             W KPKS +K   LPP P KLP+IG+L+ LVG  +PH  LR +S+++G  ++HLQLGE+PA
Sbjct  20    WKKPKSSQKYEKLPPSPPKLPVIGHLHHLVG-GLPHAALRRVSQKYGP-VLHLQLGEIPA  77

Query  414   vvvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELL  593
             VV+SS + AK  LK  D   A RP  +    + YD +DI FSPY EYWRQMRK+CI ELL
Sbjct  78    VVISSRDAAKQVLKDQDPGCAGRPESIGTKIMWYDYTDIAFSPYNEYWRQMRKICILELL  137

Query  594   SARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTE  773
             SA+ V+SF  IR++E  R+++ +RSS+  G  +N+ ++V    ++I CRAAFG+ L   +
Sbjct  138   SAKNVKSFGSIRKEEVSRVIESLRSSARGGAAVNLTEKVFGLTSAITCRAAFGEVLKDRD  197

Query  774   ELVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNL  953
              L+  + + + M   F +AD FPS K+L+  +  K +++++R+  D I+  I+ EH+   
Sbjct  198   SLIFLLKKGVTMAGGFELADLFPSSKLLNIFSWNKLKLLRMRRRLDSILDVIVAEHK---  254

Query  954   gsgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAM  1133
                   +GE G EDIVDVLI+++ +  L   IT+DNIKA+I DMF    +TS+T    AM
Sbjct  255   ---LKQNGEFGGEDIVDVLIRMQRNGELQFPITNDNIKAVIFDMFSAGTETSSTTMDWAM  311

Query  1134  VEMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENN  1307
              E+++NPRV+AK QAE+RE  KG+  VEES++  L YL LV+KET RLHPP P++ R   
Sbjct  312   AELMRNPRVMAKVQAEIREALKGKNTVEESDLQGLKYLKLVVKETFRLHPPIPLLPRACR  371

Query  1308  KDSV-VCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPF  1484
             ++ V V GY+IP  ++V++N W++ RDPQYW+ PESF+PERFE+  +DF  +S F+Y+PF
Sbjct  372   EEGVKVNGYSIPINSKVMVNIWSMGRDPQYWDKPESFEPERFENSAVDFQGNS-FEYLPF  430

Query  1485  GSGKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             G+G+R+CPG++FGLA+   PLA +LYHFDW +P G+T   + +TE   +A+  KN +  +
Sbjct  431   GAGRRICPGMNFGLANTELPLAQILYHFDWSMPEGMTRGGIDMTEQEGIAVSRKNGLVLV  490



>gb|KEH34014.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   400 bits (1028),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 210/458 (46%), Positives = 307/458 (67%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN++ L+    PH  LRDL++++G  LMHLQLGE+  +V+SS + A+  +KTHD++FAT
Sbjct  46    IGNIHNLLSSQ-PHRKLRDLAREYGP-LMHLQLGEISFIVISSPDCAREVMKTHDINFAT  103

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+ L+ D + Y+S+ I+ SPYG YWRQ+RK+C  ELLS + V S+  IR++E   L+  
Sbjct  104   RPQGLSSDLIAYNSTGIVSSPYGNYWRQLRKICTLELLSLKRVNSYQPIREEEFSNLVKW  163

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S  G+  PIN+   V + + +I+ ++AFGK     E+ +    EIL + + F +A+ F
Sbjct  164   IASKEGS--PINLTQAVLSSIYTIVSKSAFGKKFKDQEKFISAEKEILKIAAGFDLAELF  221

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS   +HF TG + ++ +V +  D+IM +II EH+    S          ED+VDVL+K 
Sbjct  222   PSITWMHFFTGLRPKLERVHRVVDQIMENIINEHK-EAKSKGEFDQVESDEDLVDVLLKY  280

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             +D ++    +T DNIKAII+D+FG   +TS +    AM EMVKNPR++ KAQAEVRE+F 
Sbjct  281   QDGNNKEFFLTIDNIKAIIMDIFGAGGETSASTIDWAMAEMVKNPRIMKKAQAEVREIFN  340

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINAW  1370
              KGRVEE+ +++L YL  ++KET+RLHPP P +I RE  +   + GY IP +T+V++NAW
Sbjct  341   MKGRVEENCINELNYLKSIVKETLRLHPPAPLLIPRECAQSCKIDGYDIPTKTKVIVNAW  400

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP YW +PE F PERF D  +D+ + S F+Y+PFG+G+R+CPG  FGL SV   LA
Sbjct  401   AIARDPNYWTEPERFYPERFIDSDIDY-KGSNFEYIPFGAGRRICPGSIFGLRSVELALA  459

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP+GI    L +TE   + +  K+D+  +
Sbjct  460   KLLYHFDWKLPNGIKSEELDMTEKFGITVCRKDDLLLL  497



>sp|D5JBX1.1|GAO_BARSP RecName: Full=Germacrene A oxidase; Short=BsGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Barnadesia spinosa]
 gb|ADF43083.1| germacrene A oxidase [Barnadesia spinosa]
Length=496

 Score =   400 bits (1027),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 200/458 (44%), Positives = 309/458 (67%), Gaps = 16/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ LVG  +PH  + D+++++G  LMHLQLGEV  +VVSS   AK  L T+D+ FA 
Sbjct  41    IGHMHHLVG-TLPHRGVTDMARKYG-SLMHLQLGEVSTIVVSSPRWAKEVLTTYDITFAN  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  L  + V Y ++DI+ SPYGEYWRQ+RK+C  ELLSA+ V+SF  +R++E   L+  
Sbjct  99    RPETLTGEIVAYHNTDIVLSPYGEYWRQLRKLCTLELLSAKKVKSFQSLREEECWNLVKE  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             VR SSG+G P+++ + +   + +I+ RAAFGK +    E  + V EIL +   F VAD F
Sbjct  159   VR-SSGSGSPVDLSESIFKLIATILSRAAFGKGIKDQREFTEIVKEILRLTGGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS KILH L+G+++++  +  + D ++ +I+ EH  +          S  E ++DVL++L
Sbjct  218   PSKKILHHLSGKRAKLTNIHNKLDSLINNIVSEHPGS-------RTSSSQESLLDVLLRL  270

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             KDS  LP+  T DN+KA+ILDMFG   DTS+     A+ E+++ PR + K Q E+R+   
Sbjct  271   KDSAELPL--TSDNVKAVILDMFGAGTDTSSATIEWAISELIRCPRAMEKVQTELRQALN  328

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G  R++E ++ +L+YL LVIKET+RLHPP P++  RE  +  V+ GY IP +T++++N +
Sbjct  329   GKERIQEEDIQELSYLKLVIKETLRLHPPLPLVMPRECREPCVLAGYEIPTKTKLIVNVF  388

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+YW+D E+F PERFE+ P++    S+++Y+PFG+G+RMCPG + GLA+V  PLA
Sbjct  389   AINRDPEYWKDAETFMPERFENSPINIM-GSEYEYLPFGAGRRMCPGAALGLANVELPLA  447

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             H+LY+F+W+LP+G     L ++E     +  K+++  +
Sbjct  448   HILYYFNWKLPNGARLDELDMSECFGATVQRKSELLLV  485



>gb|KHN08718.1| Cytochrome P450 71D8 [Glycine soja]
Length=501

 Score =   400 bits (1027),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 204/460 (44%), Positives = 312/460 (68%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L    ++PH  LRDL+K++G  LMHLQLGE+ AVV SS ++AK  +KTHD+ F 
Sbjct  41    IGNLHQLAEAGSLPHHALRDLAKKYGP-LMHLQLGEISAVVASSPKMAKEIVKTHDVSFL  99

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP ++    + Y    I F+PYG++WRQMRK+C TELLS + V+SF+ IR+DE+ + +D
Sbjct  100   QRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSTKRVQSFASIREDEAAKFID  159

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE-LVKFVNEILIMVSSFSVAD  833
              +R S  AG PIN+   + + + + I R AFG      +E +V  + +I+     F +AD
Sbjct  160   SIRES--AGSPINLTSRIFSLICASISRVAFGGIYKEQDEFVVSLIRKIVESGGGFDLAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS   L+FLTG+ +R+ K+ ++ D+++ +II+EH+      K  + E   +D +D+L+
Sbjct  218   VFPSIPFLYFLTGKMTRLKKLHKQVDKVLENIIREHQEKNKIAKEDAAELEDQDFIDLLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             K+K  D+L + +T +NIKA+ILD+F    DTS +    AM EM++NPRV  KAQAE+R+ 
Sbjct  278   KIKQDDTLDIQMTTNNIKALILDIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAELRQA  337

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F+ +  + ES++++L YL LVIKET R+HPP P++  RE ++ +++ GY IP +T+V++N
Sbjct  338   FREKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECSQPTIIDGYEIPAKTKVMVN  397

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             A+AI +D QYW D + F PERFE   +DF + + F Y+PFG G+R+CPG++ GLAS+  P
Sbjct  398   AYAICKDSQYWIDADRFVPERFEGSSIDF-KGNNFNYLPFGGGRRICPGMTLGLASIMLP  456

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + P  + + E   +A+G KN++  I
Sbjct  457   LALLLYHFNWELPNKMKPEEMNMDEHFGLAIGRKNELHLI  496



>gb|KEH25843.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=500

 Score =   399 bits (1026),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 214/461 (46%), Positives = 307/461 (67%), Gaps = 16/461 (3%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L +   +PH TL DLS ++G  LMHLQLGE+  VVVSS  + K  +KTHDL F 
Sbjct  45    IGNLHQLALAGKLPHHTLGDLSHKYGP-LMHLQLGEISTVVVSSPNLTKEIMKTHDLSFV  103

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP+ LA + + Y+S DI+F+ YG+YWRQMRK+C +ELLSA+ V+SFS IR+D   +++ 
Sbjct  104   QRPQFLAPNILTYESKDIIFASYGDYWRQMRKICTSELLSAKRVQSFSSIREDGVEKMIQ  163

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              + SSS    P+++   V++ ++S + RA FGK     ++L+  + + + M S F VAD 
Sbjct  164   FIHSSS-CQDPLDLTKMVSSLVSSFVSRATFGKKSKYEDDLLCLLKQAMEMASGFDVADL  222

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS+K +H +TG K ++  ++++ D I+  II EH++N             E++VDVL++
Sbjct  223   FPSFKPIHLITGIKPKLENLQKKLDMILESIINEHQSN--------PALQGENLVDVLLR  274

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             ++   SL + IT DN+KA+I DMFGG  DTS      AM E++KNPRV+ KAQAE+RE  
Sbjct  275   IQQRSSLEIPITQDNVKAVIWDMFGGGSDTSAITIEWAMSELMKNPRVMKKAQAEIREAV  334

Query  1197  KG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             KG  R+ ES++ KL YL LVIKET+RLHPP  ++ RE  +   + GY IP +T +++NAW
Sbjct  335   KGKKRIYESDLHKLGYLKLVIKETLRLHPPATLLMRECREACNIGGYEIPLKTNLILNAW  394

Query  1371  AISRDPQYWEDPESFKPERFEDDP-MDFTR--SSQFKYMPFGSGKRMCPGISFGLASVYT  1541
             AI RDP++W D E F PERF D    DF +   + F+Y PFG G+RMCPGI FGLA++  
Sbjct  395   AIGRDPEHWSDAEKFIPERFHDSTGFDFNKVNDNSFQYFPFGGGRRMCPGILFGLANIEL  454

Query  1542  PLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             PLA LLYHFDW++P+ +    L +TE+    +  KN++F I
Sbjct  455   PLAALLYHFDWKIPNEMKEEDLDMTEVFGATVSRKNNLFLI  495



>ref|XP_006452554.1| hypothetical protein CICLE_v10008073mg [Citrus clementina]
 ref|XP_006474924.1| PREDICTED: cytochrome P450 71D11-like [Citrus sinensis]
 gb|ESR65794.1| hypothetical protein CICLE_v10008073mg [Citrus clementina]
Length=504

 Score =   399 bits (1025),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 216/457 (47%), Positives = 305/457 (67%), Gaps = 8/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L G ++PH  LRDL+K+FG  LM LQLG+VP ++VSS EVAK  +KTHD+ FA+
Sbjct  49    IGNLHQLAG-SLPHHRLRDLTKKFGP-LMLLQLGQVPTIIVSSPEVAKDVMKTHDVVFAS  106

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP   A   + Y+   I+FS YG+ W+Q+RK+C++ELLS + V+SF  IR+ E   L++ 
Sbjct  107   RPHFPAAQIMSYNYRGIIFSAYGDCWKQLRKICVSELLSTKRVQSFQSIREAEVSDLINW  166

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  SS AG  IN+ ++V + M  I  RAAFG      E  V  + E   ++S F++AD F
Sbjct  167   I--SSKAGLVINLTEKVYSLMYGITSRAAFGNRSRDQETFVSVIEETTKVISGFNIADMF  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS  +L  LTG KS++ K+ QE D I+ +II +H+    +          ED+VDVL+K+
Sbjct  225   PSIGLLQRLTGNKSQVEKLLQEADRIVENIINDHKKR-KATLKNCKTGDDEDLVDVLLKI  283

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             +    L  S+T DNIKA+I D+FG   +TS T    AM EM+KNPRV+ KAQAEVREVF 
Sbjct  284   QGHGDLDSSLTTDNIKAVIFDIFGAGSETSATTVDWAMYEMMKNPRVMKKAQAEVREVFN  343

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
              KG+V+E+ ++++ YL LV+KET+RLHP  P+I RE      + G+ IP + RV++N+WA
Sbjct  344   RKGKVDETGINEMKYLKLVVKETLRLHPSAPLILRECGDSCEINGFNIPAKARVIVNSWA  403

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
               RDP YW +PESF PERF D  +D+ + + F+Y+PFG+G+R+CPG+SFGLASV   LA 
Sbjct  404   TGRDPMYWTEPESFIPERFIDHSVDY-KGTNFEYIPFGAGRRICPGMSFGLASVELTLAM  462

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHF+W+LP+G+    L +TE     +  K D+  I
Sbjct  463   LLYHFEWKLPNGMKHEDLDMTEAFGATVRRKQDLCMI  499



>ref|XP_004243471.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=504

 Score =   399 bits (1024),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 211/460 (46%), Positives = 319/460 (69%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L    +PH  L+ LS ++G  +M+LQLGEVP VVVSS+ +AK  LKTHDL FA+
Sbjct  40    IGSVHHLTS-GLPHQVLKKLSFKYGP-IMYLQLGEVPTVVVSSSHMAKQILKTHDLAFAS  97

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  +    + Y+  DI FSPYG+YWR MRK+ + ELLSA+ V+SFS IRQDE   LL  
Sbjct  98    RPETMMGKIICYNCKDIAFSPYGDYWRHMRKLTVLELLSAKMVKSFSPIRQDELSNLLSS  157

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RS +    PIN+V+++  FM +  CR+AFG       EL+  +++   +   F +AD F
Sbjct  158   IRSMN-LDSPINLVEKLLWFMNAATCRSAFGNVCKDQRELITLIHQAQSLSGGFELADLF  216

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH ++G +S+++  R + D+++ +II  HR N  +GK+ +GESG+ED++DV +++
Sbjct  217   PSKKYLHGISGMESKLMNARYKIDQVLDNIINVHRENRANGKSCNGESGAEDLIDVFLRV  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              +S   P+ +T+DNIKA+ILDMF    DTS++  + A+ E+++NP ++AKAQAEVREV  
Sbjct  277   MESGQFPVPLTNDNIKAVILDMFVAGSDTSSSTVIWALSELMRNPNIMAKAQAEVREVMG  336

Query  1200  GRVEESNVD----KLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
              +  + ++D     ++YL LVIKET+RLHPP P++  RE  +++ +  +TIP +++V++N
Sbjct  337   KKTCDDDIDTDLENVSYLMLVIKETLRLHPPTPLLVPRECREETKIDEFTIPLKSKVMVN  396

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              WAI RDP+ WE+PE F PERFE+  ++FT  + F+++PFG+G+R+CPGI FGLA V  P
Sbjct  397   VWAIGRDPENWENPECFVPERFENSSIEFT-GNHFEFLPFGAGRRICPGIQFGLALVTLP  455

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LAHLLY+FDW+LP GI+   L +TE   ++   + D++ I
Sbjct  456   LAHLLYNFDWKLPQGISASDLDMTEANGISARREKDLYLI  495



>gb|KHN48844.1| Cytochrome P450 71D8 [Glycine soja]
Length=508

 Score =   399 bits (1024),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 201/463 (43%), Positives = 315/463 (68%), Gaps = 10/463 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L    ++PH  LRDL+K++G  LMHLQLGE+ AVV SS ++AK  +KTHD+ F 
Sbjct  42    IGNLHQLAEAGSLPHHALRDLAKKYGP-LMHLQLGEISAVVASSPKMAKEIVKTHDVSFL  100

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP ++    + Y    I F+PYG++WRQMRK+C TELLS + V+SF+ IR+DE+ + +D
Sbjct  101   QRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSTKRVQSFASIREDEAAKFID  160

Query  657   RVRSS--SGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE-LVKFVNEILIMVSSFSV  827
              +R+S    AG PIN+  ++ + + + I R AFG      +E +V  + +I+     F +
Sbjct  161   SIRNSIREAAGSPINLTSQIFSLICASISRVAFGGIYKEQDEFVVSLIRKIVESGGGFDL  220

Query  828   ADT-FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVD  1004
             AD  FPS   L+F+TG+ +++ K+ ++ D+++ +II+EH+      K    E   +D +D
Sbjct  221   ADVVFPSIPFLYFITGKMAKLKKLHKQVDKVLENIIREHQEKKKIAKEDGAEVEDQDFID  280

Query  1005  VLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEV  1184
             +L+K++  D++ + +T +NIKA+ILD+F    DTS +    AM EM++NPRV  KAQAE+
Sbjct  281   LLLKIQQDDTMDIEMTTNNIKALILDIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAEL  340

Query  1185  REVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRV  1355
             R+ F+ +  + ES++++L YL LVIKET R+HPP P++  RE ++ +++ GY IP +T+V
Sbjct  341   RQTFREKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECSQPTIIDGYEIPTKTKV  400

Query  1356  LINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASV  1535
             ++NA+AI +DP+YW D E F PERFED  +DF + + F Y+PFG G+R+CPG++ GLAS+
Sbjct  401   MVNAYAICKDPKYWTDAERFVPERFEDSSIDF-KGNNFNYLPFGGGRRICPGMTLGLASI  459

Query  1536  YTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
               PLA LLYHF+WELP+ + P  + + E   +A+G KN++  +
Sbjct  460   MLPLALLLYHFNWELPNKMKPEEMNMDEHFGLAIGRKNELHLV  502



>gb|AEX07771.1| cytochrome P450 [Catharanthus roseus]
Length=506

 Score =   398 bits (1023),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 214/461 (46%), Positives = 309/461 (67%), Gaps = 12/461 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++ +G +VP+  LRDL+++ G  LMHLQLGEV A+V +S ++AK   KT DL FA 
Sbjct  47    IGNLHQFLG-SVPYQILRDLAQKNGP-LMHLQLGEVSAIVAASPQMAKEITKTLDLQFAD  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP + A   V YD  DI F+ YG+YWRQ+RK+ + ELL+++ VRSF  IR+DE   L+  
Sbjct  105   RPVIQALRIVTYDYLDISFNAYGKYWRQLRKIFVQELLTSKRVRSFCSIREDEFSNLVKT  164

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S++G  + IN+   +T+   SII + AFGK     E  +  +N+IL +   F + D F
Sbjct  165   INSANG--KSINLSKLMTSCTNSIINKVAFGKVRYEREVFIDLINQILALAGGFKLVDLF  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+KILH L G + ++ ++R + D+I+  +I EHR N      G+G +G EDIVD+L+++
Sbjct  223   PSYKILHVLEGTERKLWEIRGKIDKILDKVIDEHRENSSRTGKGNGCNGQEDIVDILLRI  282

Query  1020  KDSDSLPMSI--TDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++   L + I   ++NIKA++ D+  G  +TS+T    AM EM++NP V++KAQ E+RE 
Sbjct  283   EEGGDLDLDIPFGNNNIKALLFDIIAGGTETSSTAVDWAMSEMMRNPHVMSKAQKEIREA  342

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINA  1367
             F G+  +EE+++  L YL LVI+ET+RLHPP P++ R+  +   + GY IP  T+  IN 
Sbjct  343   FNGKEKIEENDIQNLKYLKLVIQETLRLHPPAPLLMRQCREKCEIGGYHIPVGTKAFINV  402

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQ--FKYMPFGSGKRMCPGISFGLASVYT  1541
             WAI RDP YW +PESF PERF+D+  +FT+S    F+Y+PFG+G+RMCPGISFGLA+V  
Sbjct  403   WAIGRDPAYWPNPESFIPERFDDNTYEFTKSEHHAFEYLPFGAGRRMCPGISFGLANVEL  462

Query  1542  PLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             PLA LLYHF+W+LP G T  TL +TE   +A   K D+  I
Sbjct  463   PLALLLYHFNWQLPDGST--TLDMTEATGLAARRKYDLQLI  501



>gb|EYU21978.1| hypothetical protein MIMGU_mgv1a004623mg [Erythranthe guttata]
Length=517

 Score =   399 bits (1024),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 215/463 (46%), Positives = 305/463 (66%), Gaps = 18/463 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ +    +PH + + LS++ G  LMH+ LGEV A+VVSS  +AK  LK HD  FA 
Sbjct  47    IGHLHHI--GKLPHRSFQKLSEKHGP-LMHVMLGEVTAIVVSSPALAKQVLKAHDPTFAD  103

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  +A + + Y+SS+I FS YG+YWRQMRK+CI ELLSA+ V+SFS IR DE  +L++ 
Sbjct  104   RPVTIAGEILWYNSSNISFSQYGDYWRQMRKICILELLSAKNVKSFSSIRNDEVSQLIES  163

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++ SS     +++ +++    +SI CRAAFGK     ++L+    E + +VS F V+D +
Sbjct  164   IKISSST---VDLTEKIFGMTSSITCRAAFGKVCKDKDQLIGMFKEGITLVSGFDVSDLY  220

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgs---------e  992
             PS K+L  L+  + R++K+R + D I+ D+I EHR NL        E+           E
Sbjct  221   PSSKMLKALSCNRMRLMKMRLKLDLILDDVIDEHRRNLEKIVFADEENSERRGNGEFGNE  280

Query  993   DIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKA  1172
             D+VDVL+++K+S  L   I+DDNIKA+I D+F    +TS+T     M E+++NPRV++K 
Sbjct  281   DLVDVLLRVKESGELEFPISDDNIKAVIYDIFAAGTETSSTTIDWIMAELIRNPRVMSKL  340

Query  1173  QAEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPR  1346
             Q E+RE FK      ES+V KL YL LVIKE  RLH P P+I R +  D+ + GY IP  
Sbjct  341   QTEIRETFKDNPNFGESDVQKLKYLKLVIKEGFRLHAPIPLIPRVSRADTEIEGYVIPIG  400

Query  1347  TRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGL  1526
              +VL+NAWA+ RDP  W DPE F+PERFE+DP DFT  + F+Y+PFG+G+RMCPG++FGL
Sbjct  401   AKVLVNAWAMGRDPGLWSDPERFEPERFENDPRDFT-GNDFEYIPFGAGRRMCPGMTFGL  459

Query  1527  ASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDI  1655
             ASV  PLAHLLY FDW+LP G++   L +TE P +    + ++
Sbjct  460   ASVELPLAHLLYSFDWKLPAGMSSGDLDMTERPAITAARRQNL  502



>ref|XP_007214747.1| hypothetical protein PRUPE_ppa025066mg [Prunus persica]
 gb|EMJ15946.1| hypothetical protein PRUPE_ppa025066mg [Prunus persica]
Length=514

 Score =   398 bits (1023),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 221/459 (48%), Positives = 311/459 (68%), Gaps = 10/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL+RL G ++PH  LRDL+K++G  LMHL+LGEV AVVVSSAE AK  +KTHDL FA+
Sbjct  48    IGNLHRLAG-SLPHHRLRDLAKKYGP-LMHLKLGEVSAVVVSSAEFAKEVMKTHDLIFAS  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA + + Y S+DI F+PYGEYWRQ+RK+C  ELLS + V+SF  IR++E   L+  
Sbjct  106   RPTILAANILSYGSTDIGFAPYGEYWRQLRKICTLELLSTKRVQSFRPIREEEVVNLIQW  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  +S AG PIN+  E+ +   +I  R AFGK     E+ +  V E +   S F++AD F
Sbjct  166   I--ASRAGSPINLTQEIYSSTYTITSRTAFGKKTRDQEKFIYIVKEFVKAASGFALADIF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS  +LH L+  + ++ ++ +E D+IMG+IIKEH+ N+            ED+VDVL+K 
Sbjct  224   PSVSLLHLLSRMRPKLERLHKEADKIMGNIIKEHQRNV-VNTKSGEGEADEDLVDVLLKF  282

Query  1020  KD-SDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
              D  + L  S+T +NIKA+I D+F    +TS+T    A+ EM+KNPRV+  AQ EVRE+F
Sbjct  283   HDHGNELEFSLTTENIKAVIFDIFAAGSETSSTAVDWAIAEMIKNPRVMNMAQNEVRELF  342

Query  1197  --KGRVEESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINA  1367
               KG+V+E+ + ++ YLNLVIKET     P   ++ RE  +   + GY IP +++V++NA
Sbjct  343   NRKGQVDETCIREMKYLNLVIKETLRLHPPGPLLLPRECGEKCEIDGYEIPVKSKVIVNA  402

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP YW +PESF P RF D+ +D+ + + F+Y+PFG+G+RMCPG+SFGLASV  PL
Sbjct  403   WAIGRDPNYWNEPESFNPNRFLDNSIDY-KGTNFEYIPFGAGRRMCPGVSFGLASVELPL  461

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP+G+    L +TE     +  K+D+  I
Sbjct  462   ALLLYHFDWKLPNGMKHEDLDMTEAFGATVKRKHDLHLI  500



>ref|XP_011081932.1| PREDICTED: cytochrome P450 71D95-like [Sesamum indicum]
Length=505

 Score =   398 bits (1022),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 216/457 (47%), Positives = 308/457 (67%), Gaps = 12/457 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L G  +PH   R ++ ++G  ++HLQLGEV AVV+SS E  K  LK  D   A 
Sbjct  49    IGHLHHLAG-ELPHRAYRRIAHKYGP-VIHLQLGEVSAVVISSREATKEVLKDQDPACAN  106

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  +    + YD  D+ FSPY  YWRQMRK+C  ELLSA+ VRSF YIRQ+E   LL+ 
Sbjct  107   RPESIGIQIMWYDYVDMTFSPYNGYWRQMRKICTLELLSAKNVRSFGYIRQEELSLLLES  166

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RSSSG    IN+  +V  F +S+ICRA+ GK +   ++L++ + + + M   F +AD F
Sbjct  167   LRSSSGEA--INLTQKVFAFTSSVICRASLGKVMRDRDKLIEMLKKAVAMAGGFELADLF  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K++H L   K +++++R++ D I+  I++EH+      K     S  EDIVDVL+++
Sbjct  225   PSSKLMHVLCWNKYKLLRMRRKLDAILDVILEEHK-----LKKSGDVSRGEDIVDVLLRM  279

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             + +  L   IT+DNIKA+I DMF    +TS+T    AM E+++NPRV+AK QAEVRE FK
Sbjct  280   QKNGELQFPITNDNIKAVIFDMFSAGTETSSTTIDWAMAELMRNPRVMAKVQAEVREAFK  339

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
             G+  VEES+V  L YL LVIKET RLHPP P++ R    +  V GY+IP +++VLIN WA
Sbjct  340   GKTTVEESDVQALKYLKLVIKETFRLHPPIPLLPRACRDECEVNGYSIPLKSKVLINIWA  399

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             + RDP+YW  PE+F+PERF++  +DF   +  +Y+PFG+G+R+CPG++FGLA+V  PLA 
Sbjct  400   MGRDPEYWHQPETFQPERFDNSCIDFL-GNNLEYIPFGAGRRICPGMNFGLANVELPLAQ  458

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHFDW++P G+TP  + +TE   +A+  KN +F +
Sbjct  459   LLYHFDWKMPKGMTPDDVDMTEAEGIAIARKNGLFLV  495



>gb|KCW76838.1| hypothetical protein EUGRSUZ_D01192 [Eucalyptus grandis]
Length=508

 Score =   398 bits (1022),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 204/458 (45%), Positives = 309/458 (67%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +GNL+++ G  +PH  L DL+K +G  + +LQLGE+P + + + E AK  LKT +L FA 
Sbjct  47    LGNLHQMFG-ELPHHRLTDLAKTYGP-VFYLQLGEIPVITICTPEAAKEVLKTQELTFAD  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP   A +   Y  S + FSPYGEYWRQ+RK+C+ ELLS + VRSF+++R++E   L+  
Sbjct  105   RPPFTAAEMTSYVGSSLFFSPYGEYWRQLRKICVLELLSVKRVRSFAWVREEEVSNLVKY  164

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++SSSG   P+N+ +++   + SIIC+AAFG    + +E +  + E + +VS F +A+ F
Sbjct  165   IKSSSGL--PLNLSEKIFACVNSIICKAAFGHKCKQQDEFISSLQESIKLVSGFGLAELF  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHR-NNLgsgktgsgesgseDIVDVLIK  1016
             PS + L ++ G K ++ K++++ DEI+  I+ +H+              G ED+VDVL +
Sbjct  223   PSLRFLFYINGMKFKLDKIQRKYDEILNIILADHKIQREQCLNRPEDTWGEEDLVDVLQR  282

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             L++S+ +   +T DNIK +ILD+     +TS+T+ + AM EM+KNP V+AKAQ E R V 
Sbjct  283   LQESNEIGFHLTTDNIKGVILDIIAAGSETSSTVLIWAMSEMLKNPNVMAKAQDETRRVL  342

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             KG+  V+ESN++KL+YL  VIKET+R+HPPG +I R   ++  + GY IP  +RVLINA+
Sbjct  343   KGKDGVQESNIEKLSYLKCVIKETLRMHPPGSLIPRAPREECKINGYDIPRNSRVLINAY  402

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW +PE F+PERF +  +D+ +    +++PFGSG+R+CPGISF  ASV   LA
Sbjct  403   AIGRDPRYWTNPEKFEPERFFESSVDY-KGLHHQFLPFGSGRRICPGISFATASVELILA  461

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYH+DW+L +G TP  L +TE+   A+G K+D++ I
Sbjct  462   SLLYHYDWKLANGQTPEQLDMTEVFGTAVGRKDDLYVI  499



>gb|KEH25835.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=500

 Score =   397 bits (1021),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 212/461 (46%), Positives = 307/461 (67%), Gaps = 16/461 (3%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL+++     + H T+RDLS ++G  LMHLQLGE+ AVVVSS  + K  ++THDL F 
Sbjct  45    IGNLHQIAFAGKLLHHTIRDLSHKYGP-LMHLQLGEISAVVVSSPNLTKEIMRTHDLSFV  103

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RPR LA + + Y+S DIL S YG+YWRQMRK+C +ELLSA+ V+SFS IR+D   +++ 
Sbjct  104   ERPRFLAPNIITYESKDILMSSYGDYWRQMRKICTSELLSAKRVQSFSSIREDGVEKMIQ  163

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              + S+S    P+++   +++ ++S I RA FGK     +EL+  + + + MV+ F V+D 
Sbjct  164   FIHSTS-CQDPLDLSKMISSLVSSFISRATFGKKSKYEDELLCLLKQSMEMVNYFDVSDV  222

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS+K +HF++G K R+   +++ D I   II  H++N         +   E+IVDVL++
Sbjct  223   FPSFKPIHFISGMKPRLKNFQKKLDMIFEKIINAHQSN--------HDLQGENIVDVLLR  274

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             ++ S SL + IT DN+KA+I DMF GA D+S      AM E++KNPRV  KAQAE+REV 
Sbjct  275   IQQSGSLNIPITHDNVKAVIWDMFAGASDSSAITIDWAMSELMKNPRVRMKAQAEIREVC  334

Query  1197  KG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             KG  R+ ES++ +L+YL  VIKET+RLHPPG ++ RE  +   + GY IP +T +++NAW
Sbjct  335   KGKKRIYESDLHELSYLKSVIKETLRLHPPGAILTRECREACNIGGYEIPIKTNLILNAW  394

Query  1371  AISRDPQYWEDPESFKPERFEDDP-MDFTR--SSQFKYMPFGSGKRMCPGISFGLASVYT  1541
             AI RDP +W D E F PERF D+   DF +   + F+Y+PFG G+RMCPG+ FGLA++  
Sbjct  395   AIGRDPNHWSDAEKFIPERFHDNTGFDFNKVNDNSFQYIPFGGGRRMCPGVLFGLANIEL  454

Query  1542  PLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             PLA LLYHFDW++P+ +      +TE     +  KN++F I
Sbjct  455   PLAALLYHFDWKIPNEMKAEDFDMTEEYGATVSRKNNLFLI  495



>ref|XP_003535170.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 ref|XP_003535172.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 ref|XP_003537208.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
 gb|KHN08716.1| Cytochrome P450 71D8 [Glycine soja]
 gb|KHN13522.1| Cytochrome P450 71D8 [Glycine soja]
 gb|KHN28263.1| Cytochrome P450 71D8 [Glycine soja]
Length=501

 Score =   397 bits (1020),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 311/460 (68%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L    ++PH  LRDL+K++G  LMHLQLGE+ AVV SS ++AK  +KTHD+ F 
Sbjct  41    IGNLHQLAEAGSLPHHALRDLAKKYGP-LMHLQLGEISAVVASSPKMAKEIVKTHDVSFL  99

