BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25496_g6_i1 len=1093 path=[18168:0-663 18831:664-664 8017:665-921
19088:922-946 4327:947-1092]

Length=1093
                                                                      Score     E

ref|XP_011085159.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  97.1    2e-20   
ref|XP_002321809.2|  lectin family protein                            97.1    2e-20   Populus trichocarpa [western balsam poplar]
emb|CDP11227.1|  unnamed protein product                              95.9    4e-20   
emb|CDP11226.1|  unnamed protein product                              95.1    8e-20   
gb|KDP23148.1|  hypothetical protein JCGZ_00140                       95.1    9e-20   
ref|XP_010519089.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9      89.7    7e-18   
gb|KHF97309.1|  protein phloem protein 2-like a9                      89.0    1e-17   
ref|XP_011000214.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  89.0    1e-17   
ref|XP_007024920.1|  Phloem protein 2-A10, putative                   89.0    4e-17   
ref|XP_010540681.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  87.0    7e-17   
ref|XP_006468453.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  86.7    9e-17   
emb|CBI27174.3|  unnamed protein product                              85.1    2e-16   
ref|XP_011096790.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9      85.1    3e-16   
ref|XP_007024911.1|  Phloem protein 2, putative isoform 1             85.1    3e-16   
gb|KDO77411.1|  hypothetical protein CISIN_1g030911mg                 85.1    3e-16   
ref|XP_008459053.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  84.3    1e-15   
ref|XP_011001323.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  82.4    2e-15   
ref|XP_006448725.1|  hypothetical protein CICLE_v10016974mg           81.6    3e-15   
emb|CDY51622.1|  BnaCnng21140D                                        82.8    3e-15   
ref|XP_011000219.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  84.0    3e-15   
ref|XP_011001325.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  82.0    4e-15   
gb|ABK96474.1|  unknown                                               82.0    4e-15   Populus trichocarpa x Populus deltoides
ref|XP_004151321.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  82.4    5e-15   
ref|XP_010648790.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 ...  81.6    5e-15   
ref|XP_002277133.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 ...  81.6    7e-15   Vitis vinifera
ref|XP_006448726.1|  hypothetical protein CICLE_v10016974mg           80.9    9e-15   
ref|XP_010109810.1|  hypothetical protein L484_018467                 80.9    1e-14   
ref|XP_006374712.1|  hypothetical protein POPTR_0015s15640g           80.9    2e-14   
ref|XP_006377015.1|  hypothetical protein POPTR_0012s12100g           80.1    2e-14   
ref|XP_006377011.1|  hypothetical protein POPTR_0012s12060g           80.1    2e-14   
ref|XP_002524122.1|  conserved hypothetical protein                   78.6    3e-14   Ricinus communis
ref|NP_001280747.1|  protein PHLOEM PROTEIN 2-LIKE A9-like            79.7    3e-14   
ref|XP_011001332.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  78.6    6e-14   
ref|XP_011001329.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  78.6    7e-14   
gb|EYU31716.1|  hypothetical protein MIMGU_mgv1a021901mg              79.0    7e-14   
ref|XP_011001327.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  78.6    9e-14   
ref|XP_008459052.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  78.2    1e-13   
emb|CDY02367.1|  BnaA09g25350D                                        78.2    1e-13   
ref|XP_008225803.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9      78.2    1e-13   
emb|CBI27173.3|  unnamed protein product                              78.2    1e-13   
ref|XP_002321808.2|  hypothetical protein POPTR_0015s15510g           77.4    2e-13   Populus trichocarpa [western balsam poplar]
ref|XP_006377014.1|  hypothetical protein POPTR_0012s12090g           77.4    2e-13   
ref|XP_006356894.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  77.0    2e-13   
ref|XP_008439445.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  77.0    2e-13   
ref|XP_011011256.1|  PREDICTED: uncharacterized protein LOC105115...  78.6    4e-13   
ref|XP_004157741.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  76.6    5e-13   
gb|KGN66885.1|  hypothetical protein Csa_1G703580                     76.6    5e-13   
ref|XP_011000221.1|  PREDICTED: uncharacterized protein LOC105107851  78.6    5e-13   
ref|XP_009115009.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9      76.3    6e-13   
ref|XP_006415361.1|  hypothetical protein EUTSA_v10009870mg           76.3    7e-13   
ref|XP_007212125.1|  hypothetical protein PRUPE_ppa012071mg           75.9    8e-13   
ref|XP_011000213.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  75.5    8e-13   
ref|XP_004145477.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  75.5    8e-13   
gb|KGN66884.1|  hypothetical protein Csa_1G703570                     75.9    8e-13   
ref|XP_002321802.2|  hypothetical protein POPTR_0015s15650g           75.1    2e-12   Populus trichocarpa [western balsam poplar]
emb|CAN72995.1|  hypothetical protein VITISV_030744                   77.0    3e-12   Vitis vinifera
gb|EYU40846.1|  hypothetical protein MIMGU_mgv1a014064mg              74.7    3e-12   
ref|NP_174405.1|  protein PHLOEM protein 2-LIKE A9                    73.9    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040382.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  74.3    4e-12   
ref|XP_004157740.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  73.9    4e-12   
ref|XP_004145476.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  73.2    4e-12   
ref|XP_011000216.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  75.5    4e-12   
ref|XP_011000215.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  75.5    4e-12   
ref|XP_009611544.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  73.6    4e-12   
ref|XP_011011257.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  75.1    6e-12   
ref|XP_002891125.1|  hypothetical protein ARALYDRAFT_336533           77.0    7e-12   
ref|NP_001265911.1|  protein PHLOEM PROTEIN 2-LIKE A9-like            72.4    1e-11   
ref|XP_011000217.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  73.6    1e-11   
ref|XP_002892550.1|  hypothetical protein ARALYDRAFT_312058           72.4    1e-11   
ref|XP_006417490.1|  hypothetical protein EUTSA_v10008847mg           72.4    1e-11   
ref|XP_006389197.1|  hypothetical protein POPTR_0036s00270g           71.6    1e-11   
gb|KFK44915.1|  hypothetical protein AALP_AA1G319400                  72.0    2e-11   
ref|XP_008350620.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  72.0    2e-11   
ref|XP_006303203.1|  hypothetical protein CARUB_v10011154mg           72.0    2e-11   
ref|XP_006417491.1|  hypothetical protein EUTSA_v10008847mg           72.0    2e-11   
ref|NP_683296.1|  phloem protein 2-A10                                71.2    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004170701.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  70.9    3e-11   
ref|XP_004170700.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  70.9    3e-11   
ref|XP_004231580.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9      70.9    4e-11   
ref|XP_004170699.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  70.5    5e-11   
ref|XP_004134525.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  70.5    5e-11   
ref|XP_004134524.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  70.5    6e-11   
ref|XP_010490747.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9      70.1    8e-11   
ref|XP_007024912.1|  Phloem protein 2, putative isoform 2             69.7    8e-11   
ref|XP_002322365.2|  hypothetical protein POPTR_0015s15610g           70.1    9e-11   Populus trichocarpa [western balsam poplar]
gb|KGN49533.1|  hypothetical protein Csa_6G538620                     70.1    9e-11   
ref|XP_009780355.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  69.3    1e-10   
ref|XP_004293747.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  69.3    1e-10   
ref|XP_006305679.1|  hypothetical protein CARUB_v10010397mg           69.3    1e-10   
gb|KFK27836.1|  hypothetical protein AALP_AA8G436300                  69.3    1e-10   
emb|CDX93454.1|  BnaA06g05940D                                        69.3    2e-10   
gb|AFK44791.1|  unknown                                               68.9    2e-10   
ref|XP_004293746.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  68.9    2e-10   
ref|XP_010475875.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  68.9    2e-10   
ref|XP_009148337.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9      68.6    3e-10   
emb|CDX94920.1|  BnaC05g07510D                                        67.8    6e-10   
ref|XP_009353945.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  67.8    6e-10   
ref|XP_011001324.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  66.6    1e-09   
ref|XP_008466892.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  65.1    2e-09   
ref|XP_008780252.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  65.5    2e-09   
ref|XP_007138399.1|  hypothetical protein PHAVU_009G205500g           64.7    4e-09   
gb|AGV54232.1|  lectin                                                64.7    5e-09   
ref|XP_004253374.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  64.7    6e-09   
gb|EYU43687.1|  hypothetical protein MIMGU_mgv1a017435mg              62.4    7e-09   
ref|XP_009380878.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  63.2    2e-08   
ref|XP_006362597.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  62.8    2e-08   
ref|XP_011040383.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  62.4    3e-08   
gb|ACJ84124.1|  unknown                                               62.0    4e-08   Medicago truncatula
ref|XP_008459054.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  62.0    4e-08   
ref|XP_004157746.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  60.8    1e-07   
ref|XP_004145459.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  60.5    2e-07   
ref|XP_010317007.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  60.1    2e-07   
ref|XP_006362596.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  59.3    4e-07   
ref|NP_001236140.1|  lectin                                           58.5    6e-07   
gb|ACU13504.1|  unknown                                               58.2    8e-07   Glycine max [soybeans]
gb|KHN41519.1|  Protein PHLOEM PROTEIN 2-LIKE A9                      58.2    9e-07   
ref|XP_002311046.2|  hypothetical protein POPTR_0008s02750g           57.4    1e-06   Populus trichocarpa [western balsam poplar]
ref|XP_010941633.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  57.4    1e-06   
ref|XP_010317009.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  55.5    7e-06   
ref|XP_007138400.1|  hypothetical protein PHAVU_009G205600g           55.5    7e-06   
ref|XP_010317011.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  54.7    1e-05   
ref|XP_010650336.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9      51.6    2e-04   
ref|XP_009383688.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  50.8    3e-04   
ref|XP_010317010.1|  PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-...  49.7    5e-04   
ref|XP_006374705.1|  hypothetical protein POPTR_0015s15520g           51.2    6e-04   



>ref|XP_011085159.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Sesamum indicum]
Length=174

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 83/157 (53%), Gaps = 15/157 (10%)
 Frame = +3

Query  123  ATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGEKE-VDPTKKY  299
            A +I P+ LN            N  WK     EE++A +++V WLEVTG  E   P K+Y
Sbjct  32   AMKIPPKHLNIVWG------RDNRYWKVPDDDEESSAELNQVCWLEVTGSVEGTRPNKQY  85

Query  300  EVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKV  479
            +V F VS   ++    W   PLY+M +RGK     W+K +L+    K  +      I   
Sbjct  86   QVGFHVSFTPDA--FGWGGSPLYIMVKRGKDGKPVWRKLLLNPHQTKECD------ITAT  137

Query  480  ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP  590
             +    D KLYFGLY++WSGK K GL IH+A ++++P
Sbjct  138  TNPHSNDPKLYFGLYELWSGKWKGGLKIHHAFIRQLP  174



>ref|XP_002321809.2| lectin family protein [Populus trichocarpa]
 gb|EEF05936.2| lectin family protein [Populus trichocarpa]
Length=177

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 82/130 (63%), Gaps = 7/130 (5%)
 Frame = +3

Query  207  ESSGEEAAALVSKVIWLEVTGEKEVDPTK--KYEVKFKVSLKEESSPTEWENIPLYVMAR  380
            +SS +E  A + +V WLE+TG  + DP K  KY++KF+VS+K+++    W   P+++MA+
Sbjct  48   QSSSDETPAELVQVCWLELTGTTK-DPLKEGKYKIKFEVSMKKDA--FGWNGCPVFMMAK  104

Query  381  RGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLA  560
             GKK  Y W K  LS+V+          VID   S   +D KLYFGLY++W+GK K GL 
Sbjct  105  LGKKGRYRWSKVDLSDVSTDKKSVTSDFVID--VSKGTDDNKLYFGLYEVWTGKWKGGLQ  162

Query  561  IHYASVQEIP  590
            IH A V+++P
Sbjct  163  IHQAIVEKVP  172



>emb|CDP11227.1| unnamed protein product [Coffea canephora]
Length=173

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/192 (34%), Positives = 92/192 (48%), Gaps = 23/192 (12%)
 Frame = +3

Query  24   MKAATPEAPADPAKSGTEAKSASTLVNGVDKNNATRIYPRKLNFSLKFSLDEESSNGNWK  203
            M ++ P   ADP  S        T  NG D      + PR LN            N +  
Sbjct  1    MSSSNPHYEADPKAS------RRTKENGRD---VIVVKPRALNIVW--------GNDDRY  43

Query  204  WESSG---EEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVM  374
            W   G   +   A + +V WLEV G  + DP K Y+V F+VSL  ++    W + P+Y+M
Sbjct  44   WNVPGPRDDGKPAELLQVSWLEVAGSVDADPQKTYDVSFRVSLTPDA--FGWGSYPIYIM  101

Query  375  ARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDE-DKKLYFGLYDIWSGKLKK  551
             +RGK   + WKK  L+N  G       G  +     N    D+KLYFGLY++WSGK K 
Sbjct  102  VKRGKFGKFDWKKVYLTNCDGINRIHLTGKSVQNGRENQGSTDRKLYFGLYEVWSGKWKG  161

Query  552  GLAIHYASVQEI  587
            GL IH  +++E+
Sbjct  162  GLKIHDVTIREV  173



>emb|CDP11226.1| unnamed protein product [Coffea canephora]
Length=168

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 89/160 (56%), Gaps = 14/160 (9%)
 Frame = +3

Query  111  DKNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGEKEVDPT  290
            D      + PR LN          + +  W    +G++  A + +V WLEVTG  ++D  
Sbjct  22   DGKEVITVKPRNLNIVWG------NDDRYWNIPKNGDDKPAELLQVCWLEVTGSVDIDSQ  75

Query  291  KKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVI  470
            K YEV F++SL  ++    W +  LY+M +RG    + WKK  L+N   KG+E  +  + 
Sbjct  76   KTYEVSFRLSLTPDA--FGWGSSLLYIMVKRGNSGKFAWKKVSLAN---KGTE--VFHIK  128

Query  471  DKVASND-DEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
             ++A +D   DKKLYFGLY++WSGK K GL IH  +V+EI
Sbjct  129  GELAQDDISRDKKLYFGLYEVWSGKWKGGLKIHDVTVKEI  168



>gb|KDP23148.1| hypothetical protein JCGZ_00140 [Jatropha curcas]
Length=170

 Score = 95.1 bits (235),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 80/131 (61%), Gaps = 8/131 (6%)
 Frame = +3

Query  204  WESSGEEAAALVSKVIWLEVTG--EKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMA  377
            W+ S ++A+A + +V WLEVTG   + +   K YE+KFKV +KE      W   P+++MA
Sbjct  39   WKLSRDQASAELLQVCWLEVTGSTSENLQKGKSYEIKFKVEMKE--GAFGWNGCPVFIMA  96

Query  378  RRGKKRDYCWKKFVLSNVT-GKGSEREI---GLVIDKVASNDDEDKKLYFGLYDIWSGKL  545
            + GKK  Y W+K  L N+   K  + EI   GL ++  A+   ED KLYFGLY++W+G+ 
Sbjct  97   KIGKKGKYKWEKIDLINLAKDKKGQFEIPVNGLTVEVPATYSGEDTKLYFGLYEVWTGRW  156

Query  546  KKGLAIHYASV  578
            K GL IH A V
Sbjct  157  KGGLVIHQAEV  167



>ref|XP_010519089.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 [Tarenaya hassleriana]
Length=179

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 89/172 (52%), Gaps = 19/172 (11%)
 Frame = +3

Query  99   VNGVDKNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEA-AALVSKVIWLEVTGEK  275
            ++ V+  N   I PR LNF+            +  W    E+   A +  + WLEVTG  
Sbjct  10   ISSVEVENGRIIKPRGLNFTW--------GGDSRYWIIPKEDGKPAELKTICWLEVTGTV  61

Query  276  EVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKF-VLSNVTGKGS--  446
            +V P KKY++ FKVS K ++  T W+  P+++ A+ GKK    WK+   ++ + GK    
Sbjct  62   DVKPGKKYQIGFKVSFKPDA--TGWDQAPVFMSAKIGKKGKTTWKRIKSINQIFGKSGLE  119

Query  447  -----EREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
                 E +    I       D+D KL FGLY++W+G+ K GL IH ASVQE+
Sbjct  120  MVVPDETDGRFEIYVSPMESDQDSKLRFGLYEVWTGQRKTGLMIHEASVQEM  171



>gb|KHF97309.1| protein phloem protein 2-like a9 [Gossypium arboreum]
Length=172

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 78/126 (62%), Gaps = 6/126 (5%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRD  398
            E+ AA + +V WLEVTG  +++P  +YE+ FK+S + +S    W   P+++MA+ GKK  
Sbjct  49   EQEAAELIQVSWLEVTGSVKLEPLTRYEISFKLSFRRDS--FGWSGAPIFLMAKVGKKGK  106

Query  399  YCWKKFV-LSNVTGKG--SEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHY  569
            Y WK+   L N+         +    I+ + SN+  DK+LYFGLY++WSGK K GL +H 
Sbjct  107  YKWKRLKELDNLPKDPIMVPTDDSFTIEPILSNE-PDKRLYFGLYEVWSGKWKGGLKVHE  165

Query  570  ASVQEI  587
            A V+++
Sbjct  166  AIVRKL  171



>ref|XP_011000214.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Populus euphratica]
 ref|XP_011011258.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Populus euphratica]
Length=173

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 76/128 (59%), Gaps = 5/128 (4%)
 Frame = +3

