BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25496_g1_i6 len=3323 path=[10125:0-998 8079:999-1138 8167:1139-1147
8176:1148-1901 12014:1902-1983 12096:1984-2042 12155:2043-2523
5012:2524-3322]

Length=3323
                                                                      Score     E

ref|XP_004247758.1|  PREDICTED: uncharacterized protein LOC101260476   1485   0.0      
ref|XP_009763750.1|  PREDICTED: uncharacterized protein LOC104215...   1483   0.0      
ref|XP_009625531.1|  PREDICTED: uncharacterized protein LOC104116...   1480   0.0      
ref|XP_006354448.1|  PREDICTED: uncharacterized protein LOC102604983   1480   0.0      
ref|XP_009625533.1|  PREDICTED: uncharacterized protein LOC104116...   1478   0.0      
ref|XP_009617889.1|  PREDICTED: uncharacterized protein LOC104110...   1475   0.0      
ref|XP_011073566.1|  PREDICTED: uncharacterized protein LOC105158...   1423   0.0      
ref|XP_002281958.1|  PREDICTED: uncharacterized protein LOC100249...   1418   0.0      Vitis vinifera
ref|XP_011029772.1|  PREDICTED: uncharacterized protein LOC105129...   1414   0.0      
ref|XP_011029770.1|  PREDICTED: uncharacterized protein LOC105129...   1412   0.0      
ref|XP_002311690.2|  cyclopropane-fatty-acyl-phospholipid synthas...   1409   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU32577.1|  hypothetical protein MIMGU_mgv1a001185mg               1404   0.0      
ref|XP_009586640.1|  PREDICTED: uncharacterized protein LOC104084...   1400   0.0      
ref|XP_006493505.1|  PREDICTED: uncharacterized protein LOC102615...   1400   0.0      
ref|XP_009357997.1|  PREDICTED: uncharacterized protein LOC103948...   1397   0.0      
ref|XP_009358001.1|  PREDICTED: uncharacterized protein LOC103948...   1396   0.0      
ref|XP_007227011.1|  hypothetical protein PRUPE_ppa001275mg            1396   0.0      
ref|XP_008224157.1|  PREDICTED: uncharacterized protein LOC103323...   1394   0.0      
ref|XP_008224158.1|  PREDICTED: uncharacterized protein LOC103323...   1391   0.0      
ref|XP_010264925.1|  PREDICTED: uncharacterized protein LOC104602...   1391   0.0      
ref|XP_004296397.1|  PREDICTED: uncharacterized protein LOC101309817   1390   0.0      
ref|XP_002314493.2|  cyclopropane-fatty-acyl-phospholipid synthas...   1389   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010650134.1|  PREDICTED: uncharacterized protein LOC100242...   1387   0.0      
emb|CDO99279.1|  unnamed protein product                               1385   0.0      
ref|XP_010650133.1|  PREDICTED: uncharacterized protein LOC100242...   1383   0.0      
emb|CBI23697.3|  unnamed protein product                               1381   0.0      
ref|XP_007035209.1|  Cyclopropane-fatty-acyl-phospholipid synthas...   1380   0.0      
ref|XP_010650132.1|  PREDICTED: uncharacterized protein LOC100242...   1379   0.0      
gb|KDP40373.1|  hypothetical protein JCGZ_02371                        1379   0.0      
ref|XP_002528810.1|  methyltransferase, putative                       1377   0.0      Ricinus communis
emb|CAN68017.1|  hypothetical protein VITISV_025151                    1377   0.0      Vitis vinifera
ref|XP_009625534.1|  PREDICTED: uncharacterized protein LOC104116...   1375   0.0      
ref|XP_009617891.1|  PREDICTED: uncharacterized protein LOC104110...   1370   0.0      
gb|KEH42686.1|  cyclopropane-fatty-acyl-phospholipid synthase          1368   0.0      
ref|XP_008460674.1|  PREDICTED: uncharacterized protein LOC103499...   1365   0.0      
ref|XP_009625535.1|  PREDICTED: uncharacterized protein LOC104116...   1363   0.0      
ref|XP_004234691.1|  PREDICTED: uncharacterized protein LOC101256...   1362   0.0      
ref|XP_011030438.1|  PREDICTED: uncharacterized protein LOC105129...   1360   0.0      
ref|XP_011030435.1|  PREDICTED: uncharacterized protein LOC105129...   1360   0.0      
ref|XP_008340636.1|  PREDICTED: uncharacterized protein LOC103403...   1360   0.0      
ref|XP_009617893.1|  PREDICTED: uncharacterized protein LOC104110...   1358   0.0      
gb|KGN61573.1|  hypothetical protein Csa_2G171940                      1358   0.0      
ref|XP_010023867.1|  PREDICTED: uncharacterized protein LOC104414444   1356   0.0      
gb|AAT74602.1|  cyclopropane fatty acid synthase                       1355   0.0      Gossypium hirsutum [American cotton]
ref|XP_004495453.1|  PREDICTED: uncharacterized protein LOC101501999   1353   0.0      
ref|XP_006606354.1|  PREDICTED: uncharacterized protein LOC100815...   1348   0.0      
emb|CBI23694.3|  unnamed protein product                               1348   0.0      
ref|XP_009586642.1|  PREDICTED: uncharacterized protein LOC104084...   1346   0.0      
ref|XP_006406021.1|  hypothetical protein EUTSA_v10020039mg            1345   0.0      
ref|XP_006296683.1|  hypothetical protein CARUB_v10012958mg            1343   0.0      
ref|XP_006589307.1|  PREDICTED: uncharacterized protein LOC100801...   1342   0.0      
ref|XP_010023868.1|  PREDICTED: uncharacterized protein LOC104414445   1339   0.0      
gb|AAL57657.1|  AT3g23510/MEE5_5                                       1338   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002883433.1|  hypothetical protein ARALYDRAFT_898865            1338   0.0      
ref|XP_011073567.1|  PREDICTED: uncharacterized protein LOC105158...   1337   0.0      
ref|XP_009102608.1|  PREDICTED: uncharacterized protein LOC103828731   1337   0.0      
ref|NP_188995.2|  Cyclopropane-fatty-acyl-phospholipid synthase        1337   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44154.1|  unnamed protein product                               1336   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466687.1|  PREDICTED: uncharacterized protein LOC104746847   1334   0.0      
ref|XP_010527410.1|  PREDICTED: uncharacterized protein LOC104804765   1333   0.0      
ref|XP_009586641.1|  PREDICTED: uncharacterized protein LOC104084...   1333   0.0      
ref|XP_010512493.1|  PREDICTED: uncharacterized protein LOC104788...   1332   0.0      
ref|NP_188993.2|  cyclopropane-fatty-acyl-phospholipid synthase        1332   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011030437.1|  PREDICTED: uncharacterized protein LOC105129...   1328   0.0      
ref|XP_010023866.1|  PREDICTED: uncharacterized protein LOC104414443   1323   0.0      
gb|KGN61574.1|  hypothetical protein Csa_2G171950                      1323   0.0      
ref|XP_010670961.1|  PREDICTED: uncharacterized protein LOC104887...   1321   0.0      
ref|XP_010490069.1|  PREDICTED: uncharacterized protein LOC104767788   1320   0.0      
ref|XP_006350407.1|  PREDICTED: uncharacterized protein LOC102579...   1316   0.0      
ref|XP_006489661.1|  PREDICTED: uncharacterized protein LOC102611924   1315   0.0      
ref|XP_006857466.1|  hypothetical protein AMTR_s00067p00185740         1315   0.0      
emb|CDX85109.1|  BnaC07g07970D                                         1300   0.0      
ref|XP_008796355.1|  PREDICTED: uncharacterized protein LOC103711...   1298   0.0      
ref|XP_004147184.1|  PREDICTED: uncharacterized protein LOC101213850   1294   0.0      
ref|XP_008796354.1|  PREDICTED: uncharacterized protein LOC103711...   1294   0.0      
emb|CDX77504.1|  BnaA07g06420D                                         1290   0.0      
ref|XP_006489662.1|  PREDICTED: uncharacterized protein LOC102612...   1289   0.0      
ref|XP_010936014.1|  PREDICTED: uncharacterized protein LOC105055...   1284   0.0      
ref|XP_006421140.1|  hypothetical protein CICLE_v10004346mg            1280   0.0      
ref|XP_010529627.1|  PREDICTED: uncharacterized protein LOC104806...   1272   0.0      
ref|XP_010317817.1|  PREDICTED: uncharacterized protein LOC101256...   1263   0.0      
ref|XP_010532680.1|  PREDICTED: uncharacterized protein LOC104808649   1255   0.0      
gb|KDO50392.1|  hypothetical protein CISIN_1g0358701mg                 1251   0.0      
ref|XP_009586643.1|  PREDICTED: uncharacterized protein LOC104084...   1250   0.0      
ref|XP_010532681.1|  PREDICTED: uncharacterized protein LOC104808651   1247   0.0      
gb|KHG28467.1|  putative fatty acid methyltransferase                  1246   0.0      
ref|XP_009135859.1|  PREDICTED: uncharacterized protein LOC103860003   1238   0.0      
ref|XP_010512500.1|  PREDICTED: uncharacterized protein LOC104788...   1235   0.0      
emb|CDX92987.1|  BnaA03g37090D                                         1233   0.0      
ref|XP_006489756.1|  PREDICTED: uncharacterized protein LOC102615557   1230   0.0      
ref|NP_001147782.1|  cyclopropane fatty acid synthase                  1230   0.0      Zea mays [maize]
dbj|BAJ93367.1|  predicted protein                                     1230   0.0      
ref|XP_009102616.1|  PREDICTED: uncharacterized protein LOC103828...   1227   0.0      
gb|KCW60262.1|  hypothetical protein EUGRSUZ_H02971                    1226   0.0      
ref|XP_006406026.1|  hypothetical protein EUTSA_v10020049mg            1223   0.0      
gb|KHG28468.1|  putative fatty acid methyltransferase                  1220   0.0      
ref|XP_006406025.1|  hypothetical protein EUTSA_v10020040mg            1217   0.0      
ref|XP_004957293.1|  PREDICTED: uncharacterized protein LOC101772901   1217   0.0      
ref|XP_011091265.1|  PREDICTED: uncharacterized protein LOC105171...   1217   0.0      
ref|XP_003581006.1|  PREDICTED: uncharacterized protein LOC100842...   1209   0.0      
ref|XP_007035221.1|  Cyclopropane-fatty-acyl-phospholipid synthase     1207   0.0      
emb|CDX94854.1|  BnaC03g43340D                                         1204   0.0      
ref|XP_002528378.1|  cyclopropane-fatty-acyl-phospholipid synthas...   1203   0.0      Ricinus communis
ref|XP_009102765.1|  PREDICTED: uncharacterized protein LOC103828879   1201   0.0      
gb|KDO54095.1|  hypothetical protein CISIN_1g038410mg                  1199   0.0      
ref|XP_002531842.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...   1197   0.0      Ricinus communis
ref|XP_010026810.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   1193   0.0      
ref|XP_006420314.1|  hypothetical protein CICLE_v10007034mg            1189   0.0      
gb|EEC82010.1|  hypothetical protein OsI_25960                         1182   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010670959.1|  PREDICTED: uncharacterized protein LOC104887...   1181   0.0      
ref|XP_010532685.1|  PREDICTED: uncharacterized protein LOC104808...   1180   0.0      
ref|XP_006350408.1|  PREDICTED: uncharacterized protein LOC102579...   1174   0.0      
ref|XP_011029773.1|  PREDICTED: uncharacterized protein LOC105129...   1174   0.0      
ref|XP_008796356.1|  PREDICTED: uncharacterized protein LOC103711...   1167   0.0      
ref|XP_010264927.1|  PREDICTED: uncharacterized protein LOC104602...   1167   0.0      
dbj|BAB01742.1|  unnamed protein product                               1167   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011091264.1|  PREDICTED: uncharacterized protein LOC105171751   1158   0.0      
gb|KHN01041.1|  Putative fatty acid methyltransferase                  1153   0.0      
ref|XP_010670924.1|  PREDICTED: uncharacterized protein LOC104887...   1153   0.0      
gb|EMS55075.1|  Cyclopropane-fatty-acyl-phospholipid synthase          1144   0.0      
dbj|BAB02771.1|  mycolic acid methyl transferase-like protein          1143   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007035215.1|  Cyclopropane fatty acid synthase                  1140   0.0      
ref|XP_008667917.1|  PREDICTED: cyclopropane fatty acid synthase ...   1138   0.0      
ref|XP_010239672.1|  PREDICTED: uncharacterized protein LOC100842...   1136   0.0      
ref|XP_009586644.1|  PREDICTED: uncharacterized protein LOC104084...   1136   0.0      
ref|XP_008460675.1|  PREDICTED: uncharacterized protein LOC103499...   1135   0.0      
ref|XP_007035214.1|  Cyclopropane-fatty-acyl-phospholipid synthas...   1135   0.0      
emb|CDY09021.1|  BnaC01g30700D                                         1135   0.0      
gb|KDO54097.1|  hypothetical protein CISIN_1g0029283mg                 1134   0.0      
gb|EMT03310.1|  Cyclopropane-fatty-acyl-phospholipid synthase          1134   0.0      
ref|XP_011091266.1|  PREDICTED: uncharacterized protein LOC105171...   1125   0.0      
ref|XP_006606355.1|  PREDICTED: uncharacterized protein LOC100815...   1120   0.0      
gb|AAM33848.1|AF470622_1  cyclopropane synthase                        1119   0.0      Sterculia foetida
gb|KHN30725.1|  Putative fatty acid methyltransferase                  1117   0.0      
gb|AAT74601.1|  cyclopropane fatty acid synthase                       1111   0.0      Gossypium hirsutum [American cotton]
ref|XP_009586646.1|  PREDICTED: uncharacterized protein LOC104084...   1110   0.0      
ref|XP_010650129.1|  PREDICTED: uncharacterized protein LOC100249...   1104   0.0      
ref|XP_010670960.1|  PREDICTED: uncharacterized protein LOC104887...   1102   0.0      
gb|AAT74600.1|  cyclopropane fatty acid synthase                       1092   0.0      Gossypium hirsutum [American cotton]
emb|CDX77514.1|  BnaA07g06520D                                         1090   0.0      
ref|XP_010650130.1|  PREDICTED: uncharacterized protein LOC100249...   1087   0.0      
ref|XP_010532686.1|  PREDICTED: uncharacterized protein LOC104808...   1083   0.0      
emb|CDX77513.1|  BnaA07g06510D                                         1080   0.0      
gb|EPS70161.1|  hypothetical protein M569_04599                        1069   0.0      
dbj|BAJ95828.1|  predicted protein                                     1068   0.0      
gb|AES60365.2|  cyclopropane-fatty-acyl-phospholipid synthase          1067   0.0      
ref|XP_008224159.1|  PREDICTED: uncharacterized protein LOC103323...   1065   0.0      
ref|XP_002964119.1|  hypothetical protein SELMODRAFT_166747            1060   0.0      
ref|XP_007144121.1|  hypothetical protein PHAVU_007G1305000g           1059   0.0      
ref|XP_010670925.1|  PREDICTED: uncharacterized protein LOC104887...   1053   0.0      
ref|XP_004169247.1|  PREDICTED: uncharacterized protein LOC101225338   1053   0.0      
ref|XP_001769171.1|  predicted protein                                 1034   0.0      
ref|XP_004972625.1|  PREDICTED: uncharacterized protein LOC101764920   1014   0.0      
gb|KHG13738.1|  Cyclopropane-fatty-acyl-phospholipid synthase          1013   0.0      
ref|XP_002451281.1|  hypothetical protein SORBIDRAFT_05g026900         1013   0.0      Sorghum bicolor [broomcorn]
ref|XP_004956057.1|  PREDICTED: uncharacterized protein LOC101762...   1011   0.0      
ref|XP_006664478.1|  PREDICTED: uncharacterized protein LOC102701601   1004   0.0      
ref|XP_007035212.1|  Cyclopropane-fatty-acyl-phospholipid synthas...   1004   0.0      
dbj|BAC83502.1|  putative cyclopropane synthase                         999   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008796358.1|  PREDICTED: uncharacterized protein LOC103711...    996   0.0      
ref|XP_008664677.1|  PREDICTED: uncharacterized protein LOC103643...    996   0.0      
ref|XP_008664676.1|  PREDICTED: uncharacterized protein LOC103643...    996   0.0      