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP ++    + Y    I F+PYG++WRQMRK+C TELLS + V+SF+ IR+DE+ + +D
Sbjct  100   QRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSTKRVQSFASIREDEAAKFID  159

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE-LVKFVNEILIMVSSFSVAD  833
              +R S  AG PIN+   + + + + I R AFG      +E +V  + +I+     F +AD
Sbjct  160   SIRES--AGSPINLTSRIFSLICASISRVAFGGIYKEQDEFVVSLIRKIVESGGGFDLAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS   L+FLTG+ +R+ K+ ++ D+++ +II+EH+      K    E   +D +D+L+
Sbjct  218   VFPSIPFLYFLTGKMTRLKKLHKQVDKVLENIIREHQEKNKIAKEDGAELEDQDFIDLLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++  D+L + +T +NIKA+ILD+F    DTS +    AM EM++NPRV  KAQAE+R+ 
Sbjct  278   RIQQDDTLDIQMTTNNIKALILDIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAELRQA  337

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F+ +  + ES++++L YL LVIKET R+HPP P++  RE ++ +++ GY IP +T+V++N
Sbjct  338   FREKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECSQPTIIDGYEIPAKTKVMVN  397

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             A+AI +D QYW D + F PERFE   +DF + + F Y+PFG G+R+CPG++ GLAS+  P
Sbjct  398   AYAICKDSQYWIDADRFVPERFEGSSIDF-KGNNFNYLPFGGGRRICPGMTLGLASIMLP  456

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + P  + + E   +A+G KN++  I
Sbjct  457   LALLLYHFNWELPNKMKPEEMNMDEHFGLAIGRKNELHLI  496



>ref|XP_003537212.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=501

 Score =   397 bits (1020),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 201/460 (44%), Positives = 311/460 (68%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L    ++PH  LRDL+K++G  LMHLQLGE+ AV+ SS ++AK  +KTHD+ F 
Sbjct  41    IGNLHQLAEAGSLPHHALRDLAKKYGP-LMHLQLGEISAVIASSPKMAKEIVKTHDVSFL  99

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP ++    + Y    I F+PYG++WRQMRK+C TELLS + V+SF+ IR+DE+ + +D
Sbjct  100   QRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSTKRVQSFASIREDEAAKFID  159

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE-LVKFVNEILIMVSSFSVAD  833
              +R S  AG PIN+   + + + + I R AFG      +E +V  + +I+     F +AD
Sbjct  160   SIRES--AGSPINLTSRIFSLICASISRVAFGGIYKEQDEFVVSLIRKIVESGGGFDLAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS   L+FLTG+ +R+ K+ ++ D+++ +II+EH+      K    E   +D +D+L+
Sbjct  218   VFPSIPFLYFLTGKMTRLKKLHKQVDKVLENIIREHQEKNKIAKEDGAELEDQDFIDLLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++  D+L + +T +NIKA+ILD+F    DTS +    AM EM++NPRV  KAQAE+R+ 
Sbjct  278   RIQQDDTLDIQMTTNNIKALILDIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAELRQA  337

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F+ +  + ES++++L YL LVIKET R+HPP P++  RE ++ +++ GY IP +T+V++N
Sbjct  338   FREKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECSQPTIIDGYEIPAKTKVMVN  397

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             A+AI +D QYW D + F PERFE   +DF + + F Y+PFG G+R+CPG++ GLAS+  P
Sbjct  398   AYAICKDSQYWIDADRFVPERFEGSSIDF-KGNNFNYLPFGGGRRICPGMTLGLASIMLP  456

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + P  + + E   +A+G KN++  I
Sbjct  457   LALLLYHFNWELPNKMKPEEMNMDEHFGLAIGRKNELHLI  496



>gb|AIS36971.1| (-)-limonene 3-hydroxylase-like cytochrome p450-dependent oxygenase 
[Mentha spicata]
Length=500

 Score =   397 bits (1020),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 220/478 (46%), Positives = 314/478 (66%), Gaps = 11/478 (2%)
 Frame = +3

Query  237   RQWMKPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpav  416
             +QW KPK    LPPGP KLPLIG+L+ L G  +P   L  ++KQ+G  + H+QLGEV +V
Sbjct  24    KQWRKPKPQENLPPGPPKLPLIGHLHLLWG-KLPQHALASVAKQYGP-VAHVQLGEVFSV  81

Query  417   vvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLS  596
             V+SS E  K  +K  D   A R   +    + YD+ DI+FSPY E+WRQMRK+C++ELLS
Sbjct  82    VLSSREATKEAMKLVDPACADRFDSIGTKIMWYDNDDIIFSPYSEHWRQMRKICVSELLS  141

Query  597   ARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE  776
             AR VRSF +IRQDE  RLL  +RSS+ AG  +++ + + T   SIICRAAFG  +   EE
Sbjct  142   ARNVRSFGFIRQDEVSRLLGHLRSSAAAGEAVDLTERIATLTCSIICRAAFGSVIRDHEE  201

Query  777   LVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLg  956
             LV+ V + L M S F +AD FPS K+L+ L   KS++ ++R+  D I+  I++EH+    
Sbjct  202   LVELVKDALSMASGFELADMFPSSKLLNLLCWNKSKLWRMRRRVDAILEAIVEEHK----  257

Query  957   sgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMV  1136
                  SGE G EDI+DVL +++    + + IT + IKA I D F    +TS+T T+  M 
Sbjct  258   --LKKSGEFGGEDIIDVLFRMQKDSQIKVPITTNAIKAFIFDTFSAGTETSSTTTLWVMA  315

Query  1137  EMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVIKETMRLHPPGPVIYRENNK  1310
             E+++NP V+AKAQAEVR   KG+   +  +V +L Y+  V+KETMR+HPP P+I R   +
Sbjct  316   ELMRNPEVMAKAQAEVRAALKGKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCRE  375

Query  1311  DSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGS  1490
             +  V GYTIP + R++IN W++ R+P YWE PE+F PERF+    DF   + F+++PFG+
Sbjct  376   ECEVNGYTIPNKARIMINVWSMGRNPLYWEKPETFWPERFDQVSRDFM-GNDFEFIPFGA  434

Query  1491  GKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             G+R+CPG++FGLA+V  PLA LLYHFDW+L  G+ P  + ++E   +    KN++  +
Sbjct  435   GRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMKPSDMDMSEAEGLTGIRKNNLLLV  492



>gb|EYU39554.1| hypothetical protein MIMGU_mgv1a004505mg [Erythranthe guttata]
Length=523

 Score =   398 bits (1022),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 215/463 (46%), Positives = 307/463 (66%), Gaps = 10/463 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L GP+ PH  L DLSK++G  LM+L+LGE+  +VVSS E+A+ FLKTHD+ FA+
Sbjct  46    IGHLHHLTGPDPPHYKLADLSKRYGP-LMYLRLGEIDNIVVSSPEIARAFLKTHDVTFAS  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +L+ +   Y+++DI F+PYG+YWRQ+RK+C  ELLSA+ V+SF  IR + S +L   
Sbjct  105   RPSLLSTEIGCYNNTDIAFAPYGDYWRQLRKICTLELLSAKRVQSFRPIRVEVSSKLCKW  164

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + +S   G  +N+ + V+     ++ RAA GK  +      + V E + +V+ F +AD +
Sbjct  165   IAASQDEGSTVNLSERVSMSNYDVMVRAAIGKKSDEASAFTRVVKEGIRLVNVFHIADLY  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEH-RNNLgsgktg---sgesgseDIVDV  1007
             PS KI+  + G ++++    ++ D I+G++I E  R N      G         ED++DV
Sbjct  225   PSIKIMQMIGGLRTKIENHHRQLDRIIGNVIDERKRENARVATVGDGDGDGEKREDLLDV  284

Query  1008  LIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVR  1187
             L+K + S SL + +TDDNIKA++ DMFG  VDTS T+   AM EM++NPRVL KAQ EVR
Sbjct  285   LLKFQSSGSLDIPLTDDNIKAVLQDMFGAGVDTSPTVIDWAMSEMLRNPRVLKKAQEEVR  344

Query  1188  EVFK---GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRV  1355
              VF    G V+E   D+L Y  LVIKET+R HP  P++  RE+ +  ++ GY IP +TRV
Sbjct  345   RVFDSKGGIVDERYFDELKYFKLVIKETLRAHPVVPLLLPRESREPCLINGYEIPVKTRV  404

Query  1356  LINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASV  1535
             ++NAWAI RDP+YWE+PESFKPERF + P++FT  + F+Y+PFGSG+R CPG+  GLA+V
Sbjct  405   VVNAWAIGRDPEYWEEPESFKPERFIETPIEFT-GNNFEYIPFGSGRRACPGMMIGLANV  463

Query  1536  YTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
               PLA  LYHFDW LP G+ P  L +TEL   +   K D+  +
Sbjct  464   ELPLAMFLYHFDWMLPDGMKPEDLDMTELAGASARRKFDLCVV  506



>ref|XP_004511999.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=505

 Score =   397 bits (1020),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 214/460 (47%), Positives = 310/460 (67%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L     +PH  L+ LS ++G  LMHLQLGE+  VVVSS ++AK  +KTHD+ FA
Sbjct  44    IGNLHQLAFASKLPHHALKILSHKYGP-LMHLQLGEISTVVVSSPKLAKEVMKTHDVVFA  102

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP++L+   + Y   DI+FSPYG+YWRQMRK+C+ E+LS + V+SFSYIR+DE+ + + 
Sbjct  103   NRPKLLSPQILAYGFKDIVFSPYGDYWRQMRKICVLEVLSVKRVQSFSYIREDETTKFIK  162

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              ++S SG+   IN+   + + + SII RAAFG      +E V  + + + M     + D 
Sbjct  163   SIKSFSGST--INLTSRIFSVINSIISRAAFGDKSEDQDEFVSLIRKAIAMSGGLELDDL  220

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNN-LgsgktgsgesgseDIVDVLI  1013
             FPS K ++ LTG KS+  K+ +  D+I+ ++I++H      +      E+  ED+VDVL+
Sbjct  221   FPSMKPINILTGMKSKFEKIHKRIDKILDNVIRKHEEKRTITKDEKKIEAEKEDLVDVLL  280

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++ S SL + +T +NIKA+I D+F    DTS+T    +M EM+KNPRV  KAQAE+R+ 
Sbjct  281   RVQQSGSLDIQMTINNIKAVIWDIFVAGTDTSSTTIEWSMSEMMKNPRVRDKAQAELRQA  340

Query  1194  FKG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F+G  ++ ES++ +L YLNLVIKET+RLHPP P++  RE  + + + GY IP +T +LIN
Sbjct  341   FRGKDKICESDMHQLTYLNLVIKETLRLHPPSPLLVPRECYELTNIDGYDIPKKTIILIN  400

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AW   RDPQYW D E F PERF+   +DF + + F+Y+PFG+G+RMCPG+SFGLASV  P
Sbjct  401   AWTKGRDPQYWSDAERFIPERFDGSFIDF-KGNNFEYIPFGAGRRMCPGMSFGLASVMFP  459

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + P    + E   M +G KN++  I
Sbjct  460   LALLLYHFNWELPNHMKPDHFDMIEHFGMTVGRKNELCLI  499



>ref|XP_006452556.1| hypothetical protein CICLE_v10008047mg [Citrus clementina]
 ref|XP_006474920.1| PREDICTED: cytochrome P450 71D11-like isoform X1 [Citrus sinensis]
 gb|ESR65796.1| hypothetical protein CICLE_v10008047mg [Citrus clementina]
Length=510

 Score =   397 bits (1019),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 219/455 (48%), Positives = 305/455 (67%), Gaps = 9/455 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNLY+L G ++PH  LRDLSK++G  LM LQLGEVP ++VSS EVAK  +KTHD+ FA+
Sbjct  49    IGNLYQLAG-SLPHHGLRDLSKKYGP-LMLLQLGEVPTIIVSSPEVAKEVMKTHDVVFAS  106

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP   A   + Y+  DI+FS YG+ W+Q+RK+C++ELLSA+ V+SF  IR+ E   L++ 
Sbjct  107   RPHFPAAQILSYNYRDIIFSSYGDSWKQLRKICVSELLSAKRVQSFQSIREAEVSDLINW  166

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  SS AG  IN+   V + M  I  RAAFG      E  V  + E   ++S F++AD F
Sbjct  167   I--SSKAGSVINLTQNVHSLMYGITSRAAFGNRSRDQEAFVAVIEETTKVISGFNIADVF  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS  +L +LTG KS++  + QE   I+ +II EH+    +          ED+VDVL+K+
Sbjct  225   PSIGLLQWLTGNKSQVETLHQEGVRIVENIINEHKKR-KATLKNCKTGDDEDLVDVLLKI  283

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             +    L   +T D+IKA+I D+F    +TS T    AM EM+KNPRV+ KAQAEVREVF 
Sbjct  284   QGHGDLDSFLTTDHIKAVISDIFAAGSETSATTVDWAMCEMMKNPRVMKKAQAEVREVFH  343

Query  1200  --GRVEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINAW  1370
               G+V E+++D++ +L LV+KET+RLHP  P +I RE  +   + G+ IP + RV++NAW
Sbjct  344   RTGKVNETSIDEMKFLKLVVKETLRLHPAAPLLIPRECGQRCQINGFDIPVKARVIVNAW  403

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW +PESF PERF D  +D+ + + F+Y+PFG+G+R+CPG+SFGLASV  PLA
Sbjct  404   AIGRDPEYWTEPESFIPERFLDHSVDY-KGTNFEYIPFGAGRRICPGMSFGLASVELPLA  462

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDI  1655
              LLYHFDW+LP+GI    L +TE   + +  K D+
Sbjct  463   MLLYHFDWKLPNGIKHEDLDMTEAFGVTVRRKQDL  497



>ref|XP_003611883.1| Cytochrome P450 [Medicago truncatula]
 gb|AES94841.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   396 bits (1018),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 208/463 (45%), Positives = 313/463 (68%), Gaps = 12/463 (3%)
 Frame = +3

Query  300   IGNLYRLVG-PNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL+++    ++PH   + L+ ++G  ++HL+LGE  AVV+SS ++AK  LKTHD+ FA
Sbjct  44    IGNLHQIAALGSLPHRAFKQLAHKYGP-IVHLKLGETSAVVISSPKLAKEILKTHDVIFA  102

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP + A   + Y S DI FSPYG+YWRQMRK+C+ ELLS + V+SFSYIR+DE+   + 
Sbjct  103   NRPHLQASHIMTYGSKDIAFSPYGDYWRQMRKICMLELLSNKRVQSFSYIREDETRNFIK  162

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              ++SS G+   +N+ + + + ++S + R+AFG      +E V  + + +  V     AD 
Sbjct  163   SIQSSEGSS--VNLTNRIFSLVSSTVSRSAFGDKTEDQDEFVSVIRKAIESVGGLEPADL  220

Query  837   FPSWK-ILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNN---LgsgktgsgesgseDIVD  1004
             FPS K I+  LTG KS+++K+ ++ D+I+  I+++H+        GK  S E   ED+VD
Sbjct  221   FPSMKSIIQMLTGTKSKVLKMHKKADKILEIIVRKHQEKQRRAKEGKVSSDEVEQEDLVD  280

Query  1005  VLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEV  1184
             VL+++++S SL + IT  NIKA+I D F    DT+T+  V AM E++KNP V+ KAQAE+
Sbjct  281   VLLRIQESGSLEIPITTSNIKAVIFDAFAAGTDTTTSTIVWAMSELMKNPSVMNKAQAEI  340

Query  1185  REVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRV  1355
             RE  KG+  + E+++ +L YL LVIKET+RLH P P++  RE  + + + GY IP +T+V
Sbjct  341   REACKGKEIISENDIQELPYLKLVIKETLRLHSPTPLLLPRECTELTNIDGYDIPKKTKV  400

Query  1356  LINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASV  1535
             +IN WA++RDPQYW D E F PERFE   +DF R + F+Y+PFG+G+R+CPG+ FG+A +
Sbjct  401   MINVWAMARDPQYWTDAEMFNPERFEGSSIDF-RGNNFEYLPFGAGRRICPGLQFGIAGI  459

Query  1536  YTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
               P+A LLYHF+WELP+ + P  L +TE   +A+G K+D+  I
Sbjct  460   MLPVALLLYHFNWELPNKMKPMDLDMTEHYGLAIGKKSDLCLI  502



>ref|XP_003600339.1| Cytochrome P450 [Medicago truncatula]
 gb|AES70590.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=511

 Score =   396 bits (1018),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 210/459 (46%), Positives = 304/459 (66%), Gaps = 9/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +GN+  LV  N P   LRDL+K++G  LMHLQLGE+  +VVSS EVA+  LKTHD+ FA+
Sbjct  48    LGNILNLVTTNPPR-KLRDLAKKYGP-LMHLQLGEIFFIVVSSPEVAREVLKTHDIIFAS  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +L  + V Y+S+DI FSPYG+YWRQ+RK+C  ELLS R V+S    RQ E + LL++
Sbjct  106   RPHLLVLEIVSYNSTDIAFSPYGDYWRQLRKICAIELLSTRRVKSLWPKRQKEINSLLNK  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + ++ G+    N+  EV + + +   +AAFGK     EE +  V +++ +   F + D F
Sbjct  166   IDANEGS--EFNLTQEVISMLYTFTSKAAFGKKYLEQEEFLSVVKQLIKLAGGFYLGDLF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS + +  L+G K ++ K+ Q+ D I+G II +H+  +            ED++D L+K 
Sbjct  224   PSAQWIQTLSGMKPKLKKLSQQVDRILGHIINDHKEAMSKRAKEGLAEVEEDLIDCLLKF  283

Query  1020  KDSDS-LPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             +DS S +  ++T DNIKAIILD+F    +TS +  + AM EM+K+ RVL KAQAEVRE F
Sbjct  284   EDSGSDMGFNLTTDNIKAIILDVFAAGSETSASTIIWAMAEMMKDQRVLKKAQAEVREGF  343

Query  1197  --KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
                GRV+E+ +D+  YL  VIKE++RLHP  P++  RE  +   + GY IP ++RVL+NA
Sbjct  344   DRSGRVDEATIDEFKYLKAVIKESLRLHPSVPLLLPRECGQACEINGYYIPVKSRVLVNA  403

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP+YW DP+ F PERF D  +DF + + F+Y+PFG+G+R+CPG+++G+A+V   L
Sbjct  404   WAIGRDPKYWNDPDKFYPERFIDSSIDF-KGTNFEYIPFGAGRRICPGMNYGMANVEQVL  462

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A +LYHFDW+LP+GI    L+L E    AM  K D++ I
Sbjct  463   ALILYHFDWKLPNGIKNEELELIEEFGAAMSRKGDLYLI  501



>ref|XP_007020554.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12079.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=541

 Score =   397 bits (1020),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 208/460 (45%), Positives = 311/460 (68%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++LV   +PH TL +L+K++G  LM L+LGEVP +VVSS E+AK  ++THD+ F  
Sbjct  47    IGNLHQLVS-TLPHHTLSNLAKKYG-PLMWLKLGEVPTLVVSSPEMAKEVMRTHDITFCQ  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   + Y+  DI+FSPYG YWRQM+K+C+TELLS   V+SF  IR+ E   L++ 
Sbjct  105   RPYLLAASIMGYNFQDIIFSPYGNYWRQMKKICMTELLSTNRVQSFQSIREQEVSALMEI  164

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  SS A  P+N+ +++ +    I  RAAFGK     EE ++   E+  +   F +AD +
Sbjct  165   I--SSNARSPVNLSEKIYSLTYGITARAAFGKKSGDEEEFIRIAIEVSKLAGGFCLADMY  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEH--RNNLgsgktgsgesgseDIVDVLI  1013
             PS ++L  ++G + ++ K+ + +D I+  II +H  R N  +      +   ED+VD+L+
Sbjct  223   PSNEMLKLISGIRLKLEKLHKASDRILEKIIDQHKERRNGMANTKTGNKKDEEDLVDILL  282

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             KL+    L   ++ DNIKA+I D+FG   + S+     AM EMV+NP+++ +AQAEVR V
Sbjct  283   KLQQQGDLDFPLSKDNIKAVIQDIFGAGSEASSNTVEWAMSEMVRNPKLMKEAQAEVRRV  342

Query  1194  F--KGRVEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLIN  1364
             F  KG+V+E  +++L +L L++KET+RL+P GP +I RE ++D V+ GY IP +T+V++N
Sbjct  343   FHGKGKVDEVGLEELKFLKLIVKETLRLYPAGPLLIPRECSEDCVIGGYEIPAKTKVIVN  402

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP YW++ E F+PERF D P+DF R + F+Y+PFG+G+RMCPGISF L ++  P
Sbjct  403   AWAIGRDPSYWKEAEKFQPERFIDKPIDF-RGTNFEYIPFGAGRRMCPGISFALPNIELP  461

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA+LLYHFDW+LP+ +    L +TE   + +  KND+F I
Sbjct  462   LANLLYHFDWKLPNKMKCEDLDMTESFGLTIRRKNDLFLI  501



>emb|CDP18847.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   396 bits (1017),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 201/457 (44%), Positives = 299/457 (65%), Gaps = 29/457 (6%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN++ L G  +PHV LRDL++                        AK  L THD  FA 
Sbjct  49    IGNMHNLFG-GLPHVVLRDLARM-----------------------AKEVLVTHDPTFAN  84

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  LA   + YD  D++F PYG+ WRQMRK+C TELLS + VRSFSYIR+DE  +L++ 
Sbjct  85    RPDRLAVKIMWYDQQDMIFIPYGDKWRQMRKICTTELLSGKHVRSFSYIRKDEISKLIES  144

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RSS GA   IN+ +    + + + CRAAFG+     E ++ +V E + + + F  AD F
Sbjct  145   IRSSQGAA--INVGEIFFMYTSLMTCRAAFGRICKEYETMIAYVKEGIALAAGFDAADMF  202

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+L  ++G + +++K+  + D I+ D+I +H+ N  SGK  + E+G ED++DVL++ 
Sbjct  203   PSLKVLPLISGLRRKLLKMHYKIDSILDDVISQHKLNHKSGKKSNAETGEEDLIDVLLRE  262

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             ++S +  M IT  +IKA++ D+F G  DT++  +  AM E++K+PRV+AKAQAEVR+VFK
Sbjct  263   QESGNPQMPITSKDIKAVVFDIFTGGTDTASVTSEWAMAELMKHPRVMAKAQAEVRQVFK  322

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
             G+  +EE +V KL YL +V+KET+RLHPP P+I R + ++  V G  IP ++++++NAWA
Sbjct  323   GKKPIEEDDVQKLVYLKMVVKETLRLHPPIPLIPRASRENRQVKGCMIPNKSQIMVNAWA  382

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             I RDP+YW+DPE F PERFE + +D+T  +  +Y+PFG+G+RMCPG +FG+ +V  PLAH
Sbjct  383   IGRDPEYWDDPEIFLPERFEQNSIDYT-GTHCQYLPFGTGRRMCPGTAFGIVNVELPLAH  441

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHFDW LP  +    L + E   + +  KN++  +
Sbjct  442   LLYHFDWRLPDRMNVIDLDMDEAAGINIKRKNNLNLV  478



>ref|XP_010644547.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   396 bits (1017),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 219/459 (48%), Positives = 313/459 (68%), Gaps = 11/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++LVG ++PH +LR+L+K+ G  LMHLQLGEV A+VVSS E+AK  +KTHD+ F+ 
Sbjct  47    IGNMHQLVG-SLPHHSLRNLAKKHGP-LMHLQLGEVSAIVVSSREMAKEVMKTHDIIFSQ  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   V YD +DI F+PYG+YWRQ+RK+ I ELLSA+ V+SF  +R++E   +L+ 
Sbjct  105   RPCILAASIVSYDCTDIAFAPYGDYWRQIRKISILELLSAKRVQSFRSVREEE---VLNL  161

Query  660   VRS-SSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
             VRS SS  G  IN+ + + +   SII RAAFGK     E     + +       F++AD 
Sbjct  162   VRSISSQEGVSINLTESIFSLTFSIISRAAFGKKCKDQEAFSVTLEKFAGSGGGFTIADV  221

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS K+LH ++G + ++ K+ ++ D I+ +II EH+         S     ED+VDVL+K
Sbjct  222   FPSIKLLHVVSGIRHKLEKIHKKLDTILENIINEHKAR-SEASEISEAEVDEDLVDVLLK  280

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             ++    L   +T DNIKAI+LD+F    +TS+T    AM EM+KNP V+AKAQAEVR++F
Sbjct  281   VQKQGDLEFPLTTDNIKAILLDLFIAGSETSSTAVEWAMAEMLKNPGVMAKAQAEVRDIF  340

Query  1197  --KGRVEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINA  1367
               KG  +E+ + +L +L LVIKET+RLHPP P +I RE+ +   + GY IP +TRV+INA
Sbjct  341   SRKGNADETMIHELKFLKLVIKETLRLHPPVPLLIPRESRESCEINGYEIPVKTRVIINA  400

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WA++RDP++W D ESF PERF D  +D+ + + F+Y+PFG+G+RMCPGI FG+A+V   L
Sbjct  401   WAVARDPEHWNDAESFNPERFLDSSIDY-QGTNFEYIPFGAGRRMCPGILFGMANVEIAL  459

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLY+FDW+LP+G     L +TE  R ++  K ++  I
Sbjct  460   AQLLYYFDWKLPNGTQHEELDMTEDFRTSLRRKLNLHLI  498



>ref|XP_003535171.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=501

 Score =   395 bits (1016),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 201/460 (44%), Positives = 311/460 (68%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L    ++PH  LRDL+K++G  LMHLQLGE+ AVV SS ++AK  +KTHD+ F 
Sbjct  41    IGNLHQLAEAGSLPHHALRDLAKKYGP-LMHLQLGEISAVVASSPKMAKEIVKTHDVSFL  99

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP ++    + Y    I F+PYG++WRQMRK+C TELLS + V+SF+ IR+DE+ + +D
Sbjct  100   QRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSTKRVQSFASIREDEAAKFID  159

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE-LVKFVNEILIMVSSFSVAD  833
              +R S  AG PIN+   + + + + I R AFG      +E +V  + +I+     F +AD
Sbjct  160   SIRES--AGSPINLTSRIFSLICASISRVAFGGIYKEQDEFVVSLIRKIVESGGGFDLAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS   L+FLTG+ +R+ K+ ++ ++++ +II+EH+      K    E   +D +D+L+
Sbjct  218   VFPSIPFLYFLTGKMTRLKKLHKQVNKVLENIIREHQEKNKIAKEDGAELEDQDFIDLLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++  D+L + +T +NIKA+ILD+F    DTS +    AM EM++NPRV  KAQAE+R+ 
Sbjct  278   RIQQDDTLDIQMTTNNIKALILDIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAELRQA  337

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F+ +  + ES++++L YL LVIKET R+HPP P++  RE ++ +++ GY IP +T+V++N
Sbjct  338   FREKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECSQPTIIDGYEIPAKTKVMVN  397

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             A+AI +D QYW D + F PERFE   +DF + + F Y+PFG G+R+CPG++ GLAS+  P
Sbjct  398   AYAICKDSQYWIDADRFVPERFEGSSIDF-KGNNFNYLPFGGGRRICPGMTLGLASIMLP  456

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + P  + + E   +A+G KN++  I
Sbjct  457   LALLLYHFNWELPNKMKPEEMNMDEHFGLAIGRKNELHLI  496



>gb|KCW68415.1| hypothetical protein EUGRSUZ_F02064 [Eucalyptus grandis]
Length=476

 Score =   394 bits (1013),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 213/457 (47%), Positives = 307/457 (67%), Gaps = 9/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L+G  +    LRDL+K+ G  LMHLQLGEVP V+VSSAE+AK  +KTHDL FA 
Sbjct  17    IGNLHQLLGSPLLR-ALRDLAKKHGP-LMHLQLGEVPHVIVSSAEMAKEVMKTHDLTFAM  74

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA + + Y S+ I F+PYGEYWRQ+RK+   ELLSA+ V+SF +IR++E+  L+  
Sbjct  75    RPPLLASEVMSYGSTSIAFAPYGEYWRQIRKISTLELLSAKRVQSFRHIREEETLNLVKW  134

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             V  +S AG PIN+  ++ +        AAFGK     EE +  V +   + + F V D F
Sbjct  135   V--ASNAGSPINLTQKLFSTNYGATSIAAFGKKFKEQEEFISVVTKANKLAAGFEVGDAF  192

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH ++  K R+ K+ ++ D +M ++I+E R      K    E+  +D++DVL++ 
Sbjct  193   PSSKWLHVISRMKPRLEKLHRQADRMMNNVIREKREE--RAKRRDDETRHDDLIDVLLRF  250

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
              D      S+T DNIKA+ILD+F    +TS T    A+ EM+KNPR+L KAQAEVREVF 
Sbjct  251   ADPGGPEFSLTTDNIKAVILDIFVAGGETSATQVDWALAEMMKNPRILKKAQAEVREVFD  310

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
              +G+ +E+ + +L YL LVIKE +R+HP  P++ RE  +   + GY IP +T+V++NAWA
Sbjct  311   RRGKADETGLPELEYLKLVIKECLRMHPSIPLLLRECRERFEINGYEIPVKTKVVVNAWA  370

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             I RDP+YW++PE+F PERF+D P+D+ + + F+Y+PFG+G+RMCPG++FG+ +V  PLA 
Sbjct  371   IGRDPKYWDNPEAFYPERFKDSPVDY-KGTSFEYIPFGAGRRMCPGMNFGIVNVELPLAM  429

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHFDWELP G+    L + EL  +    K D++ +
Sbjct  430   LLYHFDWELPEGMKREELDMGELLGVTQRRKRDLYLV  466



>sp|Q9XHE7.1|C71DD_MENPI RecName: Full=Cytochrome P450 71D13; AltName: Full=(-)-(4S)-Limonene-3-hydroxylase; 
AltName: Full=Cytochrome P450 isoform 
PM17 [Mentha x piperita]
 gb|AAD44151.1| cytochrome p450 isoform PM17 [Mentha x piperita]
Length=500

 Score =   395 bits (1015),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 219/478 (46%), Positives = 313/478 (65%), Gaps = 11/478 (2%)
 Frame = +3

Query  237   RQWMKPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpav  416
             +QW KPK    LPPGP KLPLIG+L+ L G  +P   L  ++KQ+G  + H+QLGEV +V
Sbjct  24    KQWRKPKPQENLPPGPPKLPLIGHLHLLWG-KLPQHALASVAKQYGP-VAHVQLGEVFSV  81

Query  417   vvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLS  596
             V+SS E  K  +K  D   A R   +    + YD+ DI+FSPY  +WRQMRK+C++ELLS
Sbjct  82    VLSSREATKEAMKLVDPACADRFESIGTKIMWYDNDDIIFSPYSVHWRQMRKICVSELLS  141

Query  597   ARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE  776
             AR VRSF +IRQDE  RLL  +RSS+ AG  +++ + + T   SIICRAAFG  +   EE
Sbjct  142   ARNVRSFGFIRQDEVSRLLGHLRSSAAAGEAVDLTERIATLTCSIICRAAFGSVIRDHEE  201

Query  777   LVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLg  956
             LV+ V + L M S F +AD FPS K+L+ L   KS++ ++R+  D I+  I++EH+    
Sbjct  202   LVELVKDALSMASGFELADMFPSSKLLNLLCWNKSKLWRMRRRVDAILEAIVEEHK----  257

Query  957   sgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMV  1136
                  SGE G EDI+DVL +++    + + IT + IKA I D F    +TS+T T+  M 
Sbjct  258   --LKKSGEFGGEDIIDVLFRMQKDSQIKVPITTNAIKAFIFDTFSAGTETSSTTTLWVMA  315

Query  1137  EMVKNPRVLAKAQAEVREVFKGRVEE--SNVDKLAYLNLVIKETMRLHPPGPVIYRENNK  1310
             E+++NP V+AKAQAEVR   KG+ +    +V +L Y+  V+KETMR+HPP P+I R   +
Sbjct  316   ELMRNPEVMAKAQAEVRAALKGKTDWDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCRE  375

Query  1311  DSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGS  1490
             +  V GYTIP + R++IN W++ R+P YWE PE+F PERF+    DF   + F+++PFG+
Sbjct  376   ECEVNGYTIPNKARIMINVWSMGRNPLYWEKPETFWPERFDQVSRDFM-GNDFEFIPFGA  434

Query  1491  GKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             G+R+CPG++FGLA+V  PLA LLYHFDW+L  G+ P  + ++E   +    KN++  +
Sbjct  435   GRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMNPSDMDMSEAEGLTGIRKNNLLLV  492



>ref|XP_003535169.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=501

 Score =   395 bits (1014),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 199/460 (43%), Positives = 311/460 (68%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L    ++PH  LRDL+K++G  LMHLQLGE+ AV+ SS ++AK  +KTHD+ F 
Sbjct  41    IGNLHQLAEAGSLPHHALRDLAKKYGP-LMHLQLGEISAVIASSPKMAKEIVKTHDVSFL  99

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP ++    + Y    I F+PYG++WRQMRK+C TELLS + V+SF+ IR+DE+ + +D
Sbjct  100   QRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSTKRVQSFASIREDEAAKFID  159

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE-LVKFVNEILIMVSSFSVAD  833
              +R S  AG PIN+   + + + + I R +FG      +E +V  + +I+     F +AD
Sbjct  160   SIRES--AGSPINLTSRIFSLICASISRVSFGGIYKEQDEFVVSLIRKIVESGGGFDLAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS   L+FLTG+ +R+ K+ ++ D+++ +II+EH+      K    E   +D +D+L+
Sbjct  218   VFPSIPFLYFLTGKMTRLKKLHKQVDKVLENIIREHQEKNKIAKEDGAELEDQDFIDLLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++  D+L + +T +NIKA+ILD+F    DTS +    AM EM++NPRV  KAQAE+R+ 
Sbjct  278   RIQQDDTLDIQMTTNNIKALILDIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAELRQA  337