Query  207  ESSGEEAAALVSKVIWLEVTGEKEVDPTK-KYEVKFKVSLKEESSPTEWENIPLYVMARR  383
            +SS +E  A + +V WLEVTG       + KY++KF+VS K ++    W+  P+++MA+ 
Sbjct  48   QSSSDETPAELVQVCWLEVTGTTNKSLKEGKYKIKFEVSKKTDA--FGWDGCPVFMMAKL  105

Query  384  GKKRDYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAI  563
            GKK  Y W K  LS V    S      VI+   S   ED KLYFGLY++W+GK K GL I
Sbjct  106  GKKGRYRWSKIDLSKVGTDKSPITSEFVIE--VSKGTEDNKLYFGLYEVWTGKWKGGLQI  163

Query  564  HYASVQEI  587
            H A V+E+
Sbjct  164  HQAIVEEV  171



>ref|XP_007024920.1| Phloem protein 2-A10, putative [Theobroma cacao]
 gb|EOY27542.1| Phloem protein 2-A10, putative [Theobroma cacao]
Length=234

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 60/167 (36%), Positives = 86/167 (51%), Gaps = 22/167 (13%)
 Frame = +3

Query  111  DKNNATRIYPRKLNFSLKFSLDEESSNGNWKWE-----SSGEEAAALVSKVIWLEVTGEK  275
            D+    R  PR  N            N N  W      S+ +E A LV +V WLEVTG  
Sbjct  79   DEQGVYRFKPRAFNIVW--------GNDNRYWRIPSTRSNNDEVAELV-QVSWLEVTGLV  129

Query  276  EVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKF----VLSNVTGKG  443
            E+ P K Y+V F +S KE++    W   P+++MA+ GKK  Y W++      L  V  + 
Sbjct  130  ELRPLKTYQVTFTLSFKEDA--FGWNGSPVFLMAKVGKKGKYKWRRLKELESLPKVPTEV  187

Query  444  SEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQE  584
                   +++    +D  DK+LYFGLY++WSGK K GL +H A+V+E
Sbjct  188  PSNSEPFLVE--VPDDVPDKRLYFGLYEVWSGKWKGGLRVHGATVKE  232



>ref|XP_010540681.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Tarenaya hassleriana]
Length=180

 Score = 87.0 bits (214),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 73/131 (56%), Gaps = 10/131 (8%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRD  398
            E   A +    WLEVTG  +V P KKY++ FK+S K ++  T W+  P+++ A+ GKK  
Sbjct  51   EGKPAELKMACWLEVTGTVDVKPGKKYQISFKISFKPDA--TGWDQAPVFMSAKIGKKGK  108

Query  399  YCWKKFVLSN--VTGKGSEREIG------LVIDKVASNDDEDKKLYFGLYDIWSGKLKKG  554
              WK+    N  +   GSE  I         I+   +  D+  KL FGLY++W+G+ K G
Sbjct  109  TMWKRIKSINQIIQKSGSESVIPDETDGQFEINVPPTESDQATKLQFGLYEVWTGRWKTG  168

Query  555  LAIHYASVQEI  587
            L IH ASVQE+
Sbjct  169  LMIHDASVQEV  179



>ref|XP_006468453.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Citrus sinensis]
Length=169

 Score = 86.7 bits (213),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +3

Query  243  KVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVL  422
            +V WLEVTG  EV   KKY++ FK+SLK ++    W   P+++MA+ GKK  Y W+K   
Sbjct  57   QVCWLEVTGSVEVKRGKKYQIGFKISLKADA--FGWSGCPVFMMAKLGKKGKYTWRKMKP  114

Query  423  SNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
             +  GK +  EI     ++   +  + +LYFGLY++W+GK K GL IH+A ++E+
Sbjct  115  LDHLGKEAA-EIPDEKFEILVPEQGENQLYFGLYEVWNGKWKGGLLIHHAFIREV  168



>emb|CBI27174.3| unnamed protein product [Vitis vinifera]
Length=167

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 82/157 (52%), Gaps = 21/157 (13%)
 Frame = +3

Query  138  PRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE---KEVDPTKKYEVK  308
            PR+LN S  +  D       WK    G    A + +V WLEV+G      V P  KY + 
Sbjct  21   PRQLNVS--WGRDSRY----WKMPGKGSNRPAELLRVCWLEVSGSVPIGSVPPGTKYRIT  74

Query  309  FKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVL----SNVTGKGSEREIGLVIDK  476
            F++SLK ++    W + P+YVMA+ GK+    WKK  L    S  T   S    GL I+ 
Sbjct  75   FQISLKSDA--FGWNDCPVYVMAKFGKEGKNSWKKISLQAHYSEPTSIPSTE--GLEIET  130

Query  477  VASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
              +ND     +YFGLYDIW+G  K GL +H A+V++I
Sbjct  131  EDAND----TIYFGLYDIWTGHWKGGLQLHNATVEQI  163



>ref|XP_011096790.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 [Sesamum indicum]
Length=163

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/129 (38%), Positives = 76/129 (59%), Gaps = 7/129 (5%)
 Frame = +3

Query  204  WESSGEEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMAR  380
            W    +   A + +V WLEVTG    + P+K YEV F++SL  ++    W + P+Y+M +
Sbjct  40   WTVPNKANLAELHQVSWLEVTGSVNGISPSKIYEVGFRLSLTPDA--FGWGSSPVYIMVK  97

Query  381  RGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLA  560
            RGK   + W+K +L        + EI + + K    D+E  KLYFGLY++WSGK K GL 
Sbjct  98   RGKYGKFAWRKILLDAYAT--MQFEITVTLKKAEIPDEE--KLYFGLYEVWSGKWKGGLK  153

Query  561  IHYASVQEI  587
            I++A ++E+
Sbjct  154  IYHAFIKEL  162



>ref|XP_007024911.1| Phloem protein 2, putative isoform 1 [Theobroma cacao]
 gb|EOY27533.1| Phloem protein 2, putative isoform 1 [Theobroma cacao]
Length=175

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 77/129 (60%), Gaps = 9/129 (7%)
 Frame = +3

Query  210  SSGEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGK  389
            ++ +E A LV +V WLEVTG  +++ +K Y+V F +S KE +S   W   P+++MA+ GK
Sbjct  50   NNNDEVAELV-QVSWLEVTGVAKLENSKTYQVTFTLSFKENAS--GWSGCPVFLMAKVGK  106

Query  390  KRDYCWKKF----VLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGL  557
            K  Y WK+      L  V  +        +++     D  D +LYFGLY++WSG+ KKGL
Sbjct  107  KGKYKWKRLKELESLPKVPTEVPSNSEPFLVE--VPKDVNDTRLYFGLYEVWSGQWKKGL  164

Query  558  AIHYASVQE  584
             +H A+V+E
Sbjct  165  RVHGATVKE  173



>gb|KDO77411.1| hypothetical protein CISIN_1g030911mg [Citrus sinensis]
Length=169

 Score = 85.1 bits (209),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 89/165 (54%), Gaps = 20/165 (12%)
 Frame = +3

Query  108  VDKNNATRIYPRKLNF-----SLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE  272
             ++  AT I PR LN         + L E+ SN          +   LV +V WLE TG 
Sbjct  19   AERTEAT-IKPRGLNIVWGNDPRYWHLPEKRSN----------DPVELV-QVCWLEATGS  66

Query  273  KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSER  452
             EV   KKY++ FK+SLK ++    W   P+++MA+ GKK  Y W+K    +  GK +  
Sbjct  67   VEVKRGKKYQIGFKISLKADA--FGWSGCPVFMMAKLGKKGKYTWRKMKPLDHLGKEAA-  123

Query  453  EIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
            EI     ++   +  + +LYFGLY++W+GK K GL IH+A ++E+
Sbjct  124  EIPDEKFEILVPEQGENQLYFGLYEVWNGKWKGGLLIHHAFIREV  168



>ref|XP_008459053.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Cucumis melo]
Length=205

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 88/176 (50%), Gaps = 29/176 (16%)
 Frame = +3

Query  117  NNATRIYPRKLNFSLKFSLDEESSNGNWKWESSG---------EEAAALVSKVIWLEVTG  269
            +N  ++YPR LN +          N    W   G         E   A + +V WLEVTG
Sbjct  28   DNKFKVYPRALNITW--------GNDRRYWTIPGRDPNNYDKDENYFAELKQVCWLEVTG  79

Query  270  --EKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKG  443
              +K++ P K Y+  F VSL  ++    W++  +Y+MA+ GKK  +  KK  L+ +    
Sbjct  80   SIKKDLVPGKTYKASFGVSLSPDAF--GWDDCSVYIMAKIGKKGHFHLKKMNLTTIPTTS  137

Query  444  SEREIG--------LVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
            ++ +I         L++    +  D+D  LYFGLY++W+ + K GL IHYA V+ +
Sbjct  138  TDVKISFIPTPGDDLIVQVPLTQPDDDLNLYFGLYEVWTNRWKGGLRIHYALVEMV  193



>ref|XP_011001323.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X1 [Populus 
euphratica]
Length=171

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/161 (35%), Positives = 84/161 (52%), Gaps = 11/161 (7%)
 Frame = +3

Query  114  KNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE-KEVDPT  290
            K ++ R   +   F++ + LD+      W   + G    A + +V WLE+TG  K+  P 
Sbjct  17   KRDSQRWTFKPRGFNIIWGLDQRY----WNLPAEGTTDPAELVQVCWLELTGTTKDSLPE  72

Query  291  KKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLS--NVTGKGSEREIGL  464
             KYE+KFK+ +K  +      N P+++MA+ GK+  Y W K  L   N   +    E   
Sbjct  73   GKYEIKFKLEVKPGAFGLS--NSPIFMMAKVGKRGRYKWNKIKLQEKNSDNRTVTEEPTF  130

Query  465  VIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
             ID   + DD   KLYFGLY++W+GK K GL IH A+V  +
Sbjct  131  QIDVKGTTDDN--KLYFGLYEVWTGKWKGGLLIHGATVDPV  169



>ref|XP_006448725.1| hypothetical protein CICLE_v10016974mg [Citrus clementina]
 gb|ESR61965.1| hypothetical protein CICLE_v10016974mg [Citrus clementina]
Length=133

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 74/129 (57%), Gaps = 3/129 (2%)
 Frame = +3

Query  201  KWESSGEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMAR  380
            +W  +       + +V WLEVTG  EV   KKY++ FK+SLK ++    W   P+++MA+
Sbjct  7    QWNGTRSNDPVELVQVCWLEVTGSVEVKHGKKYQIGFKISLKADA--FGWGGCPVFMMAK  64

Query  381  RGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLA  560
             GKK  Y  +K    +  GK    EI     ++   +  + +LYFGLY++W+GK K GL 
Sbjct  65   LGKKGKYTSRKMKPLDHLGK-EAAEIPDEKVEILVPEQGENQLYFGLYEVWNGKWKGGLL  123

Query  561  IHYASVQEI  587
            IH+A ++E+
Sbjct  124  IHHAFIREV  132



>emb|CDY51622.1| BnaCnng21140D [Brassica napus]
Length=176

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 70/127 (55%), Gaps = 10/127 (8%)
 Frame = +3

Query  231  ALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCW  407
            A +  V WLEVTG   + +P K Y++ FK+S K E+  T W+  PL + A+ GKK    W
Sbjct  52   AEMKMVSWLEVTGSFDKTEPGKAYQIGFKISFKPEA--TGWDGAPLAMSAKIGKKGKTVW  109

Query  408  KKFVLSNVTGKGSE-------REIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIH  566
            KK    N    GSE        +    I    + D++D KL FGLY++W+G+ K GL IH
Sbjct  110  KKIKSVNQNKGGSEPVNIPDESDGQFEISVSPTADNQDTKLQFGLYEVWTGRWKTGLLIH  169

Query  567  YASVQEI  587
             A VQ++
Sbjct  170  EAFVQQV  176



>ref|XP_011000219.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Populus euphratica]
Length=265

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 79/154 (51%), Gaps = 33/154 (21%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWE--NIPLYVMARRGKK  392
            ++  A + +V WL+V+GE +V   K YEV F +S+  E S   W+  + P+ VMAR GK 
Sbjct  96   DDGPAELREVCWLDVSGEMDVTKGKTYEVSFMLSMNTEKS-FGWDDPDYPVMVMARIGKA  154

Query  393  RDYCWKKFVLSNVTG----------------------------KGSEREIGLVIDKVASN  488
            R+Y  KK  LS + G                            K S+ +     D+  +N
Sbjct  155  REYVRKKIKLSELKGEVMEFPPDKCRVVFKNDEKSESEEELPAKKSQSQTKSTSDENPNN  214

Query  489  DDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP  590
            D+E  KLYFGLY++WS K K GL IH A VQEIP
Sbjct  215  DEE--KLYFGLYEVWSNKWKGGLRIHEAIVQEIP  246



>ref|XP_011001325.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Populus euphratica]
Length=168

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 85/159 (53%), Gaps = 16/159 (10%)
 Frame = +3

Query  129  RIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE--KEVDPTKKYE  302
            R  PR L+ +  +S DE    G W     G +  A + KV WLE+ G   K +   ++Y 
Sbjct  20   RFKPRGLHIT--WSSDE----GYWTMPEKGTDDPAELLKVCWLEINGSTPKPLSKGERYA  73

Query  303  VKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKV-  479
            + FK+S+ E+     W+  P ++MA+ GKK    W +  L++V G   + E+ +   K+ 
Sbjct  74   LSFKISMTEDK--FGWQTTPAFMMAKVGKKGIAKWTRVNLADVQG---DNEMEVPFGKLR  128

Query  480  --ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP  590
               S + +D  LYFG Y++WSG  K GL IH A V++IP
Sbjct  129  FEVSKNAQDTTLYFGFYELWSGGWKGGLRIHEAVVEKIP  167



>gb|ABK96474.1| unknown [Populus trichocarpa x Populus deltoides]
Length=168

 Score = 82.0 bits (201),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/157 (34%), Positives = 82/157 (52%), Gaps = 12/157 (8%)
 Frame = +3

Query  129  RIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE--KEVDPTKKYE  302
            R  PR LN +        S+ G W     G +  A + KV WLE+ G   K +   ++Y 
Sbjct  20   RFKPRGLNITWS------STEGYWTMPEKGTDDPAELLKVCWLEINGSTPKPLSKGERYA  73

Query  303  VKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNV-TGKGSEREIGLVIDKV  479
            + FK+S+ E+     W+  P ++MA+ GKK    W +  L++V  G   +   G +  +V
Sbjct  74   LSFKISMTEDR--FGWQEAPAFMMAKVGKKGVAKWARINLADVQVGPEMKVPFGKLRFEV  131

Query  480  ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP  590
            + N  +D  LYFG Y++WSG  K GL IH A V+E+P
Sbjct  132  SKNA-QDTTLYFGFYELWSGGWKGGLRIHEAVVEEMP  167



>ref|XP_004151321.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Cucumis sativus]
 gb|KGN66904.1| hypothetical protein Csa_1G709160 [Cucumis sativus]
Length=203

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 97/200 (49%), Gaps = 34/200 (17%)
 Frame = +3

Query  42   EAPADPAKSGTEAKSASTLVNGVDKNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGE  221
              P+DP         A T VN + ++   +IYPR LN +        S    W       
Sbjct  10   RPPSDPHFR------AVTSVNTIGEDTF-KIYPRALNITWG------SDRRYWTIPRRDR  56

Query  222  EAA-------ALVSKVIWLEVTGEKEVD--PTKKYEVKFKVSLKEESSPTEWENIPLYVM  374
                      A + +V WLEVTG    D  P K Y+V F VSL  ++    W++  +Y+M
Sbjct  57   TTDDEDEDYFAELKQVCWLEVTGSTNRDLVPEKTYKVSFGVSLGPDAF--GWDDCSVYIM  114

Query  375  ARRGKKRDYCWKKFVLSNVTGKGSEREIGL---------VIDKVASNDDEDKKLYFGLYD  527
            A+ GKK ++ ++K  L  +T   ++ EI L         V     +N+++D KLYFGLYD
Sbjct  115  AKIGKKGNFRFQKVNLGIITTT-TDPEISLIPFTELTVTVPTPRTNNNNDDLKLYFGLYD  173

Query  528  IWSGKLKKGLAIHYASVQEI  587
            +W+ + K GL IHYA V+ +
Sbjct  174  VWTNRWKGGLRIHYALVEMV  193



>ref|XP_010648790.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 isoform X2 [Vitis 
vinifera]
 ref|XP_010648793.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 isoform X2 [Vitis 
vinifera]
Length=175

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/137 (39%), Positives = 73/137 (53%), Gaps = 15/137 (11%)
 Frame = +3

Query  198  WKWESSGEEAAALVSKVIWLEVTGE---KEVDPTKKYEVKFKVSLKEESSPTEWENIPLY  368
            WK         A + +V WLEV+G      V P  KY + F++SLK ++    W + P+Y
Sbjct  43   WKMPEKNSGGPAELLQVCWLEVSGSVPIGSVPPGTKYRITFQISLKSDA--FGWNDCPVY  100

Query  369  VMARRGKKRDYCWKKFVL----SNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWS  536
            VMA+ GK+    WKK  L    S  T   S    GL I+   +ND     +YFGLYDIW+
Sbjct  101  VMAKFGKEGKNSWKKISLQAHYSEPTSIPSTE--GLEIETEDAND----TIYFGLYDIWT  154