ref|XP_004956056.1|  PREDICTED: uncharacterized protein LOC101762...    994   0.0      
ref|XP_003590114.1|  Cyclopropane fatty acid synthase                   994   0.0      
ref|XP_008796357.1|  PREDICTED: uncharacterized protein LOC103711...    992   0.0      
dbj|BAK05129.1|  predicted protein                                      989   0.0      
ref|XP_010936016.1|  PREDICTED: uncharacterized protein LOC105055...    988   0.0      
dbj|BAK05892.1|  predicted protein                                      986   0.0      
ref|NP_001066537.1|  Os12g0267200                                       985   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EYU18296.1|  hypothetical protein MIMGU_mgv1a024671mg                984   0.0      
ref|XP_010936015.1|  PREDICTED: uncharacterized protein LOC105055...    981   0.0      
gb|EEC78767.1|  hypothetical protein OsI_18995                          972   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_008677860.1|  PREDICTED: uncharacterized protein LOC103652...    970   0.0      
ref|XP_009763752.1|  PREDICTED: uncharacterized protein LOC104215...    960   0.0      
ref|XP_009625539.1|  PREDICTED: uncharacterized protein LOC104116...    959   0.0      
ref|XP_006421139.1|  hypothetical protein CICLE_v10004346mg             959   0.0      
ref|XP_009625540.1|  PREDICTED: uncharacterized protein LOC104116...    957   0.0      
ref|XP_009617895.1|  PREDICTED: uncharacterized protein LOC104110...    949   0.0      
ref|XP_007035213.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    946   0.0      
ref|XP_006489664.1|  PREDICTED: uncharacterized protein LOC102612...    934   0.0      
ref|XP_006489666.1|  PREDICTED: uncharacterized protein LOC102613...    930   0.0      
ref|XP_010532687.1|  PREDICTED: uncharacterized protein LOC104808...    921   0.0      
ref|XP_010650131.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    917   0.0      
ref|XP_008677861.1|  PREDICTED: uncharacterized protein LOC103652...    916   0.0      
gb|EMT06798.1|  Cyclopropane-fatty-acyl-phospholipid synthase           911   0.0      
ref|XP_006489667.1|  PREDICTED: uncharacterized protein LOC102613...    903   0.0      
ref|XP_011029775.1|  PREDICTED: uncharacterized protein LOC105129...    898   0.0      
ref|XP_009780643.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    895   0.0      
ref|XP_008460676.1|  PREDICTED: pavine N-methyltransferase-like i...    882   0.0      
ref|XP_009102618.1|  PREDICTED: uncharacterized protein LOC103828...    877   0.0      
ref|XP_008340641.1|  PREDICTED: uncharacterized protein LOC103403...    867   0.0      
ref|XP_006606356.1|  PREDICTED: uncharacterized protein LOC100815...    865   0.0      
gb|EPS65744.1|  cyclopropane fatty acid synthase                        863   0.0      
gb|KDO40331.1|  hypothetical protein CISIN_1g036521mg                   862   0.0      
ref|XP_006589308.1|  PREDICTED: uncharacterized protein LOC100801...    856   0.0      
ref|XP_006431328.1|  hypothetical protein CICLE_v10030464mg             852   0.0      
ref|XP_008796359.1|  PREDICTED: uncharacterized protein LOC103711...    825   0.0      
gb|EEE62857.1|  hypothetical protein OsJ_17660                          819   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_004169418.1|  PREDICTED: cyclopropane-fatty-acyl-phospholi...    807   0.0      
ref|XP_006350427.1|  PREDICTED: uncharacterized protein LOC102587606    784   0.0      
gb|ABG37642.1|  cyclopropane fatty acid synthase                        822   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006489668.1|  PREDICTED: uncharacterized protein LOC102613...    739   0.0      
gb|EMS47376.1|  Cyclopropane-fatty-acyl-phospholipid synthase           734   0.0      
ref|XP_010670963.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    722   0.0      
ref|XP_002528809.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    716   0.0      Ricinus communis
ref|XP_004172280.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    711   0.0      
ref|XP_006354535.1|  PREDICTED: pavine N-methyltransferase-like         703   0.0      
gb|KCW60259.1|  hypothetical protein EUGRSUZ_H029682                    698   0.0      
ref|XP_006489663.1|  PREDICTED: uncharacterized protein LOC102612...    701   0.0      
ref|XP_004247760.1|  PREDICTED: uncharacterized protein LOC101261068    677   0.0      
ref|XP_011013987.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    678   0.0      
emb|CDY67345.1|  BnaCnng54600D                                          675   0.0      
ref|XP_002314497.2|  hypothetical protein POPTR_0010s07830g             672   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002314494.2|  hypothetical protein POPTR_0010s07840g             667   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002314496.2|  hypothetical protein POPTR_0010s07820g             662   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006378321.1|  hypothetical protein POPTR_0010s07800g             657   0.0      
emb|CDY18120.1|  BnaA01g23810D                                          654   0.0      
ref|XP_009107970.1|  PREDICTED: uncharacterized protein LOC103833648    653   0.0      
ref|NP_188989.2|  cyclopropane-fatty-acyl-phospholipid synthase         650   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011041421.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    648   0.0      
ref|XP_010532682.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    644   0.0      
ref|XP_010488415.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    636   0.0      
ref|XP_010532683.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    633   0.0      
ref|XP_007035217.1|  Cyclopropane fatty acid synthase isoform 1         631   0.0      
ref|XP_004296401.1|  PREDICTED: cyclopropane-fatty-acyl-phospholi...    627   0.0      
ref|XP_011041574.1|  PREDICTED: uncharacterized protein LOC105137508    627   0.0      
gb|KFK39641.1|  hypothetical protein AALP_AA3G270000                    617   0.0      
ref|XP_002528379.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    612   0.0      Ricinus communis
ref|XP_010466684.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    612   0.0      
ref|XP_010466685.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    611   0.0      
ref|XP_010466683.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    611   0.0      
gb|EMS56688.1|  Cyclopropane-fatty-acyl-phospholipid synthase           614   0.0      
ref|XP_005824669.1|  hypothetical protein GUITHDRAFT_165417             630   0.0      
ref|XP_006299255.1|  hypothetical protein CARUB_v10015414mg             603   0.0      
ref|XP_004307321.1|  PREDICTED: probable fatty acid methyltransfe...    601   0.0      
ref|NP_188990.4|  Cyclopropane-fatty-acyl-phospholipid synthase         599   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658552.1|  PREDICTED: uncharacterized protein LOC102715408    610   0.0      
ref|XP_010532684.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    594   0.0      
gb|KDO54091.1|  hypothetical protein CISIN_1g0146251mg                  590   0.0      
ref|XP_007035240.1|  Cyclopropane fatty acid synthase                   591   0.0      
ref|XP_007035218.1|  Cyclopropane fatty acid synthase isoform 2         587   0.0      
ref|XP_010670965.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    573   0.0      
ref|XP_007035220.1|  Cyclopropane fatty acid synthase                   566   0.0      
gb|EEE67149.1|  hypothetical protein OsJ_24210                          578   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_005648777.1|  cyclopropane fatty acid synthase                   590   0.0      
dbj|BAB01740.1|  cyclopocyclopropane fatty acid synthase-like pro...    563   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001059618.1|  Os07g0474600                                       555   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002183150.1|  predicted protein                                  558   8e-178   Phaeodactylum tricornutum CCAP 1055/1
ref|NP_001189954.1|  Cyclopropane-fatty-acyl-phospholipid synthase      541   1e-177   
ref|XP_007512428.1|  cyclopropane-fatty-acyl-phospholipid synthase      559   8e-177   
ref|XP_004173332.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    533   8e-177   
ref|XP_001695321.1|  cyclopropane fatty acid synthase                   560   4e-176   Chlamydomonas reinhardtii
ref|XP_002294769.1|  predicted protein                                  551   4e-176   Thalassiosira pseudonana CCMP1335
ref|XP_001422042.1|  predicted protein                                  549   2e-175   Ostreococcus lucimarinus CCE9901
gb|KCW60260.1|  hypothetical protein EUGRSUZ_H029681                    523   2e-172   
gb|AFW60130.1|  hypothetical protein ZEAMMB73_361545                    525   3e-172   
gb|KFK39644.1|  hypothetical protein AALP_AA3G270300                    524   4e-172   
ref|XP_009388106.1|  PREDICTED: uncharacterized protein LOC103974927    521   7e-172   
ref|XP_002502708.1|  predicted protein                                  540   7e-172   Micromonas commoda
ref|XP_009414043.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    513   5e-169   
dbj|BAB01739.1|  unnamed protein product                                518   4e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406023.1|  hypothetical protein EUTSA_v10022172mg             513   7e-168   
ref|XP_005537745.1|  probable mycolic acid methyl transferase           531   4e-167   
emb|CEG00624.1|  Mycolic acid cyclopropane synthase                     534   2e-165   
ref|XP_002467653.1|  hypothetical protein SORBIDRAFT_01g031685          512   1e-163   Sorghum bicolor [broomcorn]
ref|XP_005792764.1|  hypothetical protein EMIHUDRAFT_454253             520   4e-163   
ref|XP_003083973.1|  unnamed protein product                            534   2e-162   
ref|XP_002883432.1|  predicted protein                                  490   4e-160   
ref|XP_004173387.1|  PREDICTED: probable fatty acid methyltransfe...    484   9e-159   
dbj|BAJ91247.1|  predicted protein                                      477   2e-155   
ref|XP_005708372.1|  cyclopropane-fatty-acyl-phospholipid synthase      488   4e-153   
ref|XP_004147183.1|  PREDICTED: uncharacterized protein LOC101213610    488   6e-152   
ref|XP_009757348.1|  PREDICTED: uncharacterized protein LOC104210208    460   4e-149   
gb|KDO54102.1|  hypothetical protein CISIN_1g043102mg                   461   2e-146   
gb|EMS64510.1|  Cyclopropane-fatty-acyl-phospholipid synthase           454   3e-140   
gb|KDO40332.1|  hypothetical protein CISIN_1g0240962mg                  431   1e-138   
gb|EMS68326.1|  Cyclopropane-fatty-acyl-phospholipid synthase           433   1e-137   
ref|XP_002460494.1|  hypothetical protein SORBIDRAFT_02g029350          435   8e-137   Sorghum bicolor [broomcorn]
gb|KGN61575.1|  hypothetical protein Csa_2G171960                       426   8e-137   
ref|XP_002451282.1|  hypothetical protein SORBIDRAFT_05g026910          443   3e-136   
ref|XP_006420313.1|  hypothetical protein CICLE_v10005536mg             426   5e-136   
gb|KDO39428.1|  hypothetical protein CISIN_1g047022mg                   422   1e-133   
emb|CDY09024.1|  BnaC01g30670D                                          420   1e-133   
ref|XP_009388073.1|  PREDICTED: uncharacterized protein LOC103974893    410   3e-130   
ref|XP_009758040.1|  PREDICTED: uncharacterized protein LOC104210742    404   2e-128   
gb|EWM29595.1|  cyclopropane fatty acid synthase                        407   3e-122   
ref|XP_005853443.1|  amine oxidase                                      406   6e-122   
gb|EMS68524.1|  Cyclopropane-fatty-acyl-phospholipid synthase           417   8e-122   
gb|KGN61578.1|  hypothetical protein Csa_2G172480                       382   1e-119   
ref|XP_006420311.1|  hypothetical protein CICLE_v10005727mg             376   4e-118   
gb|KDO54094.1|  hypothetical protein CISIN_1g048309mg                   378   4e-118   
gb|EMS47377.1|  Cyclopropane-fatty-acyl-phospholipid synthase           386   3e-116   
dbj|BAJ92759.1|  predicted protein                                      362   2e-112   
dbj|BAJ86532.1|  predicted protein                                      358   4e-111   
ref|XP_008466845.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    349   4e-108   
gb|EMT01204.1|  Cyclopropane-fatty-acyl-phospholipid synthase           355   8e-106   
ref|XP_009388278.1|  PREDICTED: phytoene desaturase-like                338   2e-104   
ref|XP_008460733.1|  PREDICTED: uncharacterized protein LOC103499495    359   5e-104   
ref|XP_005717868.1|  unnamed protein product                            345   1e-103   
dbj|GAM27526.1|  hypothetical protein SAMD00019534_107020               339   7e-101   
emb|CDY54629.1|  BnaCnng27480D                                          323   1e-98    
emb|CDX85102.1|  BnaC07g08040D                                          317   5e-97    
ref|XP_004356254.1|  cyclopropane fatty acid synthase                   327   1e-96    
gb|EFA79547.1|  cyclopropane fatty acid synthase                        324   3e-96    
ref|XP_002862681.1|  hypothetical protein ARALYDRAFT_359447             315   5e-96    
gb|KGN61577.1|  hypothetical protein Csa_2G172470                       311   2e-94    
ref|WP_035725299.1|  NADH-ubiquinone oxidoreductase subunit 6           320   2e-94    
ref|WP_033423299.1|  cyclopropane-fatty-acyl-phospholipid synthase      326   3e-94    
ref|XP_638909.1|  cyclopropane fatty acid synthase                      319   3e-94    
ref|XP_003289116.1|  hypothetical protein DICPUDRAFT_48369              315   1e-92    
ref|WP_015774604.1|  cyclopropane-fatty-acyl-phospholipid synthase      321   2e-92    
ref|WP_035852078.1|  NADH-ubiquinone oxidoreductase subunit 6           313   6e-92    
ref|WP_018152743.1|  hypothetical protein                               312   7e-92    
ref|WP_017451245.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    310   5e-91    
ref|WP_028577058.1|  cyclopropane-fatty-acyl-phospholipid synthase      317   1e-90    
ref|XP_001804144.1|  hypothetical protein SNOG_13944                    309   2e-90    
ref|WP_026989223.1|  NADH-ubiquinone oxidoreductase subunit 6           309   2e-90    
gb|EKG13441.1|  Cyclopropane-fatty-acyl-phospholipid/mycolic acid...    309   2e-90    
ref|WP_039789083.1|  NADH-ubiquinone oxidoreductase subunit 6           308   3e-90    
ref|WP_036551677.1|  NADH-ubiquinone oxidoreductase subunit 6           308   6e-90    
ref|WP_006465178.1|  dehydrogenase                                      307   8e-90    
ref|WP_013233084.1|  NADH-ubiquinone oxidoreductase subunit 6           307   8e-90    
ref|WP_008326156.1|  NADH-ubiquinone oxidoreductase subunit 6           306   2e-89    
dbj|GAK56531.1|  cyclopropane-fatty-acyl-phospholipid synthase          305   3e-89    
ref|WP_013031406.1|  cyclopropane-fatty-acyl-phospholipid synthase      305   3e-89    
ref|WP_037046900.1|  cyclopropane-fatty-acyl-phospholipid synthase      305   4e-89    