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F+ +  + ES++++L YL LVIKET R+HPP P++  RE ++ +++ GY IP +T+V++N
Sbjct  338   FREKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECSQPTIIDGYEIPAKTKVMVN  397

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             A+AI +D QYW D + F PERF+   +DF + + F Y+PFG G+R+CPG++ GLAS+  P
Sbjct  398   AYAICKDSQYWIDADRFVPERFQGSSIDF-KGNNFNYLPFGGGRRICPGMTLGLASIMLP  456

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + P  + + E   +A+G KN++  I
Sbjct  457   LALLLYHFNWELPNKMKPEEMNMDEHFGLAIGRKNELHLI  496



>ref|XP_004506687.1| PREDICTED: cytochrome P450 71D11-like [Cicer arietinum]
Length=509

 Score =   395 bits (1014),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 213/459 (46%), Positives = 299/459 (65%), Gaps = 9/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+  LV  N P   LRDL+K++G  LMHLQLGE+  +VVSSAEVAK  LKTHD+ FA+
Sbjct  46    IGNILHLVTSNPPR-KLRDLAKRYGP-LMHLQLGEIFFIVVSSAEVAKEVLKTHDITFAS  103

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP ++A D   Y+S+DI FSPYG+YWRQ+RK+C  ELLS R V+S   IR+ E + LL +
Sbjct  104   RPHLMATDIASYNSTDIAFSPYGDYWRQLRKICAIELLSVRRVKSLWPIREKEMNSLLKK  163

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S+ G+    N+   V +FM +   +AAFGK     EE +    +++ +   F + D F
Sbjct  164   IASNEGS--QFNLSQAVISFMYTFTSKAAFGKKYAEEEEFISVAKQLIKLAGGFYIGDLF  221

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS   LH L+G K ++ K+ Q  D I+G II +H+               ED++DVL+K 
Sbjct  222   PSATWLHNLSGMKPKLEKLSQHVDRILGHIINDHKEERSRRAKEGVAEAEEDLIDVLLKF  281

Query  1020  KD-SDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             +D S+ L   +T DNIKAIILD+F    +T+ T    AM EM+KNPRVL  AQAEVR+  
Sbjct  282   EDSSNDLDFYLTSDNIKAIILDVFIAGSETAATTINWAMAEMIKNPRVLKIAQAEVRDKI  341

Query  1197  --KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
               +G ++E+ + +L YL  VIKE++RLHP  P++  RE  +  V+ GY IP ++RV+INA
Sbjct  342   NRRGMIDETTLGELKYLKAVIKESLRLHPSIPLLLPRECRQACVINGYHIPVKSRVIINA  401

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP+YW DP+ F PERF D  +D+ + + F+Y+PFG G+R+CPG+++G+A+V   L
Sbjct  402   WAIGRDPKYWIDPDKFYPERFIDSSIDY-KGTNFEYIPFGGGRRICPGMNYGIANVEQTL  460

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A  LYHFDW+LP+G+    L+L E    AM  K D++ I
Sbjct  461   AMFLYHFDWKLPNGMKNEELELREEFGAAMSRKGDLYLI  499



>ref|XP_003529194.2| PREDICTED: cytochrome P450 71D11-like [Glycine max]
Length=517

 Score =   395 bits (1014),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 215/460 (47%), Positives = 303/460 (66%), Gaps = 11/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN++ LV    PH  LRDL+K +G  LMHLQLGEV  ++VSS E AK  +KTHD+ FA+
Sbjct  48    IGNIHHLV-TCTPHRKLRDLAKTYGP-LMHLQLGEVFTIIVSSPEYAKEIMKTHDVIFAS  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA D + Y+S++I+FSPYG YWRQ+RK+C  ELL+ R V SF  IR++E   L+  
Sbjct  106   RPKILASDILCYESTNIVFSPYGNYWRQLRKICTVELLTQRRVNSFKQIREEEFTNLVKM  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S  G+  PIN+ + V   + SII RAAFG      EE +  V E + + S F++ D F
Sbjct  166   IDSHKGS--PINLTEAVFLSIYSIISRAAFGTKCKDQEEFISVVKEAVTIGSGFNIGDLF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K L  +TG + ++ ++  +TD I+ +II EHR    S          ED+VDVL+K 
Sbjct  224   PSAKWLQLVTGLRPKLERLHGKTDRILKEIINEHR-EAKSKAKEDQGEAEEDLVDVLLKF  282

Query  1020  KDSD--SLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +D D  +  +S+T +NIKAIILD+F    +TS T    AM E++K+PRV+ KAQ EVRE+
Sbjct  283   QDGDDRNQDISLTINNIKAIILDVFAAGGETSATTINWAMAEIIKDPRVMKKAQVEVREI  342

Query  1194  F--KGRVEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLIN  1364
             F  KGRV+E  +++L YL  V+KET+RLHPP P +I RE  +   + GY IP +++V +N
Sbjct  343   FNMKGRVDEICINELKYLKSVVKETLRLHPPAPLLIPRECGQTCEINGYHIPVKSKVFVN  402

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP+YW +PE F PERF D  +D+ + + F++ PFGSG+R+CPGI+ G  +V   
Sbjct  403   AWAIGRDPKYWTEPERFYPERFIDSSIDY-KGNNFEFTPFGSGRRICPGITLGSVNVELA  461

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF W+LP+G+    L +TE    ++  K D++ I
Sbjct  462   LAFLLYHFHWKLPNGMKSEELDMTEKFGASVRRKEDLYLI  501



>ref|XP_007020553.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY12078.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=518

 Score =   395 bits (1014),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 210/460 (46%), Positives = 308/460 (67%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++LV   +PH TLRDL+K++G  LM L+LGEVP +VVSS E+AK  ++THD+ F  
Sbjct  53    IGNLHQLVS-TLPHYTLRDLAKKYGP-LMWLKLGEVPTLVVSSLEMAKEVMRTHDVTFCQ  110

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   + Y+  DI+FSPYG YWRQM+K+C+TELLS   V+SF  IR+ E   L++ 
Sbjct  111   RPYLLAASIMGYNFQDIIFSPYGNYWRQMKKICMTELLSTNRVQSFQSIREQEVSALMEI  170

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  SS A  P+N+ +++ +    I  RAAFGK     EE +    E+  +   F +AD +
Sbjct  171   I--SSNARSPVNLSEKIYSMTYGITARAAFGKKSGDEEEFISIAIEVSKLAGGFCLADMY  228

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEH--RNNLgsgktgsgesgseDIVDVLI  1013
             PS ++L  ++G + ++ K+ + +D I+  II +H  R N  +      +   ED+VDVL+
Sbjct  229   PSNEMLKLISGIRLKLEKLHKASDRILEKIIDQHKERRNGMANTKTGNKKDEEDLVDVLL  288

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             KL+    L   +  DNIKA+I D+FG   + S+     AM EMV+NP+++ +AQAEVR V
Sbjct  289   KLQQQGDLDFPLLKDNIKAVIQDIFGAGSEASSNTVEWAMSEMVRNPKLMKEAQAEVRRV  348

Query  1194  F--KGRVEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLIN  1364
             F  KG+V+E  +++L +L L++KET+RL+P GP +I RE ++D V+ GY IP +T+V++N
Sbjct  349   FHGKGKVDEVGLEELKFLKLIVKETLRLYPAGPLLIPRECSEDCVIGGYEIPAKTKVIVN  408

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP YW++ E F+PERF D  +DF R + F+Y+PFG+G+RMCPGISF L ++  P
Sbjct  409   AWAIGRDPSYWKEAEKFQPERFIDKRIDF-RGTNFEYIPFGAGRRMCPGISFALPNIELP  467

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFDW+LP+ +    L +TE   + +  KND+F I
Sbjct  468   LAKLLYHFDWKLPNEMKCDDLDMTESFGLTVRRKNDLFLI  507



>sp|D5J9U8.1|GAO_LACSA RecName: Full=Germacrene A oxidase; Short=LsGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Lactuca sativa]
 gb|ADF32078.1| germacrene A oxidase [Lactuca sativa]
Length=488

 Score =   394 bits (1011),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 203/460 (44%), Positives = 311/460 (68%), Gaps = 16/460 (3%)
 Frame = +3

Query  249   KPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvss  428
             +PKS +K  P   +LP+IG+++ L+G  +PH  + DL+++ G  LMHLQLGEV  +VVSS
Sbjct  24    RPKSTKKQLPEASRLPIIGHMHHLIG-TMPHRGVMDLARKHG-SLMHLQLGEVSTIVVSS  81

Query  429   aevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTV  608
              + AK  L T+D+ FA RP  L  + + Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V
Sbjct  82    PKWAKEILTTYDITFANRPETLTGEIIAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKV  141

Query  609   RSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKF  788
             +SF  IR++E   L+  V+  SG+G+PIN+ + + T + +I+ RAAFGK +    E  + 
Sbjct  142   KSFQSIREEECWNLVKEVK-ESGSGKPINLSESIFTMIATILSRAAFGKGIKDQREFTEI  200

Query  789   VNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgkt  968
             V EIL     F VAD FPS K LH L+G+++R+  + ++ D ++ +I+ EH         
Sbjct  201   VKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDNLINNIVAEHH-------V  253

Query  969   gsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVK  1148
              +    +E ++DVL++LKDS   P+  T DN+KAIILDMFG   DTS+     A+ E+++
Sbjct  254   STSSKANETLLDVLLRLKDSAEFPL--TADNVKAIILDMFGAGTDTSSATVEWAISELIR  311

Query  1149  NPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSV  1319
              PR + K QAE+R+   G  +++E ++  LAYLNLVI+ET+RLHPP P++  RE  +   
Sbjct  312   CPRAMEKVQAELRQALNGKEKIQEEDIQDLAYLNLVIRETLRLHPPLPLVMPRECREPVN  371

Query  1320  VCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKR  1499
             + GY I  +T++++N +AI+RDP+YW+D E+F PERFE++P +    + ++Y+PFG+G+R
Sbjct  372   LAGYEIANKTKLIVNVFAINRDPEYWKDAEAFIPERFENNPNNIM-GADYEYLPFGAGRR  430

Query  1500  MCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTE  1619
             MCPG + GLA+V  PLA++LYHF+W+LP+G +   L +TE
Sbjct  431   MCPGAALGLANVQLPLANILYHFNWKLPNGASHDQLDMTE  470



>ref|XP_003520242.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=502

 Score =   394 bits (1012),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 200/460 (43%), Positives = 313/460 (68%), Gaps = 9/460 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L    ++PH  LRDL+K++G  LMHLQLGE+ AVV SS ++AK  +KTHD+ F 
Sbjct  41    IGNLHQLAEAGSLPHHALRDLAKKYGP-LMHLQLGEISAVVASSPKMAKEIVKTHDVSFL  99

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP ++    + Y    I F+PYG++WRQMRK+C TELLSA+ V+SF+ IR+DE+ + +D
Sbjct  100   QRPHLVFGQMISYGGLGIAFAPYGDHWRQMRKMCATELLSAKRVQSFASIREDEAAKFID  159

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE-LVKFVNEILIMVSSFSVAD  833
              +R S  AG PIN+   + + + + I R AFG      +E +V  + +I+     F +AD
Sbjct  160   LIRES--AGSPINLTSRIFSLICASISRVAFGGIYKEQDEFVVSLIRKIVESGGGFDLAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS   L+F+TG+ +R+ K+ ++ D+++ +IIK+H     S K    E   +D +D+L+
Sbjct  218   VFPSIPFLYFITGKMARLKKLHKQVDKVLENIIKDHHEKNKSAKEDGAEVEDQDFIDLLL  277

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++  D+L + +T +NIKA+ILD+F    DTS++     M EM++NP V  KAQAE+R+ 
Sbjct  278   RIQQDDTLGIEMTTNNIKALILDIFAAGTDTSSSTLEWTMTEMMRNPTVREKAQAELRQT  337

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F+ +  + ES++++L YL LVIKET+R+HPP P++  RE ++ +++ GY IP +T+V++N
Sbjct  338   FREKDIIHESDLEQLTYLKLVIKETLRVHPPTPLLLPRECSQLTIIDGYEIPAKTKVMVN  397

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             A+AI +DPQYW   + F PERFED  +DF + + F+Y+PFG G+R+CPG++ GLAS+  P
Sbjct  398   AYAICKDPQYWTHADRFIPERFEDSSIDF-KGNNFEYLPFGGGRRICPGMTLGLASIMLP  456

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + P  + + E   +A+  KN++  +
Sbjct  457   LALLLYHFNWELPNNMKPEDMDMAEHFGLAINRKNELHLV  496



>ref|XP_010061471.1| PREDICTED: cytochrome P450 71D11-like [Eucalyptus grandis]
Length=503

 Score =   394 bits (1012),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 213/457 (47%), Positives = 307/457 (67%), Gaps = 9/457 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L+G  +    LRDL+K+ G  LMHLQLGEVP V+VSSAE+AK  +KTHDL FA 
Sbjct  44    IGNLHQLLGSPLLR-ALRDLAKKHG-PLMHLQLGEVPHVIVSSAEMAKEVMKTHDLTFAM  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA + + Y S+ I F+PYGEYWRQ+RK+   ELLSA+ V+SF +IR++E+  L+  
Sbjct  102   RPPLLASEVMSYGSTSIAFAPYGEYWRQIRKISTLELLSAKRVQSFRHIREEETLNLVKW  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             V  +S AG PIN+  ++ +        AAFGK     EE +  V +   + + F V D F
Sbjct  162   V--ASNAGSPINLTQKLFSTNYGATSIAAFGKKFKEQEEFISVVTKANKLAAGFEVGDAF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH ++  K R+ K+ ++ D +M ++I+E R      K    E+  +D++DVL++ 
Sbjct  220   PSSKWLHVISRMKPRLEKLHRQADRMMNNVIREKREE--RAKRRDDETRHDDLIDVLLRF  277

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
              D      S+T DNIKA+ILD+F    +TS T    A+ EM+KNPR+L KAQAEVREVF 
Sbjct  278   ADPGGPEFSLTTDNIKAVILDIFVAGGETSATQVDWALAEMMKNPRILKKAQAEVREVFD  337

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
              +G+ +E+ + +L YL LVIKE +R+HP  P++ RE  +   + GY IP +T+V++NAWA
Sbjct  338   RRGKADETGLPELEYLKLVIKECLRMHPSIPLLLRECRERFEINGYEIPVKTKVVVNAWA  397

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             I RDP+YW++PE+F PERF+D P+D+ + + F+Y+PFG+G+RMCPG++FG+ +V  PLA 
Sbjct  398   IGRDPKYWDNPEAFYPERFKDSPVDY-KGTSFEYIPFGAGRRMCPGMNFGIVNVELPLAM  456

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHFDWELP G+    L + EL  +    K D++ +
Sbjct  457   LLYHFDWELPEGMKREELDMGELLGVTQRRKRDLYLV  493



>ref|XP_006363816.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006363817.1| PREDICTED: premnaspirodiene oxygenase-like isoform X2 [Solanum 
tuberosum]
Length=503

 Score =   393 bits (1010),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 210/458 (46%), Positives = 307/458 (67%), Gaps = 13/458 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L   ++PH TL++LS ++G  +MHLQLGEV AV+VSS +VAK  LKTHD+ FA 
Sbjct  46    IGNLHQLSN-SLPHHTLKNLSNKYGP-MMHLQLGEVSAVIVSSPQVAKEVLKTHDIIFAN  103

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++L+   +  +S  + FSPYG  WRQ+RKVC+ ELLSA+ V+SF  IR++E   L++ 
Sbjct  104   RPQLLSVQILSNNSPTLSFSPYGANWRQLRKVCVLELLSAKRVQSFESIREEEVENLIEA  163

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S      PI+I + + +   +I  RAAFGK     +E +K +  I  +   F + D F
Sbjct  164   I-SFIQPQVPIDISEMLFSMTNNITARAAFGKKCKHKDEFIKAMKTITELSGGFDIPDLF  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS KI H L+G +S + KV Q  D+I  DII+EH+ N             ED+VDVL+++
Sbjct  223   PSLKIFHSLSGVRSALEKVHQNVDKIFEDIIQEHKAN------KRDMLYKEDLVDVLLRV  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             ++S  L + I+ + +K++IL++F G  DTS+T+   A+ EM+KNP+V+ KAQAEVR VFK
Sbjct  277   QESGDLEIPISRNTLKSVILEIFIGGTDTSSTVLEWAISEMMKNPQVMEKAQAEVRRVFK  336

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G  ++ ES + KL Y+ LVIKET+R+HPP P++  RE  +   + GY IP +T+V+INAW
Sbjct  337   GKSKITESEIQKLDYMKLVIKETLRMHPPAPLLLPREAIEKCDIGGYEIPAKTKVIINAW  396

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI R P++W++ E F+PERF+D  +DF   +  +Y+PFG G+R+CPG  FG+A+V  PLA
Sbjct  397   AIGRHPEHWKNAECFEPERFQDSDLDFI-GTNLEYIPFGGGRRICPGTLFGIANVELPLA  455

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LL+HFDW+LP GI    L +TE     +G KND++ +
Sbjct  456   KLLFHFDWKLPDGIEASNLDMTETFGATVGRKNDLYLV  493



>ref|XP_007154033.1| hypothetical protein PHAVU_003G085400g [Phaseolus vulgaris]
 gb|ESW26027.1| hypothetical protein PHAVU_003G085400g [Phaseolus vulgaris]
Length=511

 Score =   393 bits (1010),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 212/459 (46%), Positives = 314/459 (68%), Gaps = 12/459 (3%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L     +PH TL+ LS ++G  LMHLQLGE+ AV+VSS ++AK  +KTHDL+F 
Sbjct  47    IGNLHQLARADTLPHHTLQSLSHKYGP-LMHLQLGEISAVIVSSPDMAKEIMKTHDLNFV  105

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP++L    + Y S+DI F+PYGEYWRQMRK+C  ELLSA+ V SFS+IR++E  +L+ 
Sbjct  106   QRPQLLCPKILAYGSTDIAFAPYGEYWRQMRKICTLELLSAKRVHSFSFIREEEVAKLIR  165

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              ++  + AG  +N+ + V +F+++++ R AFGK   +  EL+  + +   +   F +AD 
Sbjct  166   SIQLCACAGSQVNVSENVFSFLSTLVSRTAFGKKSEKGNELLCLLKKGAELAGGFDLADL  225

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS K +HFLT  K+++  + +E D+I+  II EH++              E++VDVL++
Sbjct  226   FPSLKAVHFLTRMKTKLENMHKELDKILESIISEHQSK------HRNGDAEENLVDVLLR  279

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             ++ S +L + +T +NIKA+I D+FG   DTS T+    M E++KNPRV+ KAQ E+RE F
Sbjct  280   VQQSATLEVPLTINNIKAVIWDIFGAGTDTSATVLEWGMSELLKNPRVMKKAQVEIREAF  339

Query  1197  KG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINA  1367
             +G  R+ ES V +L+YL LVIKET+RLHPP P++     +DS  + GY IP +T+V+INA
Sbjct  340   RGKKRIGESEVYELSYLKLVIKETLRLHPPVPLLLPRECRDSCKIGGYDIPRKTKVIINA  399

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WA+ RDP++W D + F PERF+    DF + + F+Y+PFG+G+R+CPGI  GLA+V  PL
Sbjct  400   WALGRDPKHWYDAQKFIPERFDGTGFDF-KGNNFEYIPFGAGRRICPGILLGLANVELPL  458

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP+G+ P  L +TE     +G KN+++ I
Sbjct  459   AALLYHFDWKLPNGMKPQDLDMTEAFGATVGRKNNLYLI  497



>ref|XP_006367127.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
tuberosum]
Length=505

 Score =   393 bits (1010),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 206/460 (45%), Positives = 311/460 (68%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L    +PH  L++LS++FG  +M+LQLGEVP +VVSS  +A+  +KTHDL FA+
Sbjct  46    IGSVHHLT-KGIPHHVLKNLSQKFGP-IMYLQLGEVPTIVVSSPHMAQKIMKTHDLAFAS  103

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             R + +      YD +DI FSPYGEYWR MRK+CI ELLSA+ V+SFS IR DE   L+  
Sbjct  104   RSQTMLGKIFCYDCTDIAFSPYGEYWRHMRKLCIMELLSAKMVKSFSPIRLDELSSLVSS  163

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTL-NRTEELVKFVNEILIMVSSFSVADT  836
             ++S      PIN+ +++  FM S+ CR++FGK   ++ E ++  ++ +L +   F +AD 
Sbjct  164   IKSMKNT--PINVSEKLFWFMNSVTCRSSFGKACKDQNEAMISLIHGVLSLAGGFELADL  221

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHR-NNLgsgktgsgesgseDIVDVLI  1013
             +PS K L  ++G  S++++ R + D ++  +I  HR N+    K  +    +ED++DV  
Sbjct  222   YPSKKFLSGISGMGSKLIEARNKVDTVLDKVIDVHRENHANGKKCNAECGSNEDLIDVFF  281

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++  +  LP ++T++NIKA+ILDMF    DTS++    A+ EM+K+P V+AKAQAEVREV
Sbjct  282   RVMGTGELPFTLTNNNIKAVILDMFVAGSDTSSSTVTWALSEMMKSPSVMAKAQAEVREV  341

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             FKG+   ++ +++K+ YL LVIKET+RLHPP P++  RE  +++ + GY IP +++VL+N
Sbjct  342   FKGKKTFDDDDLEKVDYLKLVIKETLRLHPPTPLLVPRECREETEIDGYIIPVKSKVLVN  401

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              WAI RDP+ WED ESF PERFE+  +DF+  + F+++PFG+G+R CPG  FGLA V  P
Sbjct  402   VWAIGRDPESWEDSESFIPERFENSSVDFS-GTHFQFLPFGAGRRTCPGRLFGLALVTLP  460

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LAHLLY+F+W LP+G+ P  L + E   M      D++ I
Sbjct  461   LAHLLYNFNWTLPNGMDPRDLDMNEANGMTARRDKDLYLI  500



>sp|D5JBW9.1|GAO_SAUCO RecName: Full=Germacrene A oxidase; Short=SlGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Saussurea costus]
 gb|ADF43081.1| germacrene A oxidase [Saussurea costus]
Length=488

 Score =   392 bits (1008),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 205/460 (45%), Positives = 316/460 (69%), Gaps = 16/460 (3%)
 Frame = +3

Query  249   KPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvss  428
             +PKS +KL P P +LP+IG+++ L+G  +PH  + DL++++G  LMHLQLGEV  +VVSS
Sbjct  24    RPKSNKKLLPEPWRLPIIGHMHHLIG-TMPHRGVMDLARKYG-SLMHLQLGEVSTIVVSS  81

Query  429   aevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTV  608
              + AK  L THD+ FA RP  L  + + Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V
Sbjct  82    PKWAKEILTTHDITFANRPETLTGEIIAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKV  141

Query  609   RSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKF  788
             +SF  +R++E   L+  V+  SG+GRP+++ + +   + +I+ RAAFGK +   +E  + 
Sbjct  142   KSFQSLREEECWNLVQEVK-ESGSGRPVDLSENIFKMIATILSRAAFGKGIKDQKEFTEI  200

Query  789   VNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgkt  968
             V EIL     F VAD FPS K LH L+G+++R+  + ++ D ++ +I+ EH  N      
Sbjct  201   VKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDNLINNIVAEHPGN------  254

Query  969   gsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVK  1148
              +    +E ++DV+++LKDS   P+  T DN+KAIILDMFG   DTS+     A+ E+++
Sbjct  255   -NSSKSNETLLDVMLRLKDSVEFPL--TADNVKAIILDMFGAGTDTSSATVEWAISELIR  311

Query  1149  NPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSV  1319
              PR + K QAE+R+  KG  +V+E ++  L+YL+LVIKET+RLHPP P++  RE  +   
Sbjct  312   CPRAMEKVQAELRQALKGKDKVKEEDIQDLSYLDLVIKETLRLHPPLPLVMPRECRQPVN  371

Query  1320  VCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKR  1499
             + GY I  +T++++N +AI+RDP+YW+D ESF PERFE+ P+     ++++Y+PFG+G+R
Sbjct  372   LAGYDIANKTKLIVNVFAINRDPEYWKDAESFIPERFENSPITVM-GAEYEYLPFGAGRR  430

Query  1500  MCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTE  1619
             MCPG + GLA+V  PLA++LYHF+W+LP+G +   L +TE
Sbjct  431   MCPGAALGLANVQLPLANILYHFNWKLPNGASHDQLDMTE  470



>dbj|BAM68809.1| putative CYP71AV1 ortholog [Artemisia afra]
Length=495

 Score =   392 bits (1008),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 195/443 (44%), Positives = 300/443 (68%), Gaps = 16/443 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G  +PH  + DL++++G  LMHLQLGEV  +VVSS + AK  L T+D+ FA 
Sbjct  48    IGHMHHLIG-TIPHRGVMDLARKYG-SLMHLQLGEVSTIVVSSPKWAKEILTTYDITFAN  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  L  + V Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V+SF  +R++E   L+  
Sbjct  106   RPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSIKKVKSFQSLREEECWNLVQE  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++ +SG+GRP N+ + V   + +I+ RAAFGK +   +E  + V EIL     F VAD F
Sbjct  166   IK-ASGSGRPFNLSENVFKLIATILSRAAFGKGIKDQKEFTEIVKEILRQTGGFDVADIF  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G+++R+  + Q+ D ++ +++ EH          +    +E ++DVL++L
Sbjct  225   PSKKFLHHLSGKRARLTSIHQKLDNLINNLVAEH-------TVTTSNKTNETLLDVLLRL  277

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             KDS   P+  T DN+KAIILDMFG   DTS+     A+ E++K PR + K QAE+R+   
Sbjct  278   KDSAEFPL--TSDNVKAIILDMFGAGTDTSSATIEWAISELIKCPRAMEKVQAELRKALN  335

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G  ++ E ++ +L+YLNLVIKET+RLHPP P++  RE  +   + GY IP +T++++N +
Sbjct  336   GKEKIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQPVNLAGYNIPNKTKLIVNVF  395

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+YW+D E+F PERFE+        ++++Y+PFG+G+RMCPG + GLA+V  PLA
Sbjct  396   AINRDPEYWKDAETFIPERFENSSAT-VMGAEYEYLPFGAGRRMCPGAALGLANVQLPLA  454

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
             ++LYHF+W+LP+G +   + +TE
Sbjct  455   NILYHFNWKLPNGASHDQIDMTE  477



>ref|XP_003517257.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=506

 Score =   393 bits (1009),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 204/445 (46%), Positives = 308/445 (69%), Gaps = 10/445 (2%)
 Frame = +3

Query  300   IGNLYRL-VGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L +  ++PH TLRDL+ ++G  LMHLQLGE+ +VVVSS  +AK  +KTHDL F 
Sbjct  46    IGNLHQLAMAGSLPHRTLRDLALKYGP-LMHLQLGEISSVVVSSPNMAKEIMKTHDLAFV  104

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP+ L    + Y  +DI+F+PYG+YWRQM+K+C++ELLSA+ V+SFS+IR+DE+ + ++
Sbjct  105   QRPQFLPAQILTYGQNDIVFAPYGDYWRQMKKICVSELLSAKRVQSFSHIREDETSKFIE  164

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              +R S G+  PIN+  ++ + ++S + R AFG      EE +  + ++++    F   D 
Sbjct  165   SIRISEGS--PINLTSKIYSLVSSSVSRVAFGDKSKDQEEFLCVLEKMILAGGGFEPDDL  222

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsge-sgseDIVDVLI  1013
             FPS K LH + G K+++ K+ ++ D+I  +I++EH+                ED+VDVL+
Sbjct  223   FPSMK-LHLINGRKAKLEKMHEQVDKIADNILREHQEKRQRALREGKVDLEEEDLVDVLL  281

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++ SD+L + I+  NIKA+ILD+F    DTS +    AM EM++NPRV  KAQAEVR+ 
Sbjct  282   RIQQSDNLEIKISTTNIKAVILDVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQA  341

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F+    + E++V KL YL LVIKET+RLH P P++  RE ++ +++ GY IP +T+V+IN
Sbjct  342   FRELKIIHETDVGKLTYLKLVIKETLRLHAPSPLLVPRECSELTIIDGYEIPVKTKVMIN  401

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              WAI RDPQYW D E F PERF+   +DF + + F+Y+PFG+G+RMCPG++FGLA++  P
Sbjct  402   VWAIGRDPQYWTDAERFVPERFDGSSIDF-KGNNFEYLPFGAGRRMCPGMTFGLANIMLP  460

Query  1545  LAHLLYHFDWELPHGITPHTLKLTE  1619
             LA LLYHF+WELP+ + P  + ++E
Sbjct  461   LALLLYHFNWELPNEMKPEDMDMSE  485



>dbj|BAM68810.1| putative CYP71AV1 ortholog [Artemisia absinthium]
Length=495

 Score =   392 bits (1008),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 194/443 (44%), Positives = 301/443 (68%), Gaps = 16/443 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G  +PH  + DL++++G  LMHLQLGEV  +VVSS + AK  L T+D+ FA 
Sbjct  48    IGHMHHLIG-TIPHRGVMDLARKYG-SLMHLQLGEVSTIVVSSPKWAKEILTTYDITFAN  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  L  + V Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V+SF  +R++E   L+  
Sbjct  106   RPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEECWNLVQE  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++ +SG+GRP+N+ + +   + +I+ RAAFGK +   +E  + V EIL     F VAD F
Sbjct  166   IK-ASGSGRPVNLSENIFKLIATILSRAAFGKGIKDQKEFTEIVKEILRQTGGFDVADIF  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G+++R+  +  + D ++ +++ EH  N       +    +E ++DVL++L
Sbjct  225   PSKKFLHHLSGKRARLTSIHMKLDNLINNLVAEHTVN-------TSSKTNETLLDVLLRL  277

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             KDS   P+  T DN+KAIILDMFG   DTS+     A+ E++K PR + K QAE+R+   
Sbjct  278   KDSAEFPL--TADNVKAIILDMFGAGTDTSSATVEWAISELIKCPRAMEKVQAELRKALN  335

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G  ++ E ++ +L+YLNLVIKET+RLHPP P++  RE  +   + GY IP +T++++N +
Sbjct  336   GKEKIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQPVNLAGYNIPNKTKLIVNVF  395

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+YW+D E+F PERFE+        ++++Y+PFG+G+RMCPG + GLA+V  PLA
Sbjct  396   AINRDPEYWKDAETFIPERFENSSTT-VMGAEYEYLPFGAGRRMCPGAALGLANVQLPLA  454

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
             ++LYHF+W+LP+G +   + +TE
Sbjct  455   NILYHFNWKLPNGASYDQIDMTE  477



>ref|XP_010061472.1| PREDICTED: cytochrome P450 71D11-like [Eucalyptus grandis]
Length=511

 Score =   393 bits (1009),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 216/458 (47%), Positives = 307/458 (67%), Gaps = 10/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L+G + PH  LRDL+K+ G  LMHLQLGEVP V+VSSAE+AK  +KTHDL FAT
Sbjct  46    IGNLHQLLG-SPPHRALRDLAKKHGP-LMHLQLGEVPHVIVSSAEMAKEVMKTHDLTFAT  103

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA + + Y S+DI F+PYGEYWRQ+RK+C  EL S + V+SF +IR++E+  L+  
Sbjct  104   RPPLLASEVMSYGSTDIAFAPYGEYWRQLRKICTLELFSVKRVQSFRHIREEETSNLVKW  163

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             V  +S AG PIN+  ++ +        AAFGK     EE +  V E   + + F V D F
Sbjct  164   V--ASNAGSPINLTQKLFSTNYGATSIAAFGKKFKEQEEFISVVTEANKLAAGFEVGDVF  221

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH ++  K R+ K+ ++ D +M +II+E        K    E+  +D++DVL++ 
Sbjct  222   PSSKWLHVISRMKPRLEKLHRQADHMMNNIIRE--RREERAKRRDDETRHDDLIDVLLRF  279

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
              D      S+T DNIKA+ILD+F    +TS T    A+ EM+KNPR+L KAQAEVREVF 
Sbjct  280   ADPGGPEFSLTADNIKAVILDIFVAGGETSATQVDWALAEMMKNPRILKKAQAEVREVFD  339

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +G+ +E  + +L YL LVIKE++R+ P  P++  RE  +   + GY IP +T+V++NAW
Sbjct  340   RRGKADEMGLPELEYLKLVIKESLRMRPSVPLLLPRECGERCEINGYEIPVKTKVVVNAW  399

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW++PE F PERF+D P+D+ + + F+Y+PFG+G+RMCPG++FG+ +V  PLA
Sbjct  400   AIGRDPKYWDNPEVFYPERFKDSPVDY-KGTSFEYIPFGAGRRMCPGMNFGIVNVELPLA  458

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDWELP G+    L ++EL       K D++ +
Sbjct  459   MLLYHFDWELPEGMKREELDMSELLGATQRRKRDMYLV  496



>ref|XP_004511997.1| PREDICTED: cytochrome P450 71D8-like [Cicer arietinum]
Length=506

 Score =   393 bits (1009),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 199/460 (43%), Positives = 314/460 (68%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLVG-PNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL+++    ++PH   + L+ ++G  +MHL+LG++  +V++S ++AK  LKTHD+ FA
Sbjct  44    IGNLHQIASLGSLPHRAFQQLAHKYGP-IMHLKLGQISTIVITSPKLAKEILKTHDIVFA  102

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP + +   + Y S DI FSPYG+Y+RQMRK+C+ ELLSA+ V+SFSYIR+DE++  ++
Sbjct  103   NRPHLESAHIMSYGSKDIAFSPYGDYYRQMRKICMLELLSAKRVQSFSYIREDETNIFIE  162