Query  537  GKLKKGLAIHYASVQEI  587
            G  K GL +H A+V++I
Sbjct  155  GHWKGGLQLHNATVEQI  171



>ref|XP_002277133.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 isoform X1 [Vitis 
vinifera]
 emb|CBI27175.3| unnamed protein product [Vitis vinifera]
Length=179

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 73/136 (54%), Gaps = 8/136 (6%)
 Frame = +3

Query  198  WKWESSGEEAAALVSKVIWLEVTGEKEVDPTK---KYEVKFKVSLKEESSPTEWENIPLY  368
            WK         A + +V WLEV+G   +       K+++ F+VS K ++    W N P+Y
Sbjct  43   WKMPEKNSGGPAELLQVCWLEVSGSVPIRSAPIGTKFKITFQVSFKSDA--FGWNNCPVY  100

Query  369  VMARRGKKRDYCWKKFVLSNVTGKGSE--REIGL-VIDKVASNDDEDKKLYFGLYDIWSG  539
            VMA+ GKK  Y W K  L     + +      GL ++ K A+  + +  +YFGLY++WSG
Sbjct  101  VMAKFGKKGKYTWTKISLRTDNSQPTNILPPDGLEIVTKEATTANVNDTIYFGLYEVWSG  160

Query  540  KLKKGLAIHYASVQEI  587
            K K GL +H A V++I
Sbjct  161  KWKGGLELHNAMVEQI  176



>ref|XP_006448726.1| hypothetical protein CICLE_v10016974mg [Citrus clementina]
 gb|ESR61966.1| hypothetical protein CICLE_v10016974mg [Citrus clementina]
Length=169

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 70/115 (61%), Gaps = 3/115 (3%)
 Frame = +3

Query  243  KVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVL  422
            +V WLEVTG  EV   KKY++ FK+SLK ++    W   P+++MA+ GKK  Y  +K   
Sbjct  57   QVCWLEVTGSVEVKHGKKYQIGFKISLKADA--FGWGGCPVFMMAKLGKKGKYTSRKMKP  114

Query  423  SNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
             +  GK    EI     ++   +  + +LYFGLY++W+GK K GL IH+A ++E+
Sbjct  115  LDHLGK-EAAEIPDEKVEILVPEQGENQLYFGLYEVWNGKWKGGLLIHHAFIREV  168



>ref|XP_010109810.1| hypothetical protein L484_018467 [Morus notabilis]
 gb|EXC24753.1| hypothetical protein L484_018467 [Morus notabilis]
Length=178

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 85/168 (51%), Gaps = 23/168 (14%)
 Frame = +3

Query  117  NNATRIYPRKLNF-----SLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGEKE-  278
            N     YPR LN      +  + L E+ ++         +   A + +V WLEVTG  + 
Sbjct  18   NGTIVFYPRALNIVWGADTRYWRLPEKQTDRE-------KTRPAELIQVSWLEVTGTTDP  70

Query  279  VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREI  458
            ++  K Y++ F++SLK ++    W    LY+MA+ G++  Y W K    +   + + R  
Sbjct  71   LNEEKSYKISFELSLKPDA--FGWNGCQLYLMAKLGRRGRYKWTKVTFKD---QPNNRPF  125

Query  459  -----GLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
                   VI    S D ED+KLYFGLY++WSGK K GL IH A V E+
Sbjct  126  TVPAEDFVIKVPPSTDAEDRKLYFGLYEVWSGKWKGGLEIHKAEVAEV  173



>ref|XP_006374712.1| hypothetical protein POPTR_0015s15640g [Populus trichocarpa]
 gb|ERP52509.1| hypothetical protein POPTR_0015s15640g [Populus trichocarpa]
Length=202

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 58/142 (41%), Positives = 81/142 (57%), Gaps = 15/142 (11%)
 Frame = +3

Query  198  WKWESS------GEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENI  359
            WK ES       G++  A + +V WL+V+GE  V   K YEV F +S+  ++S   W++ 
Sbjct  40   WKEESQFWSIPEGDDGPAELLEVCWLDVSGEMPVTKGKTYEVSFMLSMNTKNS-FGWDD-  97

Query  360  PLYVMARRGKKRDYCWKKFVLSNVTGKGSE-----REIGLVIDKVASNDDEDKKLYFGLY  524
            P+ VMAR GK+  Y  K+  L +++G+  E       I    D+ A ND E   LYFGLY
Sbjct  98   PVTVMARIGKEGKYQRKEIKLLDLSGEVKEFPPDKCRIEFKSDENAKNDKE--TLYFGLY  155

Query  525  DIWSGKLKKGLAIHYASVQEIP  590
            ++W+ K K GL IH A VQEIP
Sbjct  156  EMWTNKWKGGLRIHEAIVQEIP  177



>ref|XP_006377015.1| hypothetical protein POPTR_0012s12100g [Populus trichocarpa]
 gb|ERP54812.1| hypothetical protein POPTR_0012s12100g [Populus trichocarpa]
Length=172

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/146 (35%), Positives = 75/146 (51%), Gaps = 7/146 (5%)
 Frame = +3

Query  153  FSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKE  329
            F++ + LDE      WK    G+   A + +V WLE+TG  K+  P  KYE+KFK+ +K 
Sbjct  30   FNIIWGLDERY----WKLPEKGKVEPAELLQVCWLELTGTTKDSLPEGKYEIKFKLEVKP  85

Query  330  ESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKL  509
             +      N P+++MA+ GK+  Y W K  L           +            +D KL
Sbjct  86   GAFGLS--NSPIFMMAKVGKRGRYKWNKIKLQEKNSDNRPVIVEPTFQIEVKGTTDDNKL  143

Query  510  YFGLYDIWSGKLKKGLAIHYASVQEI  587
            YFGLY++W+GK K GL IH A+V  +
Sbjct  144  YFGLYEVWTGKWKGGLLIHGATVDPV  169



>ref|XP_006377011.1| hypothetical protein POPTR_0012s12060g [Populus trichocarpa]
 gb|ERP54808.1| hypothetical protein POPTR_0012s12060g [Populus trichocarpa]
Length=163

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 86/174 (49%), Gaps = 16/174 (9%)
 Frame = +3

Query  96   LVNGVDKNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE-  272
            +V  +      R  PR LN +        S+ G W     G +  A + KV WLE+ G  
Sbjct  1    MVFMLQHTGRWRFKPRGLNITWS------STEGYWTMPEKGTDGPAELLKVCWLEIEGST  54

Query  273  -KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSE  449
             + +   K+Y + FK+S+ E+     W+  P ++MA+ GKK    W +  L++V     +
Sbjct  55   PEHLSKGKRYALSFKISMTEDR--FGWQEAPAFMMAKVGKKGIAKWARINLADVQ---VD  109

Query  450  REIGLVIDKV---ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP*LKT  602
             E+ + + K+      + +D  LYFG Y++W G  K GL IH A V+++P L +
Sbjct  110  HEMEVPLGKLQFEVPENAQDTTLYFGFYELWCGGWKGGLRIHEAVVEKMPDLPS  163



>ref|XP_002524122.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38233.1| conserved hypothetical protein [Ricinus communis]
Length=136

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 75/133 (56%), Gaps = 15/133 (11%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTG--EKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKK  392
            EEAA L+ +V WLEVTG  +  +   KKY + F + L + +    W   P+++MA+ GKK
Sbjct  6    EEAAKLL-QVCWLEVTGSTKNPLSKGKKYGISFTIELMDGA--FGWHGCPVFMMAKIGKK  62

Query  393  RDYCWKKFVLSN--------VTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLK  548
              Y W+K  LS+        +  K SE +    ID   S DD    LYFGLY++W+GK K
Sbjct  63   GKYRWQKSDLSSLPKNQKLEIPLKTSENKYPFTIDVNPSEDDP--VLYFGLYEVWTGKWK  120

Query  549  KGLAIHYASVQEI  587
             GL I+ A ++EI
Sbjct  121  GGLNIYQAKIEEI  133



>ref|NP_001280747.1| protein PHLOEM PROTEIN 2-LIKE A9-like [Malus domestica]
 emb|CAZ15549.1| phloem protein 2 [Malus domestica]
Length=177

 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 71/126 (56%), Gaps = 7/126 (6%)
 Frame = +3

Query  222  EAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDY  401
            E A L+ +V WLEVTG   +   KKYE+ F V L  ++    W +I  ++MA+ GKK  Y
Sbjct  55   EPAELI-QVSWLEVTGSYSLSTAKKYEISFDVELAPDA--FGWRDIQAFLMAKVGKKGKY  111

Query  402  CWKKFVLSNVTGKGSEREI----GLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHY  569
             W K  ++    K  + +I    G  +     ++  D  +YFGLY++WSGK K GL IH 
Sbjct  112  TWTKVKVAAQDPKVGKFKIPDDNGPPMKIEVPSNAPDSTVYFGLYEVWSGKWKGGLKIHQ  171

Query  570  ASVQEI  587
            ASV+E+
Sbjct  172  ASVKEV  177



>ref|XP_011001332.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X3 [Populus 
euphratica]
Length=168

 Score = 78.6 bits (192),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 82/157 (52%), Gaps = 12/157 (8%)
 Frame = +3

Query  129  RIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE--KEVDPTKKYE  302
            R  PR L+ +        S  G W     G +  A + KV WLE+ G   + +   K+Y 
Sbjct  20   RFKPRGLHITWS------SDKGYWTMPEKGTDDPAELLKVCWLEIEGSTPEHLSKGKRYA  73

Query  303  VKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVT-GKGSEREIGLVIDKV  479
            ++FK+S+ ++     W+  P ++MA+ GKK    W +  L+++      E  +G++  +V
Sbjct  74   LRFKISMTKDR--FGWQEAPAFMMAKVGKKGIAKWARINLADLQEDHEMEVPLGMLQFEV  131

Query  480  ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP  590
              N  +D  LYFG Y++WSG  K GL IH A V++IP
Sbjct  132  PENA-QDTTLYFGFYEVWSGGWKGGLRIHEAVVEKIP  167



>ref|XP_011001329.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X2 [Populus 
euphratica]
 ref|XP_011001330.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X2 [Populus 
euphratica]
 ref|XP_011001331.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X2 [Populus 
euphratica]
Length=168

 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 82/157 (52%), Gaps = 12/157 (8%)
 Frame = +3

Query  129  RIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE--KEVDPTKKYE  302
            R  PR L+ +        S  G W     G +  A + KV WLE+ G   + +   K+Y 
Sbjct  20   RFKPRGLHITWS------SDKGYWTMPEKGTDDPAELLKVCWLEIEGSTPEHLSKGKRYA  73

Query  303  VKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVT-GKGSEREIGLVIDKV  479
            ++FK+S+ ++     W+  P ++MA+ GKK    W +  L+++      E  +G++  +V
Sbjct  74   LRFKISMTKDR--FGWQEAPAFMMAKVGKKGIAKWARINLADLQEDHEMEVPLGMLQFEV  131

Query  480  ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP  590
              N  +D  LYFG Y++WSG  K GL IH A V++IP
Sbjct  132  PENA-QDTTLYFGFYEVWSGGWKGGLRIHEAVVEKIP  167



>gb|EYU31716.1| hypothetical protein MIMGU_mgv1a021901mg [Erythranthe guttata]
Length=196

 Score = 79.0 bits (193),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 92/185 (50%), Gaps = 41/185 (22%)
 Frame = +3

Query  150  NFSLKFSLDEES--------------SNGNWKWESSGEEAAAL-VSKVIWLEVTGEKE-V  281
            N SL+F +D+E+               N    W    +E +A+ +++V WLEVTG  E  
Sbjct  14   NPSLEFKVDDETKRMIIPARHLNIVWGNDTRYWNVPIDEGSAVELNQVCWLEVTGCVEKT  73

Query  282  DPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSN----------V  431
             P K YEV F+VSL  ++    W + PLYVM +RGK   + W K+ + +          +
Sbjct  74   SPEKIYEVGFEVSLGADA--FGWGSSPLYVMVKRGKDGKFEWTKYSMQDHHQSHDHHISL  131

Query  432  TGK------------GSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYAS  575
            T K              E +I +  +   +    D+K+YFGLY++WSGK K GL IH+A 
Sbjct  132  TAKLMSSSSEQQQQQHKEDDI-INNNNNNAAAAADEKIYFGLYEVWSGKWKGGLKIHHAF  190

Query  576  VQEIP  590
            V E+P
Sbjct  191  VHELP  195



>ref|XP_011001327.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X1 [Populus 
euphratica]
Length=197

 Score = 78.6 bits (192),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 82/159 (52%), Gaps = 16/159 (10%)
 Frame = +3

Query  129  RIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE--KEVDPTKKYE  302
            R  PR L+ +        S    W     G +  A + KV WLE+ G   K +   ++Y 
Sbjct  20   RFKPRGLHITW------SSDKSYWTMPDKGTDDPAGLLKVCWLEINGSTPKPLSKGERYA  73

Query  303  VKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKV-  479
            ++FK+S+ E+     W+  P ++MA+ GKK    W +  L++V    ++ EI + + K+ 
Sbjct  74   LRFKISMTEDK--FGWQTTPAFMMAKVGKKGIAKWTRINLTDVQ---ADHEIKVPLGKLR  128

Query  480  --ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP  590
                 + +D  LYFG Y++WSG  K GL IH A V+++P
Sbjct  129  FEVPENAQDTTLYFGFYELWSGGWKGGLRIHEAVVEKMP  167



>ref|XP_008459052.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Cucumis melo]
Length=184

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/169 (37%), Positives = 91/169 (54%), Gaps = 19/169 (11%)
 Frame = +3

Query  114  KNNATRIYPRKLNFSLK-----FSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTG-EK  275
            KN  T IYP+  N +       + L  +S N     ESS   AAA + +V WLEVT    
Sbjct  22   KNKKTIIYPKGFNITWGNDKRYWRLPRQSRNLK---ESS---AAAELLQVSWLEVTCWTD  75

Query  276  EVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVL----SNVTGKG  443
             V+  K Y+V F VS+   ++   W+   +Y+MA+ GK   + +KK  L    S+   K 
Sbjct  76   NVEIGKSYKVGFNVSM--TAAAFGWKGCDVYIMAKIGKAGKFVYKKMCLDSKASDDQNKF  133

Query  444  SEREIGLVID-KVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
            +  E  L+I  K  S+   D +LYFG+Y++WSGK K GL IH+A V+++
Sbjct  134  NMPEDDLIITVKPPSSSPGDNRLYFGMYEVWSGKWKGGLKIHHAFVEKV  182



>emb|CDY02367.1| BnaA09g25350D [Brassica napus]
Length=187

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 68/125 (54%), Gaps = 10/125 (8%)
 Frame = +3

Query  228  AALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYC  404
            +A +  V WLEVTG  +E +P K Y++ FK+S K ++  T W+  PL + A+ GKK    
Sbjct  51   SAELKMVSWLEVTGSFEETEPGKAYQIGFKISFKPDA--TGWDGAPLVMSAKIGKKGKTV  108

Query  405  WKKFVLSNVTGKGSE-------REIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAI  563
            W+K    N    GSE             I    + D++D KL FGLY++W+G+ K GL I
Sbjct  109  WRKIKSVNQNKGGSEPVNIPDESNGQFEISVSPTADNQDTKLQFGLYEVWTGRWKTGLLI  168

Query  564  HYASV  578
            H A V
Sbjct  169  HEAFV  173



>ref|XP_008225803.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 [Prunus mume]
Length=181

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/143 (35%), Positives = 74/143 (52%), Gaps = 22/143 (15%)
 Frame = +3

Query  198  WKWESSGEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMA  377
            WK  + G      + +V WLEVT    ++P K+YE+ F+V L  ++    W +I  ++MA
Sbjct  45   WKLPNKGSGDPVELLQVSWLEVTATVNLNPKKEYEISFEVELAPDA--FGWRDIQAFLMA  102

Query  378  RRGKKRDYCWKK-----------FVLSNVTGKGSEREIGLVIDKVASNDDE--DKKLYFG  518
            + GKK  Y W K           F + +  G G    I        S+DD   D  L+FG
Sbjct  103  KVGKKGKYRWTKVKLAQDSNVGRFTIPDTNGNGQTFSI-------RSDDDANADNTLHFG  155

Query  519  LYDIWSGKLKKGLAIHYASVQEI  587
            LY++WSGK K GL I+ A+V+E+
Sbjct  156  LYEVWSGKWKGGLKIYGANVKEV  178



>emb|CBI27173.3| unnamed protein product [Vitis vinifera]
Length=177

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 74/136 (54%), Gaps = 10/136 (7%)
 Frame = +3

Query  198  WKWESSGEEAAALVSKVIWLEVTGEKEVDPTK---KYEVKFKVSLKEESSPTEWENIPLY  368
            WK       + A + +V WLEV+G   +       K+ + F+VS K ++    W N P+Y
Sbjct  43   WKMPEKNSGSPAELLQVCWLEVSGSVPIRSASIGTKFRITFQVSFKSDA--FGWNNCPVY  100

Query  369  VMARRGKKRDYCWKKFVLSNVTGKGSE--REIGL-VIDKVASNDDEDKKLYFGLYDIWSG  539
            VMA+ GKK  Y W K  L     + +      GL ++ K A N ++   +YFGLY++WSG
Sbjct  101  VMAKFGKKGKYAWTKISLRTDYSQPTNILPPEGLEIVTKDAPNVND--TIYFGLYEVWSG  158