ref|WP_027232012.1|  NADH-ubiquinone oxidoreductase subunit 6           305   5e-89    
ref|WP_028464938.1|  NADH-ubiquinone oxidoreductase subunit 6           305   6e-89    
ref|WP_040099190.1|  cyclopropane-fatty-acyl-phospholipid synthase      311   1e-88    
gb|EAR60721.1|  hypothetical protein MED92_13638                        304   2e-88    
ref|WP_040661572.1|  NADH-ubiquinone oxidoreductase subunit 6           304   2e-88    
ref|WP_029916671.1|  cyclopropane-fatty-acyl-phospholipid synthase      310   2e-88    
ref|WP_014286810.1|  NADH-ubiquinone oxidoreductase subunit 6           303   4e-88    
gb|KEF51607.1|  cyclopropane-fatty-acyl-phospholipid synthase           303   4e-88    
ref|WP_015724829.1|  cyclopropane-fatty-acyl-phospholipid synthase      309   4e-88    
ref|WP_032830102.1|  cyclopropane-fatty-acyl-phospholipid synthase      302   4e-88    
ref|WP_032829569.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    302   4e-88    
ref|WP_004765858.1|  cyclopropane-fatty-acyl-phospholipid synthase      302   6e-88    
gb|EMJ93734.1|  cyclopropane-fatty-acyl-phospholipid synthase           301   7e-88    
ref|XP_010109738.1|  Cyclopropane-fatty-acyl-phospholipid synthase      291   7e-88    
ref|WP_030103211.1|  NADH-ubiquinone oxidoreductase subunit 6           301   1e-87    
ref|WP_028614521.1|  cyclopropane-fatty-acyl-phospholipid synthase      300   1e-87    
gb|KEQ88104.1|  cyclopropane-fatty-acyl-phospholipid synthase           302   1e-87    
ref|WP_007228810.1|  cyclopropane-fatty-acyl-phospholipid synthase      300   1e-87    
ref|WP_007967311.1|  cyclopropane-fatty-acyl-phospholipid synthase      300   1e-87    
ref|WP_028880747.1|  NADH-ubiquinone oxidoreductase subunit 6           301   1e-87    
ref|WP_019965200.1|  NADH-ubiquinone oxidoreductase subunit 6           301   1e-87    
ref|WP_016832821.1|  hypothetical protein                               300   2e-87    
ref|WP_017234374.1|  hypothetical protein                               300   2e-87    
ref|WP_036537494.1|  cyclopropane-fatty-acyl-phospholipid synthase      299   2e-87    
ref|WP_038617514.1|  NADH-ubiquinone oxidoreductase subunit 6           300   2e-87    
ref|WP_036519337.1|  NADH-ubiquinone oxidoreductase subunit 6           301   2e-87    
ref|WP_023874324.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    300   3e-87    
ref|WP_008547394.1|  NADH-ubiquinone oxidoreductase subunit 6           300   3e-87    
ref|XP_007707490.1|  hypothetical protein COCCADRAFT_32698              300   3e-87    
ref|WP_026107288.1|  cyclopropane-fatty-acyl-phospholipid synthase      300   3e-87    
ref|WP_008223526.1|  cyclopropane-fatty-acyl-phospholipid synthase      299   3e-87    
gb|EFA79548.1|  hypothetical protein PPL_07599                          302   5e-87    
ref|WP_034951396.1|  NADH-ubiquinone oxidoreductase subunit 6           300   5e-87    
ref|WP_008588835.1|  cyclopropane-fatty-acyl-phospholipid synthase      299   5e-87    
ref|WP_025249175.1|  NADH-ubiquinone oxidoreductase subunit 6           299   5e-87    
ref|WP_034225625.1|  cyclopropane-fatty-acyl-phospholipid synthase      299   5e-87    
ref|WP_008952004.1|  cyclopropane-fatty-acyl-phospholipid synthase      298   6e-87    
ref|WP_012567205.1|  NADH-ubiquinone oxidoreductase subunit 6           299   6e-87    
ref|WP_028444633.1|  NADH-ubiquinone oxidoreductase subunit 6           299   7e-87    
ref|WP_008983445.1|  cyclopropane-fatty-acyl-phospholipid synthase      298   8e-87    
ref|XP_007690517.1|  hypothetical protein COCMIDRAFT_102075             299   9e-87    
ref|WP_027776057.1|  NADH-ubiquinone oxidoreductase subunit 6           298   9e-87    
gb|KEQ71785.1|  cyclopropane-fatty-acyl-phospholipid synthase           300   9e-87    
ref|WP_040372386.1|  hypothetical protein                               305   1e-86    
ref|WP_007615457.1|  NADH-ubiquinone oxidoreductase subunit 6           298   2e-86    
ref|WP_003163823.1|  NADH-ubiquinone oxidoreductase subunit 6           298   2e-86    
ref|WP_011295863.1|  NADH-ubiquinone oxidoreductase subunit 6           298   2e-86    
ref|WP_035507039.1|  NADH-ubiquinone oxidoreductase subunit 6           298   2e-86    
ref|WP_027837826.1|  NADH-ubiquinone oxidoreductase subunit 6           298   2e-86    
ref|WP_002997644.1|  cyclopropane-fatty-acyl-phospholipid synthase      298   2e-86    
ref|WP_013135425.1|  cyclopropane-fatty-acyl-phospholipid synthase      296   2e-86    
ref|WP_018411529.1|  NADH-ubiquinone oxidoreductase subunit 6           297   2e-86    
gb|EMD86301.1|  hypothetical protein COCHEDRAFT_1198234                 298   2e-86    
ref|WP_028101362.1|  NADH-ubiquinone oxidoreductase subunit 6           297   2e-86    
ref|WP_010151137.1|  cyclopropane-fatty-acyl-phospholipid synthase      297   3e-86    
ref|WP_008610474.1|  cyclopropane-fatty-acyl-phospholipid synthase      296   3e-86    
ref|WP_008119503.1|  NADH-ubiquinone oxidoreductase subunit 6           297   3e-86    
dbj|GAK46215.1|  amine oxidase                                          298   3e-86    
ref|WP_028196764.1|  NADH-ubiquinone oxidoreductase subunit 6           297   3e-86    
gb|EJN00550.1|  putative NAD/FAD-binding protein                        297   4e-86    
gb|EGD05972.1|  amine oxidase                                           296   4e-86    
ref|XP_009766520.1|  PREDICTED: uncharacterized protein LOC104217...    288   4e-86    
ref|XP_007695176.1|  hypothetical protein COCSADRAFT_216295             297   4e-86    
ref|WP_039370008.1|  NADH-ubiquinone oxidoreductase subunit 6           296   5e-86    
ref|WP_034203531.1|  NADH-ubiquinone oxidoreductase subunit 6           296   6e-86    
ref|WP_021157772.1|  Amine oxidase, flavin-containing                   296   6e-86    
gb|KER00237.1|  hypothetical protein AUEXF2481DRAFT_34438               297   7e-86    
ref|XP_007144120.1|  hypothetical protein PHAVU_007G1305001g            286   8e-86    
ref|WP_015768371.1|  NADH-ubiquinone oxidoreductase subunit 6           296   8e-86    
ref|WP_007641361.1|  cyclopropane-fatty-acyl-phospholipid synthase      295   9e-86    
gb|KEQ62956.1|  cyclopropane-fatty-acyl-phospholipid synthase           297   9e-86    
gb|ERZ99035.1|  hypothetical protein GLOINDRAFT_339331                  296   9e-86    
ref|WP_029221686.1|  cyclopropane-fatty-acyl-phospholipid synthase      295   1e-85    
gb|AJE99893.1|  NADH-ubiquinone oxidoreductase subunit 6                295   1e-85    
gb|EXI88479.1|  protoporphyrinogen oxidase                              296   1e-85    
ref|WP_039398472.1|  NADH-ubiquinone oxidoreductase subunit 6           295   1e-85    
dbj|GAM27527.1|  hypothetical protein SAMD00019534_107030               298   1e-85    
ref|WP_008347203.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    295   1e-85    
ref|WP_040855695.1|  NADH-ubiquinone oxidoreductase subunit 6           296   2e-85    
ref|WP_020702431.1|  NADH-ubiquinone oxidoreductase subunit 6           295   2e-85    
ref|WP_003456705.1|  SAM dependent methyltransferase, cyclopropan...    294   3e-85    
ref|WP_027514249.1|  NADH-ubiquinone oxidoreductase subunit 6           295   3e-85    
ref|WP_018698285.1|  hypothetical protein                               295   3e-85    
ref|XP_006676884.1|  hypothetical protein BATDEDRAFT_86144              295   3e-85    
ref|WP_020414996.1|  hypothetical protein                               294   3e-85    
ref|WP_012432094.1|  NADH-ubiquinone oxidoreductase subunit 6           294   4e-85    
ref|WP_010572522.1|  cyclopropane-fatty-acyl-phospholipid synthase      294   4e-85    
ref|WP_027565709.1|  NADH-ubiquinone oxidoreductase subunit 6           294   5e-85    
ref|WP_014087480.1|  NADH-ubiquinone oxidoreductase subunit 6           293   6e-85    
ref|WP_007974402.1|  cyclopropane-fatty-acyl-phospholipid synthase      293   6e-85    
ref|WP_028369081.1|  NADH-ubiquinone oxidoreductase subunit 6           293   7e-85    
ref|WP_008293215.1|  cyclopropane-fatty-acyl-phospholipid synthase      293   7e-85    
ref|XP_008716404.1|  hypothetical protein HMPREF1541_03834              293   8e-85    
ref|WP_035210178.1|  NADH-ubiquinone oxidoreductase subunit 6           293   8e-85    
ref|WP_013714269.1|  cyclopropane-fatty-acyl-phospholipid synthase      293   9e-85    
gb|KHJ36351.1|  putative cyclopropane-fatty-acyl-phospholipid syn...    295   9e-85    
ref|WP_017361874.1|  cyclopropane-fatty-acyl-phospholipid synthase      293   9e-85    
ref|WP_007670477.1|  NADH-ubiquinone oxidoreductase subunit 6           293   9e-85    
ref|WP_035996342.1|  NADH-ubiquinone oxidoreductase subunit 6           293   9e-85    
ref|WP_035310951.1|  NADH-ubiquinone oxidoreductase subunit 6           293   9e-85    
ref|WP_009769616.1|  NADH-ubiquinone oxidoreductase subunit 6           293   1e-84    
ref|WP_020770137.1|  cyclopropane-fatty-acyl-phospholipid synthase      292   1e-84    
ref|WP_017678135.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    292   1e-84    
gb|EME40925.1|  hypothetical protein DOTSEDRAFT_74470                   294   1e-84    
ref|WP_033379455.1|  NADH-ubiquinone oxidoreductase subunit 6           292   1e-84    
ref|WP_040652358.1|  NADH-ubiquinone oxidoreductase subunit 6           292   2e-84    
ref|WP_012110778.1|  NADH-ubiquinone oxidoreductase subunit 6           293   2e-84    
ref|WP_008259909.1|  NADH-ubiquinone oxidoreductase subunit 6           293   2e-84    
ref|WP_023443719.1|  cyclopropane-fatty-acyl-phospholipid synthase      292   2e-84    
ref|WP_016551412.1|  cyclopropane-fatty-acyl-phospholipid synthase      292   2e-84    
gb|EEG09848.1|  amine oxidase                                           291   2e-84    
ref|WP_010637102.1|  NADH-ubiquinone oxidoreductase subunit 6           292   2e-84    
gb|ACT36384.1|  cylcopropane fatty acid acyl phospholipid synthase      291   2e-84    
ref|WP_037020191.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   2e-84    
ref|WP_041014026.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   3e-84    
ref|WP_025871998.1|  NADH-ubiquinone oxidoreductase subunit 6           291   3e-84    
gb|EMN02370.1|  cyclopropane-fatty-acyl-phospholipid synthase           290   3e-84    
gb|EKM95559.1|  cyclopropane-fatty-acyl-phospholipid synthase           291   3e-84    
ref|XP_003837090.1|  hypothetical protein LEMA_P033240.1                296   3e-84    
ref|WP_036186404.1|  NADH-ubiquinone oxidoreductase subunit 6           292   3e-84    
ref|WP_027671132.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   3e-84    
ref|WP_024894758.1|  NADH-ubiquinone oxidoreductase subunit 6           291   3e-84    
ref|WP_021701492.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   3e-84    
ref|WP_027950607.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   3e-84    
ref|WP_002644825.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   4e-84    
ref|WP_024025660.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   4e-84    
ref|WP_027816433.1|  NADH-ubiquinone oxidoreductase subunit 6           291   4e-84    
ref|WP_035864519.1|  NADH-ubiquinone oxidoreductase subunit 6           291   4e-84    
ref|WP_019676732.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   4e-84    
ref|WP_024162296.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   4e-84    
ref|WP_016545452.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   4e-84    
ref|WP_010568252.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   5e-84    
ref|WP_035517956.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   5e-84    
gb|EMS82095.1|  cyclopropane-fatty-acyl-phospholipid synthase           290   5e-84    
ref|WP_008889725.1|  NADH-ubiquinone oxidoreductase subunit 6           291   5e-84    
ref|WP_003282254.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   5e-84    
ref|WP_014160581.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   5e-84    
ref|WP_004435713.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   5e-84    
ref|WP_011921129.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   5e-84    
ref|XP_008024747.1|  hypothetical protein SETTUDRAFT_62269              291   5e-84    
ref|WP_003246977.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   6e-84    
gb|EMO89818.1|  cyclopropane-fatty-acyl-phospholipid synthase           290   6e-84    
ref|WP_007742446.1|  NADH-ubiquinone oxidoreductase subunit 6           290   6e-84    
ref|WP_009024070.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   7e-84    
ref|WP_036032499.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   8e-84    
ref|WP_036073647.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   9e-84    
ref|WP_007878405.1|  putative amine oxidase                             291   9e-84    
ref|WP_012476587.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   9e-84    
gb|EKR71676.1|  cyclopropane-fatty-acyl-phospholipid synthase           290   1e-83    
gb|EMS86753.1|  cyclopropane-fatty-acyl-phospholipid synthase           290   1e-83    
ref|WP_039940271.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   1e-83    
ref|WP_011349277.1|  NADH-ubiquinone oxidoreductase subunit 6           290   1e-83    
ref|WP_036098089.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   1e-83    
ref|WP_017510251.1|  hypothetical protein                               290   1e-83    
ref|WP_012476829.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   1e-83    
gb|KFJ90934.1|  cyclopropane-fatty-acyl-phospholipid synthase           289   1e-83    
ref|WP_011487298.1|  NADH-ubiquinone oxidoreductase subunit 6           290   1e-83    
ref|WP_009239824.1|  MULTISPECIES: NADH-ubiquinone oxidoreductase...    289   2e-83    
ref|WP_013797662.1|  cyclopropane-fatty-acyl-phospholipid synthase      289   2e-83    
ref|WP_015682975.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   2e-83    
ref|WP_012910566.1|  cyclopropane-fatty-acyl-phospholipid synthase      289   2e-83    
ref|WP_036079206.1|  cyclopropane-fatty-acyl-phospholipid synthase      289   2e-83    
ref|WP_014189646.1|  NADH-ubiquinone oxidoreductase subunit 6           290   2e-83    
ref|WP_008242442.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   2e-83    
ref|WP_033403562.1|  NADH-ubiquinone oxidoreductase subunit 6           289   2e-83    
ref|WP_039365608.1|  NADH-ubiquinone oxidoreductase subunit 6           289   2e-83    
ref|WP_026145216.1|  cyclopropane-fatty-acyl-phospholipid synthase      289   2e-83    
ref|WP_035611143.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   2e-83    
ref|WP_012071731.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   2e-83    
gb|EMI72021.1|  cyclopropane-fatty-acyl-phospholipid synthase           287   2e-83    
gb|EXI82655.1|  protoporphyrinogen oxidase                              289   2e-83    
ref|WP_020306308.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   3e-83    
ref|WP_011136771.1|  NADH-ubiquinone oxidoreductase subunit 6           288   3e-83    
ref|WP_015636970.1|  methyltransferase                                  288   3e-83    