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              ++SS  AG  +N+ + + + ++SI+ R+AFG      +E V+ + + +  V     AD 
Sbjct  163   LIKSS--AGSEVNLTNRIFSLVSSIVSRSAFGDKTEDQDEFVRVIRKTIESVGGLEPADL  220

Query  837   FPSWK-ILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
             FPS K I+H LTG KS++ K+++++D+I+  I+ +H+           +   ED+VDVL+
Sbjct  221   FPSMKYIIHVLTGNKSKLEKMQKQSDKILEIIVGKHQEK-QRRAKEGSDEEQEDLVDVLL  279

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++ S +L + IT  NIKAII D F    DT+T+  V AM E++KNPRV+ K Q+E+R+ 
Sbjct  280   RVQQSGTLDIPITTSNIKAIIFDTFAAGTDTTTSTIVWAMAELMKNPRVMEKLQSELRDA  339

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
              KG+  + E +V  L YL LVIKET+RLH P P++  RE+ + + + GY IP +T+V++N
Sbjct  340   CKGKEIITEVDVQDLPYLKLVIKETLRLHSPTPLLLPRESTQLTNIGGYDIPKKTKVMVN  399

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              WA++RDP YW D E F PERF+ + +D+ + + F+Y+PFG+G+R+CPG+SFG+A +  P
Sbjct  400   VWAMARDPYYWNDAEMFIPERFDANSIDY-KGNHFEYLPFGAGRRICPGMSFGIAGIMLP  458

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFDW+LP+ + P  L +TE   +A+G K D+  I
Sbjct  459   LALLLYHFDWKLPNQMKPQDLDMTEHYGLAIGRKTDLCLI  498



>emb|CDP07886.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   392 bits (1007),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 209/459 (46%), Positives = 309/459 (67%), Gaps = 26/459 (6%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL+ L+G + PH  LR+LSK+ G  LMH QLGEV ++VVSS+ +AK  LKTHDL+F  
Sbjct  43    IGNLHHLIG-SPPHHALRNLSKKHGP-LMHFQLGEVSSIVVSSSRLAKEVLKTHDLEFGN  100

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             R   LA   + YD  DI  +PYG+YWRQMRK+                    E+ +L+  
Sbjct  101   RAEFLATKILCYDYGDIASAPYGDYWRQMRKIY-------------------EALKLMSS  141

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGK-TLNRTEELVKFVNEILIMVSSFSVADT  836
             +++ +GAG+ +N+ +++ ++ +S++CRAAFGK + +  +  ++ V E L + S+F ++D 
Sbjct  142   IKTLAGAGKIVNLKEKLASYTSSMVCRAAFGKVSKDDHKAFLQLVMEALPLSSAFEISDL  201

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS KILH L   K++++KV  + D I+  II +H +NL   +   GESG ED+ DVL++
Sbjct  202   FPSLKILHPLFSAKTKLMKVHHKMDVILDKIIDQHIDNLARTRMAMGESGHEDLTDVLLR  261

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             +K+S  L   IT +N+KA++ DMF G  +TS+T    AM E++KNP V+ K Q EVR+ F
Sbjct  262   VKESGDLQFPITKNNVKAVLFDMFLGGTETSSTTLEWAMSELIKNPNVMTKVQNEVRKAF  321

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGPV-IYRENNKDSVVCGYTIPPRTRVLINA  1367
              G+  +EE+ + +L YL LVIKET+RLHPP P+ + ++  +   + GY+IP +TR+ +N 
Sbjct  322   TGKKTIEENEIQQLQYLKLVIKETLRLHPPAPLSVPKQCREQCEIDGYSIPVKTRLFVNT  381

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI+RDP+YW+DPESFKPERFE+  +DFT  + F+ +PFGSG+R+CPGISFG+A+V  PL
Sbjct  382   WAIARDPEYWDDPESFKPERFENSSIDFT-GNHFELLPFGSGRRICPGISFGIANVELPL  440

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
               LLYHFDW LP+G++P  L + E   +A   KND+  +
Sbjct  441   TLLLYHFDWRLPNGLSPDDLDMIESVGIATTRKNDLCLL  479



>ref|XP_008246006.1| PREDICTED: cytochrome P450 71D11-like [Prunus mume]
Length=514

 Score =   393 bits (1009),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 224/459 (49%), Positives = 314/459 (68%), Gaps = 10/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L G ++PH  LRDL+K++G  LMHL+LGEV AVVVSSAE AK  +KTHDL FA+
Sbjct  48    IGNLHQLAG-SLPHHRLRDLAKKYGP-LMHLKLGEVSAVVVSSAEFAKEVMKTHDLIFAS  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   + Y S+DI ++PYGEYWRQ+RK+C  ELLS + V+SF  IR++E   L+  
Sbjct  106   RPTILAAKILSYGSTDIGYAPYGEYWRQLRKICTLELLSTKRVQSFRPIREEEVVNLIQW  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  +S AG PINI  EV +   +I  R AFGK     E+ +  V E +   S F++ D F
Sbjct  166   I--ASRAGSPINITREVYSSTYTITSRTAFGKKTRDQEKFIYIVKEFVKAASGFALTDIF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS  +LH L+G + ++ ++ +E D I+G+IIKEH+ +L            ED+VDVL+K 
Sbjct  224   PSVSLLHLLSGMRLKLERLHKEADRILGNIIKEHQRDL-VTTKSGEGEAEEDLVDVLLKF  282

Query  1020  KD-SDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
              D  + L  S+T +NIKA+I D+F    +TS+T    A+ EM+KNPRV+  AQ EVREVF
Sbjct  283   HDHGNELEFSLTIENIKAVIFDIFAAGSETSSTAVDWAIAEMIKNPRVMNMAQNEVREVF  342

Query  1197  --KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINA  1367
               KG+V+E+ + ++ YLNLVIKET+RLHPPGP++     ++   + GY IP +++V++NA
Sbjct  343   NRKGQVDETCIREMKYLNLVIKETLRLHPPGPLLLPRECREKCEIDGYEIPVKSKVIVNA  402

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP YW +PESF P+RF D  +D+ + + F+Y+PFG+G+RMCPG+SFGLA+V  PL
Sbjct  403   WAIGRDPNYWNEPESFNPDRFLDSSIDY-KGTNFEYIPFGAGRRMCPGVSFGLANVELPL  461

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP G+    L +TE     +  K+D+  I
Sbjct  462   ALLLYHFDWKLPSGMKHEDLDMTEAFGATVKRKDDLHLI  500



>gb|KCW68416.1| hypothetical protein EUGRSUZ_F02065 [Eucalyptus grandis]
Length=530

 Score =   393 bits (1010),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 216/458 (47%), Positives = 307/458 (67%), Gaps = 10/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L+G + PH  LRDL+K+ G  LMHLQLGEVP V+VSSAE+AK  +KTHDL FAT
Sbjct  65    IGNLHQLLG-SPPHRALRDLAKKHGP-LMHLQLGEVPHVIVSSAEMAKEVMKTHDLTFAT  122

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA + + Y S+DI F+PYGEYWRQ+RK+C  EL S + V+SF +IR++E+  L+  
Sbjct  123   RPPLLASEVMSYGSTDIAFAPYGEYWRQLRKICTLELFSVKRVQSFRHIREEETSNLVKW  182

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             V  +S AG PIN+  ++ +        AAFGK     EE +  V E   + + F V D F
Sbjct  183   V--ASNAGSPINLTQKLFSTNYGATSIAAFGKKFKEQEEFISVVTEANKLAAGFEVGDVF  240

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH ++  K R+ K+ ++ D +M +II+E        K    E+  +D++DVL++ 
Sbjct  241   PSSKWLHVISRMKPRLEKLHRQADHMMNNIIRE--RREERAKRRDDETRHDDLIDVLLRF  298

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
              D      S+T DNIKA+ILD+F    +TS T    A+ EM+KNPR+L KAQAEVREVF 
Sbjct  299   ADPGGPEFSLTADNIKAVILDIFVAGGETSATQVDWALAEMMKNPRILKKAQAEVREVFD  358

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              +G+ +E  + +L YL LVIKE++R+ P  P++  RE  +   + GY IP +T+V++NAW
Sbjct  359   RRGKADEMGLPELEYLKLVIKESLRMRPSVPLLLPRECGERCEINGYEIPVKTKVVVNAW  418

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW++PE F PERF+D P+D+ + + F+Y+PFG+G+RMCPG++FG+ +V  PLA
Sbjct  419   AIGRDPKYWDNPEVFYPERFKDSPVDY-KGTSFEYIPFGAGRRMCPGMNFGIVNVELPLA  477

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDWELP G+    L ++EL       K D++ +
Sbjct  478   MLLYHFDWELPEGMKREELDMSELLGATQRRKRDMYLV  515



>dbj|BAM68815.1| cytochrome P450 monooxygenase CYP71AV2 [Artemisia maritima]
Length=495

 Score =   392 bits (1007),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 194/443 (44%), Positives = 301/443 (68%), Gaps = 16/443 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G  +PH  + DL++++G  LMHLQLGEV  +VVSS + AK  L T+D+ FA 
Sbjct  48    IGHMHHLIG-TIPHRGVMDLARKYG-SLMHLQLGEVSTIVVSSPKWAKEILTTYDITFAN  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  L  + V Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V+SF  +R++E   L+  
Sbjct  106   RPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEECWNLVQE  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++ ++G+GRP+N+ + +   + +I+ RAAFGK +    E  + V EIL     F VAD F
Sbjct  166   IK-AAGSGRPVNLSENIFKLIATILSRAAFGKGIKDQREFTEIVKEILRQTGGFDVADIF  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G+++R+  +  + D ++ +++ EH  N       +    +E ++DVL++L
Sbjct  225   PSKKFLHHLSGKRARLTSIHMKLDNLINNLVAEHTVN-------TSSKTNETLLDVLLRL  277

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             KDS   P+  T DN+KAIILDMFG   DTS+     A+ E++K PR + K QAE+R+  K
Sbjct  278   KDSAEFPL--TADNVKAIILDMFGAGTDTSSATIEWAISELIKCPRAMEKVQAELRKALK  335

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G  ++ E ++ +L+YLNLVIKET+RLHPP P++  RE  +   + GY IP +T++++N +
Sbjct  336   GKEKIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQPVNLAGYNIPNKTKLIVNVF  395

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+YW+D E+F PERFE+        ++++Y+PFG+G+RMCPG + GLA+V  PLA
Sbjct  396   AINRDPEYWKDAETFIPERFENSSTT-VMGAEYEYLPFGAGRRMCPGSALGLANVQLPLA  454

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
             ++LYHF+W+LP+G +   + +TE
Sbjct  455   NILYHFNWKLPNGASYDQIDMTE  477



>gb|ADA70806.1| cytochrome P450 CYP71D177 [Scoparia dulcis]
Length=504

 Score =   392 bits (1007),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 209/459 (46%), Positives = 303/459 (66%), Gaps = 18/459 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L G  +PH  L+ ++K++G  LMHL+LG V A+VVSS E AK  LK  D   A 
Sbjct  43    IGHLHHL-GTELPHRALQKMAKKYGP-LMHLRLGNVLAIVVSSREGAKELLKNKDPLCAD  100

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  +    + YD  DI+FSPY +YWRQMRK+C+ ELLS + VRSFS IRQDE+ ++++ 
Sbjct  101   RPESIGSQIMWYDYRDIIFSPYNDYWRQMRKICMIELLSTKNVRSFSSIRQDEALQMVES  160

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE--LVKFVNEILIMVSSFSVAD  833
             +R+SSG  +P+N  + +  F  +I CR AFGK +   +   L + + +   M + + +AD
Sbjct  161   IRASSG--KPVNFTETILAFTCAITCRTAFGKVMKPEDRHTLSELLKKAAAMAAGYELAD  218

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FP+   L   +  K +++K+R++ D I+  I+KEH           GE G EDIVDVL+
Sbjct  219   LFPA---LSLFSVNKYKLMKMRRQMDSILDAIVKEHE------FKQRGEFGGEDIVDVLL  269

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +LK +  L   I  DNIKA+I D+F    +TS+T    AM E+++NPRV+AK QAE+R+ 
Sbjct  270   RLKQTGDLQFPIERDNIKAVIFDVFSAGSETSSTTVDWAMAELMQNPRVMAKVQAELRDA  329

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINA  1367
             FKG+  ++ES++  L YL LVIKET+RLHPP P++ R   ++S + GYTIP + ++++N 
Sbjct  330   FKGKKTIDESDIQSLTYLKLVIKETLRLHPPFPMLLRGTREESQLNGYTIPYKAKIIVNN  389

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WA+ RDP YW +PESF+PERFE    DF   + F+++PFG+GKR+CPG+ FGLA+V  PL
Sbjct  390   WAMGRDPAYWHEPESFQPERFESISTDFL-GNNFEFLPFGAGKRICPGLHFGLANVELPL  448

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHF+W  P G+T   + LTE   +++  KN +F I
Sbjct  449   AQLLYHFNWNFPQGMTAKDIDLTETEGLSLSRKNGLFLI  487



>ref|XP_007033123.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY04049.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=509

 Score =   392 bits (1007),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 209/458 (46%), Positives = 308/458 (67%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L+  ++PH TLRDL+K+ G  LMHLQLGEVP +V+SS E AK  LK H   FA 
Sbjct  47    IGNMHQLIS-SLPHHTLRDLAKKHGP-LMHLQLGEVPTIVISSPETAKEVLKDHATIFAQ  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   + YDS++I+FSPYG+YWRQ+RK+   ELLS   V SF +IR++E   L+  
Sbjct  105   RPYLLASKIMSYDSTNIVFSPYGKYWRQLRKISTMELLSPSRVLSFRFIREEEVSALIKT  164

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  S   G P+N+  ++ +    I  RAAFGK     EE ++ + E + +   F +AD +
Sbjct  165   I--SLIEGSPVNLSVKIFSMTYGITSRAAFGKKSKDQEEFIRIMMETIKLAGGFCLADMY  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS ++L  ++G + ++ K++  +D I+ DI+ EH+           + G ED++DVL+KL
Sbjct  223   PSNELLKLISGVRLKLEKLQLASDRILEDIVNEHKEKTNRTSETGNQQGEEDLLDVLLKL  282

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             + S  L + +T+D IKAIILD+     DTS+T    AM EM+KNPRV+ +AQAEVR+VF 
Sbjct  283   QQSSDLEIPLTNDKIKAIILDILVAGGDTSSTTMEWAMSEMLKNPRVMKQAQAEVRQVFD  342

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              KG V+E+ + +L +L  ++KET+RLHP  P++  RE +++ V+ GY I  +++V++NAW
Sbjct  343   RKGNVDEAGIHELKFLRSIVKETLRLHPAAPLLVPRECDENCVISGYDILAKSKVIVNAW  402

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RD +YW+D E+F PERF D P+DF R + F+Y+PFG+G+R+CPGISF L ++  PLA
Sbjct  403   AIGRDSRYWKDAENFNPERFLDSPIDF-RGTHFEYIPFGAGRRICPGISFALPNIELPLA  461

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP+G     L +TE   + +  KND+F I
Sbjct  462   QLLYHFDWKLPNGSNCEDLDMTECFGITVRRKNDLFLI  499



>gb|KHN37234.1| Cytochrome P450 71D11 [Glycine soja]
Length=507

 Score =   392 bits (1007),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 213/460 (46%), Positives = 303/460 (66%), Gaps = 11/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++LV  + PH  LRDL+K +G  +MHLQLGE+  +VVSSAE A+  LKTHD++FA+
Sbjct  30    IGNLHQLV-TSTPHRKLRDLAKIYGP-MMHLQLGEIFTIVVSSAEYAEEILKTHDVNFAS  87

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+ L  +   Y+ + I F+PYGEYWRQ+RK+C  ELLS + V SF  IR++E   L+  
Sbjct  88    RPKFLVSEITTYEHTSIAFAPYGEYWRQVRKICAMELLSPKRVNSFRSIREEEFTNLVKM  147

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             V S  G+  PIN+ + V + + +II RAAFG      EE +  + E + + + F++ D F
Sbjct  148   VGSHEGS--PINLTEAVHSSVCNIISRAAFGMKCKDKEEFISIIKEGVKVAAGFNIGDLF  205

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K L  +TG +S++ K+  + D I+GDII EH+    S          ED++ VL+K 
Sbjct  206   PSAKWLQHVTGLRSKLEKLFGQIDRILGDIINEHK-EAKSKAKEGNGKAEEDLLAVLLKY  264

Query  1020  KDSDS--LPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++ ++     S+T +NIKA+  D+F G +D   T    AM EM+++PRV+ KAQ EVRE+
Sbjct  265   EEGNASNQGFSLTINNIKAVTSDIFAGGIDAVATAINWAMAEMIRDPRVMKKAQIEVREI  324

Query  1194  F--KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F  KGRV+ES +D+L YL  V+KET+RLHPP P+I  RE  +   + G+ IP +T+V IN
Sbjct  325   FNMKGRVDESCMDELKYLKSVVKETLRLHPPAPLILPRECAQACEINGFHIPVKTKVFIN  384

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              WAI+RDP YW +PE F PERF D  +DF +   F+Y+PFG+G+R+CPG +FGLASV   
Sbjct  385   VWAIARDPNYWSEPERFYPERFIDSSIDF-KGCNFEYIPFGAGRRICPGSTFGLASVELI  443

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFDW+LP+G+      +TE   + +  K+DI+ I
Sbjct  444   LAFLLYHFDWKLPNGMKNEDFDMTEEFGVTVARKDDIYLI  483



>ref|XP_006421138.1| hypothetical protein CICLE_v10004785mg [Citrus clementina]
 gb|ESR34378.1| hypothetical protein CICLE_v10004785mg [Citrus clementina]
Length=509

 Score =   392 bits (1007),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 213/458 (47%), Positives = 305/458 (67%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L G  +PH  LRDL+K++G  LM LQLG+VPA++VSS EVAK  +KTHD+ FA+
Sbjct  48    IGNLHQLAG-FLPHHRLRDLTKKYGP-LMLLQLGQVPAIIVSSPEVAKEVMKTHDVIFAS  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP       + Y+  D++FSPYG+ W+Q+RK+C++ELLSA+ V+SF  IR+ E   L++ 
Sbjct  106   RPHFPPAQILSYNYRDVIFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREAEVSDLINW  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  SS AG  IN+ ++V + M  I  RAAFG      E     + EI  ++S F++AD F
Sbjct  166   I--SSKAGSVINLTEKVYSLMYGITSRAAFGNRSRDQEAFASVIGEITKVMSGFNIADMF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS   L +LTG KSR+ ++ QE D I+ +II EH+               ED+VD+L+K+
Sbjct  224   PSVGFLQWLTGNKSRVERLHQEADRIVKNIINEHKKR-KETLKICKIGDDEDLVDILLKI  282

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             +    L  S+T D+IKA+I D+F    +TS T    AM EM++NPRV+ KAQAEVREVF 
Sbjct  283   QGRGDLDSSLTTDHIKAVIFDIFAAGSETSATTVDWAMCEMMRNPRVMKKAQAEVREVFH  342

Query  1200  --GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
               G+V E+++D++ +  L +KET+RLHP  P++  RE  +   + G+ IP +T+V +NAW
Sbjct  343   RTGKVNETSIDEMKFFKLFVKETLRLHPVAPLLLPRECGERCQINGFDIPVKTKVFVNAW  402

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW +P SF PERF D  +D+ + + F+++PFG+G+R+CPGISFGLASV  PLA
Sbjct  403   AIGRDPKYWTEPASFIPERFLDHSIDY-KGTNFEFIPFGAGRRICPGISFGLASVELPLA  461

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP+G+    L +TE     +  K D+  I
Sbjct  462   MLLYHFDWKLPNGMKHEDLDMTEAFATTVRRKQDLCMI  499



>gb|KDP25063.1| hypothetical protein JCGZ_22598 [Jatropha curcas]
 gb|AIM47556.1| CYP726A26 [Jatropha curcas]
Length=498

 Score =   392 bits (1006),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 209/457 (46%), Positives = 299/457 (65%), Gaps = 12/457 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL+ L G + PH  LRDL+ ++G  +M  QLG+VP VV+SSAE+AK  LKTH+  F  
Sbjct  46    IGNLHNLFGRDQPHHRLRDLAGKYGA-VMGFQLGQVPTVVISSAEIAKQVLKTHEFQFID  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA D V+Y+ SDI+F+PYG+YWRQ++K+ I ELLS++ V+SF  +R++E       
Sbjct  105   RPSLLAADIVLYNRSDIIFAPYGDYWRQIKKIAILELLSSKRVQSFKSVREEEVSSFFKF  164

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S   AG P+N+   + +    II + + GK   R EE++  + + +     FSVAD F
Sbjct  165   LYSK--AGSPVNLSRTLLSLTNGIIAKTSIGKKCKRQEEIIAVITDAIKATGGFSVADVF  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+K LH +TG  S + ++ +E D I+ +I+ EH+ N         ++  ++I+DVL+ +
Sbjct  223   PSFKFLHIITGISSTIRRIHREADTILEEIMDEHKAN------NESKNEPDNILDVLLDI  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             +   +L   +T DNIKAIIL+MFG A DTS+     AM EM+KNP  + KAQ EVREVF 
Sbjct  277   QQRGNLEFPLTADNIKAIILEMFGAASDTSSVTIEWAMSEMMKNPWTMKKAQEEVREVFN  336

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
             G   V E+++ +L YL LVIKET+RLHPP  +I RE N+   +  Y I P+TRVL+NAWA
Sbjct  337   GTGDVSEASLQELQYLKLVIKETLRLHPPLTLIPRECNQKCQINEYDIYPKTRVLVNAWA  396

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             I RDP +W DPE F PERF    +DF + + F+++PFG+GKRMCPGI+  +A++   LA 
Sbjct  397   IGRDPNWWTDPERFDPERFRCGSVDF-KGTDFEFIPFGAGKRMCPGITMAMANIELILAQ  455

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHF+WELP    P TL ++E   +A+  K ++  I
Sbjct  456   LLYHFNWELPGKAKPETLDMSESFGLAVKRKVELNLI  492



>ref|XP_010644548.1| PREDICTED: premnaspirodiene oxygenase-like [Vitis vinifera]
Length=508

 Score =   392 bits (1006),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 222/459 (48%), Positives = 312/459 (68%), Gaps = 11/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++LVG ++PH +LR L+K+ G  LMHLQLGEV A+VVSS E+AK  +KTHD+ F+ 
Sbjct  47    IGNMHQLVG-SLPHRSLRSLAKKHG-PLMHLQLGEVSAIVVSSREMAKEVMKTHDIIFSQ  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   V YD +DI F+PYG YWRQ+RK+ + ELLSA+ V+SF  +R++E   +L+ 
Sbjct  105   RPCILAASIVSYDCTDIAFAPYGGYWRQIRKISVLELLSAKRVQSFRSVREEE---VLNL  161

Query  660   VRSSS-GAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
             VRS S   G  IN+   + +   SII R AFGK     E     +++       F++AD 
Sbjct  162   VRSVSLQEGVLINLTKSIFSLTFSIISRTAFGKKCKDQEAFSVTLDKFADSAGGFTIADV  221

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS K+LH ++G + ++ KV ++ D I+G+II EH+    + K        +D+VDVL+K
Sbjct  222   FPSIKLLHVVSGMRRKLEKVHKKLDRILGNIINEHKAR-SAAKETCEAEVDDDLVDVLLK  280

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             ++    L   +T DNIKA++LD+F    +TS+T    AM EM+KNPRV+AKAQAEVR++F
Sbjct  281   VQKQGDLEFPLTMDNIKAVLLDLFVAGTETSSTAVEWAMAEMLKNPRVMAKAQAEVRDIF  340

Query  1197  --KGRVEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINA  1367
               KG  +E+ V +L +L LVIKET+RLHPP P +I RE+ +   + GY IP +TRV+INA
Sbjct  341   SRKGNADETVVRELKFLKLVIKETLRLHPPVPLLIPRESRERCAINGYEIPVKTRVIINA  400

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI+RDP+YW D ESF PERF D  +D+ + + F+Y+PFG+G+RMCPGI FG+A+V   L
Sbjct  401   WAIARDPKYWTDAESFNPERFLDSSIDY-QGTNFEYIPFGAGRRMCPGILFGMANVELAL  459

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP+G     L +TE  R +   K D++ I
Sbjct  460   AQLLYHFDWKLPNGARHEELDMTEGFRTSTKRKQDLYLI  498



>ref|XP_009595834.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=509

 Score =   392 bits (1006),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 214/463 (46%), Positives = 311/463 (67%), Gaps = 15/463 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNV----PHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDL  467
             IGNL++L+        PHV LR+L+ ++G  LMHL+LG+  AVVVSSAEVAK  L THDL
Sbjct  45    IGNLHQLLCLGSSEFQPHVALRNLADKYGP-LMHLKLGQRLAVVVSSAEVAKELLSTHDL  103

Query  468   DFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHR  647
              FA RP++L    V YD S+I+F+ YG++WRQMRK+C +ELL  R ++SF  +  DE   
Sbjct  104   TFANRPQLLVGKIVWYDFSNIVFAQYGDFWRQMRKICNSELLGQRKIQSFFPMMFDEVSS  163

Query  648   LLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSV  827
             L+  ++     G PIN+   ++    +I C+AA G+T +  E L+  + E++     FS 
Sbjct  164   LVMSIQEHD-IGTPINLSKRLSLMQFAITCKAAVGRTYSDQETLLMVMREVVTSADMFSP  222

Query  828   ADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDV  1007
              D FPS KIL  + G K ++ K+ Q+ D ++ +II+EH       +  S +   EDIVDV
Sbjct  223   EDLFPSMKILQLIGGLKKKLTKMHQKADHVVEEIIREHE----IKRGTSVKPIEEDIVDV  278

Query  1008  LIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVR  1187
             L++LK+S   P+ IT +NIKA+I DMF     ++TT+T  A+ E+V+NPR++ KAQ EVR
Sbjct  279   LLRLKESQDFPIPITRNNIKAVIFDMFVAGTTSTTTVTEWALSELVRNPRIMKKAQGEVR  338

Query  1188  EVFK---GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRV  1355
             +VFK    R++++++ KL YL +VIKET+RLHPPGP+ + RE+ ++  + GYTIP +T V
Sbjct  339   QVFKFGTERIDQTHIQKLTYLRMVIKETLRLHPPGPLSFPRESREECKINGYTIPNKTVV  398

Query  1356  LINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASV  1535
             L+N WAI RDP+YWE+PE+F+PERFE  P+D T  + F+Y PFG G+RMCPG+ FG+A V
Sbjct  399   LVNLWAIGRDPKYWENPETFEPERFECSPIDIT-GTHFEYTPFGVGRRMCPGMPFGMAGV  457

Query  1536  YTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
               PLA LLYHFDW+LP+G++P  + + E    ++  KN +  +
Sbjct  458   EVPLALLLYHFDWKLPNGMSPEEIDMAEKFSTSLERKNALCLV  500



>gb|KDP39287.1| hypothetical protein JCGZ_01044 [Jatropha curcas]
Length=510

 Score =   392 bits (1006),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 203/457 (44%), Positives = 302/457 (66%), Gaps = 6/457 (1%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L G  +PHV LR+L+ ++G  LMHL+LGEV  +VVSS E AK  +KTHD  FA 
Sbjct  46    IGSMHHLSGSLLPHVRLRNLANEYGP-LMHLKLGEVTNIVVSSPETAKAIMKTHDHIFAQ  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA + + Y+S+D+ F+PYG+YWRQMRK+C  E+LSA+ V SF  IR++E  + +  
Sbjct  105   RPFLLAANIMAYNSTDLAFAPYGDYWRQMRKICTQEILSAKRVLSFGLIREEEVSKFIRD  164

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  SS AG  +N      +   +II R A GK     E ++    +++     FS++D +
Sbjct  165   L--SSRAGSTVNFSRMFNSVTYNIIQRVAIGKLWKGEEIVIPAFKKLIEAAGGFSLSDLY  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+LH ++  K ++++  +ETD++  +II EHR    S      ++  EDI+DVL++ 
Sbjct  223   PSIKLLHKISTTKFKLLRAHKETDKLFQNIIDEHRARKASRAKSGAKNEEEDIIDVLLQA  282

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             +  + L   ITDDNIKA+I+D+  G  DTS T  V AM E++KNP V+ + Q EVR+VF 
Sbjct  283   QSEEELEYPITDDNIKAVIMDVLSGGTDTSATTVVWAMSELLKNPDVMKRVQTEVRQVFS  342

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
              KG V+E ++ +L YL  V+KETMRLHP G V+ RE  +D V+ GY IP ++R++INAWA
Sbjct  343   KKGYVDEESIGELHYLKAVVKETMRLHPTGAVLTRECREDCVINGYDIPYKSRIIINAWA  402

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             + RDP YW + E F P+RF +  +D+ +   F+++PFG+G+R+CPGI FG+++V  PLA 
Sbjct  403   LGRDPDYWPEAERFNPDRFLNSSIDY-KGKHFEFLPFGAGRRICPGILFGISNVQFPLAR  461

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHFDW+LP+G+ P  L + E   +A+   ND+  I
Sbjct  462   LLYHFDWKLPNGMRPEDLDMNEKYGIAVRRANDLQLI  498



>gb|AHN62855.1| germacrene A oxidase [Tanacetum parthenium]
Length=488

 Score =   391 bits (1004),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 194/443 (44%), Positives = 300/443 (68%), Gaps = 16/443 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G  +PH  + DL++++G  LMHLQLGEV  +VVSS + AK  L T+D+ FA 
Sbjct  41    IGHMHHLIG-TIPHRGVMDLARKYG-SLMHLQLGEVSTIVVSSPKWAKEILTTYDITFAN  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  L  + V Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V+SF  +R++E   L+  
Sbjct  99    RPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEECWNLVQE  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++ +SG+GRP+N+ + +   + +I+ RAAFGK +   +E  + V EIL     F VAD F
Sbjct  159   IK-ASGSGRPVNLSENIFKLIATILSRAAFGKGIKDQKEFTEIVKEILRQTGGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G+++R+  + Q+ D ++ +++ EH          +    +E ++DVL++L
Sbjct  218   PSKKFLHHLSGKRARLTSIHQKLDNLINNLVAEH-------TVKTSSKTNETLLDVLLRL  270

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             KDS   P+  T DN+KAIILDMFG   DTS+     A+ E++K PR + K Q E+R+   
Sbjct  271   KDSAEFPL--TADNVKAIILDMFGAGTDTSSATIEWAISELIKCPRAMEKVQVELRKALN  328

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G  R+ E ++ +L+YLNLVIKET+RLHPP P++  RE  +   + GY IP +T++++N +
Sbjct  329   GKERIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQPVNLAGYDIPNKTKLIVNVF  388

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+YW+D E+F PERFE+        ++++Y+PFG+G+RMCPG + GLA+V  PLA
Sbjct  389   AINRDPEYWKDAETFIPERFENSSTTVM-GAEYEYLPFGAGRRMCPGAALGLANVQLPLA  447

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
             ++LYHF+W+LP+G +   + +TE
Sbjct  448   NILYHFNWKLPNGASYDQIDMTE  470



>gb|AGO03790.1| costunolide [Tanacetum cinerariifolium]
Length=496

 Score =   391 bits (1005),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 200/456 (44%), Positives = 309/456 (68%), Gaps = 16/456 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L  P  PH  LR+L+K++G  +MHLQLG+V  VVVS+  +A+  +KT+D+ FA 
Sbjct  41    IGNIHQLKSPT-PHRVLRELAKKYGP-IMHLQLGQVSTVVVSTPRLAQEIMKTNDISFAD  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP         Y + DI ++PYGEYWRQM+K+C  ELLSA+ VRSFS IR++E    L R
Sbjct  99    RPTTTTSQIFFYKAQDIGWAPYGEYWRQMKKICTLELLSAKKVRSFSSIREEE----LTR  154

Query  660   VRS--SSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
             +R    S AG PIN  +     + ++IC+A  G        L++ + ++L  +S+F++A 
Sbjct  155   IRKILESKAGTPINYTEMTIEMVNNVICKATLGDCCKDQALLIELLYDVLKTLSAFNLAS  214

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              +P  + L+ ++G+K++ +K++++ D+IM DI+KEHR         +  S  ED+VDVL+
Sbjct  215   YYPRLQFLNVISGKKAKWLKMQKKLDDIMEDILKEHRAK-----GRAKNSDQEDLVDVLL  269

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++K++  L + +TD+++KA++LDM     DTS+T    AM E+++NP ++ +AQ EVR V
Sbjct  270   RVKETGGLDIDVTDEHVKAVVLDMLTAGTDTSSTTLEWAMTELMRNPDMMKRAQEEVRSV  329

Query  1194  FKGR-VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
              KG  V E+++  L YL L++KETMRLH P P++  RE  +D  V GY IP +T+VL+NA
Sbjct  330   VKGEHVTETDLQSLHYLKLIVKETMRLHAPTPLLVPRECRQDCNVDGYDIPAKTKVLVNA  389

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WA   DP  WE+PESF PERF++ P++F   + F+Y+PFG+G+R+CPG++FGL+ V  PL
Sbjct  390   WACGVDPGSWENPESFIPERFKNCPINFM-GADFQYIPFGAGRRICPGLTFGLSMVEYPL  448

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDI  1655
             AH LYHFDW+LP+G+ PH L +TE+  ++  +K+ +
Sbjct  449   AHFLYHFDWKLPNGMKPHELDITEITTISTSLKHHL  484



>gb|AIA09035.1| germacrene A oxidase [Cynara cardunculus var. scolymus]
Length=486

 Score =   390 bits (1003),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 314/460 (68%), Gaps = 16/460 (3%)
 Frame = +3