Query  540  KLKKGLAIHYASVQEI  587
            K K GL +H A+V+++
Sbjct  159  KWKGGLELHNATVEQM  174



>ref|XP_002321808.2| hypothetical protein POPTR_0015s15510g [Populus trichocarpa]
 gb|EEF05935.2| hypothetical protein POPTR_0015s15510g [Populus trichocarpa]
Length=168

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 85/157 (54%), Gaps = 12/157 (8%)
 Frame = +3

Query  129  RIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE--KEVDPTKKYE  302
            R  PR L+ +        S++  WK    G +  A +  V WLE+ G   + +   K Y 
Sbjct  20   RFKPRGLHITWS------SNSSYWKMPEKGTDGPAELMAVCWLEIDGSTSEPLSKGKGYA  73

Query  303  VKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNV-TGKGSEREIGLVIDKV  479
            + FK+S+ ++ S   W+  P++++A+ GKK    W+K  L ++  G   E   G +  +V
Sbjct  74   LSFKISMTKQDS--VWKEGPVFMLAKVGKKGIAKWEKINLGDMRIGNIIEIPYGKLRFEV  131

Query  480  ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP  590
                 ED +LYFGLY++W+GK K+GL IH A V+E+P
Sbjct  132  PKKA-EDTRLYFGLYELWTGKWKEGLQIHEAVVEEMP  167



>ref|XP_006377014.1| hypothetical protein POPTR_0012s12090g [Populus trichocarpa]
 gb|ERP54811.1| hypothetical protein POPTR_0012s12090g [Populus trichocarpa]
Length=168

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 80/159 (50%), Gaps = 16/159 (10%)
 Frame = +3

Query  129  RIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE--KEVDPTKKYE  302
            R  PR LN +        S+   W     G +  A + KV WLE+ G   K +   ++Y 
Sbjct  20   RFKPRGLNITWS------SNEHYWTMPEKGTDDPAELLKVCWLEINGSTPKPLSKGERYA  73

Query  303  VKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKV-  479
            + FK+S+ E+     W+  P ++MA+ GKK    W +  L++V     + E+ +   K+ 
Sbjct  74   LSFKISMTEDR--FGWQEAPAFMMAKVGKKGVAKWARINLADVQ---VDHEMEVPFGKLR  128

Query  480  --ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP  590
               S + +D  LYFG Y++W G  K GL IH A V+E+P
Sbjct  129  FEVSKNAQDTTLYFGFYELWCGGWKGGLRIHEAVVEEMP  167



>ref|XP_006356894.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Solanum tuberosum]
Length=170

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 62/162 (38%), Positives = 82/162 (51%), Gaps = 15/162 (9%)
 Frame = +3

Query  108  VDKNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTG-EKEVD  284
            ++K    +IYP    F++ +  DE      WK     E+ A LV +V WLEVTG   +V+
Sbjct  17   LEKGTVFKIYPAA--FNIVWGKDERY----WKLPQEKEDPATLV-QVSWLEVTGWCDKVE  69

Query  285  PTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLS---NVTGKGSERE  455
               KYEVKFKV L  +S    +  +PLY M + G K    WKK  L+   NV   GS   
Sbjct  70   KGTKYEVKFKVKLTPDS--FGFNELPLYFMVKSGSKN--LWKKIYLTKDANVESNGSYLV  125

Query  456  IGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQ  581
               +      +  ED KL FGLY++WSGK K GL I    +Q
Sbjct  126  PNNLTITTTDSPYEDSKLCFGLYEVWSGKWKGGLIIQEVIIQ  167



>ref|XP_008439445.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Cucumis melo]
Length=169

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 69/126 (55%), Gaps = 7/126 (6%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTG-EKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            +E  A    V WLEV    +   P  KY++ FK+SL  E  P  W++ P+++MA+ G+  
Sbjct  48   KECYAEAINVTWLEVKAIYRGAKPGSKYKIGFKISLTSE--PVGWDSSPVFMMAKVGESG  105

Query  396  DYCWKK--FVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHY  569
             Y WK+  F ++N     ++      I    S   +D  L+FGLY+IW G+ KKGL IH+
Sbjct  106  SYIWKRLYFDINNAGKPPTDFPSNFSISVPVSA--QDTTLFFGLYEIWGGRWKKGLRIHH  163

Query  570  ASVQEI  587
            A V +I
Sbjct  164  AFVTKI  169



>ref|XP_011011256.1| PREDICTED: uncharacterized protein LOC105115883 isoform X1 [Populus 
euphratica]
Length=290

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 94/195 (48%), Gaps = 18/195 (9%)
 Frame = +3

Query  27   KAATPEAPADPAKSGTEAKSASTLVNGVDKNNATRIYPRKLNFSLKFSLDEESSNGNWKW  206
            KA++      P     E  +   L  G D        P+ L+    FS +E  +    K 
Sbjct  13   KASSDSQQPSPNNENPETDTEPALSQGADGKTTLTFKPKHLSI---FSEEERQAWTISKI  69

Query  207  ESSGEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRG  386
              S  +  A + +V WL+VTG       K YE+ F +S+ E++S   WE+ P+YVMAR G
Sbjct  70   SESSRDVTADMLEVCWLDVTGSMTATKGKAYEISFILSMNEKNS-FGWED-PVYVMARIG  127

Query  387  KKRDYCWKKFVLSNVTGKGSERE--------IGLVIDKVASNDDEDKKLYFGLYDIWSGK  542
            ++ +Y   +  LS +   G E+E        +    D+   N+   KKLYFGLY++W+  
Sbjct  128  EEGEYSRVQIDLSKL---GHEKEEFPAEKCRVEFRSDENTENNK--KKLYFGLYEVWTNN  182

Query  543  LKKGLAIHYASVQEI  587
             K GL IH A V+E+
Sbjct  183  WKGGLRIHEAIVREL  197



>ref|XP_004157741.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Cucumis sativus]
Length=184

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 86/169 (51%), Gaps = 19/169 (11%)
 Frame = +3

Query  114  KNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGE-----EAAALVSKVIWLEVTG-EK  275
            KN    IYP+   F++ +  D+      W++           AAA + +V WLEVT    
Sbjct  22   KNQKVIIYPK--GFTITWGNDKRY----WRFPRQSRNLKESSAAAELLQVSWLEVTCWTD  75

Query  276  EVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSER-  452
             V+  K Y+V F VS+   ++   W+   +Y+MA+ GK   + +KK  L      G  + 
Sbjct  76   NVEIGKSYKVGFNVSM--TAAAFGWKGCEVYIMAKIGKAGKFVYKKMCLDGKASDGQTKF  133

Query  453  ---EIGLVID-KVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
               E  L+I  K  S    D +LYFG+Y++WSGK K GL IH+A V+++
Sbjct  134  NMPEDNLIITVKPPSTSPGDNRLYFGMYEVWSGKWKGGLKIHHAFVEKV  182



>gb|KGN66885.1| hypothetical protein Csa_1G703580 [Cucumis sativus]
Length=184

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 56/169 (33%), Positives = 86/169 (51%), Gaps = 19/169 (11%)
 Frame = +3

Query  114  KNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGE-----EAAALVSKVIWLEVTG-EK  275
            KN    IYP+   F++ +  D+      W++           AAA + +V WLEVT    
Sbjct  22   KNQKVIIYPK--GFTITWGNDKRY----WRFPRQSRNLKESSAAAELLQVSWLEVTCWTD  75

Query  276  EVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSER-  452
             V+  K Y+V F VS+   ++   W+   +Y+MA+ GK   + +KK  L      G  + 
Sbjct  76   NVEIGKSYKVGFNVSM--TAAAFGWKGCEVYIMAKIGKAGKFVYKKMCLDGKASDGQTKF  133

Query  453  ---EIGLVID-KVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
               E  L+I  K  S    D +LYFG+Y++WSGK K GL IH+A V+++
Sbjct  134  NMPEDNLIITVKPPSTSPGDNRLYFGMYEVWSGKWKGGLKIHHAFVEKV  182



>ref|XP_011000221.1| PREDICTED: uncharacterized protein LOC105107851 [Populus euphratica]
Length=310

 Score = 78.6 bits (192),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 62/195 (32%), Positives = 94/195 (48%), Gaps = 18/195 (9%)
 Frame = +3

Query  27   KAATPEAPADPAKSGTEAKSASTLVNGVDKNNATRIYPRKLNFSLKFSLDEESSNGNWKW  206
            KA++      P     E  +   L  G D        P+ L+    FS +E  +    K 
Sbjct  33   KASSDSQQPSPNNENPETDTEPALSQGADGKTTLTFKPKHLSI---FSEEERQAWTISKI  89

Query  207  ESSGEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRG  386
              S  +  A + +V WL+VTG       K YE+ F +S+ E++S   WE+ P+YVMAR G
Sbjct  90   SESSRDVTADMLEVCWLDVTGSMTATKGKAYEISFILSMNEKNS-FGWED-PVYVMARIG  147

Query  387  KKRDYCWKKFVLSNVTGKGSERE--------IGLVIDKVASNDDEDKKLYFGLYDIWSGK  542
            ++ +Y   +  LS +   G E+E        +    D+   N+   KKLYFGLY++W+  
Sbjct  148  EEGEYSRVQIDLSKL---GHEKEEFPAEKCRVEFRSDENTENNK--KKLYFGLYEVWTNN  202

Query  543  LKKGLAIHYASVQEI  587
             K GL IH A V+E+
Sbjct  203  WKGGLRIHEAIVREL  217



>ref|XP_009115009.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 [Brassica rapa]
 ref|XP_009115010.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 [Brassica rapa]
Length=195

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 67/126 (53%), Gaps = 10/126 (8%)
 Frame = +3

Query  225  AAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDY  401
              A +  V WLEVTG  +E +P K Y++ FK+S K ++  T W   PL + A+ GKK   
Sbjct  58   VPAELKMVSWLEVTGSFEETEPGKAYQIGFKISFKPDA--TGWNGAPLVMSAKIGKKGKT  115

Query  402  CWKKFVLSNVTGKGSE-------REIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLA  560
             WKK    +    GSE        E    I    + D++D KL FGLY++W+G+ K GL 
Sbjct  116  VWKKIKSVDQNKGGSEPVNIPDESEGQFEIWVSPTADNQDTKLQFGLYEVWTGRWKTGLL  175

Query  561  IHYASV  578
            IH A V
Sbjct  176  IHEAFV  181



>ref|XP_006415361.1| hypothetical protein EUTSA_v10009870mg [Eutrema salsugineum]
 gb|ESQ33714.1| hypothetical protein EUTSA_v10009870mg [Eutrema salsugineum]
Length=183

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 72/134 (54%), Gaps = 14/134 (10%)
 Frame = +3

Query  222  EAAALVSKVIWLEVTGEKE-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRD  398
            +  A + KV WLEVTG  E ++P K Y + FK+S K ++  T W+  P+++ A+ GK   
Sbjct  52   KVPAELKKVSWLEVTGSFEKIEPRKTYRIGFKISFKPDA--TGWDEAPVFMSAKIGKNGK  109

Query  399  YCWKKFVLSNVT----GKGSE-------REIGLVIDKVASNDDEDKKLYFGLYDIWSGKL  545
              WK+    N       +GSE        +    I    +  ++D KL FGLY++W+GK 
Sbjct  110  TVWKRIKSINQNFLKPKRGSEPVNIPDESDGRFEISVSPTTVNQDTKLQFGLYEVWTGKW  169

Query  546  KKGLAIHYASVQEI  587
            K GL IH A VQE+
Sbjct  170  KTGLLIHEAFVQEV  183



>ref|XP_007212125.1| hypothetical protein PRUPE_ppa012071mg [Prunus persica]
 gb|EMJ13324.1| hypothetical protein PRUPE_ppa012071mg [Prunus persica]
Length=184

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 18/126 (14%)
 Frame = +3

Query  243  KVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKK---  413
            +V WLEVT    ++P ++YE+ F+V L  ++    W +I  ++MA+ GKK  Y W K   
Sbjct  63   QVSWLEVTATVGLNPGREYEISFQVELAPDA--FGWRDIQAFLMAKVGKKGKYTWTKVKL  120

Query  414  --------FVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHY  569
                    F + +  G G    I     K     D D  L+FGLY++WSGK K GL I+ 
Sbjct  121  AQDSNVGRFTIPDTNGNGRPFRI-----KSLDMKDADNTLHFGLYEVWSGKWKGGLKIYE  175

Query  570  ASVQEI  587
            A+V+++
Sbjct  176  ANVEDV  181



>ref|XP_011000213.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Populus euphratica]
 ref|XP_011011259.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Populus euphratica]
Length=168

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 85/157 (54%), Gaps = 12/157 (8%)
 Frame = +3

Query  129  RIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE--KEVDPTKKYE  302
            R  PR L+ +        +++  WK    G +  A +  V WLE+ G   + +   K+Y 
Sbjct  20   RFKPRGLHITW------SNNSSYWKMPQKGTDGPAELLAVCWLEIDGSTSEPLSKGKRYA  73

Query  303  VKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNV-TGKGSEREIGLVIDKV  479
            + FK+S+ ++     W+  P++++A+ GKK    W+K  L ++  G   E   G +  +V
Sbjct  74   LSFKISMTKQDP--VWKEGPVFMLAKVGKKGIAKWEKINLGDMRIGNIIEIPYGKLRFEV  131

Query  480  ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP  590
                 ED +LYFGLY++W+GK K+GL IH A V+E+P
Sbjct  132  PKKA-EDTRLYFGLYELWTGKWKEGLQIHEAVVEEMP  167



>ref|XP_004145477.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Cucumis sativus]
Length=173

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 71/127 (56%), Gaps = 8/127 (6%)
 Frame = +3

Query  225  AAALVSKVIWLEVTG-EKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDY  401
            AAA + +V WLEVT     V+  K Y+V F VS+   ++   W+   +Y+MA+ GK   +
Sbjct  47   AAAELLQVSWLEVTCWTDNVEIGKSYKVGFNVSM--TAAAFGWKGCEVYIMAKIGKAGKF  104

Query  402  CWKKFVLSNVTGKGSER----EIGLVID-KVASNDDEDKKLYFGLYDIWSGKLKKGLAIH  566
             +KK  L      G  +    E  L+I  K  S    D +LYFG+Y++WSGK K GL IH
Sbjct  105  VYKKMCLDGKASDGQTKFNMPEDNLIITVKPPSTSPGDNRLYFGMYEVWSGKWKGGLKIH  164

Query  567  YASVQEI  587
            +A V+++
Sbjct  165  HAFVEKV  171



>gb|KGN66884.1| hypothetical protein Csa_1G703570 [Cucumis sativus]
Length=179

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 88/170 (52%), Gaps = 18/170 (11%)
 Frame = +3

Query  108  VDKNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSG----EEAAALVSKVIWLEVTGEK  275
            + K      YPR L  +        + N  W++  S      ++A  + +V WLEVT   
Sbjct  18   ITKGGKMIFYPRALTITWG------NDNRYWRFLPSTNLKDPKSAVQLLQVSWLEVTCST  71

Query  276  E-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSER  452
            + V+  + Y+V F VSL+ ++    W+++ +++MA+ GKK  Y +KK       G  S++
Sbjct  72   DKVEAGQTYKVGFNVSLQPDA--FGWDDVEVFIMAKVGKKGTYFFKKTSFGKRLGTSSKK  129

Query  453  ----EIGLVIDKVASNDDE-DKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
                + GL I  VA      D  LYFGLY++WSGK K GL IH A V+++
Sbjct  130  FSVPDEGLEIKIVAPQSSPGDCSLYFGLYEVWSGKWKGGLQIHDAFVEKV  179



>ref|XP_002321802.2| hypothetical protein POPTR_0015s15650g [Populus trichocarpa]
 gb|EEF05929.2| hypothetical protein POPTR_0015s15650g [Populus trichocarpa]
Length=199

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 74/133 (56%), Gaps = 9/133 (7%)
 Frame = +3

Query  204  WESSGEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARR  383
            W +S  +  A + +V WL+VTG       K YE+ F +S+ EE+S   WE+ P+YVMAR 
Sbjct  18   WTTSERDDPAELLEVCWLDVTGSMTATKGKAYEISFILSMNEENS-FGWED-PVYVMARI  75

Query  384  GKKRDYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDED-----KKLYFGLYDIWSGKLK  548
            G++ +Y   K  LS +  K  E E      +V    DE+     K LYFGLY++W+   K
Sbjct  76   GEEGEYTRVKIDLSKLGLK--EEEFPAEKCRVEFRSDENAENNKKTLYFGLYEVWTNHWK  133

Query  549  KGLAIHYASVQEI  587
             GL IH A V+E+
Sbjct  134  GGLRIHEAIVREL  146



>emb|CAN72995.1| hypothetical protein VITISV_030744 [Vitis vinifera]
Length=366

 Score = 77.0 bits (188),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 10/136 (7%)
 Frame = +3

Query  198  WKWESSGEEAAALVSKVIWLEVTGEKEVDPTK---KYEVKFKVSLKEESSPTEWENIPLY  368
            WK       + A + +V WLEV+G   +       K+ + F+VS K  S    W N P+Y
Sbjct  232  WKMPEKNSGSPAELLQVCWLEVSGSVPIRSASIGTKFRITFQVSFK--SDAFGWNNCPVY  289