>ref|XP_004247758.1| PREDICTED: uncharacterized protein LOC101260476 [Solanum lycopersicum]
Length=862

 Score =  1485 bits (3844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 707/865 (82%), Positives = 784/865 (91%), Gaps = 5/865 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VA+VGAGISGLVSAY LAK GA +V+YEKEDY+GGHAKTVT++GVDLDLGFMVFNRVT
Sbjct  1     MKVAIVGAGISGLVSAYELAKSGAKIVIYEKEDYIGGHAKTVTVNGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGISGLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI++FK DV+SYLEE DNNPD+DRN+TLG FI+S GYS+LFQKAY++P+CASIWSC S+G
Sbjct  121   EIIRFKQDVISYLEELDNNPDIDRNETLGHFIQSHGYSKLFQKAYLVPICASIWSCPSDG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSAYSILSFCRNHHLLQLFGRPQWLTV+ RSH+YVNKV++ELEKRGC+IR GCEV+S
Sbjct  181   VMGFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSHTYVNKVKDELEKRGCQIRIGCEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST+E+G       ++  +  ++ YDGCIMAAHAPDTL+MLGK+ATFDE RILGAFQYVY
Sbjct  241   VSTNEEGCT-----VACTDGSKDVYDGCIMAAHAPDTLRMLGKEATFDETRILGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LH +Q+ +PRN AAWS+WNFLGT+N RVC+TYWLN LQNLG+T++PY VTLNPP T
Sbjct  296   SDIFLHCDQTLLPRNSAAWSSWNFLGTMNGRVCVTYWLNILQNLGETERPYCVTLNPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKWTTGHPVPSVAAS+ASSEL +IQGKR IWFCGAYQGYGFHEDGLKAG IAA G
Sbjct  356   PDHTLLKWTTGHPVPSVAASKASSELYQIQGKRGIWFCGAYQGYGFHEDGLKAGAIAAQG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LLKK  S L NP HMVP+WPETGARLLVTRFL SFI TG +ILLEEGGT+FTFEGT+KK+
Sbjct  416   LLKKNFSVLKNPTHMVPTWPETGARLLVTRFLKSFIATGCLILLEEGGTMFTFEGTEKKS  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKV +RVHSPQFYWKVATQ DLGLADA+IHGD SFVDK +GLLNLF IFV NRDL ASV
Sbjct  476   FLKVSLRVHSPQFYWKVATQGDLGLADAFIHGDFSFVDKNDGLLNLFMIFVNNRDLKASV  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             ++ + KRGWWTPLLFT+A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLFLDET
Sbjct  536   TKFSKKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FKSEDEDLK AQ RKISLLI KAK+ KEHHILEIGCGWGSLA+E V+RTGCKY
Sbjct  596   MTYSCAIFKSEDEDLKVAQERKISLLIKKAKVKKEHHILEIGCGWGSLAVEVVKRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP   RYDRIISCEMLEAVGHEFM 
Sbjct  656   TGITLSEQQLKYAKLRVQQAGLQDHITFLLCDYRQLPKMSRYDRIISCEMLEAVGHEFME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CES LAE+G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAM+A
Sbjct  716   EFFTCCESALAEDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMSA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEHLEDIGIHYYQTLRCWR NFLE+QSQI  LGFD KFIRTWEYYFDYCAAGF T
Sbjct  776   ASRLCVEHLEDIGIHYYQTLRCWRKNFLEKQSQIHALGFDDKFIRTWEYYFDYCAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKG  2997
             CTLGDYQIVFSRPGNV AFGDPY G
Sbjct  836   CTLGDYQIVFSRPGNVAAFGDPYNG  860