Query  249   KPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvss  428
             +PKS + L P P +LP+IG+++ L+G  +PH  + DLS+++G  LMHLQLGEV  +VVSS
Sbjct  22    RPKSNKNLLPEPWRLPIIGHMHHLIG-TMPHRGVMDLSRKYG-SLMHLQLGEVSTIVVSS  79

Query  429   aevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTV  608
              + AK  L T+D+  A RP  L  + + Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V
Sbjct  80    PKWAKEILTTYDITLANRPETLTGEIIAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKV  139

Query  609   RSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKF  788
             +SF  +R++E   L+  V+ +SG+GRP+++ + +   + +I+ RAAFGK +   +E  + 
Sbjct  140   KSFQSLREEECWNLVQEVK-ASGSGRPVDLSENIFKMIATILSRAAFGKGIKDQKEFTEI  198

Query  789   VNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgkt  968
             V EIL     F VAD FPS K LH L+G+++R+  + ++ D ++ +I+ EH  N      
Sbjct  199   VKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDNLINNIVAEHPGN------  252

Query  969   gsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVK  1148
              +    +E ++DVL++LKDS   P+  T DN+KA+ILDMFG   DTS+     A+ E+++
Sbjct  253   -TSSKSNETLLDVLLRLKDSPEFPL--TADNVKAVILDMFGAGTDTSSATVEWAISELIR  309

Query  1149  NPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSV  1319
              PR + K QAE+R+  KG  +++E ++  L+YL+LVIKET+RLHPP P++  RE  +   
Sbjct  310   CPRAMEKVQAELRQALKGKDKIKEEDIQDLSYLDLVIKETLRLHPPLPLVMPRECRQPVN  369

Query  1320  VCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKR  1499
             + GY I  +T++++N +AI+RDP+YW+D ESF PERFE+ P +    ++++Y+PFG+G+R
Sbjct  370   LAGYNIADKTKLIVNVFAINRDPEYWKDAESFIPERFENSPTNVM-GAEYEYLPFGAGRR  428

Query  1500  MCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTE  1619
             MCPG + GLA+V  PLA +LYHF+W+LP+G +   L +TE
Sbjct  429   MCPGAALGLANVLLPLATILYHFNWKLPNGASHEQLDMTE  468



>ref|XP_006596106.1| PREDICTED: cytochrome P450 71D11-like [Glycine max]
Length=525

 Score =   392 bits (1007),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 213/460 (46%), Positives = 303/460 (66%), Gaps = 11/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++LV  + PH  LRDL+K +G  +MHLQLGE+  +VVSSAE A+  LKTHD++FA+
Sbjct  48    IGNLHQLV-TSTPHRKLRDLAKIYGP-MMHLQLGEIFTIVVSSAEYAEEILKTHDVNFAS  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+ L  +   Y+ + I F+PYGEYWRQ+RK+C  ELLS + V SF  IR++E   L+  
Sbjct  106   RPKFLVSEITTYEHTSIAFAPYGEYWRQVRKICAMELLSPKRVNSFRSIREEEFTNLVKM  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             V S  G+  PIN+ + V + + +II RAAFG      EE +  + E + + + F++ D F
Sbjct  166   VGSHEGS--PINLTEAVHSSVCNIISRAAFGMKCKDKEEFISIIKEGVKVAAGFNIGDLF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K L  +TG +S++ K+  + D I+GDII EH+    S          ED++ VL+K 
Sbjct  224   PSAKWLQHVTGLRSKLEKLFGQIDRILGDIINEHK-EAKSKAKEGNGKAEEDLLAVLLKY  282

Query  1020  KDSDS--LPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++ ++     S+T +NIKA+  D+F G +D   T    AM EM+++PRV+ KAQ EVRE+
Sbjct  283   EEGNASNQGFSLTINNIKAVTSDIFAGGIDAVATAINWAMAEMIRDPRVMKKAQIEVREI  342

Query  1194  F--KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F  KGRV+ES +D+L YL  V+KET+RLHPP P+I  RE  +   + G+ IP +T+V IN
Sbjct  343   FNMKGRVDESCMDELKYLKSVVKETLRLHPPAPLILPRECAQACEINGFHIPVKTKVFIN  402

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
              WAI+RDP YW +PE F PERF D  +DF +   F+Y+PFG+G+R+CPG +FGLASV   
Sbjct  403   VWAIARDPNYWSEPERFYPERFIDSSIDF-KGCNFEYIPFGAGRRICPGSTFGLASVELI  461

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHFDW+LP+G+      +TE   + +  K+DI+ I
Sbjct  462   LAFLLYHFDWKLPNGMKNEDFDMTEEFGVTVARKDDIYLI  501



>gb|KHN39921.1| Cytochrome P450 71D8 [Glycine soja]
Length=508

 Score =   391 bits (1005),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 200/461 (43%), Positives = 314/461 (68%), Gaps = 10/461 (2%)
 Frame = +3

Query  300   IGNLYRLVGP-NVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L    ++PH  L+ LSK++G  LMHLQLGE+ AVV SS ++AK  +KTHD+ F 
Sbjct  43    IGNLHQLAAAGSLPHHALKKLSKKYG-PLMHLQLGEISAVVASSPKMAKEIVKTHDVSFL  101

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP  +A + + Y    I F+ YG++WRQMRK+C+TE+LS + V+SF+ IR+DE+ + ++
Sbjct  102   QRPYFVAGEIMTYGGLGIAFAQYGDHWRQMRKICVTEVLSVKRVQSFASIREDEAAKFIN  161

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE-LVKFVNEILIMVSSFSVAD  833
              +R S  AG  IN+   + + + + I R AFG      +E +V  +  I+ +   F +AD
Sbjct  162   SIRES--AGSTINLTSRIFSLICASISRVAFGGIYKEQDEFVVSLIRRIVEIGGGFDLAD  219

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS   L+F+TG+ +++ K+ ++ D+++  I+KEH+      K    E   ED +DVL+
Sbjct  220   LFPSIPFLYFITGKMAKLKKLHKQVDKLLETIVKEHQEKHKRAKEDGAEIEDEDYIDVLL  279

Query  1014  KL-KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVRE  1190
             ++ + SD+L +++T +NIKA+ILD+F    DTS +    AM EM++NPRV  KAQAE+R+
Sbjct  280   RIQQQSDTLNINMTTNNIKALILDIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAELRQ  339

Query  1191  VFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLI  1361
              F+G+  + ES++++L YL LVIKET R+HPP P++  RE ++ +++ GY IP +T+V++
Sbjct  340   AFRGKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECSQLTIIDGYEIPAKTKVMV  399

Query  1362  NAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYT  1541
             N +A+ +DP+YW D E F PERFE   +DF + + F+Y+PFG G+R+CPG++FGLA++  
Sbjct  400   NVYAVCKDPKYWVDAEMFVPERFEASSIDF-KGNNFEYLPFGGGRRICPGMTFGLATIML  458

Query  1542  PLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             PLA LLYHF+WELP+ I P  + + E   +A+G KN++  I
Sbjct  459   PLALLLYHFNWELPNKIKPENMDMAEQFGVAIGRKNELHLI  499



>ref|XP_003615865.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98823.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=502

 Score =   391 bits (1004),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 203/459 (44%), Positives = 310/459 (68%), Gaps = 14/459 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L+  ++PH   ++L+  +G  LMHL+LGEV  ++VSS  +AK  +KTHDL+F  
Sbjct  48    IGNMHQLISNSLPHQCFKNLADTYGP-LMHLKLGEVSYLIVSSPSMAKEIMKTHDLNFCD  106

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +L      Y++ DI+FSPYGE+WRQ+RK+C+ +LLSA+ V+SF YIR++E   L+  
Sbjct  107   RPNLLLSTIFSYNAIDIIFSPYGEHWRQLRKICVLQLLSAKRVQSFRYIREEEVSNLVKS  166

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + +S G+   +N+  ++    + I  RAAFGK     E     + EI  ++  F +AD +
Sbjct  167   ISASEGS--IVNLSHKIFLMTSGITTRAAFGKRSKHQEAFKSAIKEIASLLGEFCIADVY  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+  +++  K+++ K+ +E D I+ DII +H+N          ES  ED+VD L+K+
Sbjct  225   PSVKMFQWVSRAKTKVEKLHKEIDMILQDIIVDHKN------IHKEESKDEDLVDTLLKI  278

Query  1020  -KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
              +++D     +TD+N+KAIILDMFG   +TS+   +  + EMVKNP+++ KAQAEVR+VF
Sbjct  279   QQENDHSHNPLTDNNMKAIILDMFGAGTETSSGAVLWGISEMVKNPKIMEKAQAEVRKVF  338

Query  1197  --KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
               KG V+E+ + +L YL  +I+ET+RLHP  P++  RE+ +   + GY IP +TRV IN 
Sbjct  339   DKKGYVDETELHQLIYLKSIIRETLRLHPSVPLLVPRESRERCQINGYEIPAKTRVAINV  398

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RD +YW + ESFKPERF +  +DF + + F+Y+PFG+G+RMCPG++FGL+++  PL
Sbjct  399   WAIGRDERYWAEAESFKPERFLNSTIDF-KGTNFEYIPFGAGRRMCPGMAFGLSNIELPL  457

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP+G+    L +TE   MA+G K+D+  I
Sbjct  458   AQLLYHFDWKLPNGMKNEELDMTESFGMAIGRKHDLCLI  496



>gb|KHN01537.1| Cytochrome P450 71D11 [Glycine soja]
Length=508

 Score =   391 bits (1004),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 215/460 (47%), Positives = 302/460 (66%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +GNL++LV  + PH   RDL+K +G  +MHLQLGE+  +VVSSAE AK  LKTHD+ FA+
Sbjct  30    VGNLHQLVTSS-PHKKFRDLAKIYGP-MMHLQLGEIFTIVVSSAEYAKEILKTHDVIFAS  87

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  L  + + Y+S++I FSPYG YWRQ+RK+C  ELLS + V SF  IR++E   L+  
Sbjct  88    RPHFLVSEIMSYESTNIAFSPYGNYWRQVRKICTLELLSQKRVNSFQPIREEELTNLVKM  147

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S  G+   IN+ + V + M  II RAAFG      +E +  + + +++ + F++ D F
Sbjct  148   IGSQEGSS--INLTEAVHSSMYHIITRAAFGIRCKDQDEFISAIKQAVLVAAGFNIGDLF  205

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K L  +TG +  +  + Q TD+I+ DII EHR      K G GE+  E ++DVL+K 
Sbjct  206   PSAKWLQLVTGLRPTLEALFQRTDQILEDIINEHREAKSKAKEGHGEAEEEGLLDVLLKF  265

Query  1020  KDSDSLPMSI--TDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +D +    SI  T +NIKA+I D+FGG V+   T    AM EM++NPRV+  AQ EVREV
Sbjct  266   EDGNDSNQSICLTINNIKAVIADIFGGGVEPIATTINWAMAEMIRNPRVMKTAQVEVREV  325

Query  1194  F--KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F  KGRV+E+ +++L YL  V+KET+RLHPP P+I  RE  +   + GY IP +T+V IN
Sbjct  326   FNIKGRVDETCINELKYLKSVVKETLRLHPPAPLILPRECQETCKINGYDIPVKTKVFIN  385

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP YW +PE F PERF D  +D+ +   F+Y+PFG+G+R+CPGI+FGL +V   
Sbjct  386   AWAIGRDPNYWSEPERFYPERFIDSSVDY-KGGNFEYIPFGAGRRICPGITFGLVNVELT  444

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYH DW+LP+G+      +TE   + +  K+DI+ I
Sbjct  445   LAFLLYHLDWKLPNGMKNEDFDMTEKFGVTVARKDDIYLI  484



>ref|XP_004305992.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=509

 Score =   391 bits (1004),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 211/456 (46%), Positives = 312/456 (68%), Gaps = 11/456 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L+G  +PH  LRDL+KQ G  LMHL+LGEV  VVVSSAE+AK  + THD+ FA+
Sbjct  48    IGNLHQLIGA-LPHRGLRDLAKQHGP-LMHLKLGEVSTVVVSSAELAKEVMTTHDIIFAS  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+ LA   + YDS+DI F+PY +YWR++RK+C  ELL+A+ V+S+  IR+ E   L++ 
Sbjct  106   RPQFLATRIIFYDSTDIAFAPYSDYWRELRKICTQELLNAKRVQSYRPIREKEVLNLIEW  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  SS AG PIN+  +V + + SI  +AAFG      EE +  V +++  +S F+VAD F
Sbjct  166   I--SSRAGSPINLTQKVKSSIYSITAQAAFGNECKDQEEFIYAVKDVIKAISGFNVADVF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+K+LH ++GE+ R+ +++++ D I+ +IIKEH     + K        ED+VD+L+K 
Sbjct  224   PSFKLLHMISGEQHRVERLQKQVDRILENIIKEHMQ--ATTKKRDEAHVQEDLVDILLKF  281

Query  1020  KD-SDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
              D      +S+T +NIKA+ILD+F    D S  +    M EM+K+PR++ +AQ EVREVF
Sbjct  282   HDHCGGRELSLTINNIKAVILDVFTAGSDPSAAVVDWTMSEMIKHPRIMKRAQDEVREVF  341

Query  1197  -KGR-VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
              + R V E+++  + YL LVI+E++RLHPPG ++  RE  +  V+ GY IP +TRV++NA
Sbjct  342   NRARLVNETSIRGMKYLKLVIQESLRLHPPGVLLLPRECAERCVIDGYEIPAKTRVIVNA  401

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP YW +PE+F P+RF D  +D+ + + F Y+PFG+G+R+CPG+ +GLA+V  PL
Sbjct  402   WAIGRDPNYWSNPETFNPDRFLDSSIDY-QGTNFDYIPFGAGRRICPGMLYGLANVELPL  460

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDI  1655
             A LLYHFDW+LP+ +    L +TE   + +  K D+
Sbjct  461   AMLLYHFDWKLPNEMKNDDLDMTEEFSVVVDRKQDL  496



>gb|ABG49366.1| P450 monooxygenase [Artemisia annua]
Length=488

 Score =   390 bits (1002),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/443 (44%), Positives = 301/443 (68%), Gaps = 16/443 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G  +PH  + DL++++G  LMHLQLGEV  +VVSS + AK  L T+D+ FA 
Sbjct  41    IGHMHHLIG-TIPHRGVMDLARKYG-SLMHLQLGEVSTIVVSSPKWAKEILTTYDITFAN  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  L  + V Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V+SF  +R++E   L+  
Sbjct  99    RPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEECWNLVQE  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++ ++G+GRP+N+ + +   + +I+ RAAFGK +   +E  + V EIL     F VAD F
Sbjct  159   IK-AAGSGRPVNLSENIFKLIATILSRAAFGKGIKDQKEFTEIVKEILRQTGGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G+++R+  +  + D ++ +++ EH  N       +    +E ++DVL++L
Sbjct  218   PSKKFLHHLSGKRARLTSIHMKLDNLINNLVAEHTVN-------TSSKTNETLLDVLLRL  270

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             KDS   P+  T DN+KAIILDMFG   DTS+     A+ E++K PR + K QAE+R+  K
Sbjct  271   KDSAEFPL--TADNVKAIILDMFGAGTDTSSATIEWAISELIKCPRAMEKVQAELRKALK  328

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G  ++ E ++ +L+YLNLVIKET+RLHPP P++  RE  +   + GY IP +T++++N +
Sbjct  329   GKEKIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQPVNLAGYNIPNKTKLIVNVF  388

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+YW+D E+F PERFE+        ++++Y+PFG+G+RMCPG + GLA+V  PLA
Sbjct  389   AINRDPEYWKDAETFIPERFENSSTT-VMGAEYEYLPFGAGRRMCPGSALGLANVQLPLA  447

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
             ++LYHF+W+LP+G +   + + E
Sbjct  448   NILYHFNWKLPNGASYDQIDMAE  470



>gb|AIA09036.1| germacrene A oxidase [Cynara cardunculus var. altilis]
 gb|AIA09037.1| germacrene A oxidase [Cynara cardunculus var. scolymus]
Length=486

 Score =   390 bits (1002),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 314/460 (68%), Gaps = 16/460 (3%)
 Frame = +3

Query  249   KPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvss  428
             +PKS + L P P +LP+IG+++ L+G  +PH  + DLS+++G  LMHLQLGEV  +VVSS
Sbjct  22    RPKSNKNLLPEPWRLPIIGHMHHLIG-TMPHRGVMDLSRKYG-SLMHLQLGEVSTIVVSS  79

Query  429   aevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTV  608
              + AK  L T+D+  A RP  L  + + Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V
Sbjct  80    PKWAKEILTTYDITLANRPETLTGEIIAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKV  139

Query  609   RSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKF  788
             +SF  +R++E   L+  V+ +SG+GRP+++ + +   + +I+ RAAFGK +   +E  + 
Sbjct  140   KSFQSLREEECWDLVQEVK-ASGSGRPVDLSENIFKMIATILSRAAFGKGIKDQKEFTEI  198

Query  789   VNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgkt  968
             V EIL     F VAD FPS K LH L+G+++R+  + ++ D ++ +I+ EH  N      
Sbjct  199   VKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDNLINNIVSEHPGN------  252

Query  969   gsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVK  1148
              +    +E ++DVL++LKDS   P+  T DN+KA+ILDMFG   DTS+     A+ E+++
Sbjct  253   -TSSKSNETLLDVLLRLKDSPEFPL--TADNVKAVILDMFGAGTDTSSATVEWAISELIR  309

Query  1149  NPRVLAKAQAEVREVFKG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSV  1319
              PR + K QAE+R+  KG  +++E ++  L+YL+LVIKET+RLHPP P++  RE  +   
Sbjct  310   CPRAMEKVQAELRQALKGKDKIKEEDIQDLSYLDLVIKETLRLHPPLPLVMPRECRQPVN  369

Query  1320  VCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKR  1499
             + GY I  +T++++N +AI+RDP+YW+D ESF PERFE+ P +    ++++Y+PFG+G+R
Sbjct  370   LAGYNIADKTKLIVNVFAINRDPEYWKDAESFIPERFENSPTNVM-GAEYEYLPFGAGRR  428

Query  1500  MCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTE  1619
             MCPG + GLA+V  PLA +LYHF+W+LP+G +   L +TE
Sbjct  429   MCPGAALGLANVLLPLATILYHFNWKLPNGASHEQLDMTE  468



>ref|XP_009623936.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=509

 Score =   391 bits (1004),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 219/459 (48%), Positives = 316/459 (69%), Gaps = 7/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVP-HVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L+   +P H TLR LS+++G  + HL LGE+  +VVSS E+AK  +KT DL FA
Sbjct  47    IGNLHQLMNGRLPIHHTLRSLSQRYGP-IFHLCLGEISIIVVSSPEMAKEIMKTQDLRFA  105

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
             TRP  ++ D + Y+ +DI   PYGEYWR MRKVC+ ELLSA+ V+SF+ IRQ+E   L+ 
Sbjct  106   TRPEFMSGDIIFYNYTDIGTCPYGEYWRNMRKVCVLELLSAKMVKSFNSIRQEEMSSLIS  165

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              + S+      IN+ D++  F +S+ CR+AFGK ++  ++L+  V ++ ++   F +AD 
Sbjct  166   SINSTPDDSL-INLSDKMFWFTSSVTCRSAFGKVIHDQDKLIMLVKDVTLLAGGFDLADL  224

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS K LH ++G KS+M+KV  + D I+ +II EHRNN   GK G+GESG ED++DVL++
Sbjct  225   FPSRKWLHEISGLKSKMLKVHTKIDVILENIINEHRNNRTIGKKGNGESGGEDLIDVLLR  284

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             + +S  L   IT+ NIK +I DMF    +TS+T  + A+ EM++NP V+AKAQ EVREV 
Sbjct  285   VMESGELGTPITNKNIKGVIFDMFLAGAETSSTTIIWALAEMIRNPSVMAKAQLEVREVL  344

Query  1197  KGR--VEESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINA  1367
             KG+   E+S++++L YL LVIKET     P   ++ RE  +++ +  YTIP +TRVL+NA
Sbjct  345   KGKRTFEDSDIEELKYLKLVIKETLRLHPPIPLLLPRECREETKIEQYTIPIKTRVLVNA  404

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RD +YW D ESF PERFE++ +DF + + F+++PFG+G+RMCPG+ FGL +V  PL
Sbjct  405   WAIGRDTRYWHDSESFIPERFENNSIDF-KGNHFEFIPFGAGRRMCPGLLFGLVNVGHPL  463

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+ P GI+  +  +TE   +    KND+  I
Sbjct  464   AQLLYHFDWKTPPGISSDSFDMTETDGVTARRKNDLCLI  502



>emb|CDP07881.1| unnamed protein product [Coffea canephora]
Length=844

 Score =   401 bits (1030),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 215/458 (47%), Positives = 315/458 (69%), Gaps = 7/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN++RL+G + P   LR L+++ G  LMHLQLGE+ ++V+SS  +A+  +K HDL FA+
Sbjct  382   IGNMHRLIG-SPPQHALRRLAQKHG-SLMHLQLGEISSIVISSPRLAEEVMKNHDLAFAS  439

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             R  +L      Y+ SD++ SPYGEYWRQMRK+C  ELLSA+ VRSF  +R+DE+  L+  
Sbjct  440   RAEILVTKIGRYNCSDVVSSPYGEYWRQMRKICTLELLSAKRVRSFGSVRKDEAFHLISS  499

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGK-TLNRTEELVKFVNEILIMVSSFSVADT  836
             +++  G G  IN+ + V+ + +S++CRAAFGK + +     ++ + E L++ S+F  +D 
Sbjct  500   IKALVGTGEQINLSELVSLYTSSVLCRAAFGKVSKDDQNAFLQLIKESLLLSSAFDFSDL  559

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS KILH L   KS+MV V    D ++  II +H ++ G  K  SGES  ED++DVL++
Sbjct  560   FPSLKILHPLLSVKSKMVHVHHMIDMMLDGIIDQHIDDQGRPKLASGESYQEDLIDVLLR  619

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             +KD D+L + IT DNIKA+++DMF G  +TS+T    AM EM+++P V+AKAQ E+R+  
Sbjct  620   VKDGDNLQVPITKDNIKAVLIDMFAGGTETSSTTVEWAMAEMIRSPDVMAKAQNEIRKAL  679

Query  1197  KGR--VEESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINA  1367
             KG+  VEE+++ +  YL LVIKET     P   ++ RE  ++  + GY IP +TRV+INA
Sbjct  680   KGKKAVEETDIQQARYLKLVIKETLRLHPPLPLLVPRECREECELHGYVIPVKTRVMINA  739

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP+YW+D + FKPERFE+   DF+  + F+Y+PFG+G+RMCPGISFGLA+V  PL
Sbjct  740   WAIGRDPEYWDDADGFKPERFENSAADFS-GTHFEYLPFGAGRRMCPGISFGLANVELPL  798

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFF  1661
             A LLYHFDW+LP+ +  + L +TE   +    KN+++ 
Sbjct  799   ALLLYHFDWQLPNDLNSNDLDMTETIGITASRKNNLWL  836


 Score =   269 bits (687),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 161/354 (45%), Positives = 239/354 (68%), Gaps = 8/354 (2%)
 Frame = +3

Query  309   LYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFATRPR  488
             +++L G   PH  LR L+++ G  LMHLQLGE+  +VVSS  +AK  +KTHDLDFA R  
Sbjct  1     MHQLTGSR-PHYALRKLAQKHGP-LMHLQLGEISTIVVSSPRLAKEIMKTHDLDFANRAE  58

Query  489   VLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDRVRS  668
              LAC  V Y+ SDI+ +PYGEYWRQMRK+C  ELLS + VRSF  IR DE+  L+  +++
Sbjct  59    FLACKIVCYNCSDIVCAPYGEYWRQMRKICTLELLSTKNVRSFGCIRLDEAKHLISSIQA  118

Query  669   SSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEEL--VKFVNEILIMVSSFSVADTFP  842
              + AG  IN+ D ++T+ +S++  AAF K +++  ++  ++ +N +  +  + +V+D FP
Sbjct  119   HAAAGELINLTDHLSTYTSSMVLTAAFRK-VSKVHQMTFLRLLNMVRRLGRAVTVSDLFP  177

Query  843   SWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKLK  1022
             S++ILH L+  K +++KV Q  D+I   II EH  NL   K G GESG+ED+VDVL+++K
Sbjct  178   SYRILHPLSRVKPKLMKVHQRIDKIFDTIIAEHVENLKRTKRGMGESGNEDLVDVLLRVK  237

Query  1023  DSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKG  1202
             +S  L   +T++NIKA++ D+F G  +TS+T    AM EM++NP V+A AQ E+R+ F G
Sbjct  238   ESGDLTFPVTNNNIKAVLTDIFTGGTETSSTTVEWAMSEMIRNPNVMATAQNEIRKAFMG  297

Query  1203  --RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRV  1355
                +EE++V+KL YL LVIKET+RLHPP P++  R   +   + GY +P   R+
Sbjct  298   MKTIEETDVEKLPYLKLVIKETLRLHPPIPLLVPRGCREQCEIDGYIVPQLIRL  351



>ref|XP_006493509.1| PREDICTED: cytochrome P450 71D11-like [Citrus sinensis]
Length=509

 Score =   390 bits (1002),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 214/458 (47%), Positives = 305/458 (67%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L G  +PH  LRDL+K++G  LM LQLG+VPA++VSS EVAK  +KTHD+ FA+
Sbjct  48    IGNLHQLAG-FLPHHRLRDLTKKYGP-LMLLQLGQVPAIIVSSPEVAKEVMKTHDVIFAS  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP       + Y+  DI+FSPYG+ W+Q+RK+C++ELLSA+ V+SF  IR+ E   L+D 
Sbjct  106   RPHFPPAQIISYNYRDIIFSPYGDSWKQLRKICVSELLSAKRVQSFQSIREAEVSDLIDW  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  SS AG  IN+ ++V + M  I  RAAFG      E     + EI  ++S F++AD F
Sbjct  166   I--SSKAGSVINLTEKVYSLMYGITSRAAFGNRSRDEEAFASVIAEITKVMSGFNIADMF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS   L +LTG KSR+ ++ QE D I+ +II EH+    +    S     ED+VDVL+K+
Sbjct  224   PSVGFLQWLTGNKSRVERLHQEADRIVKNIINEHKKR-KATLKISKIGDDEDLVDVLLKI  282

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             +    L   +T D+IKA+I D+F    +TS T    AM EM++NPRV+ KAQAEVREVF 
Sbjct  283   QGRGDLDSFLTTDHIKAVIFDIFAAGSETSATTVDWAMCEMMRNPRVMKKAQAEVREVFH  342

Query  1200  --GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
               G+V E+++D++ +  L +KET+RLHP  P++  RE  +   + G+ IP + +V +NAW
Sbjct  343   RTGKVNETSIDEMKFFKLFVKETLRLHPVAPLLLPRECGERCQINGFDIPVKAKVFVNAW  402

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW +P SF PERF D  +D+ + + F+++PFG+G+R+CPG+SFGLASV  PLA
Sbjct  403   AIGRDPKYWTEPASFIPERFLDHSIDY-KGTNFEFIPFGAGRRICPGMSFGLASVELPLA  461

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP+G+    L +TE     +  K D+  I
Sbjct  462   MLLYHFDWKLPNGMKHEDLDMTEAFATTVRRKQDLCMI  499



>ref|XP_006474921.1| PREDICTED: cytochrome P450 71D11-like isoform X2 [Citrus sinensis]
Length=507

 Score =   390 bits (1001),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 218/455 (48%), Positives = 303/455 (67%), Gaps = 12/455 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNLY+L G ++PH  LRDLSK++G  LM LQLGEVP ++VSS EVAK  +KTHD+ FA+
Sbjct  49    IGNLYQLAG-SLPHHGLRDLSKKYGP-LMLLQLGEVPTIIVSSPEVAKEVMKTHDVVFAS  106

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP   A   + Y+  DI+FS YG+ W+Q+RK+C++ELLSA+ V+SF  IR+ E   L++ 
Sbjct  107   RPHFPAAQILSYNYRDIIFSSYGDSWKQLRKICVSELLSAKRVQSFQSIREAEVSDLINW  166

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  SS AG  IN+   V + M  I  RAAFG      E  V  + E   ++S F++AD F
Sbjct  167   I--SSKAGSVINLTQNVHSLMYGITSRAAFGNRSRDQEAFVAVIEETTKVISGFNIADVF  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS  +L +LTG KS++  + QE   I+ +II EH+    +          ED+VDVL+K+
Sbjct  225   PSIGLLQWLTGNKSQVETLHQEGVRIVENIINEHKKR-KATLKNCKTGDDEDLVDVLLKI  283

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             +    L   +T D+IKA   D+F    +TS T    AM EM+KNPRV+ KAQAEVREVF 
Sbjct  284   QGHGDLDSFLTTDHIKA---DIFAAGSETSATTVDWAMCEMMKNPRVMKKAQAEVREVFH  340

Query  1200  --GRVEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINAW  1370
               G+V E+++D++ +L LV+KET+RLHP  P +I RE  +   + G+ IP + RV++NAW
Sbjct  341   RTGKVNETSIDEMKFLKLVVKETLRLHPAAPLLIPRECGQRCQINGFDIPVKARVIVNAW  400

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YW +PESF PERF D  +D+ + + F+Y+PFG+G+R+CPG+SFGLASV  PLA
Sbjct  401   AIGRDPEYWTEPESFIPERFLDHSVDY-KGTNFEYIPFGAGRRICPGMSFGLASVELPLA  459

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDI  1655
              LLYHFDW+LP+GI    L +TE   + +  K D+
Sbjct  460   MLLYHFDWKLPNGIKHEDLDMTEAFGVTVRRKQDL  494



>ref|XP_003549267.1| PREDICTED: cytochrome P450 71D11-like [Glycine max]
Length=526

 Score =   390 bits (1003),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 215/460 (47%), Positives = 302/460 (66%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +GNL++LV  + PH   RDL+K +G  +MHLQLGE+  +VVSSAE AK  LKTHD+ FA+
Sbjct  48    VGNLHQLVTSS-PHKKFRDLAKIYGP-MMHLQLGEIFTIVVSSAEYAKEILKTHDVIFAS  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  L  + + Y+S++I FSPYG YWRQ+RK+C  ELLS + V SF  IR++E   L+  
Sbjct  106   RPHFLVSEIMSYESTNIAFSPYGNYWRQVRKICTLELLSQKRVNSFQPIREEELTNLVKM  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S  G+   IN+ + V + M  II RAAFG      +E +  + + +++ + F++ D F
Sbjct  166   IGSQEGSS--INLTEAVHSSMYHIITRAAFGIRCKDQDEFISAIKQAVLVAAGFNIGDLF  223

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K L  +TG +  +  + Q TD+I+ DII EHR      K G GE+  E ++DVL+K 
Sbjct  224   PSAKWLQLVTGLRPTLEALFQRTDQILEDIINEHREAKSKAKEGHGEAEEEGLLDVLLKF  283

Query  1020  KDSDSLPMSI--TDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +D +    SI  T +NIKA+I D+FGG V+   T    AM EM++NPRV+  AQ EVREV
Sbjct  284   EDGNDSNQSICLTINNIKAVIADIFGGGVEPIATTINWAMAEMIRNPRVMKTAQVEVREV  343

Query  1194  F--KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F  KGRV+E+ +++L YL  V+KET+RLHPP P+I  RE  +   + GY IP +T+V IN
Sbjct  344   FNIKGRVDETCINELKYLKSVVKETLRLHPPAPLILPRECQETCKINGYDIPVKTKVFIN  403

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             AWAI RDP YW +PE F PERF D  +D+ +   F+Y+PFG+G+R+CPGI+FGL +V   
Sbjct  404   AWAIGRDPNYWSEPERFYPERFIDSSVDY-KGGNFEYIPFGAGRRICPGITFGLVNVELT  462

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYH DW+LP+G+      +TE   + +  K+DI+ I
Sbjct  463   LAFLLYHLDWKLPNGMKNEDFDMTEKFGVTVARKDDIYLI  502



>gb|AHN62856.1| costunolide synthase [Tanacetum parthenium]
Length=496

 Score =   389 bits (1000),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 199/456 (44%), Positives = 307/456 (67%), Gaps = 16/456 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L  P  PH  L+DL+K++G  +MHLQLG+V  VVVS+  +A+  +KT+D+ FA 
Sbjct  41    IGNIHQLKSPT-PHRVLKDLAKKYGP-IMHLQLGQVSTVVVSTPRLAQEIMKTNDISFAD  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP         Y + DI ++PYGEYWRQM+K+C  ELLSA+ VRSFS IR++E    L R
Sbjct  99    RPTTTTSQIFFYKAQDIGWAPYGEYWRQMKKICTLELLSAKKVRSFSSIREEE----LTR  154

Query  660   VRS--SSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVAD  833
             +R      AG PIN  +     + ++IC+A  G        L++ + ++L  +S+F++A 
Sbjct  155   IRKILEFKAGTPINYTEMTIEMVNNVICKATLGDCCKDQALLIELLYDVLKTLSAFNLAS  214

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              +P  + L+ ++G+K++ +K+++  D+IM DI+KEHR         +  S  ED+VDVL+
Sbjct  215   YYPRLQFLNVISGKKAKWLKMQKRLDDIMEDILKEHRAK-----GRAKNSDQEDLVDVLL  269

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             ++KD+  L +++TD+++KA++LDM     DTS+T    AM E+++NP ++ +AQ EVR V
Sbjct  270   RIKDTGGLDINVTDEHVKAVVLDMLTAGTDTSSTTLEWAMTELMRNPDMMKRAQEEVRSV  329