Query  369  VMARRGKKRDYCWKKFVLSNVTGKGSE--REIGL-VIDKVASNDDEDKKLYFGLYDIWSG  539
            VMA+ GKK  Y W K  L     + +      GL ++ K A N ++   +YFGLY++WSG
Sbjct  290  VMAKFGKKGKYAWTKISLRTDYSQXTNILPPEGLEIVTKDAPNVND--TIYFGLYEVWSG  347

Query  540  KLKKGLAIHYASVQEI  587
            K K GL +H A+V+++
Sbjct  348  KWKGGLELHNATVEQM  363



>gb|EYU40846.1| hypothetical protein MIMGU_mgv1a014064mg [Erythranthe guttata]
Length=202

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 74/148 (50%), Gaps = 27/148 (18%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGEKE-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            E +A  +++V WLEVTG  E   P K YEV F+VS+  ++    W + PLYVM +RGK  
Sbjct  52   EGSAVELNQVCWLEVTGCVEKTSPEKIYEVGFEVSIGADA--FGWGSSPLYVMVKRGKDG  109

Query  396  DYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDK-----------------------K  506
             + W K+ + +           L    ++S+  + +                       K
Sbjct  110  KFEWTKYSMQDHHQSHDHHIS-LTAKLMSSSKKQQQHKEDDIHDDIINTDNNNNAAADEK  168

Query  507  LYFGLYDIWSGKLKKGLAIHYASVQEIP  590
            +YFGLY++WSGK K GL IH+A V E+P
Sbjct  169  IYFGLYEVWSGKWKGGLKIHHAFVHELP  196



>ref|NP_174405.1| protein PHLOEM protein 2-LIKE A9 [Arabidopsis thaliana]
 sp|Q9SA16.1|P2A09_ARATH RecName: Full=Protein PHLOEM PROTEIN 2-LIKE A9; Short=AtPP2-A9 
[Arabidopsis thaliana]
 gb|AAD21686.1| F28K20.16 [Arabidopsis thaliana]
 gb|AEE31328.1| protein PHLOEM protein 2-LIKE A9 [Arabidopsis thaliana]
Length=180

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 73/134 (54%), Gaps = 18/134 (13%)
 Frame = +3

Query  228  AALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYC  404
             A +  V WLEVTG   +++P K Y + FK+S K ++  T W+  P+++ A+ GKK    
Sbjct  51   PAELKMVSWLEVTGSFDKIEPGKTYRIGFKISFKPDA--TGWDKAPVFMSAKIGKKGKTV  108

Query  405  WKKF-VLSNVTG--KGSEREIGL----------VIDKVASNDDEDKKLYFGLYDIWSGKL  545
            WK+   +S   G  KG    + +          ++   A N  +D KL FGLY++W+G+ 
Sbjct  109  WKRIKSVSQNFGILKGGSEPVNIPDESDGLFEILVSPTALN--QDTKLQFGLYEVWTGRW  166

Query  546  KKGLAIHYASVQEI  587
            K GL IH A VQE+
Sbjct  167  KTGLLIHEAFVQEV  180



>ref|XP_011040382.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Populus euphratica]
Length=203

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 82/141 (58%), Gaps = 16/141 (11%)
 Frame = +3

Query  198  WKWESS------GEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENI  359
            WK ES       G+  A L+ +V WL+V+GE  V   K YEV F +S+  E+S   W++ 
Sbjct  49   WKEESQYWSIPEGDGPAELL-EVCWLDVSGEMPVTKGKAYEVSFMLSMNTENS-FGWDDH  106

Query  360  PLYVMARRGKKRDYCWKKFVLSNVTGKGSE----REIGLVIDKVASNDDEDKKLYFGLYD  527
             + VMAR GK+ +Y  +K  LS ++G+  E     +  +  DK + +++    LYFGLY+
Sbjct  107  -VTVMARIGKEGEYQREKIDLSKLSGEVKEFPPDHKCRVESDKKSGSNE---TLYFGLYE  162

Query  528  IWSGKLKKGLAIHYASVQEIP  590
            +W+ K K GL IH A VQEIP
Sbjct  163  VWTNKWKGGLRIHEAIVQEIP  183



>ref|XP_004157740.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Cucumis sativus]
Length=179

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 87/170 (51%), Gaps = 18/170 (11%)
 Frame = +3

Query  108  VDKNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSG----EEAAALVSKVIWLEVTGEK  275
            + K      YPR L  +        + N  W++  S      ++   + +V WLEVT   
Sbjct  18   ITKGGKMIFYPRALTITWG------NDNRYWRFLPSTNLKDPKSVVQLLQVSWLEVTCST  71

Query  276  E-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSER  452
            + V+  + Y+V F VSL+ ++    W+++ +++MA+ GKK  Y +KK       G  S++
Sbjct  72   DKVEAGQTYKVGFNVSLQPDA--FGWDDVEVFIMAKVGKKGTYFFKKTSFGKRLGTSSKK  129

Query  453  ----EIGLVIDKVASNDDE-DKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
                + GL I  VA      D  LYFGLY++WSGK K GL IH A V+++
Sbjct  130  FSVPDEGLEIKIVAPQSSPGDCSLYFGLYEVWSGKWKGGLQIHDAFVEKV  179



>ref|XP_004145476.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Cucumis sativus]
Length=141

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 75/128 (59%), Gaps = 8/128 (6%)
 Frame = +3

Query  222  EAAALVSKVIWLEVTGEKE-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRD  398
            ++A  + +V WLEVT   + V+  + Y+V F VSL+ ++    W+++ +++MA+ GKK  
Sbjct  16   KSAVQLLQVSWLEVTCSTDKVEAGQTYKVGFNVSLQPDA--FGWDDVEVFIMAKVGKKGT  73

Query  399  YCWKKFVLSNVTGKGSER----EIGLVIDKVASNDDE-DKKLYFGLYDIWSGKLKKGLAI  563
            Y +KK       G  S++    + GL I  VA      D  LYFGLY++WSGK K GL I
Sbjct  74   YFFKKTSFGKRLGTSSKKFSVPDEGLEIKIVAPQSSPGDCSLYFGLYEVWSGKWKGGLQI  133

Query  564  HYASVQEI  587
            H A V+++
Sbjct  134  HDAFVEKV  141



>ref|XP_011000216.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X2 [Populus 
euphratica]
Length=279

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 74/131 (56%), Gaps = 5/131 (4%)
 Frame = +3

Query  204  WESSGEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARR  383
            W  S  +  A + +V WL+VTG       K YE+ F +S+ E++S   WE+ P+YVMAR 
Sbjct  97   WTISERDGPAELQEVCWLDVTGSMTATKGKAYEISFILSMNEKNS-FGWED-PVYVMARI  154

Query  384  GKKRDYCWKKFVLSNVTGKGSE-REIGLVIDKVASNDDEDKK--LYFGLYDIWSGKLKKG  554
            G+K +Y   K  LS +  K  E  E    +D  +  + E+ K  LYFGLY++W+   K G
Sbjct  155  GEKGEYTRVKIDLSKLGLKEEEFPEEKCRVDFRSDENSENNKKTLYFGLYEVWTNHWKGG  214

Query  555  LAIHYASVQEI  587
            L IH A V+E+
Sbjct  215  LRIHEAIVREV  225



>ref|XP_011000215.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X1 [Populus 
euphratica]
Length=281

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 84/157 (54%), Gaps = 11/157 (7%)
 Frame = +3

Query  126  TRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGEKEVDPTKKYEV  305
            T   P+ L+    FS +E  +   W    S  +  A + +V WL+VTG       K YE+
Sbjct  79   TTFKPKNLSI---FSEEESQA---WTISESYRDGPAELQEVCWLDVTGSMTATKGKAYEI  132

Query  306  KFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSE-REIGLVIDKVA  482
             F +S+ E++S   WE+ P+YVMAR G+K +Y   K  LS +  K  E  E    +D  +
Sbjct  133  SFILSMNEKNS-FGWED-PVYVMARIGEKGEYTRVKIDLSKLGLKEEEFPEEKCRVDFRS  190

Query  483  SNDDEDKK--LYFGLYDIWSGKLKKGLAIHYASVQEI  587
              + E+ K  LYFGLY++W+   K GL IH A V+E+
Sbjct  191  DENSENNKKTLYFGLYEVWTNHWKGGLRIHEAIVREV  227



>ref|XP_009611544.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Nicotiana tomentosiformis]
Length=168

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 78/156 (50%), Gaps = 22/156 (14%)
 Frame = +3

Query  120  NATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGEKE-VDPTKK  296
            N   IYP  LN            +G +     G+E A LV +V WLEVTG  + V+P   
Sbjct  18   NGFEIYPSALNIIW-------GKDGRYWKLLQGKEPAELV-QVSWLEVTGYCDKVEPNVT  69

Query  297  YEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDK  476
            Y+VKF++ L  ++    W ++P+Y MA+ G      WKK    N+T  G     G+ +  
Sbjct  70   YDVKFQLKLTPDA--FGWNDLPIYFMAKSGSGS--LWKKL---NLTKDGPTNSDGIYVVP  122

Query  477  ------VASNDDEDKKLYFGLYDIWSGKLKKGLAIH  566
                  V    +++ KLYFGLY++WSGK K GL I 
Sbjct  123  NNLTVTVGQAGNDENKLYFGLYEVWSGKWKGGLVIQ  158



>ref|XP_011011257.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X2 [Populus 
euphratica]
Length=288

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 94/196 (48%), Gaps = 22/196 (11%)
 Frame = +3

Query  27   KAATPEAPADPAKSGTEAKSASTLVNGVDKNNATRIYPRKLNFSLKFSLDEESSNGNWKW  206
            KA++      P     E  +   L  G D        P+ L+    FS +E  +   W  
Sbjct  13   KASSDSQQPSPNNENPETDTEPALSQGADGKTTLTFKPKHLSI---FSEEERQA---WTI  66

Query  207  ESSGE-EAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARR  383
                E +  A + +V WL+VTG       K YE+ F +S+ E++S   WE+ P+YVMAR 
Sbjct  67   SKISERDVTADMLEVCWLDVTGSMTATKGKAYEISFILSMNEKNS-FGWED-PVYVMARI  124

Query  384  GKKRDYCWKKFVLSNVTGKGSERE--------IGLVIDKVASNDDEDKKLYFGLYDIWSG  539
            G++ +Y   +  LS +   G E+E        +    D+   N+   KKLYFGLY++W+ 
Sbjct  125  GEEGEYSRVQIDLSKL---GHEKEEFPAEKCRVEFRSDENTENNK--KKLYFGLYEVWTN  179

Query  540  KLKKGLAIHYASVQEI  587
              K GL IH A V+E+
Sbjct  180  NWKGGLRIHEAIVREL  195



>ref|XP_002891125.1| hypothetical protein ARALYDRAFT_336533 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67384.1| hypothetical protein ARALYDRAFT_336533 [Arabidopsis lyrata subsp. 
lyrata]
Length=1333

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 49/136 (36%), Positives = 73/136 (54%), Gaps = 14/136 (10%)
 Frame = +3

Query  216   GEEAAALVSKVIWLEVTG-EKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKK  392
             G    A +  V WLEVTG  ++++P K Y + FK+S K ++  T W+  PL++ A+ GKK
Sbjct  1200  GFRMPAELKMVSWLEVTGCFEKIEPAKTYRIGFKISFKTDA--TGWDEAPLFMSAKIGKK  1257

Query  393   RDYCWKKFVLSNVT-GK---GSE-------REIGLVIDKVASNDDEDKKLYFGLYDIWSG  539
                 WK+    N   GK   GSE        +    I    ++ ++D  L FGLY++W+G
Sbjct  1258  GKTVWKRIKSVNQNFGKLIDGSEPINIPDESDGQFEISVSPASLNQDTMLQFGLYEVWTG  1317

Query  540   KLKKGLAIHYASVQEI  587
             + K GL IH A V E+
Sbjct  1318  RWKTGLLIHEAFVHEV  1333



>ref|NP_001265911.1| protein PHLOEM PROTEIN 2-LIKE A9-like [Cicer arietinum]
 emb|CAB71030.1| lectin-like protein [Cicer arietinum]
Length=168

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 76/126 (60%), Gaps = 10/126 (8%)
 Frame = +3

Query  222  EAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDY  401
            E +A + +V WLEV+G+ +VD    Y VKF V++KE      W+N  + VMA+ GKK  Y
Sbjct  46   EQSAELLQVSWLEVSGKVKVDKGNSYLVKFDVTVKENGFG--WDNTDVLVMAKIGKKGPY  103

Query  402  CWK----KFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHY  569
             +K    K V S V    ++ ++ + +D+     ++D +L+FGLY++WSGK K GL I+ 
Sbjct  104  KFKAVNLKCVTSGVIIPPNDNQLKIEVDQ----HEKDLELHFGLYEVWSGKWKGGLIINK  159

Query  570  ASVQEI  587
            A V ++
Sbjct  160  AEVVKV  165



>ref|XP_011000217.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X3 [Populus 
euphratica]
Length=229

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 72/125 (58%), Gaps = 5/125 (4%)
 Frame = +3

Query  222  EAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDY  401
            +  A + +V WL+VTG       K YE+ F +S+ E++S   WE+ P+YVMAR G+K +Y
Sbjct  53   DGPAELQEVCWLDVTGSMTATKGKAYEISFILSMNEKNS-FGWED-PVYVMARIGEKGEY  110

Query  402  CWKKFVLSNVTGKGSE-REIGLVIDKVASNDDEDKK--LYFGLYDIWSGKLKKGLAIHYA  572
               K  LS +  K  E  E    +D  +  + E+ K  LYFGLY++W+   K GL IH A
Sbjct  111  TRVKIDLSKLGLKEEEFPEEKCRVDFRSDENSENNKKTLYFGLYEVWTNHWKGGLRIHEA  170

Query  573  SVQEI  587
             V+E+
Sbjct  171  IVREV  175



>ref|XP_002892550.1| hypothetical protein ARALYDRAFT_312058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68809.1| hypothetical protein ARALYDRAFT_312058 [Arabidopsis lyrata subsp. 
lyrata]
Length=185

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 77/138 (56%), Gaps = 19/138 (14%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGEKE-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            +   A + KV WLEVTG  + ++P K Y++ FK+SL  ++  T W   P+++ A+ GKK 
Sbjct  52   DRTPAELKKVSWLEVTGSYDKIEPGKTYQIGFKISLTADA--TGWYQAPVFMSAKIGKKG  109

Query  396  DYCWKKF--VLSNVTG-KGSEREIGL-----------VIDKVASNDDEDKKLYFGLYDIW  533
               WK+   + +N+   KG    + +           V  KVA N  +D KL FGLY++W
Sbjct  110  KTIWKRIKSINNNIEKLKGGTGPVNIPDETDGRFEVFVSPKVAIN--QDTKLQFGLYEVW  167

Query  534  SGKLKKGLAIHYASVQEI  587
            +GK K GL I+ A V+E+
Sbjct  168  TGKWKTGLLIYEAFVEEV  185



>ref|XP_006417490.1| hypothetical protein EUTSA_v10008847mg [Eutrema salsugineum]
 gb|ESQ35843.1| hypothetical protein EUTSA_v10008847mg [Eutrema salsugineum]
Length=184

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 75/138 (54%), Gaps = 19/138 (14%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            +   A +  V WLEVTG   +V+P K Y + FK+S   ++  T WE  P+++ A+ GKK 
Sbjct  51   DRTPAELKMVSWLEVTGSFDKVEPGKTYRIGFKISFTADA--TGWEQAPVFMSAKIGKKG  108

Query  396  DYCWKKF--VLSNVTG-KGSEREIGL-----------VIDKVASNDDEDKKLYFGLYDIW  533
               WK+   V +N+   KG    + +           V   VA N  ++ KL FGLY++W
Sbjct  109  RTVWKRIKSVNNNIKKLKGGTEPVNIPDETDGRFEIFVSPTVAIN--QETKLQFGLYEVW  166

Query  534  SGKLKKGLAIHYASVQEI  587
            +GK KKGL I+ A VQE+
Sbjct  167  TGKWKKGLLIYEAFVQEV  184



>ref|XP_006389197.1| hypothetical protein POPTR_0036s00270g [Populus trichocarpa]
 gb|ERP48111.1| hypothetical protein POPTR_0036s00270g [Populus trichocarpa]
Length=142

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 68/118 (58%), Gaps = 5/118 (4%)
 Frame = +3

Query  243  KVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVL  422
            +V WL+VTG       K YE+ F +S+ EE+S   WE+ P+YVMAR G++ +Y   K  L
Sbjct  3    EVCWLDVTGSMTATKGKAYEISFILSMNEENSFG-WED-PVYVMARIGEEGEYTRVKIDL  60

Query  423  SNVTGKGSEREIGLVIDKVASNDDE---DKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
            S +  K  E        +  S ++    +KKLYFGLY++W+   K GL IH A V+E+
Sbjct  61   SKLGLKEEEFPAEKCRVEFRSGENAKSIEKKLYFGLYEVWTNNWKGGLRIHEAIVREL  118



>gb|KFK44915.1| hypothetical protein AALP_AA1G319400 [Arabis alpina]
Length=176

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 71/134 (53%), Gaps = 18/134 (13%)
 Frame = +3