>ref|XP_009763750.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009763751.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
Length=865

 Score =  1483 bits (3839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 709/870 (81%), Positives = 786/870 (90%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT++ VDLDLGFMVFNRVT
Sbjct  1     MKVAVVGAGISGLVSAYELAKAGVEVVVYEKEDYLGGHAKTVTVNDVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGVDMEISDMSFSVSLD G+G EWGSR G SGLFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFENLGVDMEISDMSFSVSLDKGYGCEWGSRTGLSGLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV+SYLEE DNNPD+DRN+TLG FI+S GYSELFQKAY+IP+CASIWSC SEG
Sbjct  121   EIIKFKQDVISYLEELDNNPDIDRNETLGHFIQSHGYSELFQKAYLIPICASIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSAYSILSFCRNHHLLQLFGRPQWLTV+ RS +YVNKV+EELEKRGC++R GCEV+S
Sbjct  181   VMGFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEELEKRGCQLRTGCEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             +ST+E+G       ++  +  ++ YDGC+MAAHAPDTL+MLGK+AT DE RILGAFQYVY
Sbjct  241   ISTNEEGCT-----VTCTDGSEDVYDGCVMAAHAPDTLRMLGKEATCDETRILGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLH +++F+PRN AAWSAWNFLGT+NN+VC+TYWLN LQNLG+T++PY VTLNPP T
Sbjct  296   SDIYLHCDKTFLPRNPAAWSAWNFLGTMNNKVCVTYWLNILQNLGETERPYCVTLNPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKWTTGHPVPSVAAS ASSEL++IQGKR IWFCGAYQGYGFHEDGLKAG+IAA G
Sbjct  356   PEHTLLKWTTGHPVPSVAASIASSELDQIQGKRGIWFCGAYQGYGFHEDGLKAGVIAAQG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LLK+  S L NP HMVP+WPETGARLLVTRFL SFI TG IILLE+GGT+FTFEGT+ K+
Sbjct  416   LLKRNYSVLKNPKHMVPTWPETGARLLVTRFLKSFITTGCIILLEDGGTMFTFEGTENKS  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKV +RVHSPQFYWKVATQ DLGLADA+I GD SFVDK EGLLNLF IFV NRDL ASV
Sbjct  476   SLKVSLRVHSPQFYWKVATQGDLGLADAFIQGDFSFVDKNEGLLNLFMIFVNNRDLKASV  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             +RS+ KRGWWTPLLFT+A++SAKYFIRH+S QNTLT+ARRNISRHYDLSNELFSLFLD+T
Sbjct  536   TRSSKKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTRARRNISRHYDLSNELFSLFLDQT  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RTGCKY
Sbjct  596   MTYSCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGHEFM 
Sbjct  656   TGITLSEQQLKYAQKRVQQAGLQDHIIFLLCDYRQLPNMSRYDRIISCEMLEAVGHEFME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF   ES LAE+G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA
Sbjct  716   EFFTCSESALAEDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF T
Sbjct  776   ASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             CTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  836   CTLGDYQIVFSRPGNVAAFGDPYHGVPSTY  865