Query  1194  FKGR-VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
              KG  V E+++  L YL L++KETMRLH P P++  RE  +D  V GY IP +T+VL+NA
Sbjct  330   VKGEHVTETDLQSLHYLKLIVKETMRLHAPTPLLVPRECRQDCNVDGYDIPAKTKVLVNA  389

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WA   DP  WE+P+SF PERFE+  ++F   + F+Y+PFG+G+R+CPG++FGL+ V  PL
Sbjct  390   WACGVDPGSWENPDSFIPERFENSSINFM-GADFQYIPFGAGRRICPGLTFGLSMVEYPL  448

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDI  1655
             AH LYHFDW+LP+G+ PH L +TE+  ++  +K+ +
Sbjct  449   AHFLYHFDWKLPYGMKPHELDITEITTISTSLKHHL  484



>ref|XP_003535173.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=500

 Score =   389 bits (999),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 201/460 (44%), Positives = 309/460 (67%), Gaps = 10/460 (2%)
 Frame = +3

Query  300   IGNLYRLV-GPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L    ++PH  LRDL+K++G  LMHLQLGE+ AVV SS ++AK  +KTHD+ F 
Sbjct  41    IGNLHQLAEAGSLPHHALRDLAKKYGP-LMHLQLGEISAVVASSPKMAKEIVKTHDVSFL  99

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP ++    + Y    I F+PYG++WRQ RK+C TELLS + V+SF+ IR+DE+ + +D
Sbjct  100   QRPHLVFGQMISYGGLGIAFAPYGDHWRQTRKMCATELLSTKRVQSFASIREDEAAKFID  159

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE-LVKFVNEILIMVSSFSVAD  833
              +R S  AG PIN+   + + + + I R AFG      +E +V  + +I+     F +AD
Sbjct  160   SIRES--AGSPINLTSRIFSLICASISRVAFGGIYKDQDEFVVSLIRKIVESGGGFDLAD  217

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS   L+FLTG+ +R+ K+ ++ D+++ +II+EH+      K    E   +D +D L+
Sbjct  218   VFPSIPFLYFLTGKMTRLKKLHKQVDKVLENIIREHQEKNKIAKEDGAELEDQDFID-LL  276

Query  1014  KLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREV  1193
             +++  D+L + +T +NIKA+ILD+F    DTS +    AM EM++NPRV  KAQAE+R+ 
Sbjct  277   RIQQDDTLDIQMTTNNIKALILDIFAAGTDTSASTLEWAMAEMMRNPRVREKAQAELRQA  336

Query  1194  FKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLIN  1364
             F+ +  + ES++++L YL LVIKET R+HPP P++  RE ++ +++ GY IP +T+V++N
Sbjct  337   FREKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECSQPTIIDGYEIPAKTKVMVN  396

Query  1365  AWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTP  1544
             A+AI +D QYW D + F PERFE   +DF + + F Y+PFG G+R+CPG++ GLAS+  P
Sbjct  397   AYAICKDSQYWIDADRFVPERFEGSSIDF-KGNNFNYLPFGGGRRICPGMTLGLASIMLP  455

Query  1545  LAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LA LLYHF+WELP+ + P  + + E   +A+G KN++  I
Sbjct  456   LALLLYHFNWELPNKMKPEEMNMDEHFGLAIGRKNELHLI  495



>gb|KDP39257.1| hypothetical protein JCGZ_01014 [Jatropha curcas]
Length=485

 Score =   389 bits (998),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 210/458 (46%), Positives = 307/458 (67%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L+G ++PH  LRDL+K+ G  +MHLQLGEV  +V+SS E AK  +KTHD+ FA 
Sbjct  24    IGNIHQLIG-SLPHHCLRDLAKKHG-GIMHLQLGEVSNIVISSPEAAKEVMKTHDIVFAQ  81

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   + Y+ +DI FSPY +YWRQ+RK+CI ELLSA+ V+SF +IR++E   L+  
Sbjct  82    RPFLLAASIISYNFTDIAFSPYADYWRQLRKICILELLSAKRVQSFRFIREEEVSNLITA  141

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + SSS  G+  N   ++ +    I  RA FG+     EE +  V EI  +   FS+AD F
Sbjct  142   ISSSS--GKAFNFSRKLFSLTYGIAARATFGEKCEDQEEFIPIVEEITEVAGGFSLADLF  199

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH ++G +SR++++++E D ++G+II +HR          GE   +D+VDVL++L
Sbjct  200   PSVKFLHSISGMRSRLIRLQKEADRVIGNIIDDHRAK-NKTGKVGGEGQDDDLVDVLLRL  258

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             ++  +L   +T DNIKA+ILD+F    +TS+T    AM EM++NPRV+ KAQ EVR++F 
Sbjct  259   QEHGNLEFPLTTDNIKAVILDIFVAGSETSSTTVEWAMSEMLRNPRVMYKAQEEVRKLFD  318

Query  1197  -KGRVEESNVDKLAYLNLVIKET-MRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
              KG VEE+++ +  YL LVIKET     P   ++ RE+ +   + GY IP +++V++NAW
Sbjct  319   KKGNVEETDLQESKYLKLVIKETLRLHPPAPLLLPRESTEKCEINGYDIPEKSKVIVNAW  378

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP +W + E+F PERF D  +D+ + + F+++PFG+G+RMCPGI FG+A+V  PLA
Sbjct  379   AIGRDPNHWTEAETFYPERFLDSSIDY-KGNNFEFIPFGAGRRMCPGILFGIANVELPLA  437

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDWELP G+   TL + E     +  KND+  I
Sbjct  438   QLLYHFDWELPSGLKAETLDMIESFGATVRRKNDLHLI  475



>ref|XP_003537216.1| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=508

 Score =   389 bits (999),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 199/461 (43%), Positives = 314/461 (68%), Gaps = 10/461 (2%)
 Frame = +3

Query  300   IGNLYRLVGP-NVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL++L    ++PH  L+ LSK++G  LMHLQLGE+ AVV SS ++AK  +KTHD+ F 
Sbjct  43    IGNLHQLAAAGSLPHHALKKLSKKYG-PLMHLQLGEISAVVASSPKMAKEIVKTHDVSFL  101

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP  +A + + Y    I F+ YG++WRQMRK+C+TE+LS + V+SF+ IR+DE+ + ++
Sbjct  102   QRPYFVAGEIMTYGGLGIAFAQYGDHWRQMRKICVTEVLSVKRVQSFASIREDEAAKFIN  161

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE-LVKFVNEILIMVSSFSVAD  833
              +R S  AG  IN+   + + + + I R AFG      +E +V  +  I+ +   F +AD
Sbjct  162   SIRES--AGSTINLTSRIFSLICASISRVAFGGIYKEQDEFVVSLIRRIVEIGGGFDLAD  219

Query  834   TFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLI  1013
              FPS   L+F+TG+ +++ K+ ++ D+++  I+KEH+      K    E   ED +DVL+
Sbjct  220   LFPSIPFLYFITGKMAKLKKLHKQVDKLLETIVKEHQEKHKRAKEDGAEIEDEDYIDVLL  279

Query  1014  KL-KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVRE  1190
             ++ + SD+L +++T +NIKA+ILD+F    DTS +    AM E+++NPRV  KAQAE+R+
Sbjct  280   RIQQQSDTLNINMTTNNIKALILDIFAAGTDTSASTLEWAMTEVMRNPRVREKAQAELRQ  339

Query  1191  VFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLI  1361
              F+G+  + ES++++L YL LVIKET R+HPP P++  RE ++ +++ GY IP +T+V++
Sbjct  340   AFRGKEIIHESDLEQLTYLKLVIKETFRVHPPTPLLLPRECSQLTIIDGYEIPAKTKVMV  399

Query  1362  NAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYT  1541
             N +A+ +DP+YW D E F PERFE   +DF + + F+Y+PFG G+R+CPG++FGLA++  
Sbjct  400   NVYAVCKDPKYWVDAEMFVPERFEASSIDF-KGNNFEYLPFGGGRRICPGMTFGLATIML  458

Query  1542  PLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             PLA LLYHF+WELP+ I P  + + E   +A+G KN++  I
Sbjct  459   PLALLLYHFNWELPNKIKPENMDMAEQFGVAIGRKNELHLI  499



>ref|XP_003532742.2| PREDICTED: cytochrome P450 71D10 [Glycine max]
Length=514

 Score =   389 bits (999),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 199/443 (45%), Positives = 300/443 (68%), Gaps = 13/443 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +GN+++  GP +PH TL +L+ Q G  LMHLQLGE P ++VSSA++AK  +KTHD  FA 
Sbjct  54    LGNIHQFFGP-LPHQTLTNLANQHGP-LMHLQLGEKPHIIVSSADIAKEIMKTHDAIFAN  111

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA     YDSSDI FS YG+ WRQ++K+CI+ELL+A+ V+S  +IR++E  +L+  
Sbjct  112   RPHLLASKSFAYDSSDIAFSSYGKAWRQLKKICISELLNAKHVQSLRHIREEEVSKLVSH  171

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             V ++ G+   IN+  E+ +   +II RAA GK     E  +  + ++L+++  FS+AD +
Sbjct  172   VYANEGS--IINLTKEIESVTIAIIARAANGKICKDQEAFMSTMEQMLVLLGGFSIADFY  229

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+L  LTG KS++ + ++E D+I+ +++K+H+ N             ED +D+L+K 
Sbjct  230   PSIKVLPLLTGMKSKLERAQRENDKILENMVKDHKEN-----ENKNGVTHEDFIDILLKT  284

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             +  D L + +T +N+KA+I DMF G       +TV AM E++KNP+ + KAQ EVR+VF 
Sbjct  285   QKRDDLEIPLTHNNVKALIWDMFVGGTAAPAAVTVWAMSELIKNPKAMEKAQTEVRKVFN  344

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              KG V+E+ + +  YLN +IKETMRLHPP  ++  REN++  VV GY IP +++V+INAW
Sbjct  345   VKGYVDETELGQCQYLNSIIKETMRLHPPEALLLPRENSEACVVNGYKIPAKSKVIINAW  404

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI R+ +YW + E F PERF DD  DF+  + F+Y+PFG+G+R+CPG +F +  +   LA
Sbjct  405   AIGRESKYWNEAERFVPERFVDDSYDFS-GTNFEYIPFGAGRRICPGAAFSMPYMLLSLA  463

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
             +LLYHFDW+LP+G T   L ++E
Sbjct  464   NLLYHFDWKLPNGATIQELDMSE  486



>gb|KDP39016.1| hypothetical protein JCGZ_00773 [Jatropha curcas]
Length=460

 Score =   387 bits (994),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 301/441 (68%), Gaps = 12/441 (3%)
 Frame = +3

Query  309   LYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFATRPR  488
             +++L G ++P   LRDLSK++G  +MH++LG+V  +VVSS E AK  +KTHD+ F  RP 
Sbjct  1     MHQLFG-SLPQHRLRDLSKKYGP-VMHIKLGQVSNIVVSSPEAAKQVMKTHDIIFLQRPF  58

Query  489   VLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDRVRS  668
             +LA + +MY+  DI F+PYG+ WRQMRK+C  ELLS + VRSF  IR+DE    +  + S
Sbjct  59    LLAAEILMYNFKDIAFAPYGDSWRQMRKICTLELLSTKRVRSFRPIREDEVSTFIRTISS  118

Query  669   SSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTFPSW  848
             SS     +N+   V     +I  R+AFGK   R E  +  V +I+ ++  FSVAD FPS 
Sbjct  119   SS----KVNLGRMVFALSNTITLRSAFGKVSERKEAFLPLVQKIVQVLEGFSVADVFPSV  174

Query  849   KILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKLKDS  1028
             + LH +TG + ++ K+ QETD ++ +II EHR N       + E   +D+VDVL+ ++DS
Sbjct  175   RFLHRITGMRGKLEKLHQETDIMLENIINEHREN-KRLGRSNSEGKEDDLVDVLLNIQDS  233

Query  1029  DSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR-  1205
             D+L   +T ++IKA++LDMF G  +TS      AM EMVK+PRVL KAQ EVR+VF  + 
Sbjct  234   DNLEFPLTMEHIKAVMLDMFLGGTETSAATIEWAMAEMVKDPRVLEKAQKEVRQVFNHKE  293

Query  1206  --VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINAWAI  1376
               ++E+ +D+L YL LVIKET+RLHPP P++    + D+V + GY +P  T+V+INAWA+
Sbjct  294   NIIDETRLDELKYLKLVIKETLRLHPPVPLLVPRQSLDAVEIDGYKLPINTKVIINAWAL  353

Query  1377  SRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHL  1556
              RD ++W + E F PERF+++ +DF + + F+++PFG+G+RMCPG+ +G+A V   LA+L
Sbjct  354   GRDSRHWNEAEKFYPERFQNNSIDF-KGNDFQFIPFGAGRRMCPGVGYGMALVELALANL  412

Query  1557  LYHFDWELPHGITPHTLKLTE  1619
             LYHFDW+LP+G+ PH L +++
Sbjct  413   LYHFDWKLPNGLEPHLLDMSD  433



>gb|KHN36161.1| Cytochrome P450 71D8 [Glycine soja]
Length=453

 Score =   387 bits (994),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 201/449 (45%), Positives = 307/449 (68%), Gaps = 9/449 (2%)
 Frame = +3

Query  330   NVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFATRPRVLACDEV  509
             ++PH TLRDL+ ++G  LMHLQLGE+ +VVVSS  +AK  +KTHDL F  RP+ L    +
Sbjct  4     SLPHRTLRDLALKYGP-LMHLQLGEISSVVVSSPNMAKEIMKTHDLAFVQRPQFLPAQIL  62

Query  510   MYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDRVRSSSGAGRP  689
              Y  +DI+F+PYG+YWRQM+K+C++ELLSA+ V+SFS+IR+DE+ + ++ +R S G+  P
Sbjct  63    TYGQNDIVFAPYGDYWRQMKKICVSELLSAKRVQSFSHIREDETSKFIESIRISEGS--P  120

Query  690   INIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTFPSWKILHFLT  869
             IN+  ++ + ++S + R AFG      EE +  + ++++    F   D FPS K LH + 
Sbjct  121   INLTSKIYSLVSSSVSRVAFGDKSKDQEEFLCVLEKMILAGGGFEPDDLFPSMK-LHLIN  179

Query  870   GEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsge-sgseDIVDVLIKLKDSDSLPMS  1046
             G K+++ K+ ++ D+I  +I++EH+                ED+VDVL++++ SD+L + 
Sbjct  180   GRKAKLEKMHEQVDKIADNILREHQEKRERALREGKVDLEEEDLVDVLLRIQQSDNLEIK  239

Query  1047  ITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFKGR--VEESN  1220
             I+  NIKA+ILD+F    DTS +    AM EM++NPRV  KAQAEVR+ F+    + E++
Sbjct  240   ISTTNIKAVILDVFTAGTDTSASTLEWAMAEMMRNPRVREKAQAEVRQAFRELKIIHETD  299

Query  1221  VDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWAISRDPQYW  1397
             V KL YL LVIKET+RLH P P++  RE ++ +++ GY IP +T+V+IN WAI RDPQYW
Sbjct  300   VGKLTYLKLVIKETLRLHAPSPLLVPRECSELTIIDGYEIPVKTKVMINVWAIGRDPQYW  359

Query  1398  EDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAHLLYHFDWE  1577
              D E F PERF+   +DF + + F+Y+PFG+G+RMCPG++FGLA++  PLA LLYHF+WE
Sbjct  360   TDAERFVPERFDGSSIDF-KGNNFEYLPFGAGRRMCPGMTFGLANIMLPLALLLYHFNWE  418

Query  1578  LPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LP+ + P  + ++E   + +  K+++  I
Sbjct  419   LPNEMKPEDMDMSENFGLTVTRKSELCLI  447



>ref|XP_008779150.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=502

 Score =   389 bits (998),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 200/459 (44%), Positives = 305/459 (66%), Gaps = 10/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+L+ L+GP +PH  LR+LS++ G  LMHL+LG+V  ++VSS ++A+  LKTHDL FA+
Sbjct  43    IGHLHHLLGP-LPHRALRELSRRHGP-LMHLRLGQVDHIIVSSPKMAREILKTHDLIFAS  100

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             R ++LA  +  YD +DI+F+PYG YWR++RK+C+ ELLSA+ V+SFS IRQ+    L+  
Sbjct  101   RDKILA-SKAFYDGADIVFAPYGSYWRELRKICVIELLSAKRVKSFSTIRQEVMSNLVGY  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + + + +  P+N+ +       ++     FG         +  + ++L  +S FSVAD F
Sbjct  160   ISTMNNS--PVNLSEMFLLTSNTMTSMVTFGTKCKHGPRFISTLKKLLEFLSGFSVADLF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNN-LgsgktgsgesgseDIVDVLIK  1016
             PS   +  L+G  S + K  +E DEI+G+IIKEH         +   +   ED+VDVL++
Sbjct  218   PSLGFIDTLSGASSSLKKCHREVDEILGEIIKEHEEKRATKNSSNEEQQQGEDLVDVLLE  277

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             LK++  L   +T  +IKA+I+DMF G  +TS T     M E++++P ++ K QAEVR+  
Sbjct  278   LKENGGLEFPLTLTSIKAVIMDMFAGGTETSATTLEWTMAELMRHPEIMEKVQAEVRQAL  337

Query  1197  KG--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
             KG  R+EE +++K  Y+ LVIKE++RLH PGP++  R   +   V GY IP  +R+++NA
Sbjct  338   KGKARIEEEDINKFHYMKLVIKESLRLHQPGPLLLPRVCRETCQVGGYNIPAGSRIIVNA  397

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WA + DP+YWEDPESFKPERF+   +D+ +   F+YMPFG+G+R+CP ++FGLA V   L
Sbjct  398   WAAATDPRYWEDPESFKPERFDGSSVDY-KGGNFEYMPFGAGRRICPAMTFGLAQVEVAL  456

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A+LLYHFDW+LP+G+ P+ L +TE    A+G+K+ ++ I
Sbjct  457   ANLLYHFDWKLPNGMAPNDLDMTESFAAAVGLKSRLWLI  495



>gb|AIA09038.1| costunolide synthase [Cynara cardunculus var. scolymus]
Length=494

 Score =   388 bits (997),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 195/457 (43%), Positives = 308/457 (67%), Gaps = 13/457 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L  P  PH  LR L++++G  +MHLQLG+V  VVVS+  +A+  +KT+D+ FA 
Sbjct  41    IGNIHQLKTPT-PHRVLRSLARKYGP-IMHLQLGQVSTVVVSTPRLAREIMKTNDISFAD  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP         Y + DI ++PYGEYWRQM+K+C  ELLSA+ VRSFS IR++E  R+   
Sbjct  99    RPTTTTSQIFFYKAQDIGWAPYGEYWRQMKKICTLELLSAKKVRSFSSIREEELRRIGKV  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S SG   PIN  +     + ++IC+A  G +     +L++ + ++L  +S+F++A  +
Sbjct  159   LESKSGT--PINFTEMTIEMVNNVICKATLGDSCKDQAKLIELLYDVLKTLSAFNLASYY  216

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             P  +IL+ ++G+K++ +K++++ D IM DI+KEHR        G   +  ED+VDVL+++
Sbjct  217   PRLQILNVISGKKAKWLKMQKQLDGIMNDILKEHR------AEGRKNNEQEDLVDVLLRV  270

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K++  L  +I DD++KA+ILDM     DTS+T    AM E+++NP ++ +AQ EVR V K
Sbjct  271   KETGGLDFNIRDDDVKAVILDMLTAGTDTSSTTLEWAMTELIRNPEMMKRAQTEVRSVVK  330

Query  1200  GRV-EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWA  1373
             G V  E+++  L YL L++KET+RLH P P++  RE  +D  V GY IP +T++++NAWA
Sbjct  331   GDVITETDLQSLHYLKLIVKETLRLHAPTPLLVPRECRQDCNVDGYDIPAKTKIIVNAWA  390

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
                DP  WE+PESF PERFE+ P+ +   + F+++PFG+G+R+CPG++FGL+ V  PLA+
Sbjct  391   CGTDPDSWENPESFIPERFENSPVSYM-GADFEFIPFGAGRRICPGLTFGLSMVEFPLAN  449

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LYHFDW+LP+G+ PH L +TE+  ++  +K+ +  +
Sbjct  450   FLYHFDWKLPNGMKPHELDITEVTGISTSLKHHLKLV  486



>gb|AGO03789.1| germacrene A oxidase [Tanacetum cinerariifolium]
Length=488

 Score =   388 bits (996),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 193/443 (44%), Positives = 299/443 (67%), Gaps = 16/443 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G  +PH  + DL++++G  LMHLQLGEV  +VVSS + AK  L T+D+ FA 
Sbjct  41    IGHMHHLIG-TIPHRGVMDLARKYG-SLMHLQLGEVSTIVVSSPKWAKEILTTYDITFAN  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  L  + V Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V+SF  +R++E   L+  
Sbjct  99    RPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFQSLREEECWNLVQE  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++ +SG+GRP+N+ + +   + +I+ RAAFGK +   +E  + V EIL     F VAD F
Sbjct  159   IK-ASGSGRPVNLSENIFKLIATILSRAAFGKGIRDQKEFTEIVKEILRQTGGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G+++R+  +  + D ++ +++ EH          +    +E ++DVL++L
Sbjct  218   PSKKFLHHLSGKRARLTSIHTKLDNLINNLVAEH-------TVKTSSKTNETLLDVLLRL  270

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             KDS   P+  T DN+KAIILDMFG   DTS+     A+ E++K PR + K Q E+R+   
Sbjct  271   KDSAEFPL--TADNVKAIILDMFGAGTDTSSATIEWAISELIKCPRAMEKVQVELRKALN  328

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G  R+ E ++ +L+YLNLVIKET+RLHPP P++  RE  +   + GY IP +T++++N +
Sbjct  329   GKERIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQPVNLAGYDIPNKTKLIVNVF  388

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+YW+D E+F PERFE+        ++++Y+PFG+G+RMCPG + GLA+V  PLA
Sbjct  389   AINRDPEYWKDAETFIPERFENSSTTVM-GAEYEYLPFGAGRRMCPGAALGLANVQLPLA  447

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
             ++LYHF+W+LP+G +   + +TE
Sbjct  448   NILYHFNWKLPNGASYDQIDMTE  470



>ref|XP_004295868.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   389 bits (998),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 208/459 (45%), Positives = 309/459 (67%), Gaps = 11/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L G ++PH +LR+L+ ++G  LMHL+LGEV  VVVSSAE AK  +KTHD  FA+
Sbjct  47    IGNIHQLAG-SLPHRSLRNLANKYGP-LMHLRLGEVSTVVVSSAEFAKEVMKTHDATFAS  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA D V Y+S++I+F+ YG+YWRQ+RK+C  E+LS + V+S+  IR++E   L+  
Sbjct  105   RPHLLAADIVSYNSTNIVFAKYGDYWRQLRKICTLEVLSPKRVQSYRPIREEEMLNLIKW  164

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  +S A  PIN+ +++     +I  RAAFGK     EE +  V E + +   F +AD F
Sbjct  165   I--ASKARSPINLTEKIYLSTYTITTRAAFGKKSKYHEEFIDAVKEGIQLAGGFDLADVF  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+ +LH +TG + ++ +++++TD I+ +IIKEH     +   G      E +++VL+K 
Sbjct  223   PSYSLLHMITGMRPKLQRLQKKTDRILENIIKEHTEK--ATSQGGEREAQEHLIEVLLKF  280

Query  1020  -KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
              KD+  L  ++T DNIKA+ILD+FG   +TS T    AM EMVKNP+++ +AQ EVREVF
Sbjct  281   HKDNCGLEFNLTTDNIKAVILDIFGAGSETSATAVDWAMSEMVKNPQIMKRAQDEVREVF  340

Query  1197  K--GRVEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINA  1367
                G V E+ + ++ YLN +IKET+RLHP  P +I RE  +   + GY IP +T+V++N 
Sbjct  341   NRLGHVSETGIKEMKYLNSIIKETLRLHPSAPLLIPRECRETCEIGGYEIPVKTKVVVNG  400

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP+YW +PE F P+RF D  +DF R + F+++PFG+G+RMCPGI++GLA+V  PL
Sbjct  401   WAIGRDPKYWTEPERFYPDRFLDSSVDF-RGTNFEFIPFGAGRRMCPGITYGLANVELPL  459

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+ P G     L + E   + +G K ++  +
Sbjct  460   AMLLYHFDWKRPDGKKHEDLDMAEAFGITVGRKENLCLV  498



>gb|AFK45297.1| unknown [Lotus japonicus]
Length=489

 Score =   388 bits (996),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 197/444 (44%), Positives = 297/444 (67%), Gaps = 15/444 (3%)
 Frame = +3

Query  300   IGNLYRLVGP-NVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL+++    ++PH +LR+L+ ++G  LMHLQLGE   VVVSS ++AK  +KTH L FA
Sbjct  48    IGNLHQMAAAGSLPHHSLRELANKYG-PLMHLQLGESSTVVVSSPDMAKEIMKTHGLAFA  106

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP +L+   + Y S+DI F+PYG+YWRQMRK+C  ELLSA+ V+SFS+IR+DE  +L+ 
Sbjct  107   QRPELLSPKILAYGSTDIAFAPYGDYWRQMRKICTLELLSAKRVQSFSFIREDEVAKLIQ  166

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              +  S+ AG P N+   V + + + + R  FGK     +EL+  + + + + + F VA+ 
Sbjct  167   SIHLSASAGSPFNLSKSVFSLVNTFLSRVVFGKKSECEDELLSLIKKAVELTAGFDVAEL  226

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS+K LH +T  ++++  + ++ D+I   I+ EH+++             E++VDVL++
Sbjct  227   FPSFKPLHLITRMEAKLENMHKKLDKIFDSIVNEHQSD---------HGKGENLVDVLLR  277

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             ++ S +L + IT +NIKA+I D+     DTS T    AM E++KNPRV  KAQAE+RE F
Sbjct  278   MQHSGNLYIPITVNNIKAVIWDIIAAGTDTSATALEWAMAELMKNPRVREKAQAELREAF  337

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
             KG+  + E+++ KL+YL  VIKET+RLHPP P++  RE  +   + GY IP +T+V++NA
Sbjct  338   KGKKTINETDLCKLSYLKSVIKETLRLHPPAPLLVPRECREACKIGGYEIPVKTKVIVNA  397

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WA+ RDP +W D E F PERF +  +DF + + F+Y+PFG+G+R+CPGI  GLA++  PL
Sbjct  398   WALGRDPNHWYDAEKFIPERFHETSVDF-KGNNFEYIPFGAGRRICPGILLGLANIELPL  456

Query  1548  AHLLYHFDWELPHGITPHTLKLTE  1619
             A  LYHFDW LP+G+    L + E
Sbjct  457   AAFLYHFDWALPNGMKSEDLDMIE  480



>ref|XP_004231934.1| PREDICTED: premnaspirodiene oxygenase-like [Solanum lycopersicum]
Length=503

 Score =   388 bits (997),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 214/458 (47%), Positives = 306/458 (67%), Gaps = 9/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L   ++PH T ++LS ++G  +MHLQLGEV AV+VSS +VAK  LKTHDL FA 
Sbjct  44    IGNLHQL-SSSLPHHTFKNLSNKYGP-MMHLQLGEVSAVIVSSPQVAKEVLKTHDLIFAN  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++L+   +  +S  + FSPYG  WRQ+RKVC+ ELLSA+ V+SF  IR++E   L++ 
Sbjct  102   RPQLLSVQILSNNSPTLSFSPYGANWRQLRKVCVLELLSAKRVQSFESIREEEVDNLIEA  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S      PI+I + + +   +I  RAAFGK     +E +K +  I  +   F + D F
Sbjct  162   I-SLIQPQVPIDISEMIFSMTNNITARAAFGKKCKHKDEFIKAMKTITELSGGFDIPDLF  220

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS KI H L+G K  + KV Q+ D+I  DII+EH+ N       S     ED+VDVL+++
Sbjct  221   PSLKIFHSLSGVKPALEKVHQKVDKIFEDIIQEHKEN--KRDMSSNMLYKEDLVDVLLRV  278

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             ++S  L + I+ + +K++IL+MF G  DTS+T+   A+ EM+KNP+V+ KAQAEVREVFK
Sbjct  279   QESGDLEIPISRNTLKSVILEMFIGGTDTSSTVLEWAISEMMKNPQVMEKAQAEVREVFK  338

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLH-PPGPVIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G  ++ ES + KL Y+ +VIKET+R+H P   ++ RE  +   + GY IP +T+V+INAW
Sbjct  339   GKSKITESEIQKLDYIKMVIKETLRMHPPLPLLLPREAIEKCEIGGYDIPAKTKVIINAW  398

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI R PQ+WE+ E F+PERF+D  +DF   +  +Y+PFG G+RMCPG  FG+A+V  PLA
Sbjct  399   AIGRHPQHWENAECFEPERFQDLDLDFV-GTNLEYIPFGGGRRMCPGSLFGIANVELPLA  457

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LL+HFDWELP GI    L +TE     +G KND++ +
Sbjct  458   KLLFHFDWELPDGIEASDLDMTETFGATVGRKNDLYLV  495



>sp|Q6WKY9.1|C7D95_MENGR RecName: Full=Cytochrome P450 71D95; AltName: Full=(-)-(4S)-Limonene-3-hydroxylase 
[Mentha x gracilis]
 gb|AAQ18708.1| limonene-3-hydroxylase [Mentha x gracilis]
Length=497

 Score =   387 bits (994),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 217/478 (45%), Positives = 316/478 (66%), Gaps = 13/478 (3%)
 Frame = +3

Query  237   RQWMKPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpav  416
             +QW K +S + LPPGP KLPL+G+L+ L G  +P   + D++K++G  + H+QLGEV +V
Sbjct  23    KQWRKSESQQNLPPGPPKLPLVGHLHLLWG-KLPQHAMADMAKKYGP-VTHVQLGEVFSV  80

Query  417   vvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLS  596
             V+SS E  K  +K  D   A R   +    + YD+ DI+FSPY ++WRQMRK+C++ELLS
Sbjct  81    VLSSREATKEAMKLLDPACADRFESIGTRIMWYDNDDIIFSPYSDHWRQMRKICVSELLS  140

Query  597   ARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE  776
             AR VRSF +IRQDE  RLL  ++SS  AG  +++ + + T   SIICRAAFG  +N  EE
Sbjct  141   ARNVRSFGFIRQDEMSRLLRHLQSS--AGETVDMTERIATLTCSIICRAAFGAIINDHEE  198

Query  777   LVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLg  956
             LV+ V + L M S F +AD FPS K+L+ L   KS++ ++R+  D I+  I++EH+    
Sbjct  199   LVELVKDSLSMASGFELADLFPSSKLLNLLCWNKSKLWRMRRRVDTILEAIVEEHK----  254

Query  957   sgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMV  1136
                  SGE G EDI+DVL +++    + + IT + IKA I D F    +TS+T T+  M 
Sbjct  255   --LKKSGEFGGEDIIDVLFRMQKDSQIKVPITTNAIKAFIFDTFSAGTETSSTTTLWVMA  312

Query  1137  EMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNK  1310
             E+++NP V+AKAQAEVR   KG+  V+  +V +L Y+  V+KETMR+HPP P+I R   +
Sbjct  313   ELMRNPAVMAKAQAEVRAALKGKTSVDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCRE  372

Query  1311  DSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGS  1490
             +  V GY IP + R++IN W++ R+P YWE PE+F PERF+    DF   S F+++PFG+
Sbjct  373   ECEVNGYKIPNKARIMINVWSMGRNPLYWEKPETFWPERFDQVSRDFM-GSDFEFIPFGA  431

Query  1491  GKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             G+R+CPG++FGLA+V  PLA LLYHFDW+L  G+ P  + ++E   +    KN++  +
Sbjct  432   GRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMKPSDMDMSEAEGLTGIRKNNLLLV  489



>gb|ABQ24001.1| limonene hydroxylase [Mentha arvensis]
Length=500

 Score =   387 bits (994),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 216/478 (45%), Positives = 310/478 (65%), Gaps = 11/478 (2%)
 Frame = +3

Query  237   RQWMKPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpav  416
             +QW KPK    LPPGP KLPLIG+L+ L G  +P   L  ++KQ+G  + H+QLGEV +V
Sbjct  24    KQWRKPKPEENLPPGPPKLPLIGHLHLLWG-KLPQHALASVAKQYGP-VAHVQLGEVFSV  81

Query  417   vvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLS  596
             V+SS E  K  +K  D   A R   +    + YD+ DI+FSPY E+WRQMRK+C++ LLS
Sbjct  82    VLSSREATKEAMKLVDPACADRFDSIGTKIMWYDNDDIIFSPYSEHWRQMRKICVSGLLS  141

Query  597   ARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE  776
             AR VRSF +IRQDE  RLL  +RSS+ AG  +++ + + T   SIICRAAFG  +   EE
Sbjct  142   ARNVRSFGFIRQDEVSRLLGHLRSSAAAGEAVDLTERIATLTCSIICRAAFGSVIRDHEE  201

Query  777   LVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLg  956
             LV+ V + L M S F +AD FPS K+L+ L   KS++ ++R+  D I+  I++EH+    
Sbjct  202   LVELVKDALSMASGFELADLFPSSKLLNLLCWNKSKLWRMRRRVDTILEAIVEEHK----  257

Query  957   sgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMV  1136
                  SGE G EDI+DVL +++    + + IT + IKA I D F    +TS+T T+  M 
Sbjct  258   --LKKSGEFGGEDIIDVLFRMQKDSQIKVPITTNAIKAFIFDTFSAGTETSSTTTLWVMA  315