Query  228  AALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYC  404
             A + +V WLEVTG   +++P K Y++ FK+S   ++  T W+  P+++ A+ GKK    
Sbjct  47   PAELKRVSWLEVTGSFDKLEPGKTYQIGFKISFTPDA--TGWDESPVFMSAKIGKKGKTV  104

Query  405  WKKFVLSNVTG----KGSER---------EIGLVIDKVASNDDEDKKLYFGLYDIWSGKL  545
            WK+    N        GSE             + +    +N  +D KL FGLY++W+G+ 
Sbjct  105  WKRIKSINQNSCKQKDGSEPVNIPDETDGRFEITVSPTVAN--QDTKLQFGLYEVWTGRW  162

Query  546  KKGLAIHYASVQEI  587
            K GL IH A VQE+
Sbjct  163  KTGLLIHEAFVQEM  176



>ref|XP_008350620.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Malus domestica]
Length=180

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 67/125 (54%), Gaps = 9/125 (7%)
 Frame = +3

Query  228  AALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCW  407
             A + +V WLEVTG   + PTK Y++ F V L   +    W +I  ++MA+ GK+  Y W
Sbjct  55   PAELKQVSWLEVTGSVSLIPTKTYQISFDVELTPCA--FGWRDIQAFLMAKVGKRGKYKW  112

Query  408  KKFVLSNVTGKG-----SEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYA  572
             K  +      G      +    L I+ + ++   D  L+FGLY+IWSGK K GL IH A
Sbjct  113  TKVKVVQDPNVGRFTIPDKTSPPLRIEVLPAS--VDNMLHFGLYEIWSGKWKGGLKIHQA  170

Query  573  SVQEI  587
            +V E+
Sbjct  171  NVTEV  175



>ref|XP_006303203.1| hypothetical protein CARUB_v10011154mg [Capsella rubella]
 gb|EOA36101.1| hypothetical protein CARUB_v10011154mg [Capsella rubella]
Length=180

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 67/132 (51%), Gaps = 14/132 (11%)
 Frame = +3

Query  228  AALVSKVIWLEVTGEKE-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYC  404
             A +  V WLEVTG  E ++P K Y++ FK+S K ++  T W+  P+ + A+ GKK    
Sbjct  51   PAELKMVSWLEVTGSFEKIEPGKTYQIGFKISFKPDA--TGWDKAPICMSAKIGKKGKTM  108

Query  405  WKKF-----------VLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKK  551
            WK+            V S       E +    I    +   +D KL FGLY++W+G+ K 
Sbjct  109  WKRIKSVQQNFGKLKVGSEPVNIPDESDGRFEISVSPTTLTQDTKLQFGLYEVWTGRWKT  168

Query  552  GLAIHYASVQEI  587
            GL IH A V E+
Sbjct  169  GLLIHEAFVHEV  180



>ref|XP_006417491.1| hypothetical protein EUTSA_v10008847mg [Eutrema salsugineum]
 gb|ESQ35844.1| hypothetical protein EUTSA_v10008847mg [Eutrema salsugineum]
Length=192

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 74/134 (55%), Gaps = 19/134 (14%)
 Frame = +3

Query  231  ALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCW  407
            A +  V WLEVTG   +V+P K Y + FK+S   ++  T WE  P+++ A+ GKK    W
Sbjct  63   AELKMVSWLEVTGSFDKVEPGKTYRIGFKISFTADA--TGWEQAPVFMSAKIGKKGRTVW  120

Query  408  KKF--VLSNVTG-KGSEREIGL-----------VIDKVASNDDEDKKLYFGLYDIWSGKL  545
            K+   V +N+   KG    + +           V   VA N  ++ KL FGLY++W+GK 
Sbjct  121  KRIKSVNNNIKKLKGGTEPVNIPDETDGRFEIFVSPTVAIN--QETKLQFGLYEVWTGKW  178

Query  546  KKGLAIHYASVQEI  587
            KKGL I+ A VQE+
Sbjct  179  KKGLLIYEAFVQEV  192



>ref|NP_683296.1| phloem protein 2-A10 [Arabidopsis thaliana]
 gb|AEE28548.1| phloem protein 2-A10 [Arabidopsis thaliana]
Length=184

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 48/138 (35%), Positives = 72/138 (52%), Gaps = 19/138 (14%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGEKE-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            +   A + KV WLEVTG  + ++P K Y + FK+S   ++  T W+  P+++ A+ GKK 
Sbjct  51   DRTPAELKKVSWLEVTGSYDKIEPGKTYRIGFKISFTADA--TGWDQAPVFMSAKIGKKG  108

Query  396  DYCWKKFV--------------LSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIW  533
               WK+                  N+  +   R    V  KVA N  +D KL FGLY++W
Sbjct  109  RTIWKRIKSVNNNFDKLKGGTGPVNIPDETDGRFEIFVSPKVAIN--QDTKLQFGLYEVW  166

Query  534  SGKLKKGLAIHYASVQEI  587
            +GK K GL I+ A V+E+
Sbjct  167  TGKWKTGLLIYEAFVEEV  184



>ref|XP_004170701.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform 3 [Cucumis 
sativus]
Length=154

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 3/124 (2%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            E++ A   KV WLEV    K   P   Y++ F +SL  ++    W++ P+++MA+ G+  
Sbjct  33   EQSYAEAIKVTWLEVKATYKGAKPGSHYKIGFNISLNSDA--FGWDSSPVFMMAKVGESG  90

Query  396  DYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYAS  575
             Y WK+   + +    S        +       +D  L+FGLY+IW G+ K GL IH+A 
Sbjct  91   YYTWKRIYFNIIEAGKSPINFPSNFEISVPVSAKDTTLFFGLYEIWGGRWKGGLRIHHAF  150

Query  576  VQEI  587
            V +I
Sbjct  151  VTKI  154



>ref|XP_004170700.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform 2 [Cucumis 
sativus]
Length=160

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 3/124 (2%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            E++ A   KV WLEV    K   P   Y++ F +SL  ++    W++ P+++MA+ G+  
Sbjct  39   EQSYAEAIKVTWLEVKATYKGAKPGSHYKIGFNISLNSDA--FGWDSSPVFMMAKVGESG  96

Query  396  DYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYAS  575
             Y WK+   + +    S        +       +D  L+FGLY+IW G+ K GL IH+A 
Sbjct  97   YYTWKRIYFNIIEAGKSPINFPSNFEISVPVSAKDTTLFFGLYEIWGGRWKGGLRIHHAF  156

Query  576  VQEI  587
            V +I
Sbjct  157  VTKI  160



>ref|XP_004231580.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 [Solanum lycopersicum]
Length=169

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 78/158 (49%), Gaps = 17/158 (11%)
 Frame = +3

Query  129  RIYPRKLNFSLKFSLDEESSNGNWKWESSGEEA-AALVSKVIWLEVTGEKE-VDPTKKYE  302
            RIYP   N            +G + W+S  EE   A + +V WLEVTG  + V+   KYE
Sbjct  22   RIYPSAFNIVW-------GKDGRY-WKSPKEEKDPATLVQVSWLEVTGLCDKVEKDTKYE  73

Query  303  VKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLS---NVTGKGSEREIGLVID  473
            VKFKV L  +S    +  +PLY M + G K+   WKK  L+   NV   GS      +  
Sbjct  74   VKFKVKLTPDS--FGFNELPLYFMVKYGSKQS--WKKIYLTKDANVESNGSYVGPNNLTI  129

Query  474  KVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
                +   D  L FGLY++WSGK K GL I    +Q++
Sbjct  130  TTTDSRSGDSNLCFGLYEVWSGKWKGGLIIEEVIIQKM  167



>ref|XP_004170699.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform 1 [Cucumis 
sativus]
Length=161

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 3/124 (2%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            E++ A   KV WLEV    K   P   Y++ F +SL  ++    W++ P+++MA+ G+  
Sbjct  40   EQSYAEAIKVTWLEVKATYKGAKPGSHYKIGFNISLNSDA--FGWDSSPVFMMAKVGESG  97

Query  396  DYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYAS  575
             Y WK+   + +    S        +       +D  L+FGLY+IW G+ K GL IH+A 
Sbjct  98   YYTWKRIYFNIIEAGKSPINFPSNFEISVPVSAKDTTLFFGLYEIWGGRWKGGLRIHHAF  157

Query  576  VQEI  587
            V +I
Sbjct  158  VTKI  161



>ref|XP_004134525.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform 2 [Cucumis 
sativus]
Length=165

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 3/124 (2%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            E++ A   KV WLEV    K   P   Y++ F +SL  ++    W++ P+++MA+ G+  
Sbjct  44   EQSYAEAIKVTWLEVKATYKGAKPGSHYKIGFNISLNSDA--FGWDSSPVFMMAKVGESG  101

Query  396  DYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYAS  575
             Y WK+   + +    S        +       +D  L+FGLY+IW G+ K GL IH+A 
Sbjct  102  YYTWKRIYFNIIEAGKSPINFPSNFEISVPVSAKDTTLFFGLYEIWGGRWKGGLRIHHAF  161

Query  576  VQEI  587
            V +I
Sbjct  162  VTKI  165



>ref|XP_004134524.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform 1 [Cucumis 
sativus]
Length=171

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 3/124 (2%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            E++ A   KV WLEV    K   P   Y++ F +SL  ++    W++ P+++MA+ G+  
Sbjct  50   EQSYAEAIKVTWLEVKATYKGAKPGSHYKIGFNISLNSDA--FGWDSSPVFMMAKVGESG  107

Query  396  DYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYAS  575
             Y WK+   + +    S        +       +D  L+FGLY+IW G+ K GL IH+A 
Sbjct  108  YYTWKRIYFNIIEAGKSPINFPSNFEISVPVSAKDTTLFFGLYEIWGGRWKGGLRIHHAF  167

Query  576  VQEI  587
            V +I
Sbjct  168  VTKI  171



>ref|XP_010490747.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 [Camelina sativa]
Length=184

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 72/138 (52%), Gaps = 19/138 (14%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGEKE-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            +   A +  V WLEVTG  + ++P K Y + FK+SL  ++  T W+  P+++ A+ GKK 
Sbjct  51   DRTPAELKMVSWLEVTGSYDKIEPGKTYRIGFKISLTADA--TGWDQAPVFMSAKIGKKG  108

Query  396  DYCWKKFVLSNVTGKGSEREIGLVIDKVASNDD--------------EDKKLYFGLYDIW  533
               WK+    N   +  +R  G V   +  + D              +D KL FGLY++W
Sbjct  109  KTIWKRIKSLNNNIEKLKRRTGPV--NIPDDTDGRFEVFVSPNITINQDTKLQFGLYEVW  166

Query  534  SGKLKKGLAIHYASVQEI  587
            +GK K GL I+ A V+E+
Sbjct  167  TGKWKTGLLIYEAFVEEV  184



>ref|XP_007024912.1| Phloem protein 2, putative isoform 2, partial [Theobroma cacao]
 gb|EOY27534.1| Phloem protein 2, putative isoform 2, partial [Theobroma cacao]
Length=164

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 66/113 (58%), Gaps = 9/113 (8%)
 Frame = +3

Query  210  SSGEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGK  389
            ++ +E A LV +V WLEVTG  +++ +K Y+V F +S KE +S   W   P+++MA+ GK
Sbjct  57   NNNDEVAELV-QVSWLEVTGVAKLENSKTYQVTFTLSFKENAS--GWSGCPVFLMAKVGK  113

Query  390  KRDYCWKKF----VLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWS  536
            K  Y WK+      L  V  +        +++    +D  DK+LYFGLY++WS
Sbjct  114  KGKYKWKRLKELESLPKVPTEVPSNSEPFLVE--VPDDVPDKRLYFGLYEVWS  164



>ref|XP_002322365.2| hypothetical protein POPTR_0015s15610g [Populus trichocarpa]
 gb|EEF06492.2| hypothetical protein POPTR_0015s15610g [Populus trichocarpa]
Length=178

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 52/147 (35%), Positives = 77/147 (52%), Gaps = 27/147 (18%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRD  398
            ++  A + +V WL+V+GE  V   K YEV F +S+  ++S   W++ P+ VMAR GK+  
Sbjct  27   DDGFAELLEVCWLDVSGEMPVTKGKTYEVSFMLSMNTKNS-FGWDD-PVTVMARIGKEGK  84

Query  399  YCWKKFVLSNVTGKGSER-----------------------EIGLVIDKVASNDDEDKKL  509
            Y  K+  L +++ +  ER                       +     D+ A ND+E   L
Sbjct  85   YQRKEIKLLDLSKEVEERPSDKCRVEFEKSESKEEPREKKSQTKSKSDENAKNDEE--TL  142

Query  510  YFGLYDIWSGKLKKGLAIHYASVQEIP  590
            YFGLY++W+ K K GL IH A VQEIP
Sbjct  143  YFGLYEVWTNKWKGGLRIHEAIVQEIP  169



>gb|KGN49533.1| hypothetical protein Csa_6G538620 [Cucumis sativus]
Length=199

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 3/124 (2%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            E++ A   KV WLEV    K   P   Y++ F +SL  ++    W++ P+++MA+ G+  
Sbjct  78   EQSYAEAIKVTWLEVKATYKGAKPGSHYKIGFNISLNSDA--FGWDSSPVFMMAKVGESG  135

Query  396  DYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYAS  575
             Y WK+   + +    S        +       +D  L+FGLY+IW G+ K GL IH+A 
Sbjct  136  YYTWKRIYFNIIEAGKSPINFPSNFEISVPVSAKDTTLFFGLYEIWGGRWKGGLRIHHAF  195

Query  576  VQEI  587
            V +I
Sbjct  196  VTKI  199



>ref|XP_009780355.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Nicotiana sylvestris]
Length=168

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 76/156 (49%), Gaps = 22/156 (14%)
 Frame = +3

Query  120  NATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE-KEVDPTKK  296
            N   IYP  LN  + +  D       WK    G+E A LV +V WLEVTG   +V+P   
Sbjct  18   NGFEIYPSGLN--IIWGQDARY----WK-LPQGKEPAELV-QVSWLEVTGYCDQVEPNVT  69

Query  297  YEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDK  476
            Y+VKF++ L  ++    W ++P+Y M + G      WKK    N+T        G+ +  
Sbjct  70   YDVKFQLKLTPDA--FGWNDLPIYFMVKSGSGS--LWKKL---NLTKDAPTNSDGIYVVP  122

Query  477  ------VASNDDEDKKLYFGLYDIWSGKLKKGLAIH  566
                  V    ++   LYFGLY++WSGK K GL I 
Sbjct  123  NNLTVTVGKGGNDGNNLYFGLYEVWSGKWKGGLVIQ  158



>ref|XP_004293747.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=175

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 71/139 (51%), Gaps = 25/139 (18%)
 Frame = +3

Query  207  ESSGEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRG  386
            E+ G++   L+ +V WLEVTG  +     KY++ F V L  ++    W++I +++MA+ G
Sbjct  47   ETDGDKPVELL-QVSWLEVTGSVDGLRPGKYKLTFDVKLTADAF--GWKDIQVFLMAKVG  103

Query  387  KKRDYCWKKFVLSNVTGKGSEREIGLVIDKVA------------SNDDEDKKLYFGLYDI  530
            KK  Y W +  L            GL  DKV+             ND  D  L+FGLY++
Sbjct  104  KKGKYKWARVKLDQ----------GLNTDKVSIPADTQKLKIEVPNDTTDNTLHFGLYEV  153

Query  531  WSGKLKKGLAIHYASVQEI  587
            WSGK K GL I+ A V  I
Sbjct  154  WSGKWKGGLEIYNAKVTAI  172



>ref|XP_006305679.1| hypothetical protein CARUB_v10010397mg [Capsella rubella]
 gb|EOA38577.1| hypothetical protein CARUB_v10010397mg [Capsella rubella]
Length=185

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 71/127 (56%), Gaps = 19/127 (15%)
 Frame = +3

Query  252  WLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKF--VL  422
            WLEVTG   +++P K Y + FK+S    S  T W+  P+++ A+ GKK    WK+   V 
Sbjct  63   WLEVTGSYNKIEPGKTYRIGFKISFT--SDATGWDQAPVFMSAKVGKKGKTVWKRIKSVN  120

Query  423  SNVTG-KGSEREIGL-----------VIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIH  566
            +N+   KG    + +           V  KVA N  +D +L FGLY++W+GK KKGL ++
Sbjct  121  NNIEKLKGGTGPVNIPDETDGRFEVFVSPKVAIN--QDTELQFGLYEVWTGKWKKGLLVY  178

Query  567  YASVQEI  587
             A V+E+
Sbjct  179  EAFVEEV  185



>gb|KFK27836.1| hypothetical protein AALP_AA8G436300 [Arabis alpina]
Length=184

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 75/138 (54%), Gaps = 19/138 (14%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            +   A +  V WLEVTG   +++P K Y + FK+S   ++  T W+  P+++ A+ GKK 
Sbjct  51   DRTPAELKMVSWLEVTGSFDKIEPGKTYRIGFKISFTGDA--TGWDQAPVFMSAKIGKKG  108

Query  396  DYCWKKF--VLSNVTG-KGSEREIGL-----------VIDKVASNDDEDKKLYFGLYDIW  533
               WK+   V +N+   KG    + +           V  KVA    +D KL FGLY++W
Sbjct  109  KTIWKRIKSVNNNIEKLKGGTEPVNIPDETDGRLEIFVSTKVAIT--QDTKLQFGLYEVW  166