>ref|XP_009625531.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009625532.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =  1480 bits (3831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 707/870 (81%), Positives = 787/870 (90%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT+DGVDLDLGFMVFNRVT
Sbjct  1     MKVAVVGAGISGLVSAYELAKAGVKVVVYEKEDYLGGHAKTVTVDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV+SYLE  DNNPD+DRN+TLG FI++ GYSELFQKAY+IP+CASIWSC SEG
Sbjct  121   EIIKFKRDVISYLEALDNNPDIDRNETLGHFIQTHGYSELFQKAYLIPICASIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSAYSILSFCRNHHLLQLFGRPQWLTV+ RS +YVNKV+EE+EKRGC++R G EV+S
Sbjct  181   VMCFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEEMEKRGCQLRTGYEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             +ST+E+G       ++  +  ++ YDGC+MAAHAPDTL+MLGK+AT+DE RILGAFQYVY
Sbjct  241   ISTNEEGCT-----VACTDGSKDVYDGCVMAAHAPDTLRMLGKEATYDETRILGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPPRT
Sbjct  296   SDIYLHCDKTFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPRT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKWTTGHPVPSVAAS ASSEL++IQG+R IWFCGAYQGYGFHEDG+KAG IAA G
Sbjct  356   PEHTLLKWTTGHPVPSVAASIASSELDQIQGERGIWFCGAYQGYGFHEDGVKAGAIAAQG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LLK+  S LNNP HMVP+WPETGARLLVTRFL SFI T  IILLEEGGT+FTFEGT+ K+
Sbjct  416   LLKRNYSVLNNPKHMVPTWPETGARLLVTRFLKSFISTECIILLEEGGTMFTFEGTENKS  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKV +RVHSPQFYWKVATQ DLGLADA+I GD SFVDK +GLLNLF IFV NRDL ASV
Sbjct  476   SLKVSLRVHSPQFYWKVATQGDLGLADAFIQGDFSFVDKNDGLLNLFMIFVNNRDLKASV  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             +RS+ KRGWWTPLLFT+A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLFLDET
Sbjct  536   TRSSKKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RTGCKY
Sbjct  596   MTYSCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQLKYA+ +V++AGLQD+I F+LCDYRQLP+  RYDRIISCEMLEAVGHEFM+
Sbjct  656   TGITLSEQQLKYAQIRVQQAGLQDHITFILCDYRQLPNMSRYDRIISCEMLEAVGHEFMD  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA
Sbjct  716   EFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF T
Sbjct  776   ASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             CTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  836   CTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  865



>ref|XP_006354448.1| PREDICTED: uncharacterized protein LOC102604983 [Solanum tuberosum]
Length=862

 Score =  1480 bits (3831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 706/866 (82%), Positives = 785/866 (91%), Gaps = 5/866 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLVSAY LAK G  VV+Y+KE+Y+GGHAKTVT++GVDLDLGFMVFNRVT
Sbjct  1     MKVAVVGAGISGLVSAYELAKSGVKVVIYDKENYIGGHAKTVTVNGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGISGLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI++FK DV+SYLEE DNNPD+DRN+TLG FI+S GYSELFQKAY++P+CASIWSC S+G
Sbjct  121   EIIRFKQDVISYLEELDNNPDIDRNETLGHFIQSHGYSELFQKAYLVPICASIWSCPSDG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSAYSILSFCRNHHLLQLFGRPQWLTV+ RSH+YVNKV++ELEKRGC+IR GCEV+S
Sbjct  181   VMGFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSHTYVNKVKDELEKRGCQIRTGCEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST+E+G       ++  +  ++ YDGCIMAAHAPDTL+MLGK+AT+DE RILGAFQYVY
Sbjct  241   VSTNEEGCT-----VACTDGSKDIYDGCIMAAHAPDTLRMLGKEATYDETRILGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LH +++ +PRN AAWS+WNFLGT+N RVC+TYWLN LQNLG+T++PY VTLNPP T
Sbjct  296   SDIFLHCDKTLLPRNSAAWSSWNFLGTMNGRVCVTYWLNILQNLGETERPYCVTLNPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKWTTGHPVPSVAAS+ASSEL +IQGKR IWFCGAYQGYGFHEDGLKAG IAA G
Sbjct  356   PEHTLLKWTTGHPVPSVAASKASSELYQIQGKRGIWFCGAYQGYGFHEDGLKAGAIAAQG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LLKK  S L NP HMVP+WPETGARLLVTRFL SFI TG +ILLEEGGT+FTFEGT+KK+
Sbjct  416   LLKKNFSILKNPKHMVPTWPETGARLLVTRFLKSFIATGCLILLEEGGTMFTFEGTEKKS  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKV +RVHSPQFYWKVATQ DLGLADA+IHGD SFVDK +GLLNLF IFV NRDL ASV
Sbjct  476   SLKVSLRVHSPQFYWKVATQGDLGLADAFIHGDFSFVDKNDGLLNLFMIFVNNRDLKASV  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             +RS+ KRGWWTPLLFT+A++S KYFIRH+S QNTLTQARRNISRHYDLSNELFSLFLDET
Sbjct  536   TRSSKKRGWWTPLLFTAAVSSVKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FKSE+EDLK AQ RKISLLI KAK+ KEHHILEIGCGWGSLA+E V+RTGCKY
Sbjct  596   MTYSCAIFKSEEEDLKVAQERKISLLIKKAKVKKEHHILEIGCGWGSLAVEVVKRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGHEFM 
Sbjct  656   TGITLSEQQLKYAKLRVQQAGLQDHITFLLCDYRQLPNMSRYDRIISCEMLEAVGHEFME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CES LAE+G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAM+A
Sbjct  716   EFFTCCESALAEDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMSA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEHLEDIGIHYYQTLRCWR NFLE+QSQI  LGFD KFIRTWEYYFDYCAAGF T
Sbjct  776   ASRLCVEHLEDIGIHYYQTLRCWRKNFLEKQSQIHALGFDDKFIRTWEYYFDYCAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGL  3000
             CTLGDYQIVFSRPGNV AFGDPY G+
Sbjct  836   CTLGDYQIVFSRPGNVAAFGDPYNGV  861



>ref|XP_009625533.1| PREDICTED: uncharacterized protein LOC104116392 isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =  1478 bits (3826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 705/870 (81%), Positives = 786/870 (90%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT+DGVDLDLGFMVFNRVT
Sbjct  1     MKVAVVGAGISGLVSAYELAKAGVKVVVYEKEDYLGGHAKTVTVDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV+SYLE  DNNPD+DRN+TLG FI++ GYSELFQKAY+IP+CASIWSC SEG
Sbjct  121   EIIKFKRDVISYLEALDNNPDIDRNETLGHFIQTHGYSELFQKAYLIPICASIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSAYSILSFCRNHHLLQLFGRPQWLTV+ RS +YVNKV+EE+EKRGC++R G EV+S
Sbjct  181   VMCFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEEMEKRGCQLRTGYEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             +ST+E+G       ++  +  ++ YDGC+MAAHAPDTL+MLGK+AT+DE RILGAFQYVY
Sbjct  241   ISTNEEGCT-----VACTDGSKDVYDGCVMAAHAPDTLRMLGKEATYDETRILGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPP T
Sbjct  296   SDIYLHCDKTFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  +LKWTTGHP+PSVAAS ASSEL++IQGKR IWFCGAYQGYGFHEDG+KAG IAA G
Sbjct  356   PEHTMLKWTTGHPIPSVAASIASSELDQIQGKRGIWFCGAYQGYGFHEDGVKAGAIAAQG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LLK+  S LNNP HMVP+WPETGARLLVTRFL SFI T  IILLEEGGT+FTFEGT+ K+
Sbjct  416   LLKRNYSVLNNPKHMVPTWPETGARLLVTRFLKSFISTECIILLEEGGTMFTFEGTENKS  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKV +RVHSPQFYWKVATQ DLGLADA+I GD SFVDK +GLLNLF IFV NRDL ASV
Sbjct  476   SLKVSLRVHSPQFYWKVATQGDLGLADAFIQGDFSFVDKNDGLLNLFMIFVNNRDLKASV  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             +RS+ KRGWWTPLLFT+A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLFLDET
Sbjct  536   TRSSKKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RTGCKY
Sbjct  596   MTYSCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQLKYA+ +V++AGLQD+I F+LCDYRQLP+  RYDRIISCEMLEAVGHEFM+
Sbjct  656   TGITLSEQQLKYAQIRVQQAGLQDHITFILCDYRQLPNMSRYDRIISCEMLEAVGHEFMD  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA
Sbjct  716   EFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF T
Sbjct  776   ASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             CTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  836   CTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  865



>ref|XP_009617889.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009617890.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =  1475 bits (3819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 704/870 (81%), Positives = 782/870 (90%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT+DGVDLDLGFMVFNRVT
Sbjct  1     MKVAVVGAGISGLVSAYELAKAGVKVVVYEKEDYLGGHAKTVTVDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM+E FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMLEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGLSGLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV+SYLE  DNNPD+DRN+TLG FI+S  YSELFQKAY+IP+CASIWSC S+G
Sbjct  121   EIIKFKQDVISYLEALDNNPDIDRNETLGHFIQSHSYSELFQKAYLIPICASIWSCPSDG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSAYSILSFCRNHHLLQLFGRPQWLTV+ RS +YVNKV+EELEKRGC+++ GCEV+S
Sbjct  181   VMGFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEELEKRGCQLKTGCEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             +ST+E+G       ++  +  ++ YDGCIMAAHAPDTL+MLGK+AT+DE RILGAFQYVY
Sbjct  241   LSTNEEGCT-----VACTDGCKDVYDGCIMAAHAPDTLRMLGKEATYDETRILGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPP T
Sbjct  296   SDIYLHCDKNFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  +LKWTTGHPVPSVAAS ASSEL +IQGKR IWFCGAYQGYGFHEDGLKAG IAA G
Sbjct  356   PEHTMLKWTTGHPVPSVAASIASSELHQIQGKRGIWFCGAYQGYGFHEDGLKAGAIAAQG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LLK+  S LNNP HMVP+W ETGARLLVTRFL SFI TG IILLEEGGT+FTFEGT+ K+
Sbjct  416   LLKRNYSVLNNPKHMVPTWKETGARLLVTRFLKSFISTGCIILLEEGGTMFTFEGTENKS  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKV +RVHSP+FYWKVATQ DLGLADA+I GD SFVDK EGLLNLF IFV NRDL ASV
Sbjct  476   SLKVSLRVHSPRFYWKVATQGDLGLADAFIQGDFSFVDKNEGLLNLFMIFVNNRDLKASV  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             +RS+ KRGWWTPLLFT+A++SAKYF+RH+S QNTLTQARRNISRHYDLSNELFSLFLDET
Sbjct  536   TRSSKKRGWWTPLLFTAAVSSAKYFVRHVSNQNTLTQARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E  +RTGCKY
Sbjct  596   MTYSCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVAKRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGHEFM 
Sbjct  656   TGITLSEQQLKYAQLRVQQAGLQDHITFLLCDYRQLPNMSRYDRIISCEMLEAVGHEFME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CES LA +G+LVLQFISIPDERYDEYRQSSDFIKEYIFPG CLP+LSRVTSAMAA
Sbjct  716   EFFTCCESALAGDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGACLPALSRVTSAMAA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRL VEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF T
Sbjct  776   ASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDNKFIRTWEYYFDYCAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             CTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  836   CTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  865



>ref|XP_011073566.1| PREDICTED: uncharacterized protein LOC105158481 isoform X1 [Sesamum 
indicum]
Length=869

 Score =  1423 bits (3683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 689/871 (79%), Positives = 779/871 (89%), Gaps = 5/871 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             +MRVAVVG G+SGLV+AY+L  GG  VV+YEKEDYLGGHAKTVT+DG  LDLGFMVFNRV
Sbjct  4     RMRVAVVGGGVSGLVAAYILEGGGVEVVLYEKEDYLGGHAKTVTVDGTSLDLGFMVFNRV  63