Query  1137  EMVKNPRVLAKAQAEVREVFKGRV--EESNVDKLAYLNLVIKETMRLHPPGPVIYRENNK  1310
             E+++NP V+AKAQ EVR   KG+   +  +V +L Y+  V+KETMR+HPP P+I R   +
Sbjct  316   ELMRNPEVMAKAQVEVRAALKGKTNWDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCRE  375

Query  1311  DSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGS  1490
             +  V GY IP + R++IN W++ R+P YWE P++F PERF+    DF   + F+++PFG+
Sbjct  376   ECEVNGYKIPNKARIMINVWSMGRNPLYWEKPKTFWPERFDQVSRDFM-GNDFEFIPFGA  434

Query  1491  GKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             G+R+CPG++FGLA+V  PLA LLYHFDW L  G+ P  + ++E   +    KN++  +
Sbjct  435   GRRICPGLNFGLANVEVPLAQLLYHFDWNLAEGMKPSDMDMSEAEGLTGIRKNNLLLL  492



>dbj|BAM68811.1| putative CYP71AV1 ortholog [Artemisia abrotanum]
Length=495

 Score =   387 bits (993),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 194/443 (44%), Positives = 300/443 (68%), Gaps = 16/443 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G  +PH  + DL++++G  LMHLQLGEV  +VVSS + AK  L T+D+ FA 
Sbjct  48    IGHMHHLIG-TIPHRGVMDLARKYGY-LMHLQLGEVSTIVVSSPKWAKEILTTYDITFAN  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  L  + V Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V+SF  +R++E   L+  
Sbjct  106   RPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKVKSFRSLREEECWNLVQE  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
              + ++G+GRP+N+ + +   +  I+ RAAFGK +   +E  + V EIL     F VAD F
Sbjct  166   FK-AAGSGRPVNLSENIFKLIARILSRAAFGKGIKDQKEFTEIVKEILRQTGGFDVADIF  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G+++R+  +  + D ++ +++ EH  N       + +  +E ++DVL++L
Sbjct  225   PSKKFLHHLSGKRARLTSIHMKLDNLINNLVAEHTVN-------TSDKTNETLLDVLLRL  277

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             KDS   P+  T DN+KAIILDMFG   DTS+     A+ E++K PR + K QAE+R+  K
Sbjct  278   KDSAEFPL--TADNVKAIILDMFGAGTDTSSATIEWAISELIKCPRAMEKVQAELRKALK  335

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G  ++ E ++ +L+YLNLVIKET+RLHPP P++  RE  +   + GY IP +T++++N +
Sbjct  336   GKEKIHEEDIQELSYLNLVIKETLRLHPPLPLVMPRECRQPVNLAGYNIPNKTKLIVNVF  395

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+YW+D E+F PERFE+        ++++Y+PFG+G+RMCPG + GLA+V  PLA
Sbjct  396   AINRDPEYWKDAETFIPERFENSSTT-VMGAEYEYLPFGAGRRMCPGSALGLANVQLPLA  454

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
             +LLYHF+W+LP+G +   + + E
Sbjct  455   NLLYHFNWKLPNGASYDQIDMAE  477



>gb|AIA09039.1| costunolide synthase [Cynara cardunculus var. altilis]
 gb|AIA09040.1| costunolide synthase [Cynara cardunculus var. scolymus]
Length=494

 Score =   386 bits (992),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 194/457 (42%), Positives = 307/457 (67%), Gaps = 13/457 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L  P  PH  LR L++++G  +MHLQLG+V  VVVS+  +A+  +KT+D+ FA 
Sbjct  41    IGNIHQLKTPT-PHRVLRSLARKYGP-IMHLQLGQVSTVVVSTPRLAREIMKTNDISFAD  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP         Y + DI ++PYGEYWRQM+K+C  ELLSA+ VRSFS IR++E  R+   
Sbjct  99    RPTTTTSQIFFYKAQDIGWAPYGEYWRQMKKICTLELLSAKKVRSFSSIREEELRRIGKV  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S SG   PIN  +     + ++IC+A  G +     +L++ + ++L  +S+F++A  +
Sbjct  159   LESKSGT--PINFTEMTIEMVNNVICKATLGDSCKDQAKLIELLYDVLKTLSAFNLASYY  216

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             P  + L+ ++G+K++ +K++++ D IM DI+KEHR        G   +  ED+VDVL+++
Sbjct  217   PRLQFLNVISGKKAKWLKMQKQLDGIMNDILKEHR------AEGRKNNEQEDLVDVLLRV  270

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K++  L  +I DD++KA+ILDM     DTS+T    AM E+++NP ++ +AQ EVR V K
Sbjct  271   KETGGLDFNIRDDDVKAVILDMLTAGTDTSSTTLEWAMTELIRNPEMMKRAQTEVRSVVK  330

Query  1200  GRV-EESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWA  1373
             G V  E+++  L YL L++KET+RLH P P++  RE  +D  V GY IP +T++++NAWA
Sbjct  331   GDVITETDLQSLHYLKLIVKETLRLHAPTPLLVPRECRQDCNVDGYDIPAKTKIIVNAWA  390

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
                DP  WE+PESF PERFE+ P+ +   + F+++PFG+G+R+CPG++FGL+ V  PLA+
Sbjct  391   CGTDPDSWENPESFIPERFENSPVSYM-GADFEFIPFGAGRRICPGLTFGLSMVEFPLAN  449

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LYHFDW+LP+G+ PH L +TE+  ++  +K+ +  +
Sbjct  450   FLYHFDWKLPNGMKPHELDITEVTGISTSLKHHLKLV  486



>gb|KHN12340.1| Cytochrome P450 71D10 [Glycine soja]
Length=502

 Score =   386 bits (992),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 197/443 (44%), Positives = 299/443 (67%), Gaps = 13/443 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +GN+++  GP +PH TL +L+ Q G  LMHLQLGE P ++VSSA++AK  +KTHD  FA 
Sbjct  42    LGNIHQFFGP-LPHQTLTNLANQHGP-LMHLQLGEKPHIIVSSADIAKEIMKTHDAIFAN  99

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA     YDSSDI FS YG+ WRQ++K+CI+ELL+A+ V+S  +IR++E  +L+  
Sbjct  100   RPHLLASKSFAYDSSDIAFSSYGKAWRQLKKICISELLNAKHVQSLRHIREEEVSKLVSH  159

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             V ++ G+   IN+  E+ +   +II RAA GK     E  +  + ++L+++  FS+AD +
Sbjct  160   VYANEGS--IINLTKEIESVTIAIIARAANGKICKDQEAFMSTMEQMLVLLGGFSIADFY  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+   LTG KS++ + ++E D+I+ +++K+H+ N             ED +D+L+K 
Sbjct  218   PSIKVFPLLTGMKSKLERAQRENDKILENMVKDHKEN-----ENKNGVTHEDFIDILLKT  272

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             +  D L + +T +N+KA+I DMF G       +TV AM E++KNP+ + KAQ EVR+VF 
Sbjct  273   QKRDDLEIPLTHNNVKALIWDMFVGGTAAPAAVTVWAMSELIKNPKAMEKAQTEVRKVFN  332

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              KG V+E+ + +  YLN +IKETMRLHPP  ++  REN++  VV GY IP +++V+INAW
Sbjct  333   VKGYVDETELGQCQYLNSIIKETMRLHPPEALLLPRENSEACVVNGYKIPAKSKVIINAW  392

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI R+ +YW + E F PERF D+  DF+  + F+Y+PFG+G+R+CPG +F +  +   LA
Sbjct  393   AIGRESKYWNEAERFVPERFVDNSYDFS-GTNFEYIPFGAGRRICPGAAFSMPYMLLSLA  451

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
             +LLYHFDW+LP+G T   L ++E
Sbjct  452   NLLYHFDWKLPNGATIQELDMSE  474



>gb|AED99878.1| cytochrome P450 [Panax notoginseng]
Length=514

 Score =   387 bits (993),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 207/459 (45%), Positives = 302/459 (66%), Gaps = 8/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPN-VPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL ++   N +PH  L +LS++ G  LMHLQLG++PA+VVSS  VAK  LKTHDL  A
Sbjct  49    IGNLMQVAASNPIPHRGLLELSRKHGP-LMHLQLGKIPAIVVSSPRVAKEVLKTHDLACA  107

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP +L    ++ +S DI+ +PYG+YWRQMRK+  +ELLSA  VRSF  +R++ES +L+D
Sbjct  108   DRPDMLLGKIMLANSRDIVLAPYGDYWRQMRKISTSELLSANKVRSFRNVREEESWQLID  167

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
              +RSS G+  PIN   +VT    +IICRA  GK     +EL++ V +I    S F +AD 
Sbjct  168   SIRSSLGS--PINYSTKVTGMANAIICRATIGKKCKYQDELIEVVEDIAYWGSGFFMADL  225

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FP  K L ++TG + ++  +R++ D I G II EHR  L + K  +     ED++DVL++
Sbjct  226   FPKLKFLEYITGMRPKLEDMRRKLDHIFGHIINEHREKLATXKEQNIHDADEDLIDVLLR  285

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             + +S  L   IT ++I+ I LDMF    D+++      M E+++NPRV+ KAQAEVR+  
Sbjct  286   INESQRLEFPITSNDIQGITLDMFTAGTDSTSATLQWIMSELMRNPRVMEKAQAEVRQAL  345

Query  1197  KGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
             KG+  + E+++  L YL LV+KET+RLH P P++  RE  K   + GYTIP  T+V++NA
Sbjct  346   KGKTIIYEADIQGLGYLKLVVKETLRLHAPVPLLVPRECRKQCEIDGYTIPVGTKVIVNA  405

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI+RDP++W D +SF PERFE+  MD+   + F+Y+PFG+G+R+C GI+F  A++  PL
Sbjct  406   WAIARDPEHWVDADSFIPERFENGSMDYI-GTNFEYIPFGAGRRVCAGIAFAAATIELPL  464

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLY+FDW+LP+ + P  + + E        KN++  I
Sbjct  465   AQLLYYFDWKLPNDMKPEDVDMEESNGATATRKNNLILI  503



>sp|Q6IV13.1|C7D95_MENSP RecName: Full=Cytochrome P450 71D95; AltName: Full=Limonene-3-hydroxylase 
[Mentha spicata]
 gb|AAT39473.1| limonene-3-hydroxylase [Mentha spicata]
Length=496

 Score =   386 bits (991),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 217/478 (45%), Positives = 315/478 (66%), Gaps = 13/478 (3%)
 Frame = +3

Query  237   RQWMKPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpav  416
             +QW K +S + LPPGP KLPL+G+L+ L G  +P   + D++K++G  + H+QLGEV +V
Sbjct  23    KQWRKSESRQNLPPGPPKLPLVGHLHLLWG-KLPQHAMADMAKKYGP-VTHVQLGEVFSV  80

Query  417   vvssaevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLS  596
             V+SS E  K  +K  D   A R   +    + YD+ DI+FSPY ++WRQMRK+C++ELLS
Sbjct  81    VLSSREATKEAMKLLDPACADRFESIGTRIMWYDNDDIIFSPYSDHWRQMRKICVSELLS  140

Query  597   ARTVRSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEE  776
             AR VRSF +IRQDE  RLL  ++SS  AG  +++ + + T   SIICRAAFG  +N  EE
Sbjct  141   ARNVRSFGFIRQDEMSRLLRHLQSS--AGETVDMTERIATLTCSIICRAAFGAIINDHEE  198

Query  777   LVKFVNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLg  956
             LV+ V + L M S F +AD FPS K+L+ L   KS++ ++R+  D I+  I+ EH+    
Sbjct  199   LVELVKDSLSMASGFELADLFPSSKLLNLLCWNKSKLWRMRRRVDTILEAIVDEHK----  254

Query  957   sgktgsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMV  1136
                  SGE G EDI+DVL +++    + + IT + IKA I D F    +TS+T T+  M 
Sbjct  255   --LKKSGEFGGEDIIDVLFRMQKDSQIKVPITTNAIKAFIFDTFSAGTETSSTTTLWVMA  312

Query  1137  EMVKNPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNK  1310
             E+++NP V+AKAQAEVR   KG+  V+  +V +L Y+  V+KETMR+HPP P+I R   +
Sbjct  313   ELMRNPAVMAKAQAEVRAALKGKTSVDVDDVQELKYMKSVVKETMRMHPPIPLIPRSCRE  372

Query  1311  DSVVCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGS  1490
             +  V GY IP + R++IN W++ R+P YWE PE+F PERF+    DF   S F+++PFG+
Sbjct  373   ECEVNGYKIPNKARIMINVWSMGRNPLYWEKPETFWPERFDQVSRDFM-GSDFEFIPFGA  431

Query  1491  GKRMCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             G+R+CPG++FGLA+V  PLA LLYHFDW+L  G+ P  + ++E   +    KN++  +
Sbjct  432   GRRICPGLNFGLANVEVPLAQLLYHFDWKLAEGMKPSDMDMSEAEGLTGIRKNNLLLV  489



>ref|XP_010104090.1| Cytochrome P450 71D10 [Morus notabilis]
 gb|EXB98291.1| Cytochrome P450 71D10 [Morus notabilis]
Length=509

 Score =   386 bits (992),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 193/457 (42%), Positives = 299/457 (65%), Gaps = 5/457 (1%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L+G  + H + RDLSK++G  +M L+LGE    +VSS E A+  L+TH+L FA 
Sbjct  47    IGNLHQLIGSPLHHRSFRDLSKKYGP-VMKLELGEALTFIVSSVEAAREVLQTHELAFAQ  105

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP+ +  + V  D   ++ SPYGEYWR MRKVC+ ELLSA+ V+SF  +R++E+ R ++ 
Sbjct  106   RPKTIGFEVVASDHPGLIVSPYGEYWRHMRKVCVMELLSAKRVQSFQSLREEEASRFIES  165

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + SSS    PIN+   +      +I RAAF K     +E +  V E++ + + F+V D F
Sbjct  166   ISSSSHQQVPINLSKTLFLVTNGMIARAAFHKKCKDEDEFIASVKELVTLSTGFTVPDCF  225

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K L ++TG K R+++++++  +I+ DII EH+       +   E   +D+VDVL+++
Sbjct  226   PSIKFLSYMTGLKPRLMRMQKKLYQILDDIIDEHKMK-HDSTSKVDEEDKQDLVDVLLEV  284

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             +  +     IT ++IK +ILD+F    +T+ T    AM E+VKNP++L KAQAEVREV  
Sbjct  285   QKLNDQKFEITTNHIKLVILDIFAAGSETAATTLEWAMSELVKNPKILEKAQAEVREVVG  344

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
              KG+V+ES++ KL Y+  ++KET+RLHPP P + RE+ K  V+ GY IP ++RV +NAWA
Sbjct  345   GKGKVKESDIQKLDYMKCIVKETLRLHPPVPFVARESRKRCVILGYEIPSKSRVAVNAWA  404

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             + RDP+ W++ E F+PERF    +D  R + F+++PFG+G+RMCPGI+   A+V   LA 
Sbjct  405   LGRDPEVWDNAECFQPERFIGSSIDL-RGTNFEFLPFGAGRRMCPGITLAFANVELILAQ  463

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             +LYHFDW LPHG     L ++++  +    ++D++ +
Sbjct  464   MLYHFDWGLPHGAKGEELDMSDVYGITCRRRDDLYLV  500



>sp|E1B2Z9.1|C7AV8_CICIN RecName: Full=Cytochrome P450 71AV8; AltName: Full=(+)-Valencene 
oxidase [Cichorium intybus]
 gb|ADM86719.1| valencene oxidase [Cichorium intybus]
Length=496

 Score =   385 bits (990),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 196/443 (44%), Positives = 298/443 (67%), Gaps = 16/443 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G  +PH  + +L+++ G  LMHLQLGEV  +VVSS   AK  L T+D+ FA 
Sbjct  41    IGHMHHLIG-TMPHRGVMELARKHG-SLMHLQLGEVSTIVVSSPRWAKEVLTTYDITFAN  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  L  + V Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V+SF  +R++E   L+  
Sbjct  99    RPETLTGEIVAYHNTDIVLAPYGEYWRQLRKLCTLELLSNKKVKSFQSLREEECWNLVKD  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R S+G G PIN+ + +   + +I+ RAAFGK +    +  + V EIL +   F VAD F
Sbjct  159   IR-STGQGSPINLSENIFKMIATILSRAAFGKGIKDQMKFTELVKEILRLTGGFDVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+LH L+G+++++  +  + D ++ +II EH  N          S  E ++DVL++L
Sbjct  218   PSKKLLHHLSGKRAKLTNIHNKLDNLINNIIAEHPGN-------RTSSSQETLLDVLLRL  270

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K+S   P+  T DN+KA+ILDMFG   DTS+     A+ E+++ PR + K Q E+R+   
Sbjct  271   KESAEFPL--TADNVKAVILDMFGAGTDTSSATIEWAISELIRCPRAMEKVQTELRQALN  328

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G  R++E ++ +L YL LVIKET+RLHPP P++  RE  +  V+ GY IP +T++++N +
Sbjct  329   GKERIQEEDLQELNYLKLVIKETLRLHPPLPLVMPRECREPCVLGGYDIPSKTKLIVNVF  388

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+YW+D E+F PERFE+ P+     S+++Y+PFG+G+RMCPG + GLA+V  PLA
Sbjct  389   AINRDPEYWKDAETFMPERFENSPITVM-GSEYEYLPFGAGRRMCPGAALGLANVELPLA  447

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
             H+LY+F+W+LP+G T   L +TE
Sbjct  448   HILYYFNWKLPNGKTFEDLDMTE  470



>sp|G3GBK0.1|C7BL3_CICIN RecName: Full=Costunolide synthase; Short=CiCOS; AltName: Full=Cytochrome 
P450 71BL3 [Cichorium intybus]
 gb|AEG79727.1| costunolide synthase [Cichorium intybus]
Length=494

 Score =   385 bits (990),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 192/454 (42%), Positives = 310/454 (68%), Gaps = 13/454 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L  P  PH  LR+L++++G  +MHLQLG+V  VVVS+  +A+  +KT+D+ FA 
Sbjct  40    IGNIHQLKSPT-PHRVLRNLARKYGP-IMHLQLGQVSTVVVSTPRLAREIMKTNDISFAD  97

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP         Y + DI ++PYGEYWRQM+K+C  ELLSA+ VRSFS IR++E  R+   
Sbjct  98    RPTTTTSQIFFYKAQDIGWAPYGEYWRQMKKICTLELLSAKKVRSFSSIREEELSRISKV  157

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S   AG PIN  +     + ++IC+A  G +      L++ + ++L  +S+F++A  +
Sbjct  158   LESQ--AGTPINFTEMTVEMVNNVICKATLGDSCKDQATLIEVLYDVLKTLSAFNLASYY  215

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             P  + L+ + G+K++ +K++++ D+I+ D++KEHR+       GS +S  ED+VDVL+++
Sbjct  216   PGLQFLNVILGKKAKWLKMQKQLDDILEDVLKEHRSK------GSNKSDQEDLVDVLLRV  269

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             KD+  L  ++TD+++KA++LDM     DTS+     AM E+++NP ++ +AQ EVR V K
Sbjct  270   KDTGGLDFTVTDEHVKAVVLDMLTAGTDTSSATLEWAMTELMRNPHMMKRAQDEVRSVVK  329

Query  1200  GR-VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAWA  1373
             G  + E+++  L YL L++KET+RLH P P++  RE  +D  V GY IP +T++L+NAWA
Sbjct  330   GNTITETDLQSLHYLKLIVKETLRLHAPTPLLVPRECRQDCNVDGYDIPAKTKILVNAWA  389

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
                DP  W+DPESF PERFE+ P+++   + F+++PFG+G+R+CPG++FGL+ V  PLA+
Sbjct  390   CGTDPDSWKDPESFIPERFENCPINYM-GADFEFIPFGAGRRICPGLTFGLSMVEYPLAN  448

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDI  1655
              LYHFDW+LP+G+ PH L +TE+  ++  +K+ +
Sbjct  449   FLYHFDWKLPNGLKPHELDITEITGISTSLKHQL  482



>ref|XP_008807778.1| PREDICTED: premnaspirodiene oxygenase-like [Phoenix dactylifera]
Length=500

 Score =   385 bits (990),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 195/458 (43%), Positives = 303/458 (66%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G  +PH  LR+LS + G   MHL+LG++  ++ SS E A+  +KTHDL FA+
Sbjct  23    IGHIHHLLG-AMPHRALRELSSRHGP-FMHLKLGQIDHIIASSPEAARDIMKTHDLAFAS  80

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++LA   + Y   DI+FSP G+YWRQ+RK+C+ ELLS + V+SFS  RQ+E   L++ 
Sbjct  81    RPQLLAPFVLFYGGKDIVFSPVGDYWRQLRKICMQELLSPKRVKSFSTCRQEEMSNLVEA  140

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +   SG+  P+N+ + +     S I R AFGK        +  + + + + S FS+AD F
Sbjct  141   ISKKSGS--PVNLSEMLLLSSNSFISRVAFGKKCKHGLRFITGMKKAIELASGFSLADLF  198

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PSW  +  LTG  +R  K RQE DEI+ +I+KEH            +   ED+VDVL+ +
Sbjct  199   PSWSFVDALTGMTARTKKARQEIDEILEEILKEHEEKREGISGKEDQLEEEDLVDVLLDV  258

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
              ++  L + +T  ++K+++L+MF G  +TS+T     M+E++++P ++ KAQAEVR+   
Sbjct  259   AENGELEIPLTRTDLKSVVLEMFIGGTETSSTTLEWVMIELMRHPEMMQKAQAEVRQALK  318

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              K  ++E ++ +L YL LVIKETMRLHP  P++  R N+++  V  Y IP  TRV++NAW
Sbjct  319   EKANIKEEDMSELHYLKLVIKETMRLHPALPLLVPRFNSENCQVGDYEIPAGTRVIVNAW  378

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+YWEDPESF+PERFE   +D+ + + F+++PFG+G+R+CPG++F +A +   LA
Sbjct  379   AIARDPRYWEDPESFRPERFEGSMVDY-KGTSFEFVPFGAGRRICPGVTFAMAQMEMALA  437

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             +LL+HFDWELP+G+ P  L +TE      G+K+ ++ +
Sbjct  438   YLLFHFDWELPNGMEPQDLDMTESFGATTGLKSPLWLV  475



>ref|XP_003550472.2| PREDICTED: cytochrome P450 71D8-like [Glycine max]
Length=559

 Score =   387 bits (995),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 212/457 (46%), Positives = 307/457 (67%), Gaps = 13/457 (3%)
 Frame = +3

Query  300   IGNLYRLVGPN-VPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFA  476
             IGNL +L   + +PH  +R+L+K++G  LMHLQLGE+ AV+VSS  +AK  +KTHDL FA
Sbjct  96    IGNLLQLAAASSLPHHAIRELAKKYGP-LMHLQLGEISAVIVSSPNMAKEIMKTHDLAFA  154

Query  477   TRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLD  656
              RP+ LA D + Y S DI F+PYG+YWRQMRK+C  ELLSA+ V+SFS IR+ E  +L++
Sbjct  155   QRPKFLASDIMGYGSVDIAFAPYGDYWRQMRKICTLELLSAKKVQSFSNIREQEIAKLIE  214

Query  657   RVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
             +++SS+GA  PIN+   + +F+++ + R  FG   +  EE +    E + +   F +AD 
Sbjct  215   KIQSSAGA--PINLTSMINSFISTFVSRTTFGNITDDHEEFLLITREAIEVADGFDLADM  272

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             FPS+K +H +TG K++M K+ ++ D+I+  IIKE++ N      G GE  +E++V+VL++
Sbjct  273   FPSFKPMHLITGLKAKMDKMHKKVDKILDKIIKENQAN-----KGMGEEKNENLVEVLLR  327

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             ++ S +L   IT +NIKA+I D+F    DTS  +   AM EM++NPRV  KAQAE+R   
Sbjct  328   VQHSGNLDTPITTNNIKAVIWDIFAAGTDTSAKVIDWAMSEMMRNPRVREKAQAEMRG--  385

Query  1197  KGRVEESNVDKLAYLNLVIKETMRLH-PPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
             K  + ESN+ +L+YL  VIKETMRLH P   ++ RE  +   + GY +P +T+V++NAWA
Sbjct  386   KETIHESNLGELSYLKAVIKETMRLHPPLPLLLPRECIEACRIDGYDLPTKTKVIVNAWA  445

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             I RDP+ W D +SF PERF    +DF +   F+Y+PFG+G+RMCPGISFG+A+V   LA 
Sbjct  446   IGRDPENWHDADSFIPERFHGASIDF-KGIDFEYIPFGAGRRMCPGISFGIANVEFALAK  504

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHF+WEL  G  P    + E     +G KN++  I
Sbjct  505   LLYHFNWELQQGTKPEEFDMDESFGAVVGRKNNLHLI  541



>gb|ACD42776.1| cytochrome P450 71D1 [Catharanthus roseus]
Length=507

 Score =   385 bits (990),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 212/451 (47%), Positives = 306/451 (68%), Gaps = 11/451 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +GNL+ ++  +VPH  LRDL+K+ G DLM L+LGE  A+VVSS  +AK  LKTHDL F  
Sbjct  48    LGNLHNMMMGSVPHRLLRDLAKKHG-DLMLLKLGEFNAIVVSSPRMAKEVLKTHDLSFLN  106

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP + A   + YD+SD++FS YG+ WRQMRK+ + ELLS + VRSF  IRQDE  RL+  
Sbjct  107   RPIIQAPKILCYDNSDLVFSQYGDSWRQMRKIFVLELLSTKRVRSFQPIRQDEGSRLVXL  166

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++ S   G+ I++ +++ ++ TS++ RAAFGK  +     +K V E   +   F  AD F
Sbjct  167   IKES--VGKSIDLSEKINSYTTSMVARAAFGKVNDAGVTFLKLVKEASEVAGGFDPADIF  224

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+K L+     +S+++K+  +TD I+ ++I EH  N   GK  +GE+G ED++D+L+ +
Sbjct  225   PSYKFLNVFFNSRSKLLKIHGKTDMILEEMIDEHIKNHEMGKKANGENGKEDVIDILLSI  284

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             KDS  L      +N+KA I DMF    +TS++    AM E+++NP V+AKAQ EVR+V K
Sbjct  285   KDSGELQFPFQMNNVKAFIFDMFAAGTETSSSTVEWAMSELIRNPDVMAKAQNEVRQVLK  344

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+  V+ES + +L YL L++KE +RLHP  P +I RE  +D  + GY IP +TRV +N W
Sbjct  345   GKQIVDESVLQELEYLKLIVKEVLRLHPSSPLLIPRECREDCQIDGYDIPVKTRVFVNIW  404

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RD +YW+DPESF PERFE+   DFT  + F+Y+PFGSG+RMCPG++FGLA+V   LA
Sbjct  405   AIARDDKYWKDPESFIPERFENTCFDFT-GNNFEYLPFGSGRRMCPGMTFGLANVDLVLA  463

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGV  1643
              LLYHF+W+LP G+  + + +TE  R+ +G 
Sbjct  464   LLLYHFNWKLPPGV--NDIDMTE--RVGLGA  490



>gb|KDP42338.1| hypothetical protein JCGZ_02811 [Jatropha curcas]
Length=504

 Score =   385 bits (989),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 212/443 (48%), Positives = 305/443 (69%), Gaps = 8/443 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN++ LVG ++P+  LRDLSK++G  +MHLQLGE   VV+SS E+A+  +KTHD++FA 
Sbjct  38    IGNVHNLVG-DLPYHRLRDLSKKYGP-IMHLQLGENTTVVISSPELAQEVMKTHDVNFAQ  95

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP VLA D V Y   DI F+PYGEYWRQ+RK+C  ELL+A+ V+SF  IR++E  +L++ 
Sbjct  96    RPFVLAGDIVSYKCKDIAFAPYGEYWRQLRKMCSLELLTAKRVQSFKSIREEEVSKLVES  155

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + SSSG+  PIN     ++   +II RA  GK     E  V  V +++    S S+AD +
Sbjct  156   ISSSSGS--PINFSKMASSLTYAIISRAVCGKVSRGEEVFVPAVEKLVEAGRSISLADLY  213

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+ + L+  + R+ K+  E D+I+ +I+ EHR        G      ED+VDVL+K 
Sbjct  214   PSVKLFNALSVVRRRVEKIHGEVDKIIENIVIEHRERKRMAHAGINSKEEEDLVDVLLKF  273

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             +++  L   +++D IKA+ILDMF    DTS+T    A+ EMVKNP ++ KAQAEVREVF 
Sbjct  274   QENGDLDSYLSNDGIKAVILDMFIAGSDTSSTTIEWAISEMVKNPSIMEKAQAEVREVFG  333

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              KG+V+E+++ +L YL LVIKET+RLHP  P++  R++ +D V+ GY I  ++ V++NAW
Sbjct  334   SKGKVDEADLHELNYLKLVIKETLRLHPAVPLLLPRQSREDCVIEGYNIATKSTVIVNAW  393

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+YW++ E F PERF +  +DF + + F+++PFG+G+RMCPG+ FGLASV  PLA
Sbjct  394   AIARDPKYWDEAERFYPERFINSSIDF-KGTNFEFIPFGAGRRMCPGMLFGLASVELPLA  452

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
              LLYHFDW+LP G  P  L +++
Sbjct  453   QLLYHFDWKLPGGQKPEDLDMSD  475



>gb|AAO32822.1| cytochrome P450 71D1, partial [Catharanthus roseus]
Length=495

 Score =   385 bits (988),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 211/451 (47%), Positives = 307/451 (68%), Gaps = 11/451 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +GNL+ ++  +VPH  LRDL+K+ G DLM L+LGE  A+VVSS  +AK  LKTHDL F  
Sbjct  36    LGNLHNMMMGSVPHRLLRDLAKKHG-DLMLLKLGEFNAIVVSSPRMAKEVLKTHDLSFLN  94

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP + A   + YD+SD++FS YG+ WR+MRK+ + ELLS + VRSF  IRQDE  RL+  
Sbjct  95    RPIIQAPKILCYDNSDLVFSQYGDSWREMRKIFVLELLSTKRVRSFQPIRQDEGSRLVSL  154

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++ S   G+ I++ +++ ++ TS++ RAAFGK  +     +K V E   +   F  AD F
Sbjct  155   IKES--VGKSIDLSEKINSYTTSMVARAAFGKVNDAGVTFLKLVKEASEVAGGFDPADIF  212

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+K L+     +S+++K+  +TD I+ ++I EH  N   GK  +GE+G ED++D+L+ +
Sbjct  213   PSYKFLNVFFNSRSKLLKIHGKTDMILEEMIDEHIKNHEMGKKANGENGKEDVIDILLSI  272

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             KDS  L      +N+KA+I DMF    +TS++    AM E+++NP V+AKAQ EVR+V K
Sbjct  273   KDSGELQFPFQMNNVKALIFDMFAAGTETSSSTVEWAMSELIRNPDVMAKAQNEVRQVLK  332

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G+  V+ES + +L YL L++KE +RLHP  P +I RE  +D  + GY IP +TRV +N W
Sbjct  333   GKQIVDESVLQELEYLKLIVKEVLRLHPSSPLLIPRECGEDCQIDGYDIPVKTRVFVNIW  392

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RD +YW+DPESF PERFE+   DFT  + F+Y+PFGSG+RMCPG++FGLA+V   LA
Sbjct  393   AIARDDKYWKDPESFIPERFENTCFDFT-GNNFEYLPFGSGRRMCPGMTFGLANVDLVLA  451

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGV  1643
              LLYHF+W+LP G+  + + +TE  R+ +G 
Sbjct  452   LLLYHFNWKLPPGV--NDIDMTE--RVGLGA  478



>ref|XP_004295869.1| PREDICTED: cytochrome P450 71D11-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   385 bits (990),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 206/459 (45%), Positives = 312/459 (68%), Gaps = 11/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L G ++PH +LR+L+ ++G  LMHL+LGE+  VVVSSAE A+  +KTHD+ FAT
Sbjct  47    IGNIHQLAG-SLPHRSLRNLANKYGP-LMHLRLGEISTVVVSSAEFAREVMKTHDVTFAT  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA D V Y+ ++I+F+ YG+YWRQ+RK+C  E+LS + V+S+  IR++E   L+  
Sbjct  105   RPYLLAADIVNYNCTNIVFAKYGDYWRQLRKICTLEVLSPKRVQSYRPIREEEMLNLIKW  164

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  +S A  PIN+ +++ +   +I  RAAFGK     EE +  V E + +   F +AD F
Sbjct  165   I--ASKARSPINLTEKIYSSTYTITTRAAFGKKSKYHEEFIDCVKEGIQLGGGFDLADVF  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS+++LH +TG + ++ ++ ++TD I+ +IIKE R+       G      E +++VL+K 
Sbjct  223   PSYRLLHMITGLRPKLERLHKKTDRILENIIKELRDK--ETSKGGESETQEHLIEVLLKF  280

Query  1020  -KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
              +D+ SL  ++T DNIKA+++D+F    +TS T    AM EMVKNP+++ +AQ EVREVF
Sbjct  281   HEDNGSLEFTLTTDNIKAVMMDIFAAGSETSATAVDWAMSEMVKNPQIMKRAQDEVREVF  340

Query  1197  K--GRVEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINA  1367
                G V E+ + ++ YLN +IKET+RLHP  P +I RE  +   + GY IP +T+V++N 
Sbjct  341   NKLGHVSETGIKEMKYLNSIIKETLRLHPSAPLLIPRECRETCEIGGYEIPVKTKVVVNG  400

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP+YW +PE F P+RF D  +DF R + F+++PFG+G+RMCPGI++GLA+V  PL
Sbjct  401   WAIGRDPKYWTEPERFYPDRFLDSSVDF-RGTDFEFIPFGAGRRMCPGITYGLANVDLPL  459

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP G     L +TE   + +G K ++  I
Sbjct  460   AMLLYHFDWKLPDGKKHEDLDMTEAFGITVGRKENLCLI  498