Query  534  SGKLKKGLAIHYASVQEI  587
            +GK KKGL I+ A V+E+
Sbjct  167  TGKWKKGLLIYEAFVEEV  184



>emb|CDX93454.1| BnaA06g05940D [Brassica napus]
Length=188

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 71/138 (51%), Gaps = 19/138 (14%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            +   A +  V WLEVTG   +V+P K Y + FK+S   ++  T W+  P+++ A+ GKK 
Sbjct  51   DRTPAELKMVSWLEVTGSFDKVEPGKTYRLGFKISFTGDA--TGWDKAPVFMSAKVGKKG  108

Query  396  DYCWKKFVLSNVTGKGSEREIGLVIDKVASNDD--------------EDKKLYFGLYDIW  533
               WK+  + ++     + + G     +    D              +D KL FGLY++W
Sbjct  109  KTIWKR--IKSINTNFEKLKSGTTPVNIPDETDGRFEIFVSPTEPITQDTKLQFGLYEVW  166

Query  534  SGKLKKGLAIHYASVQEI  587
            +GK K GL I+ ASVQE+
Sbjct  167  TGKWKSGLLIYDASVQEV  184



>gb|AFK44791.1| unknown [Lotus japonicus]
Length=165

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 76/160 (48%), Gaps = 12/160 (8%)
 Frame = +3

Query  111  DKNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGEKEVDPT  290
            D N    I PR LN            N +  W+ + +  A L+ +V WLEVTG   V   
Sbjct  18   DDNGGYIIEPRGLNIVW--------GNDDRYWKVTNQGPAELI-QVSWLEVTGLVNVQKN  68

Query  291  KKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVI  470
            K Y V F V +KE+     W+   + VMA+ GK   Y ++   L+           G + 
Sbjct  69   KTYSVTFDVKVKEDGY--GWKGTDVLVMAKLGKNGKYLYETANLTPGEKLTVPPRPGGLE  126

Query  471  DKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP  590
             KV SN  E  +L+FGLY++WSGK K GL I  A V  +P
Sbjct  127  IKVDSNTTE-TQLHFGLYEVWSGKWKGGLEIIKARVIAMP  165



>ref|XP_004293746.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=183

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 71/139 (51%), Gaps = 25/139 (18%)
 Frame = +3

Query  207  ESSGEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRG  386
            E+ G++   L+ +V WLEVTG  +     KY++ F V L  ++    W++I +++MA+ G
Sbjct  55   ETDGDKPVELL-QVSWLEVTGSVDGLRPGKYKLTFDVKLTADAF--GWKDIQVFLMAKVG  111

Query  387  KKRDYCWKKFVLSNVTGKGSEREIGLVIDKVA------------SNDDEDKKLYFGLYDI  530
            KK  Y W +  L            GL  DKV+             ND  D  L+FGLY++
Sbjct  112  KKGKYKWARVKLDQ----------GLNTDKVSIPADTQKLKIEVPNDTTDNTLHFGLYEV  161

Query  531  WSGKLKKGLAIHYASVQEI  587
            WSGK K GL I+ A V  I
Sbjct  162  WSGKWKGGLEIYNAKVTAI  180



>ref|XP_010475875.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Camelina sativa]
Length=184

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 72/138 (52%), Gaps = 19/138 (14%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGEKE-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            +   A +  V WLEVTG  + ++P K Y + FK+SL  ++  T W+  P+++ A+ GKK 
Sbjct  51   DRTPAELKMVSWLEVTGSYDKIEPGKTYRIGFKISLTADA--TGWDQAPVFMSAKIGKKG  108

Query  396  DYCWKKFVLSNVTGKGSEREIGLVIDKVASNDD--------------EDKKLYFGLYDIW  533
               WK+    N   +  +  IG V   +  + D              +D KL FGLY++W
Sbjct  109  KTIWKRIKSLNNNIEKLKAGIGPV--NIPDDTDGRFEVFVSPNITINQDTKLQFGLYEVW  166

Query  534  SGKLKKGLAIHYASVQEI  587
            +GK K GL I+ A V+E+
Sbjct  167  TGKWKTGLLIYEAFVEEV  184



>ref|XP_009148337.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 [Brassica rapa]
Length=188

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 71/138 (51%), Gaps = 19/138 (14%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            +   A +  V WLEVTG   +V+P K Y + FK+S   ++  T W+  P+++ A+ GKK 
Sbjct  51   DRTPAELKMVSWLEVTGSFDKVEPGKTYRLGFKISFTGDA--TGWDKAPVFMSAKVGKKG  108

Query  396  DYCWKKFVLSNVTGKGSEREIGLVIDKVASNDD--------------EDKKLYFGLYDIW  533
               WK+  + ++     + + G     +    D              +D KL FGLY++W
Sbjct  109  KTIWKR--IKSINTNFEKLKSGTSPVNIPDETDGRFEIFVSPTEPITQDTKLQFGLYEVW  166

Query  534  SGKLKKGLAIHYASVQEI  587
            +GK K GL I+ ASVQE+
Sbjct  167  TGKWKSGLLIYDASVQEV  184



>emb|CDX94920.1| BnaC05g07510D [Brassica napus]
Length=188

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/136 (33%), Positives = 68/136 (50%), Gaps = 15/136 (11%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGE-KEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKR  395
            +   A +  V WLEVTG   +V+P K Y + FK+S   ++  T W+  P+++ A+ GKK 
Sbjct  51   DRTPAELKMVSWLEVTGSFDKVEPGKTYRLGFKISFTGDA--TGWDKAPVFMSAKVGKKG  108

Query  396  DYCWKKFVLSNVTG---KGSEREIGL---------VIDKVASNDDEDKKLYFGLYDIWSG  539
               WK+    N      KG    + +         +         +D KL FGLY++W+G
Sbjct  109  KTIWKRIKSINTNFDKIKGGTTPVNIPDETDGRFEIFVSPTEPITQDTKLQFGLYEVWTG  168

Query  540  KLKKGLAIHYASVQEI  587
            K K GL I+ A VQE+
Sbjct  169  KWKSGLLIYDAFVQEV  184



>ref|XP_009353945.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Pyrus x bretschneideri]
 ref|XP_009376388.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 [Pyrus x bretschneideri]
Length=180

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (53%), Gaps = 13/127 (10%)
 Frame = +3

Query  228  AALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTE--WENIPLYVMARRGKKRDY  401
             A + +V WLEVTG   + PTK Y++ F V L    +P    W +I  ++MA+ GK+  Y
Sbjct  55   PAELKQVSWLEVTGSVSLIPTKTYQISFDVEL----TPCAFGWRDIQAFLMAKVGKRGKY  110

Query  402  CWKKFVLSNVTGKG-----SEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIH  566
             W K  +      G      +    L I+ + ++   D  L+FGLY++WS K K GL IH
Sbjct  111  KWTKVKVVQDPNVGRFTIPDKTSPPLRIEVLPAS--VDNMLHFGLYEVWSEKWKGGLKIH  168

Query  567  YASVQEI  587
             A+V E+
Sbjct  169  QANVTEV  175



>ref|XP_011001324.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X2 [Populus 
euphratica]
Length=154

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/144 (31%), Positives = 70/144 (49%), Gaps = 7/144 (5%)
 Frame = +3

Query  114  KNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGE-KEVDPT  290
            K ++ R   +   F++ + LD+      W   + G    A + +V WLE+TG  K+  P 
Sbjct  17   KRDSQRWTFKPRGFNIIWGLDQRY----WNLPAEGTTDPAELVQVCWLELTGTTKDSLPE  72

Query  291  KKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVI  470
             KYE+KFK+ +K  +      N P+++MA+ GK+  Y W K  L           +    
Sbjct  73   GKYEIKFKLEVKPGAFGLS--NSPIFMMAKVGKRGRYKWNKIKLQEKNSDNRTVTVEPTF  130

Query  471  DKVASNDDEDKKLYFGLYDIWSGK  542
                    +D KLYFGLY++W+GK
Sbjct  131  QIEVKRTTDDNKLYFGLYEVWTGK  154



>ref|XP_008466892.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like, partial [Cucumis 
melo]
Length=114

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 67/109 (61%), Gaps = 7/109 (6%)
 Frame = +3

Query  276  EVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVL---SNVTGKGS  446
            +V+  K Y+V F VSL+ ++    W+++ +++MA+ GKK +Y +KK  L   S  T K S
Sbjct  4    KVEAGKTYKVGFNVSLQPDA--FGWDDVEVFIMAKVGKKGNYFFKKTNLGKRSTSTKKFS  61

Query  447  EREIG-LVIDKVASNDDE-DKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
              + G L I+ VA      D  LYFGLY++WSGK K GL IH A V+++
Sbjct  62   VPDEGNLEIEIVAPQSSPGDCGLYFGLYEVWSGKWKGGLQIHDAFVEKV  110



>ref|XP_008780252.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like, partial [Phoenix 
dactylifera]
Length=147

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 80/156 (51%), Gaps = 18/156 (12%)
 Frame = +3

Query  126  TRIYPRKLNFSLKFSLDEESSNGN-WKWESSGEEAAALVSKVIWLEVTGE-KEVDPTKKY  299
             +IYP++L+           S+G  W+   + +    L+ +V WLEVTG  K VD    Y
Sbjct  4    VKIYPKELDIIW-------GSDGRYWRLPENADGPVELL-QVCWLEVTGSLKNVDKNTDY  55

Query  300  EVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKV  479
            +V F VS K ++    W + P+Y+M + G K  Y W+K  LS +  K +   I     K 
Sbjct  56   QVLFNVSTKPDA--FGWSDSPVYLMVKIGDK--YTWQKADLSQL--KKNPDNIPYTPLKF  109

Query  480  ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
                DE  K+ FGLY+IW G+ K GL I++  ++ I
Sbjct  110  KVTGDE--KVSFGLYEIWRGRWKGGLLINHVIIEPI  143



>ref|XP_007138399.1| hypothetical protein PHAVU_009G205500g [Phaseolus vulgaris]
 gb|ESW10393.1| hypothetical protein PHAVU_009G205500g [Phaseolus vulgaris]
Length=143

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 74/160 (46%), Gaps = 23/160 (14%)
 Frame = +3

Query  117  NNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGEKEVDPTKK  296
            N+   I PR LN            N +  W+    E A L+ +V WLEVTG   +   K 
Sbjct  3    NDKFEIGPRGLNIVW--------GNDSRYWKIPENEPAELI-QVSWLEVTGVVPITNPKI  53

Query  297  YEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLS---NVTGKGSEREIGLV  467
            Y V F+V +KE      WE   + VMA+ GKK  Y +K   LS   N+       EI + 
Sbjct  54   YTVSFEVRVKERG--FGWEGTDVLVMAKIGKKGKYKFKVNSLSPGQNIVIPSEPLEIPV-  110

Query  468  IDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
                    +    L+FGLY++WSGK K GL I  A VQ +
Sbjct  111  --------ENPSDLHFGLYEVWSGKWKGGLEIIRAVVQPV  142



>gb|AGV54232.1| lectin [Phaseolus vulgaris]
Length=160

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 74/160 (46%), Gaps = 23/160 (14%)
 Frame = +3

Query  117  NNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGEKEVDPTKK  296
            N+   I PR LN            N +  W+    E A L+ +V WLEVTG   +   K 
Sbjct  20   NDKFEIGPRGLNIVW--------GNDSRYWKIPENEPAELI-QVSWLEVTGVVPITNAKI  70

Query  297  YEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLS---NVTGKGSEREIGLV  467
            Y V F+V +KE      WE   + VMA+ GKK  Y +K   LS   N+       EI + 
Sbjct  71   YTVSFEVRVKERG--FGWEGTDVLVMAKIGKKGKYKFKVNSLSPGQNIVIPSEPLEIPV-  127

Query  468  IDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
                    +    L+FGLY++WSGK K GL I  A VQ +
Sbjct  128  --------ENPSDLHFGLYEVWSGKWKGGLEIIRAVVQPV  159



>ref|XP_004253374.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X1 [Solanum 
lycopersicum]
Length=164

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 73/133 (55%), Gaps = 10/133 (8%)
 Frame = +3

Query  198  WKWESSGEEAAALVSKVIWLEVTGE-KEVDPTKK--YEVKFKVSLKEESSPTEWENIPLY  368
            WK     ++ A L+ +V WLEVTG   +++ TKK  Y ++F +SL  ++    W N P+Y
Sbjct  39   WKLPKYEKDDAELI-QVNWLEVTGCIDDINITKKTSYNIEFTMSLMTDAFG--WNNSPIY  95

Query  369  VMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLK  548
            +MA+ G      W+K  L+  T    ++ I   I  +    +   K+YFGLY++W+ K K
Sbjct  96   LMAKWGDNTQ--WRKVNLA--TKTNDKKMISETITIIKGKGNNTDKIYFGLYEVWNKKWK  151

Query  549  KGLAIHYASVQEI  587
             GL IH  ++ EI
Sbjct  152  GGLKIHSVNLTEI  164



>gb|EYU43687.1| hypothetical protein MIMGU_mgv1a017435mg [Erythranthe guttata]
Length=75

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +3

Query  372  MARRGKKRDYCWKKFVL-SNVTGKGSEREIGLV-IDKVASNDDEDKKLYFGLYDIWSGKL  545
            M +RGK+  + WKKF L +N T K  E    L+  +K   +  +D+++YFGLY++WSGK 
Sbjct  1    MVKRGKEGKFAWKKFFLNTNETNKPFEITGRLIKAEKPLEDSSDDQRVYFGLYEVWSGKW  60

Query  546  KKGLAIHYASVQEIP  590
            K GL IH+A + E P
Sbjct  61   KGGLKIHHAFITESP  75



>ref|XP_009380878.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Musa acuminata 
subsp. malaccensis]
Length=176

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/142 (34%), Positives = 70/142 (49%), Gaps = 14/142 (10%)
 Frame = +3

Query  168  SLDEESSNGNWKWESSGEEAAALVSKVIWLEVTG--EKEV--------DPTKKYEVKFKV  317
            +LD    N    W       +  + +V WLEV+G  +K V        D +K Y +KF+V
Sbjct  29   ALDVTWGNDPRYWSIDKTRGSISLHQVSWLEVSGVFDKSVLDTVNAGLDTSKTYSLKFRV  88

Query  318  SLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDE  497
             +K ++    W   P+Y+M + G  + + WKK  LS +T  G+E  I    DK       
Sbjct  89   KMKADA--FGWSGCPVYLMVKDGDTKKFKWKKVDLSRLTA-GTEVYIPESPDKHTFRPPA  145

Query  498  DKKLYFGLYDIWSGKLKKGLAI  563
            D KL FGL++IW G+ K GL I
Sbjct  146  D-KLTFGLFEIWRGRWKGGLEI  166



>ref|XP_006362597.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Solanum tuberosum]
Length=164

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 83/156 (53%), Gaps = 18/156 (12%)
 Frame = +3

Query  132  IYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGEKE-VDPTKK--YE  302
            IYP+ LN  + +  D+      WK     ++ A L+ +V WLEVTG  + ++  KK  Y+
Sbjct  23   IYPKALN--IVWGTDQRF----WKLPKYEKDGAELI-QVNWLEVTGCIDNINIAKKTSYD  75

Query  303  VKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSN-VTGKGSEREIGLVIDKV  479
            V F VSL  ++    W + P+Y+MA+ G      W K  L+  + GK    +  ++    
Sbjct  76   VGFTVSLMTDAFG--WSDSPVYLMAKWGDNTQ--WTKVNLTTEINGKKMISKTIMITKGK  131

Query  480  ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
             +N D   K+YFGLY++W+ K K GL IH  ++ EI
Sbjct  132  GNNVD---KIYFGLYEVWNKKWKGGLKIHSINLTEI  164



>ref|XP_011040383.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Populus euphratica]
Length=160

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 60/102 (59%), Gaps = 5/102 (5%)
 Frame = +3

Query  291  KKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSE--REIGL  464
            K YE+ F +S+ EE S   WE+ P+YVMAR G+K +Y   K  LS +  K  E   E   
Sbjct  7    KAYEISFILSMNEEKSFG-WED-PVYVMARIGEKGEYTRVKIDLSKLGLKEEEFPEEKCR  64

Query  465  VIDKVASNDDEDKK-LYFGLYDIWSGKLKKGLAIHYASVQEI  587
            V  +   N + +KK LYFGLY++W+   K GL IH A V+E+
Sbjct  65   VDFRSDENSENNKKTLYFGLYEVWTNHWKGGLRIHEAIVREV  106



>gb|ACJ84124.1| unknown [Medicago truncatula]
 gb|AFK38121.1| unknown [Medicago truncatula]
 gb|KEH17284.1| phloem protein [Medicago truncatula]
Length=167

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 66/117 (56%), Gaps = 2/117 (2%)
 Frame = +3

Query  228  AALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCW  407
             A + +V WLEV+G+ +V+    Y VKF V +K++     W +  + VMA+ GKK  Y +
Sbjct  49   CAELIQVSWLEVSGKVKVEKGNTYIVKFMVEVKQDG--FGWGSTDVLVMAKVGKKGLYKY  106

Query  408  KKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASV  578
            +   L     K    E+   ++    +D+ D +L+FGLY++WSGK K GL I+ A V
Sbjct  107  EAVKLDCGKKKDPIPEVKDKLEIEVKSDETDLELHFGLYEVWSGKWKGGLKIYNAEV  163



>ref|XP_008459054.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Cucumis melo]
Length=177