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGVDME+SDMSF+VSLD G G EWGSRNGFSGLFAQK N+LNPYFW MI
Sbjct  64    TYPNMMEFFETLGVDMELSDMSFAVSLDGGRGCEWGSRNGFSGLFAQKTNILNPYFWTMI  123

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK+DVL+YLE+ DNNPD+DR +TLG F++S GYSELFQKAY+IP+C SIWSCSSE
Sbjct  124   REIIKFKDDVLNYLEQLDNNPDIDRTETLGHFVQSHGYSELFQKAYLIPICGSIWSCSSE  183

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM+FSAYSILSFCRNHHLLQLFGRPQWLTVK RS  YVN+VR+ LE RG  IR   EV 
Sbjct  184   GVMSFSAYSILSFCRNHHLLQLFGRPQWLTVKWRSQDYVNRVRDVLESRGSHIRTNSEVC  243

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST++ G       IS K+  ++ YDGCI+AAHAPD LKMLG+QATFDELRILGAFQY 
Sbjct  244   SVSTNDDGCT-----ISCKDGSEDTYDGCIIAAHAPDALKMLGQQATFDELRILGAFQYA  298

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDI+LHR+++ MPRN AAWSAWNFLG+V+N+VC+TYWLN LQN+ +T  P+LVTLNPP 
Sbjct  299   YSDIFLHRDKTLMPRNPAAWSAWNFLGSVDNKVCVTYWLNILQNISETGLPFLVTLNPPS  358

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TPE  LLKW+TGHP+PSVAA++ASSEL  IQGKRRIWFCGAYQGYGFHEDGLKAG++AA+
Sbjct  359   TPEHTLLKWSTGHPIPSVAATKASSELNLIQGKRRIWFCGAYQGYGFHEDGLKAGVVAAN  418

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL++RC+  NNP HMVP+W ETGARLLVTRFL SFI TG IILLE GGT+FTFEGT KK
Sbjct  419   GLLRERCTLHNNPKHMVPTWLETGARLLVTRFLDSFIATGCIILLETGGTMFTFEGTKKK  478

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
             + LKV +R+H+PQFYWKVAT+ADLGLADAYI+GD SFVDK EGLLNLF IFVANRDLS S
Sbjct  479   SSLKVSLRIHTPQFYWKVATEADLGLADAYINGDFSFVDKNEGLLNLFMIFVANRDLSTS  538

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S+ N+KRGWWTPLLFTSAIASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDE
Sbjct  539   TSKLNNKRGWWTPLLFTSAIASAKYFFQHMSRQNTLTQARRNISRHYDLSNELFSLFLDE  598

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYSCA+FK++DEDLK AQ+RK+ LLI+KA+I+K HHILEIGCGWG+LAIEAV RTGCK
Sbjct  599   TMTYSCAIFKTQDEDLKIAQLRKVFLLIEKARINKNHHILEIGCGWGTLAIEAVRRTGCK  658

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSEQQL+YAE KV+EAGLQD I+FLLCDYRQLP+  +YDRIISCEMLEAVGHE+M
Sbjct  659   YTGITLSEQQLQYAEAKVKEAGLQDRIKFLLCDYRQLPNTDKYDRIISCEMLEAVGHEYM  718

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFF  CESVL E+GILVLQFISIPDERY+EYRQS+DFIKEYIFPGGCLPSLSRVT+AM+
Sbjct  719   EEFFRCCESVLQEDGILVLQFISIPDERYNEYRQSADFIKEYIFPGGCLPSLSRVTTAMS  778

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             A+SRLCVEHLEDIGIHYYQTLR WR +FLE+QS+I  LGFD+KFIRTWEYYFDYCAAGF 
Sbjct  779   AASRLCVEHLEDIGIHYYQTLRRWRESFLEKQSKIQALGFDEKFIRTWEYYFDYCAAGFK  838

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             TCTLG+YQIVFSRPGNV AFGDPYK + SAY
Sbjct  839   TCTLGNYQIVFSRPGNVEAFGDPYKTIPSAY  869



>ref|XP_002281958.1| PREDICTED: uncharacterized protein LOC100249441 isoform X1 [Vitis 
vinifera]
Length=865

 Score =  1418 bits (3671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/870 (77%), Positives = 767/870 (88%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV LDLGFMVFNRVT
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVPLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGVDME+SDMSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61    YPNMMEFFETLGVDMELSDMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             +++KFK+DVL YLEE +NNPDMDRN TLG+FIK RGYSELFQKAY++P+CASIWSC +EG
Sbjct  121   DVIKFKDDVLKYLEELENNPDMDRNQTLGDFIKCRGYSELFQKAYLVPICASIWSCPAEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSA+S+LSFCRNHHLLQLFGRPQWLTVK RSH YVNKVREELE +GC+IR GCEV S
Sbjct  181   VMTFSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHYYVNKVREELESKGCQIRTGCEVVS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST + G      +  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV 
Sbjct  241   VSTTDDG----CTVFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVS  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LH +++FMP+N AAWSAWNFLGT++N+VCLTYWLN LQN+  T +P+LVTLNPP T
Sbjct  296   SDIFLHCDKNFMPQNPAAWSAWNFLGTIDNKVCLTYWLNVLQNIDQTSRPFLVTLNPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+T HP PSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAHG
Sbjct  356   PDHTLLKWSTSHPFPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK 
Sbjct  416   MLGKGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSRKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
             LLKV +++H+PQFYWK+ATQADLGLADAYI+GD S VDK EGL NLF IF+ANRDL +S+
Sbjct  476   LLKVSLKIHNPQFYWKIATQADLGLADAYINGDFSLVDKDEGLQNLFMIFIANRDLDSSL  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             SR N+KRGWWTPL FT+ IASA+YF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDET
Sbjct  536   SRLNNKRGWWTPLFFTAGIASARYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK+E EDLK AQ+RKISLLI+K +I K+H +LEIGCGWGSLAIE V+RTGCKY
Sbjct  596   MTYSCAVFKTEGEDLKVAQLRKISLLIEKVRIDKKHEVLEIGCGWGSLAIEVVKRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK+AE KV+EAGLQDNIRFLLCDYRQL D+ +YDRIISCEMLEAVGHE+M 
Sbjct  656   TGITLSEEQLKFAEMKVKEAGLQDNIRFLLCDYRQLSDSYKYDRIISCEMLEAVGHEYME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAA
Sbjct  716   EFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLC+EHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T
Sbjct  776   SSRLCMEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  836   HTLGNYQIVFSRPGNAAAFSNPYESVVSTY  865



>ref|XP_011029772.1| PREDICTED: uncharacterized protein LOC105129420 isoform X2 [Populus 
euphratica]
Length=865

 Score =  1414 bits (3661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/870 (77%), Positives = 766/870 (88%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV+ DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVVGAGISGLVSAYVLAKAGVEVVLYEKENYLGGHAKTVSFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLG+DME+SDMSFSVSLD G G EWGSRNG SGLFAQKKN+L+PYFW+M+R
Sbjct  61    YPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLSPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DVLSYLE  +NNPD+DRN+TLG+F+KSRGYSELFQKAY+IP+C SIWSC SEG
Sbjct  121   EIIKFKDDVLSYLEMLENNPDVDRNETLGKFVKSRGYSELFQKAYLIPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLL+LFGRPQWLTV RRSHSYVNKVRE+LE  GC+IR GCE+ +
Sbjct  181   VMSFSAFSVLSFCRNHHLLELFGRPQWLTVTRRSHSYVNKVREKLESWGCQIRTGCEIQA  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST ++G A     +  ++ + E Y GCIMA HAPD L +LGKQATFDE RILGAFQY+Y
Sbjct  241   VSTKDEGCA-----VLCRDGLLEMYSGCIMAVHAPDALALLGKQATFDETRILGAFQYMY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR++ FMP+N AAWSAWNFLG+ +N+VCLTYWLN LQN+ +T  P+LVTLNP   
Sbjct  296   SDIFLHRDKKFMPQNSAAWSAWNFLGSTDNKVCLTYWLNVLQNIDETGLPFLVTLNPDHV  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  L+KW+TGHPVPSVAA++AS EL+ IQGKRRIWFCGAYQGYGFHEDGLK+GM+AAHG
Sbjct  356   PDHTLVKWSTGHPVPSVAATKASLELDHIQGKRRIWFCGAYQGYGFHEDGLKSGMVAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL  RC+ L+NP HM PS  ETGARL VTRFL  +I TG +ILLEEGGTVF+FEGT KK 
Sbjct  416   LLGNRCAILSNPKHMAPSMLETGARLFVTRFLGHYISTGCLILLEEGGTVFSFEGTSKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFV+K EGLLNL  I + NRD++ S 
Sbjct  476   SLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVNKDEGLLNLLMILIVNRDVNKSA  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ N KRGWWTPLLFT+ IASAK+FI+H+SRQNTLTQARRNISRHYDLSNELF+LFLDET
Sbjct  536   SKLNKKRGWWTPLLFTAGIASAKFFIQHVSRQNTLTQARRNISRHYDLSNELFALFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSC VFK+EDEDLK AQMRKISLLI+KA ISK+H ILEIGCGWG+LAIEAV+RTGCKY
Sbjct  596   MTYSCGVFKTEDEDLKDAQMRKISLLIEKAGISKDHEILEIGCGWGTLAIEAVQRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK+AE KV+EAGLQD I F LCDYRQLP   +YDRIISCEM+EAVGHE+M 
Sbjct  656   TGITLSEEQLKHAEMKVKEAGLQDRIAFHLCDYRQLPKTHKYDRIISCEMIEAVGHEYME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TSAMA 
Sbjct  716   EFFGCCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITSAMAT  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDY AAGF T
Sbjct  776   SSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYSAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  836   HTLGNYQVVFSRPGNVVALSNPYKSFPSAY  865



>ref|XP_011029770.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
 ref|XP_011029771.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
Length=866

 Score =  1412 bits (3656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/870 (77%), Positives = 767/870 (88%), Gaps = 4/870 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV+ DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVVGAGISGLVSAYVLAKAGVEVVLYEKENYLGGHAKTVSFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLG+DME+SDMSFSVSLD G G EWGSRNG SGLFAQKKN+L+PYFW+M+R
Sbjct  61    YPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLSPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DVLSYLE  +NNPD+DRN+TLG+F+KSRGYSELFQKAY+IP+C SIWSC SEG
Sbjct  121   EIIKFKDDVLSYLEMLENNPDVDRNETLGKFVKSRGYSELFQKAYLIPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLL+LFGRPQWLTV RRSHSYVNKVRE+LE  GC+IR GCE+ +
Sbjct  181   VMSFSAFSVLSFCRNHHLLELFGRPQWLTVTRRSHSYVNKVREKLESWGCQIRTGCEIQA  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST ++  AG  V+   ++ + E Y GCIMA HAPD L +LGKQATFDE RILGAFQY+Y
Sbjct  241   VSTKDE--AGCAVLC--RDGLLEMYSGCIMAVHAPDALALLGKQATFDETRILGAFQYMY  296