>dbj|BAM68816.1| putative cytochrome P450 monooxygenase CYP71AV1 [Artemisia schmidtiana]
Length=496

 Score =   385 bits (988),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/443 (43%), Positives = 299/443 (67%), Gaps = 16/443 (4%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ L+G  +PH  L DL++++G  LMHLQLGEV  +VVSS + AK  L THD+ FAT
Sbjct  49    IGHMHHLIG-TIPHRGLMDLARKYG-SLMHLQLGEVSTIVVSSPKWAKEILTTHDITFAT  106

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP  L  + + Y ++DI+F+PYGEYWRQ+RK+C  ELLSA+ V+S+  +R++E   L+  
Sbjct  107   RPDTLTGEIIAYHNTDIIFAPYGEYWRQVRKLCTLELLSAKKVKSYKSLREEECWNLVQE  166

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             ++ +SG+GRP+N+ + +   + +I+CRAAFGK +   +   + + E+      F VAD F
Sbjct  167   IK-ASGSGRPVNLSENIFKLIATILCRAAFGKGIKDQKAFTENMKEMSKETGGFDVADIF  225

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH L+G+++R+  + ++ D ++ +++ EH          +     E ++DVL++L
Sbjct  226   PSKKFLHHLSGKRARLTSIHKKLDNVINNVVAEH-------TVKASSKTEETLLDVLLRL  278

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             KDS      +T DN+KAII+DMF    DTS      A+ E++K PR + K QAE+R+  K
Sbjct  279   KDSAEF--QLTADNVKAIIMDMFVAGTDTSAVTIEWAISELIKCPRAMEKVQAELRKALK  336

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINAW  1370
             G  ++ + ++ +L+YLNLVIKET+RLHPP P++ R+     V + GY IP +T++++N +
Sbjct  337   GKEKIHDEDIHELSYLNLVIKETLRLHPPLPLVSRKECHQQVNLAGYDIPNKTKLIVNVF  396

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP++W+D E+F PERFE+        ++++Y+PFG G+RMCPG + GLA+V  PLA
Sbjct  397   AINRDPEFWKDAETFIPERFENSSTT-VMGAEYEYLPFGGGRRMCPGAALGLANVQLPLA  455

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
              +LYHF+W+LP+G++   + +TE
Sbjct  456   TILYHFNWKLPNGVSYEEIDMTE  478



>ref|XP_010653207.1| PREDICTED: cytochrome P450 71D9-like [Vitis vinifera]
Length=504

 Score =   385 bits (989),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 215/458 (47%), Positives = 308/458 (67%), Gaps = 10/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++LVG ++PH +LRDL+K++G  LMHLQLG+V  +VVSS E+AK  +KTHD++FA 
Sbjct  44    IGNLHQLVG-SLPHHSLRDLAKKYGP-LMHLQLGQVSMLVVSSPEIAKEVMKTHDINFAQ  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   V YDS+D+ FSPYG+YWRQ+RK+C+ ELLSA+ V+SF  IR++E  +L+  
Sbjct  102   RPHLLATRIVSYDSTDVAFSPYGDYWRQLRKICVVELLSAKRVKSFQVIRKEEVSKLIRI  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + SSS    PIN+ D ++ F  S I RAA GK     + L     E   + S F +AD +
Sbjct  162   INSSSRF--PINLRDRISAFTYSAISRAALGKECKDHDPLTAAFGESTKLASGFCLADLY  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K +  ++G + ++ KV+Q  D I+  ++ EHR  +    T       +D+VDVL+KL
Sbjct  220   PSVKWIPLVSGVRHKLEKVQQRIDGILQIVVDEHRERM--KTTTGKLEEEKDLVDVLLKL  277

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             +    L + +TDDNIKA+ILD+FGG  DT +T     M EM+KNP V+ KAQAEVR VF 
Sbjct  278   QQDGDLELPLTDDNIKAVILDIFGGGGDTVSTAVEWTMAEMMKNPEVMKKAQAEVRRVFD  337

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSV-VCGYTIPPRTRVLINAW  1370
              KG V+E+ +D+L +L  VI ET+RLHPP P++     ++   + GY +P +TRV+INAW
Sbjct  338   GKGNVDEAGIDELKFLKAVISETLRLHPPFPLLLPRECREKCKINGYEVPVKTRVVINAW  397

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI R P  W + E F PERF D  +D+ + + F ++PFGSG+R+CPGI FG+  +  PLA
Sbjct  398   AIGRYPDCWSEAERFYPERFLDSSIDY-KGADFGFIPFGSGRRICPGILFGIPVIELPLA  456

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LL+HFDW+LP+G+ P  L +TE+  +A+  K+++  I
Sbjct  457   QLLFHFDWKLPNGMRPEDLDMTEVHGLAVRKKHNLHLI  494



>gb|KDP39024.1| hypothetical protein JCGZ_00781 [Jatropha curcas]
Length=537

 Score =   386 bits (991),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 204/458 (45%), Positives = 304/458 (66%), Gaps = 11/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L+G ++PH  LR LS Q+G  +MHL+LG++  +V+SS E AK  +KTHD+ F+ 
Sbjct  44    IGNMHQLLG-SIPHHRLRHLSNQYGP-VMHLKLGQISNIVISSPEAAKKVMKTHDIIFSQ  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA + + Y+  DI  +PYG+ WRQMRK+C  ELLS + VRSF  IR++E+   +  
Sbjct  102   RPFLLAGEIIFYNFKDIALAPYGDSWRQMRKICTLELLSTKRVRSFRAIREEETSNFIRS  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S S     +NI   V +   +I  R+AFGK   R E  +  V +I++++  FSVAD F
Sbjct  162   ISSLS----EVNISKMVLSLSNAITLRSAFGKVSERHEAFLPLVQKIVLVLEGFSVADIF  217

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH + G +S++ K+ QE D ++ +II EHR N       + +   +D+VDVL+ L
Sbjct  218   PSVKFLHGIIGMRSKIEKLHQEADIMLENIINEHREN-KRLGRSNTQGKEDDLVDVLLNL  276

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             +  DSL   +  +NIKA++LDMF    +TS T+   AM EMVK+ RV+ KAQ E+R+VF 
Sbjct  277   QCGDSLEFPLRIENIKAVMLDMFLAGTETSATVIEWAMSEMVKDSRVMKKAQEEIRQVFN  336

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              K  ++E+  D+L YL LVIKET+RLHPP P++  RE  +   + GY +P  T+V+INAW
Sbjct  337   EKENIDETRFDELKYLKLVIKETLRLHPPAPLLAPRECLEAVEIDGYEVPINTKVIINAW  396

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RD ++W + E F PERF+++ +DF + + F+++PFG+G+RMCPG+++GLA V   LA
Sbjct  397   AIGRDSRHWNEAEKFYPERFQNNSIDF-KGNDFEFIPFGAGRRMCPGVTYGLAVVELVLA  455

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             +LLYHFDW+LP+G+  H L ++E        KN++  I
Sbjct  456   NLLYHFDWKLPNGLEAHQLDMSETFGATARRKNELHLI  493



>ref|XP_007033124.1| Cytochrome P450 71D10, putative [Theobroma cacao]
 gb|EOY04050.1| Cytochrome P450 71D10, putative [Theobroma cacao]
Length=509

 Score =   385 bits (989),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 205/458 (45%), Positives = 310/458 (68%), Gaps = 8/458 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+++L+G ++PH TLRDL+K+ G  LMHLQLG+VP +V+SS  +AK  LK H   FA 
Sbjct  47    IGNMHQLIG-SLPHHTLRDLAKKHGP-LMHLQLGDVPTIVISSPAIAKEVLKDHATIFAQ  104

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA   + YDS++I+FSPYG YWRQ+RK+   ELLS   V+SF +IR++E   L+  
Sbjct  105   RPYLLASKIMSYDSTNIVFSPYGNYWRQLRKISTMELLSPSRVQSFRFIREEEVSALIKT  164

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  S   G P+N+ +++ +    I  RAAFGK     EE ++ + E + +   F +AD +
Sbjct  165   I--SLIEGSPVNLSEKIFSMTYGITSRAAFGKKSKGQEEFIRIMTEAIKLSGGFCLADLY  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+L  ++G + ++ K+++ +D I+ DI+ EH+           +   +D++DVL+KL
Sbjct  223   PSNKLLKLISGVRLKLEKLQRASDRILEDIVNEHKEKTNRTSETGNQQEEDDLLDVLLKL  282

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             + S  L + +T+D IKAIILD+ G   +TS+T    AM EM++NPRV+ +AQAEVR+VF 
Sbjct  283   QQSSDLEIPLTNDKIKAIILDILGAGSETSSTTMEWAMSEMLRNPRVMKQAQAEVRQVFD  342

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
              KG ++E+ + +L +L  ++KET+RLHP  P++  RE +++ V+ GY I  +++V++NAW
Sbjct  343   RKGNLDEAGIHELKFLRSIVKETLRLHPAAPLLVPRECDENCVISGYDILAKSKVIVNAW  402

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RD +YW+D E F PERF D P+DF R + F+Y+PFG+G+R+CPGISF L ++  PLA
Sbjct  403   AIGRDSRYWKDAEKFNPERFLDSPIDF-RGTHFEYIPFGAGRRICPGISFALPNIELPLA  461

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LLYHFDW+LP+G     L +TE   + +  KND+F I
Sbjct  462   QLLYHFDWKLPNGSNCEDLDMTECFGITVRRKNDLFLI  499



>ref|XP_004248582.1| PREDICTED: premnaspirodiene oxygenase-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   385 bits (989),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 206/443 (47%), Positives = 304/443 (69%), Gaps = 7/443 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL++L+G ++PH TLRD++ ++G  +MHL+ GEVP V+VSSAE AK  +KTHDL FA 
Sbjct  46    IGNLHQLMG-SLPHHTLRDMANEYGP-IMHLRFGEVPTVIVSSAEAAKEVMKTHDLVFAD  103

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++L  D + Y+S+ I FSPYG++WRQ+RK+C+ ELL+ + V+SF  IRQ+E   L+  
Sbjct  104   RPKILVADIIGYNSTQITFSPYGDHWRQLRKICVAELLNVKRVQSFESIRQEEVEDLIKT  163

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + SS+ +G  IN+   + T   +II RAAFG+ L   +E +  + +I+ +   F + DTF
Sbjct  164   I-SSNPSGTTINLSQMIFTLTNNIIARAAFGRKLENQDEFIGTLRKIVDLAGGFDLPDTF  222

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K LH LTG K+ M K+  + D+I+  +++EH+           +   ED+VDVL+++
Sbjct  223   PSLKFLHPLTGAKAAMEKIHHQIDKILESVLQEHKAARKVTINHKDKMHKEDLVDVLLRV  282

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             ++S  L + IT D IKA+IL+ F    DTS+T    AM E++KNP V+ +AQAEVR+ FK
Sbjct  283   QESSDLDVPITTDTIKAVILETFIAGTDTSSTALEWAMAELMKNPHVMEQAQAEVRKAFK  342

Query  1200  GR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G+  + ES V +L YL LVIKET+RLH P P++  R   +   + GY I   TR+++NAW
Sbjct  343   GKSMMTESEVQQLDYLKLVIKETLRLHAPVPLLVPRVARERCELGGYEIQANTRLMVNAW  402

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI RDP+YWE+ E F+PER  +  +DF + + F+++PFG+G+R CPGI FG++++  PLA
Sbjct  403   AICRDPKYWENAECFEPERHRNSTLDF-KGNNFEFIPFGAGRRACPGILFGISNLELPLA  461

Query  1551  HLLYHFDWELPHGITPHTLKLTE  1619
              LL HFDW+LP+GI P+ L +TE
Sbjct  462   QLLLHFDWKLPNGIEPNNLDMTE  484



>gb|ABO32531.1| cytochrome P450-dependent monooxygenase-like protein [Ammi majus]
Length=514

 Score =   385 bits (988),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 204/458 (45%), Positives = 304/458 (66%), Gaps = 8/458 (2%)
 Frame = +3

Query  303   GNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFATR  482
             GNL+++ G  +PH  LR L+ +FG  LMHLQLGE+ A+V+S   VAK  L+THDL FA R
Sbjct  46    GNLFQVAG-KIPHRGLRKLADKFGP-LMHLQLGEISAIVISDPRVAKEVLRTHDLAFADR  103

Query  483   PRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDRV  662
             P VL  + ++ +  DI+ + YG+YWRQMRK+C  ELLSA  VRSF  IR+DE+ +L+  +
Sbjct  104   PVVLLGNIILANCRDIVLALYGDYWRQMRKICTLELLSANKVRSFRSIREDETWKLIQSI  163

Query  663   RSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTFP  842
             + SSG+   +++  +V+    ++ CRA  G+     +EL++ V EI  + S F +AD FP
Sbjct  164   KLSSGSSL-VDVSHKVSALANAVTCRATIGQACKYQDELIELVEEIAYLGSGFFLADLFP  222

Query  843   SWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsge-sgseDIVDVLIKL  1019
             S   L  L+G K  + K+R++ D I  +IIKEH + L   K GS   +  ED+VDVL+++
Sbjct  223   SIFFLPTLSGMKPALKKIRKKLDVIFDNIIKEHNDKLSRRKKGSEIDAEEEDLVDVLLRI  282

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
              DS  L   I+  +I+ ++LDM     DTS+ +   AM E+++NP+V+ K Q+EVREV K
Sbjct  283   NDSQRLEFPISSGDIQGLVLDMLTAGTDTSSAVLEWAMSELMRNPKVMKKVQSEVREVVK  342

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINAW  1370
             G  ++EE+++  ++YL LV+KET+RLH P P++  RE  K+  + GYTIP  T+V++N W
Sbjct  343   GKEKIEEADIQNMSYLKLVVKETLRLHAPVPLLLPRECRKECEINGYTIPVGTKVMVNVW  402

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             AI+RDP+ W+D ESF PERFE+  +D+   + F+++PFG+G+RMC GISFG+A+V  PLA
Sbjct  403   AIARDPECWDDAESFIPERFENSSVDYI-GANFEFLPFGAGRRMCAGISFGIATVELPLA  461

Query  1551  HLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
              LL+ FDW+LP+ + P  L + E        KN++  I
Sbjct  462   QLLHSFDWKLPNEMKPEDLDMDETNAATCKRKNNLMLI  499



>gb|AGO03787.1| cytochrome P450 [Tanacetum cinerariifolium]
Length=498

 Score =   384 bits (987),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 203/444 (46%), Positives = 299/444 (67%), Gaps = 10/444 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGN+Y+L G   PH   RDL+++ G  +MH+QLG++  VV+SS ++AK  LK HD+  A 
Sbjct  41    IGNIYQLAGLP-PHRAFRDLARKHGP-IMHIQLGQISTVVISSPKLAKEALKIHDIALAD  98

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP     D V+Y +SDI  +PYGEYWRQM+K+   ELLSA+ V+SF  IR+ E   L+D 
Sbjct  99    RPVTFTSDLVLYGNSDIALAPYGEYWRQMKKISSLELLSAKKVKSFGPIREQELDYLIDF  158

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +R SS  G+ +N+   +T  + +I+C A+FGK +    ELV+F++ +    S F VAD F
Sbjct  159   LRLSS--GKLVNLHQTITKSINNIVCIASFGKNIKYQHELVEFLDMLARTNSGFYVADLF  216

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             P +K L+F++G +S ++K+ +  D++  DI+K+H                ED++DVL+++
Sbjct  217   PKFKFLYFVSGMRSELLKLYRTLDKVFDDILKDHEQR--RIIDKGDHGQEEDLLDVLLQV  274

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
             K+   L   IT++NIKAI +D+F G  DTS+     AM EM+++PRV+ KAQ EVRE FK
Sbjct  275   KNKGGLEFPITNNNIKAIFVDIFAGGTDTSSNTIEWAMTEMIRHPRVMKKAQDEVREAFK  334

Query  1200  G--RVEESNVDKLAYLNLVIKETMRLHPPGP-VIYRENNKDSVVCGYTIPPRTRVLINAW  1370
             G  +++E+++  L YL  VIKET+RLH P P +I R   +   + GY IP  T+V++NA+
Sbjct  335   GKTKIKETDIQCLTYLPSVIKETLRLHVPLPLLIPRVCREQCKIGGYDIPVNTKVIVNAF  394

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A S DP+YWED E+FKPERF++  +DFT  S ++++PFGSG+RMCPGI+FGL SV   LA
Sbjct  395   ACSTDPEYWEDAETFKPERFDNSSVDFT-GSNYEFIPFGSGRRMCPGINFGLVSVKLFLA  453

Query  1551  HLLYHFDWELPHGITPHTLKLTEL  1622
              +LY+FDW+LP G++P  L +TE+
Sbjct  454   QMLYYFDWKLPDGLSPRKLDMTEI  477



>gb|KEH19671.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=507

 Score =   384 bits (987),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 206/459 (45%), Positives = 302/459 (66%), Gaps = 9/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +GN+  LV    P   LRDL+K++G  LMHLQLGE+  +V+SS EVAK  LKTHD+ FA+
Sbjct  44    LGNILHLVATKPPR-RLRDLAKKYGP-LMHLQLGEIFFIVISSPEVAKEVLKTHDIIFAS  101

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA D   Y+S DI FSPYG+YWRQ+RK+C  ELLS R V+S   +RQ E + LL +
Sbjct  102   RPHLLATDIASYNSMDIAFSPYGDYWRQLRKICAIELLSTRRVKSLWTVRQKEINYLLKK  161

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             + S+ G+    NI +E+ + M +   +AAFGK     EE +  V +++ +   F + D F
Sbjct  162   IASNEGS--EFNITEEIISKMYTFTSKAAFGKKYLEQEEFISVVKQLIKLAGGFYIGDLF  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS + +  ++G K ++ K+ Q+ D I+G II +H+  +   +        ED++D LIK 
Sbjct  220   PSAQWIQNISGLKPKLEKLSQQVDRILGRIITDHKETISRRENEGLPEAEEDLIDCLIKF  279

Query  1020  KDSDS-LPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
              +S S +   +T DN+KAIILD+F    +T+ T    AM EM+K+PR+L KAQAEVR+ F
Sbjct  280   VESGSDMDFELTTDNVKAIILDVFSAGSETAATTVNWAMAEMIKDPRILKKAQAEVRKGF  339

Query  1197  --KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
               +G V+E+ + +  YL  +IKE++RLHP  P++  RE+ +   + GY IP ++RVLINA
Sbjct  340   DRRGMVDEATIGEFKYLKSIIKESLRLHPSVPLLLPRESREACEINGYHIPVKSRVLINA  399

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP+YW DP+ F PERF D  +DF+  + F+++PFG+G+R+CPG+++GLA+V   L
Sbjct  400   WAIGRDPKYWNDPDKFYPERFIDSSIDFS-GTNFEFIPFGAGRRICPGMNYGLANVEQVL  458

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP+G+    L+L E   + M  K D++ I
Sbjct  459   ALLLYHFDWKLPNGMKNEELELGEEFGVTMARKGDLYLI  497



>ref|XP_009616520.1| PREDICTED: premnaspirodiene oxygenase-like [Nicotiana tomentosiformis]
Length=520

 Score =   385 bits (988),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 201/449 (45%), Positives = 303/449 (67%), Gaps = 12/449 (3%)
 Frame = +3

Query  300   IGNLYRLVGPNV----PHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDL  467
             IGNL++L+        PHV L  L+ ++G  LMHL+LG+   +VVSSAEV++ F KTHDL
Sbjct  46    IGNLHQLLCLGSSEFQPHVALSKLAAKYGP-LMHLKLGQRLVLVVSSAEVSRQFFKTHDL  104

Query  468   DFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHR  647
              F+ RP +     +MY  SD+ F+PYG++WRQMRK+C +ELL  + + SF  +  DE   
Sbjct  105   TFSNRPELFVGKIMMYGFSDMAFAPYGDFWRQMRKICNSELLGLKRIHSFVPMMFDEVRD  164

Query  648   LLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKT-LNRTEELVKFVNEILIMVSSFS  824
             L+  + +++  G+PI++ + ++    +I C+AA G+T     E  +  + E +     FS
Sbjct  165   LVKSI-AAAEVGKPIDLNERLSLLQFAITCKAAVGRTACTDQESFLMVMKEFVSFAGIFS  223

Query  825   VADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVD  1004
              AD FPSWKI+  ++G K ++ K+ Q+ D I+  II+EH    G+   G G+   EDIVD
Sbjct  224   AADLFPSWKIVQLISGLKRKLTKMHQKADHIVEQIIREHELKRGTDGDGDGKQIEEDIVD  283

Query  1005  VLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEV  1184
             VL++LK+S   P+ IT + IKA + ++F     TS T  + A  E+VKNP+++ KAQAEV
Sbjct  284   VLLRLKESKDFPIPITRNVIKATVFELFVAGTSTSATAMLWAFSELVKNPKMMKKAQAEV  343

Query  1185  REVFK---GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTR  1352
             R+V+K    R+++S++ KL YL +VIKET+R+HPPGP+ + RE+ ++S + GYTIP +T 
Sbjct  344   RQVYKLGTERIDQSHIQKLTYLRMVIKETLRIHPPGPLSFARESREESEIDGYTIPNKTL  403

Query  1353  VLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLAS  1532
             VL+N WA+ RDP++WE+PE+F P+RF+  P++ +  + F+Y PFG+G+R+CPGISFG+AS
Sbjct  404   VLLNLWAVGRDPKHWENPETFDPDRFDGSPIE-SVPTHFEYTPFGAGRRICPGISFGMAS  462

Query  1533  VYTPLAHLLYHFDWELPHGITPHTLKLTE  1619
             V   LA LLYHFDW+LP G++P  L +TE
Sbjct  463   VEVSLALLLYHFDWKLPSGMSPQELDMTE  491



>sp|D5JBW8.1|GAO_CICIN RecName: Full=Germacrene A oxidase; Short=CiGAO; AltName: Full=Germacrene 
A alcohol dehydrogenase; AltName: Full=Germacrene 
A hydroxylase [Cichorium intybus]
 gb|ADF43080.1| germacrene A oxidase [Cichorium intybus]
Length=488

 Score =   384 bits (985),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 199/460 (43%), Positives = 308/460 (67%), Gaps = 16/460 (3%)
 Frame = +3

Query  249   KPKSgrklppgprklplIGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvss  428
             +PKS +K  P   +LP+IG+++ L+G  +PH  + +L+++ G  LMHLQLGEV  +VVSS
Sbjct  24    RPKSNKKRLPEASRLPIIGHMHHLIG-TMPHRGVMELARKHG-SLMHLQLGEVSTIVVSS  81

Query  429   aevaKLFLKTHDLDFATRPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTV  608
              + AK  L T+D+ FA RP  L  + + Y ++DI+ +PYGEYWRQ+RK+C  ELLS + V
Sbjct  82    PKWAKEILTTYDITFANRPETLTGEIIAYHNTDIVLAPYGEYWRQLRKLCTLELLSVKKV  141

Query  609   RSFSYIRQDESHRLLDRVRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKF  788
             +SF  IR++E   L+  V+  SG+G+PI++ + +   + +I+ RAAFGK +    E  + 
Sbjct  142   KSFQSIREEECWNLVKEVK-ESGSGKPISLSESIFKMIATILSRAAFGKGIKDQREFTEI  200

Query  789   VNEILIMVSSFSVADTFPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgkt  968
             V EIL     F VAD FPS K LH L+G+++R+  + ++ D ++ +I+ EH         
Sbjct  201   VKEILRQTGGFDVADIFPSKKFLHHLSGKRARLTSIHKKLDTLINNIVAEHH-------V  253

Query  969   gsgesgseDIVDVLIKLKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVK  1148
              +    +E ++DVL++LKDS   P+  T DN+KAIILDMFG   DTS+     A+ E+++
Sbjct  254   STSSKANETLLDVLLRLKDSAEFPL--TADNVKAIILDMFGAGTDTSSATVEWAISELIR  311

Query  1149  NPRVLAKAQAEVREVFKGR--VEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSV  1319
              PR + K QAE+R+   G+  + E ++  L YLNLVI+ET+RLHPP P++  RE  +   
Sbjct  312   CPRAMEKVQAELRQALNGKEQIHEEDIQDLPYLNLVIRETLRLHPPLPLVMPRECREPVN  371

Query  1320  VCGYTIPPRTRVLINAWAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKR  1499
             + GY I  +T++++N +AI+RDP+YW+D E+F PERFE++P +    + ++Y+PFG+G+R
Sbjct  372   LAGYEIANKTKLIVNVFAINRDPEYWKDAEAFIPERFENNPNNIM-GADYEYLPFGAGRR  430

Query  1500  MCPGISFGLASVYTPLAHLLYHFDWELPHGITPHTLKLTE  1619
             MCPG + GLA+V  PLA++LYHF+W+LP+G +   L +TE
Sbjct  431   MCPGAALGLANVQLPLANILYHFNWKLPNGASHDQLDMTE  470



>ref|XP_006361719.1| PREDICTED: 5-epiaristolochene 1,3-dihydroxylase-like [Solanum 
tuberosum]
Length=461

 Score =   382 bits (982),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 217/459 (47%), Positives = 305/459 (66%), Gaps = 50/459 (11%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IG+++ +VG   PH  LRDL+K +G  LM LQLGEV  VVV+S+E+AK  LKTHDL FA+
Sbjct  43    IGSMHHIVG-GYPHHVLRDLAKIYGP-LMQLQLGEVSVVVVTSSEMAKQVLKTHDLAFAS  100

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP++L  D + YDS DI FSPYG+YWRQMRK+C+ ELL+A+ VRSFS IR+DE   L+D 
Sbjct  101   RPKLLVTDIITYDSRDIAFSPYGDYWRQMRKICVMELLNAKNVRSFSSIRRDEVVHLIDS  160

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +RSSS +G P+N  + +  F +S+ICR+AFG+ L   +  +K + E++ +V+SF+   T 
Sbjct  161   IRSSSSSGEPVNFTERMIWFASSMICRSAFGQLLKEQDIFIKLIREVIRLVASFANHKT-  219

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
                                   +D+ +G                      ED++DVL++L
Sbjct  220   ----------------------SDDALGG--------------------GEDLIDVLLRL  237

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVFK  1199
                 SL   I + NIKAII+DMF G  +T++T T+ AM EM+KNP + AKAQ EVRE F+
Sbjct  238   MKDKSLQFPINNHNIKAIIIDMFTGGTETTSTTTIWAMAEMMKNPSIFAKAQEEVREAFR  297

Query  1200  GRV--EESNVDKLAYLNLVIKETMRLHPPGPV-IYRENNKDSVVCGYTIPPRTRVLINAW  1370
              +V  ++ +V++L Y  LV+KET+RLHPP P+ I RE  +++ + GYTIP +T+VLIN W
Sbjct  298   DKVKFDKYDVEELKYQKLVVKETLRLHPPIPLSIPRECREETDINGYTIPVKTKVLINVW  357

Query  1371  AISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLA  1550
             A+ RDP+YW+D ESFKPERF+   +DF+  + F+++PFGSG+R+CPGISFGLA++Y PLA
Sbjct  358   ALGRDPKYWDDAESFKPERFDQCSVDFS-GNNFEFLPFGSGRRVCPGISFGLANIYLPLA  416

Query  1551  HLLYHFDWELP-HGITPHTLKLTELPRMAMGVKNDIFFI  1664
               LYHFDW+LP  G+ P  L LT+   +    KND++ I
Sbjct  417   QSLYHFDWKLPTTGMEPRDLDLTKSDGITTSRKNDLYLI  455



>gb|KDP39288.1| hypothetical protein JCGZ_01045 [Jatropha curcas]
Length=463

 Score =   382 bits (982),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 198/457 (43%), Positives = 296/457 (65%), Gaps = 6/457 (1%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             +G+++ L G ++PHV LRDL+K+ G  +MHLQLGEV  +VVSS E AK  +KTHD  FA 
Sbjct  1     MGSMHHLSGSSLPHVRLRDLAKEHGP-IMHLQLGEVTNIVVSSPETAKAVMKTHDHIFAQ  59

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +LA + + Y+S+D+ F+PYG+YWRQMR++C  E+LS + V+SF  IR++E  +L+  
Sbjct  60    RPFLLAANIMAYNSTDLAFAPYGDYWRQMREICTQEMLSNKRVQSFGLIREEEVSKLIAE  119

Query  660   VRSSSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADTF  839
             +  SS AG  +N      +   +II R A GK     E ++  + +++     FS++D +
Sbjct  120   L--SSRAGSTVNFSKMFNSVTYNIIQRVAIGKLWKGEEVVIPAIKKLIEASGGFSLSDVY  177

Query  840   PSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIKL  1019
             PS K+LH ++  K ++ +  +E D I  +II EHR    S      ++  ED++DVL++ 
Sbjct  178   PSIKLLHKISTTKFKLQRAHKEADRIFQNIIDEHRARRASRAKSGAKNEEEDLIDVLLQA  237

Query  1020  KDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF-  1196
             +  + L   ITDDNIKA+ILD+  G  DTS    V  M E+ KNP V+ + Q+EVR+VF 
Sbjct  238   QSKEDLEFPITDDNIKAVILDVLSGGSDTSANTVVWVMSELQKNPDVMKRVQSEVRQVFS  297

Query  1197  -KGRVEESNVDKLAYLNLVIKETMRLHPPGPVIYRENNKDSVVCGYTIPPRTRVLINAWA  1373
              KG V+E ++ +L YL  V+KETMRL PPG ++ RE  +D V+ GY IP ++R++INAWA
Sbjct  298   EKGYVDEESIGELHYLKAVVKETMRLRPPGTILTRECMEDCVINGYDIPYKSRIIINAWA  357

Query  1374  ISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPLAH  1553
             + RDP  W + E F P+R  +  +D+ + + F+++PFG+G R+CPGI FGL++V  PLA 
Sbjct  358   LGRDPDSWREAERFNPDRLLNSSIDY-KGNHFEFLPFGAGGRVCPGILFGLSNVQFPLAR  416

Query  1554  LLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             LLYHFDW LP+G+ P  L +     +A+   ND+  I
Sbjct  417   LLYHFDWRLPNGMQPEDLDMNAKYGIAVTRANDLQLI  453



>emb|CDP11812.1| unnamed protein product [Coffea canephora]
Length=499

 Score =   384 bits (985),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 207/459 (45%), Positives = 306/459 (67%), Gaps = 11/459 (2%)
 Frame = +3

Query  300   IGNLYRLVGPNVPHVTLRDLSKQFGKDLMHLQLGevpavvvssaevaKLFLKTHDLDFAT  479
             IGNL+ L G ++PH TL DL+K++G  LMHLQLGEV  VVVSSA+VAK FL  +D  FA 
Sbjct  39    IGNLHHLNG-SLPHRTLADLAKKYGP-LMHLQLGEVSTVVVSSADVAKDFLNKYDTIFAN  96

Query  480   RPRVLACDEVMYDSSDILFSPYGEYWRQMRKVCITELLSARTVRSFSYIRQDESHRLLDR  659
             RP +L    + Y+++ I FSPYG+YWRQ+RK+   ELLSAR V++F  IR+DE   +L+ 
Sbjct  97    RPTLLTSTILFYNNTHISFSPYGDYWRQLRKIYTMELLSARRVQTFRSIREDE---VLNM  153

Query  660   VRS-SSGAGRPINIVDEVTTFMTSIICRAAFGKTLNRTEELVKFVNEILIMVSSFSVADT  836
             ++S SS  G  +N   ++++   SI  RAAFGK     +E +  +NE++I++S F+V D 
Sbjct  154   IKSISSEEGSVVNFTTKLSSLTLSITARAAFGKRSKYHDEFLSLMNEVVILLSGFNVVDM  213

Query  837   FPSWKILHFLTGEKSRMVKVRQETDEIMGDIIKEHRNNLgsgktgsgesgseDIVDVLIK  1016
             +PS+KIL  +TG + ++ ++ ++ DE++ +I+ EH+    +G         +DIVDVL+ 
Sbjct  214   YPSFKILERITGIRRKLERLHKQIDEVLENILNEHKVK-RAGWKPGNGEAKQDIVDVLLN  272

Query  1017  LKDSDSLPMSITDDNIKAIILDMFGGAVDTSTTITVCAMVEMVKNPRVLAKAQAEVREVF  1196
             +++S      +TD+N+KA+I ++F G  +TS+T    AM EM+KNPR+L ++Q EVR+++
Sbjct  273   IQESGEFGAPLTDNNVKAVIFEIFFGGGETSSTTMAWAMAEMIKNPRLLKRSQDEVRQIY  332

Query  1197  K--GRVEESNVDKLAYLNLVIKETMRLHPPGPVIY-RENNKDSVVCGYTIPPRTRVLINA  1367
                G V+ES + +L YL  VI+ET+RLHP GP +  RE ++   + GY IP + RV +N 
Sbjct  333   GEMGNVDESRLHELKYLPAVIRETLRLHPAGPFLLPRECSEQCEIQGYEIPVKARVFVNV  392

Query  1368  WAISRDPQYWEDPESFKPERFEDDPMDFTRSSQFKYMPFGSGKRMCPGISFGLASVYTPL  1547
             WAI RDP++W + E F PERF +   DF +   F Y+PFG+G+RMCPGISF L ++  PL
Sbjct  393   WAIGRDPEHWTESEKFIPERFLESETDF-KGKTFNYIPFGAGRRMCPGISFALPNIELPL  451

Query  1548  AHLLYHFDWELPHGITPHTLKLTELPRMAMGVKNDIFFI  1664
             A LLYHFDW+LP  + P  L +TE   +A+  K D+  I
Sbjct  452   AQLLYHFDWKLPGDLNPELLDMTEAFGLAVRPKQDLLLI  490



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6749630335086