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/184 (28%), Positives = 87/184 (47%), Gaps = 20/184 (11%)
 Frame = +3

Query  57   PAKSGTEAKSASTLVNGVDKNNATRIYPRKLNFSLKFSLDEES---SNGNWKWESSGEEA  227
            P +   E      ++ G+     T++YPR   F++ +  D+     +N N      G   
Sbjct  6    PHREADETAKEKNVIKGI-----TKVYPR--GFNITWGNDDRYWNITNPN----VPGSLY  54

Query  228  AALVSKVIWLEVTGEKE-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYC  404
             A + +V WLEVT   + V+  + Y V F ++++ ++    W+ I +YVMA+ GKK  + 
Sbjct  55   MAELKQVSWLEVTCSTDNVEVGETYRVGFNITMRPDAF--GWDGIDVYVMAKVGKKGKFT  112

Query  405  WKKFVLSNVTGKGSEREIG---LVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYAS  575
              K  L  +    +   I    L I    S   E + ++ GLY++WS K K GL IH A 
Sbjct  113  SMKVSLGEIGPNETPITIPKEPLEIFVAHSTPKECRTIHLGLYEVWSSKWKGGLQIHDAF  172

Query  576  VQEI  587
            + ++
Sbjct  173  IYKV  176



>ref|XP_004157746.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Cucumis sativus]
Length=178

 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 86/172 (50%), Gaps = 15/172 (9%)
 Frame = +3

Query  99   VNGVDKN---NATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTG  269
            +NG +KN     T++YP    F++ +  D+   N   K    G    A + +V WLEVT 
Sbjct  13   INGKEKNFIKGITKVYPT--GFNITWGNDDRYWNIT-KPNVPGSLYVAELKQVSWLEVTC  69

Query  270  EKE-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVL-----SNV  431
              + V+  K Y V F +++K ++    W  I +YVMA+ GKK  +   K  L     +N+
Sbjct  70   STDNVEVGKYYRVGFNITMKPDAF--GWNGIDVYVMAKVGKKGKFTSMKVSLEEIKPNNI  127

Query  432  TGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
                 ++ + + ++ V   ++    ++ GLY++WS K K G+ IH A +  +
Sbjct  128  PITIPKKPLEIFVNPVTP-EECRSTIHLGLYEVWSSKWKGGMQIHDAFIHRV  178



>ref|XP_004145459.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Cucumis sativus]
 gb|KGN66903.1| hypothetical protein Csa_1G708660 [Cucumis sativus]
Length=178

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/172 (28%), Positives = 85/172 (49%), Gaps = 15/172 (9%)
 Frame = +3

Query  99   VNGVDKN---NATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTG  269
            +NG +KN     T++YP    F++ +  D+   N   K    G    A + +V WLEVT 
Sbjct  13   INGKEKNFIKGITKVYPT--GFNITWGNDDRYWNIT-KPNVPGSLYVAELKQVSWLEVTC  69

Query  270  EKE-VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVL-----SNV  431
              + V+  K Y V F +++K ++    W  I +YVMA+ GKK  +   K  L      N+
Sbjct  70   STDNVEVGKYYRVGFNITMKPDAF--GWNGIDVYVMAKVGKKGKFTSMKVSLEEIKPDNI  127

Query  432  TGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
                 ++ + + ++ V   ++    ++ GLY++WS K K G+ IH A +  +
Sbjct  128  PITIPKKPLEIFVNPVTP-EECRSTIHLGLYEVWSSKWKGGMQIHDAFIHRV  178



>ref|XP_010317007.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X1 [Solanum 
lycopersicum]
Length=164

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 72/133 (54%), Gaps = 10/133 (8%)
 Frame = +3

Query  198  WKWESSGEEAAALVSKVIWLEVTGE-KEVDPTKK--YEVKFKVSLKEESSPTEWENIPLY  368
            WK     ++ A L+ ++ WLEVTG   +++  KK  Y ++F +SL  ++    W + P+Y
Sbjct  39   WKLPKYEKDGAELI-QINWLEVTGCIDDINIAKKTLYNIEFTMSLMTDAFG--WNDSPIY  95

Query  369  VMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLK  548
            +MA+ G      W+K  L+  T         + I K   N+ +  K+YFGLY++W+ K K
Sbjct  96   LMAKWGDNTQ--WRKVNLATKTNDKKMISKSITITKGKGNNVD--KIYFGLYEVWNKKWK  151

Query  549  KGLAIHYASVQEI  587
             GL IH  ++ EI
Sbjct  152  GGLKIHSVNIIEI  164



>ref|XP_006362596.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Solanum tuberosum]
Length=164

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 71/133 (53%), Gaps = 10/133 (8%)
 Frame = +3

Query  198  WKWESSGEEAAALVSKVIWLEVTGE-KEVDPTKK--YEVKFKVSLKEESSPTEWENIPLY  368
            WK     ++   LV +V WLEVTG    ++  KK  Y+++F VSL  ++    W + P+Y
Sbjct  39   WKLPKYEKDGIELV-QVNWLEVTGCINNINVVKKASYDIEFTVSLMTDAFG--WRDSPVY  95

Query  369  VMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLK  548
            +MA+ G      W+K  L++           + I K   N+ +  K+YFGLY++W+ K K
Sbjct  96   LMAKWGDNTQ--WRKMNLTSEINSKKMTPKNITITKGKGNNVD--KIYFGLYEVWNKKWK  151

Query  549  KGLAIHYASVQEI  587
             GL IH  ++ EI
Sbjct  152  GGLKIHSVNLTEI  164



>ref|NP_001236140.1| lectin [Glycine max]
 emb|CAB44031.1| lectin [Glycine max]
Length=163

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 49/160 (31%), Positives = 76/160 (48%), Gaps = 16/160 (10%)
 Frame = +3

Query  111  DKNNATRIYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGEKEVDPT  290
            D      I PR LN            N +  W+   + +A L+ +V WLEV+G   +   
Sbjct  18   DDGGKFEIQPRGLNIVW--------GNDSRYWKIPEQRSAELI-QVSWLEVSGVVNLPGV  68

Query  291  KKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVI  470
            KKY V+F+V +K++     W    + VMA+ GK   Y +K   L+     G    I    
Sbjct  69   KKYRVEFEVRVKDDG--FGWSGTDVLVMAKIGKTGKYTYKVTKLN----PGETLNIPKST  122

Query  471  DKVASN-DDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
            D +    + + + L+FGLY++WSGK K GL I  A ++ +
Sbjct  123  DPLEIQVNKQSEDLHFGLYEVWSGKWKGGLEIVRALIKPL  162



>gb|ACU13504.1| unknown [Glycine max]
Length=163

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 7/124 (6%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRD  398
            E+  A + +V WLEV+G   +   KKY V+F+V +K++     W    + VMA+ GK   
Sbjct  45   EQGPAELIQVSWLEVSGVVNLPGVKKYRVEFEVRVKDDG--FGWSGTDVLVMAKIGKTGK  102

Query  399  YCWKKFVLSNVTGKGSEREIGLVIDKVASN-DDEDKKLYFGLYDIWSGKLKKGLAIHYAS  575
            Y +K   L+     G    I    D +    + + + L+FGLY++WSGK K GL I  A 
Sbjct  103  YTYKVTKLN----PGETLNIPKSTDPLEIQVNKQSEDLHFGLYEVWSGKWKGGLEIVRAL  158

Query  576  VQEI  587
            ++ +
Sbjct  159  IKPL  162



>gb|KHN41519.1| Protein PHLOEM PROTEIN 2-LIKE A9 [Glycine soja]
Length=177

 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 7/124 (6%)
 Frame = +3

Query  219  EEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRD  398
            E+  A + +V WLEV+G   +   KKY V+F+V +K++     W    + VMA+ GK   
Sbjct  59   EQGPAELIQVSWLEVSGVVNLPGVKKYRVEFEVRVKDDG--FGWSGTDVLVMAKIGKTGK  116

Query  399  YCWKKFVLSNVTGKGSEREIGLVIDKVASN-DDEDKKLYFGLYDIWSGKLKKGLAIHYAS  575
            Y +K   L+     G    I    D +    + + + L+FGLY++WSGK K GL I  A 
Sbjct  117  YTYKVTKLN----PGETLNIPKSTDPLEIQVNKQSEDLHFGLYEVWSGKWKGGLEIVRAL  172

Query  576  VQEI  587
            ++ +
Sbjct  173  IKPL  176



>ref|XP_002311046.2| hypothetical protein POPTR_0008s02750g [Populus trichocarpa]
 gb|EEE88413.2| hypothetical protein POPTR_0008s02750g [Populus trichocarpa]
Length=129

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 65/120 (54%), Gaps = 22/120 (18%)
 Frame = +3

Query  228  AALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCW  407
            +A + +V WL+V+GE  V   K Y V F +S+  E+S   W+ +P+++MAR G++     
Sbjct  32   SAELLEVCWLDVSGEMRVTKGKTYGVSFMLSMNTENS-FGWD-VPVFLMARIGEE-----  84

Query  408  KKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEI  587
                  N T   S        D+ A N++E   LYF L ++W+ K K GL IH + VQE+
Sbjct  85   -----GNQTKSKS--------DENAKNNEE--TLYFRLNEVWANKWKGGLRIHESEVQEV  129



>ref|XP_010941633.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Elaeis guineensis]
Length=169

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 65/131 (50%), Gaps = 11/131 (8%)
 Frame = +3

Query  204  WESSGEEAAALVSKVIWLEVTGEKEVDPTKK---YEVKFKVSLKEESSPTEWENIPLYVM  374
            W  + +EA  L  +V WLEVTG    +   K   Y+V F V  K ++    W + P+Y+M
Sbjct  42   WRVTQDEAELL--QVCWLEVTGSYPFNRLTKGATYKVTFNVKTKPDAF--GWSDSPVYLM  97

Query  375  ARRGKKRDYCWKKFVLSNV-TGKGSEREIGLVID-KVASNDDEDKKLYFGLYDIWSGKLK  548
             +   K  Y WKK  LS +     +    G  +   V +N  +   L FGLY+IW G+ K
Sbjct  98   VKVDGK--YTWKKADLSQLKNNMETNIPAGTTLTFTVPANAKDQDNLTFGLYEIWRGRWK  155

Query  549  KGLAIHYASVQ  581
             GL I + +++
Sbjct  156  GGLVIKHVTIE  166



>ref|XP_010317009.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X1 [Solanum 
lycopersicum]
Length=169

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 72/134 (54%), Gaps = 12/134 (9%)
 Frame = +3

Query  198  WKWESSGEEAAALVSKVIWLEVTGE-KEVDPTKK--YEVKFKVSLKEESSPTEWENIPLY  368
            WK     ++ A L+ +V WLEVTG   +++  KK  Y ++F +SL  ++    W + P+Y
Sbjct  39   WKLPKDEKDDAELI-QVNWLEVTGCIDDINIAKKTSYNIEFTMSLMIDAFG--WSDSPIY  95

Query  369  VMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDK-VASNDDEDKKLYFGLYDIWSGKL  545
            +MA+ G      W+K  L+  T         + I K   SN D   K+YFGLY++W+ K 
Sbjct  96   LMAKWGDNTQ--WRKVNLATKTNDKKMISETITIKKGKGSNTD---KIYFGLYEVWNKKW  150

Query  546  KKGLAIHYASVQEI  587
            K GL IH  ++ ++
Sbjct  151  KGGLKIHPINLTQV  164



>ref|XP_007138400.1| hypothetical protein PHAVU_009G205600g [Phaseolus vulgaris]
 gb|ESW10394.1| hypothetical protein PHAVU_009G205600g [Phaseolus vulgaris]
Length=163

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 65/131 (50%), Gaps = 14/131 (11%)
 Frame = +3

Query  204  WESSGEEAAALVSKVIWLEVTGEKEVDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARR  383
            W+   +  A L+ +  WLEVT    +    KY+V F V +KE      W   P+ VMAR 
Sbjct  42   WKIPDDGPAELI-QASWLEVTCVVPITVAGKYKVSFNVRVKENGF--GWNGTPVRVMARS  98

Query  384  GKKRDYCWKKFVLS---NVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKG  554
             K   Y ++   LS   N+T   +     LVI+   +  D    L+FGLY++W+GK K G
Sbjct  99   VKNGRYKYETDRLSPGENITIPSNS----LVINVKHTPTD----LHFGLYEVWTGKWKGG  150

Query  555  LAIHYASVQEI  587
            L +  A VQ +
Sbjct  151  LEVIKALVQPV  161



>ref|XP_010317011.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Solanum lycopersicum]
Length=163

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 71/133 (53%), Gaps = 11/133 (8%)
 Frame = +3

Query  198  WKWESSGEEAAALVSKVIWLEVTGE-KEVDPTKK--YEVKFKVSLKEESSPTEWENIPLY  368
            WK     ++ A L+ ++ WLEVTG   +++  KK  Y ++F +SL  ++    W + P+Y
Sbjct  39   WKLPKYEKDGAELI-QINWLEVTGCIDDINIAKKTLYNIEFTMSLMVDAFG--WNDSPIY  95

Query  369  VMARRGKKRDYCWKKFVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLK  548
            +MA+ G   D   +K  L+  T    ++ I   I       +   K+YFGLY++W+ K K
Sbjct  96   LMAKWG---DNTQRKVNLA--TKANDKKMISKAITITKGKGNNVNKIYFGLYEVWNKKWK  150

Query  549  KGLAIHYASVQEI  587
             GL IH  ++ EI
Sbjct  151  GGLKIHSVNLIEI  163



>ref|XP_010650336.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9 [Vitis vinifera]
Length=194

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 40/78 (51%), Gaps = 5/78 (6%)
 Frame = +3

Query  198  WKWESSGEEAAALVSKVIWLEVTGEKEVDPTK---KYEVKFKVSLKEESSPTEWENIPLY  368
            WK       + A + +V WLEV+G   +       K+ + F+VS K ++    W N P+Y
Sbjct  43   WKMPEKNSGSPAELLQVCWLEVSGSVPIRSASIGTKFRITFQVSFKSDA--FGWNNCPVY  100

Query  369  VMARRGKKRDYCWKKFVL  422
            VMA+ GKK  Y W K  L
Sbjct  101  VMAKFGKKGKYAWTKISL  118



>ref|XP_009383688.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like [Musa acuminata 
subsp. malaccensis]
Length=184

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 62/119 (52%), Gaps = 7/119 (6%)
 Frame = +3

Query  243  KVIWLEVTGEKE---VDPTKKYEVKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKK  413
            +V WLEV G+ +   +   ++Y+VKF V ++ ++    W   P+Y+MA+    + + WKK
Sbjct  64   QVSWLEVVGKLDGSRLVAGERYKVKFMVKMRADA--FGWSGCPVYLMAKDASGK-FVWKK  120

Query  414  FVLSNVTGKGSEREIGLVIDKVASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQEIP  590
              LS +    +E  I  +  +V        ++ FGL++IW G  K GL I    + ++P
Sbjct  121  ADLS-LLPSDTELPIPDIQSQVLIFTAPPDQVVFGLFEIWRGTWKGGLEIVRVIIDKVP  178



>ref|XP_010317010.1| PREDICTED: protein PHLOEM PROTEIN 2-LIKE A9-like isoform X2 [Solanum 
lycopersicum]
Length=164

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 79/155 (51%), Gaps = 18/155 (12%)
 Frame = +3

Query  132  IYPRKLNFSLKFSLDEESSNGNWKWESSGEEAAALVSKVIWLEVTGEKE-VDPTKK--YE  302
            I+P+ LN  + +  D+      WK      + A L+ +V WLEVTG  + ++  KK  Y 
Sbjct  23   IHPKSLN--IVWGNDKRY----WKLPKDENDDAELI-QVNWLEVTGCIDNINIMKKTSYN  75

Query  303  VKFKVSLKEESSPTEWENIPLYVMARRGKKRDYCWKKFVLSN-VTGKGSEREIGLVIDKV  479
            ++F ++L  ++    W + P+Y+MA+ G      W+K  L+  +  K    E   +    
Sbjct  76   IEFIMALMADAFG--WSDSPIYLMAKWGDNTQ--WRKVNLATKINDKKMISETITIKKGK  131

Query  480  ASNDDEDKKLYFGLYDIWSGKLKKGLAIHYASVQE  584
             SN D   K+ FGLY++W+ K K GL IH  ++ E
Sbjct  132  GSNTD---KICFGLYEVWNKKWKGGLKIHSVNLIE  163



>ref|XP_006374705.1| hypothetical protein POPTR_0015s15520g, partial [Populus trichocarpa]
 gb|ERP52502.1| hypothetical protein POPTR_0015s15520g, partial [Populus trichocarpa]
Length=267

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 49/85 (58%), Gaps = 8/85 (9%)
 Frame = +3

Query  348  WENIPLYVMARRGKKRDYCWKKFVLSNVTGKGSE-----REIGLVIDKVASNDDEDKKLY  512
            WE+ P+YVMAR G++ +Y  +K  LS +  K  E       +    D+ A N+   K LY
Sbjct  9    WED-PVYVMARIGEEGEYKREKIDLSKLGLKEDEFPAKKCRVEFRSDENAENNK--KTLY  65

Query  513  FGLYDIWSGKLKKGLAIHYASVQEI  587
            FGLY++W+   K GL IH A V+E+
Sbjct  66   FGLYEVWTNNWKGGLRIHEAIVREL  90



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2581342896576