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR++ FMP+N AAWSAWNFLG+ +N+VCLTYWLN LQN+ +T  P+LVTLNP   
Sbjct  297   SDIFLHRDKKFMPQNSAAWSAWNFLGSTDNKVCLTYWLNVLQNIDETGLPFLVTLNPDHV  356

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  L+KW+TGHPVPSVAA++AS EL+ IQGKRRIWFCGAYQGYGFHEDGLK+GM+AAHG
Sbjct  357   PDHTLVKWSTGHPVPSVAATKASLELDHIQGKRRIWFCGAYQGYGFHEDGLKSGMVAAHG  416

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL  RC+ L+NP HM PS  ETGARL VTRFL  +I TG +ILLEEGGTVF+FEGT KK 
Sbjct  417   LLGNRCAILSNPKHMAPSMLETGARLFVTRFLGHYISTGCLILLEEGGTVFSFEGTSKKC  476

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFV+K EGLLNL  I + NRD++ S 
Sbjct  477   SLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVNKDEGLLNLLMILIVNRDVNKSA  536

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ N KRGWWTPLLFT+ IASAK+FI+H+SRQNTLTQARRNISRHYDLSNELF+LFLDET
Sbjct  537   SKLNKKRGWWTPLLFTAGIASAKFFIQHVSRQNTLTQARRNISRHYDLSNELFALFLDET  596

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSC VFK+EDEDLK AQMRKISLLI+KA ISK+H ILEIGCGWG+LAIEAV+RTGCKY
Sbjct  597   MTYSCGVFKTEDEDLKDAQMRKISLLIEKAGISKDHEILEIGCGWGTLAIEAVQRTGCKY  656

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK+AE KV+EAGLQD I F LCDYRQLP   +YDRIISCEM+EAVGHE+M 
Sbjct  657   TGITLSEEQLKHAEMKVKEAGLQDRIAFHLCDYRQLPKTHKYDRIISCEMIEAVGHEYME  716

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TSAMA 
Sbjct  717   EFFGCCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITSAMAT  776

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDY AAGF T
Sbjct  777   SSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYSAAGFKT  836

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  837   HTLGNYQVVFSRPGNVVALSNPYKSFPSAY  866



>ref|XP_002311690.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEE89057.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=858

 Score =  1409 bits (3648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/870 (77%), Positives = 761/870 (87%), Gaps = 12/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV+ DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVVGAGISGLVSAYVLAKAGVEVVLYEKEDYLGGHAKTVSFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLG+DME+SDMSFSVSLD G G EWGSRNG SGLFAQKKN+LNPYFW+M+R
Sbjct  61    YPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLNPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DVLSYLE  +NNPD+DRN+TLG+F+KSRGYSELFQKAY+IP+C SIWSC SEG
Sbjct  121   EIIKFKDDVLSYLEMLENNPDVDRNETLGKFVKSRGYSELFQKAYLIPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLL++FGRPQWLTV RRSHSYV+KVRE+LE  GC+IR GCE+  
Sbjct  181   VMSFSAFSVLSFCRNHHLLEVFGRPQWLTVTRRSHSYVDKVREKLESWGCQIRTGCEI--  238

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
                       G   +  ++ + E Y GCIMA HAPD L +LGKQATFDE RILGAFQY+Y
Sbjct  239   ----------GCCAVLCRDGLLEMYSGCIMAVHAPDALALLGKQATFDETRILGAFQYMY  288

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR++ FMP+N AAWSAWNFLG+ +N+VCLTYWLN LQN+ +T  P+LVTLNP   
Sbjct  289   SDIFLHRDKKFMPQNSAAWSAWNFLGSTDNKVCLTYWLNVLQNIDETGLPFLVTLNPDHA  348

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  L+KW+TGHPVPSVAA++AS EL+ IQGKRRIWFCGAYQGYGFHEDGLK+GM+AAHG
Sbjct  349   PDHTLVKWSTGHPVPSVAATKASLELDHIQGKRRIWFCGAYQGYGFHEDGLKSGMVAAHG  408

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL   C+ L+NP HM PS  ETGARL VTRFL  +I TG +ILLEEGGTVF+FEGT KK 
Sbjct  409   LLGNSCAILSNPKHMAPSMLETGARLFVTRFLGHYISTGCLILLEEGGTVFSFEGTSKKC  468

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFV+K EGLLNLF I + NRD + S 
Sbjct  469   SLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVNKDEGLLNLFMILIVNRDANKSA  528

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ N KRGWWTPLLFT+ IASAK+FI+HISRQNTLTQARRNISRHYDLSNELF+LFLDET
Sbjct  529   SKLNKKRGWWTPLLFTAGIASAKFFIQHISRQNTLTQARRNISRHYDLSNELFALFLDET  588

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSC VFK+EDEDLK AQMRKISLLI+KA+ISK+H ILEIGCGWG+LAIEAV+RTGCKY
Sbjct  589   MTYSCGVFKTEDEDLKDAQMRKISLLIEKARISKDHEILEIGCGWGTLAIEAVQRTGCKY  648

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYAE KV+EAGLQD I F LCDYRQLP   +YDRIISCEM+EAVGHE+M 
Sbjct  649   TGITLSEEQLKYAEMKVKEAGLQDRIAFHLCDYRQLPKTHKYDRIISCEMIEAVGHEYME  708

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TSAMAA
Sbjct  709   EFFGCCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITSAMAA  768

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDYCAAGF T
Sbjct  769   SSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYCAAGFKT  828

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  829   HTLGNYQVVFSRPGNVVALSNPYKSFPSAY  858



>gb|EYU32577.1| hypothetical protein MIMGU_mgv1a001185mg [Erythranthe guttata]
Length=870

 Score =  1404 bits (3634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 676/871 (78%), Positives = 765/871 (88%), Gaps = 5/871 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KMRVAVVG G+SGLVSAYV+AKGG  VVVYEKEDYLGGHAKTVT+DG  LDLGFMVFNRV
Sbjct  4     KMRVAVVGGGVSGLVSAYVVAKGGVEVVVYEKEDYLGGHAKTVTVDGTSLDLGFMVFNRV  63

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGV+MEISDMSFSVSLD G G EWGSR GFSGLFAQKKN +NPYFW+MI
Sbjct  64    TYPNMMEFFETLGVEMEISDMSFSVSLDKGQGCEWGSRTGFSGLFAQKKNAINPYFWKMI  123

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             +EILKFK+DV++Y+EE DNNPD DRN+TLG FI+SRGYSELFQKAY+IP+C SIWSCSSE
Sbjct  124   KEILKFKDDVINYVEELDNNPDFDRNETLGHFIQSRGYSELFQKAYLIPICGSIWSCSSE  183

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM+FSAYSILSFCRNHHLLQLFGRPQWLTV+ RS  YV++V E LE RGC+IR   EV 
Sbjct  184   GVMSFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSQDYVHRVTEFLESRGCQIRTNSEVC  243

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVS D+ G       IS K+  ++ YD CI+ AHAPD LKMLG+ AT+DE RILGAFQY 
Sbjct  244   SVSADDDGCT-----ISCKDGSEDKYDACIIGAHAPDALKMLGQHATYDESRILGAFQYA  298

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDI+LHR++  MP+N AAWSAWNFLGT+NN+VC+TYWLN LQN+  T  P+L+TLNPP 
Sbjct  299   YSDIFLHRDKKLMPKNTAAWSAWNFLGTINNKVCVTYWLNILQNISQTGPPFLITLNPPS  358

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TPE  LLKW+TGHP+PSVAA++ASSEL  IQGKRRIWF GAYQGYGFHEDG+KAG++AA+
Sbjct  359   TPENTLLKWSTGHPIPSVAANKASSELNLIQGKRRIWFAGAYQGYGFHEDGVKAGIVAAN  418

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K C+   NP HMVPSW ETGARLLVTRFL S I  G++ILLE+GGT+FTFEGT KK
Sbjct  419   GLLGKSCTLRYNPKHMVPSWLETGARLLVTRFLQSLISIGTLILLEDGGTMFTFEGTKKK  478

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
             + LKV +R+H+PQFYWKVAT+ADLGLADAYI+GD SFVDK EG+LNLF IFVANR+LS S
Sbjct  479   SFLKVSLRIHTPQFYWKVATEADLGLADAYINGDFSFVDKNEGMLNLFMIFVANRELSTS  538

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S+ N+KRGWWTPLL TSAI+SAKYF  H+SRQN+LTQARRNISRHYDLSNELF+LFLDE
Sbjct  539   NSKLNNKRGWWTPLLLTSAISSAKYFYNHVSRQNSLTQARRNISRHYDLSNELFALFLDE  598

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TM YSCA+FK++DED+K AQ+RK+SLLI+K KI K  HILEIGCGWG+LAIEAV+RTGCK
Sbjct  599   TMMYSCAIFKTQDEDMKIAQLRKVSLLIEKGKIRKNDHILEIGCGWGTLAIEAVKRTGCK  658

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSEQQL+YAE KV+EAGLQD I+FLLCDYRQLP   +Y+RIISCEMLEAVGHE+M
Sbjct  659   YTGITLSEQQLEYAELKVKEAGLQDQIKFLLCDYRQLPKTEKYNRIISCEMLEAVGHEYM  718

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFFG CES LAE+G+ VLQFISIPDERY EYR+SSDFIKEYIFPGGCLPSLSRVTSAMA
Sbjct  719   EEFFGCCESALAEDGLFVLQFISIPDERYTEYRRSSDFIKEYIFPGGCLPSLSRVTSAMA  778

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             A+SRLCVEH+EDIGIHYYQTLRCWR NFL R S+I +LGFD+KFIRTWEYYFDYCAAGF 
Sbjct  779   AASRLCVEHVEDIGIHYYQTLRCWRENFLNRTSEIKNLGFDEKFIRTWEYYFDYCAAGFK  838

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             TCTLGDYQIVFSRPGNV AFGDPYK +  AY
Sbjct  839   TCTLGDYQIVFSRPGNVAAFGDPYKSVPCAY  869



>ref|XP_009586640.1| PREDICTED: uncharacterized protein LOC104084479 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =  1400 bits (3625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 672/870 (77%), Positives = 762/870 (88%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLV AY LAK G  VVVYEKEDYLGGHAKTVT+DGV LDLGFM FN+VT
Sbjct  1     MKVAVVGAGISGLVCAYELAKSGVKVVVYEKEDYLGGHAKTVTVDGVHLDLGFMFFNQVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME F  LG D EISDMSFSVSLD+GHG EWG+RNGFS LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFVFLGADTEISDMSFSVSLDHGHGCEWGTRNGFSSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK DV SYLE  DNNPD+D + T+G+FIKS GYSELFQK+Y+IP+C+SIWSC SEG
Sbjct  121   EISKFKQDVTSYLEALDNNPDIDCDKTIGQFIKSHGYSELFQKSYLIPICSSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSAYSILSF R+HHLLQLF  PQ LTV+ +S++YVNKV+E+LEKRGC+IR GCEV+ 
Sbjct  181   VMGFSAYSILSFFRDHHLLQLFSLPQLLTVRWKSYAYVNKVKEDLEKRGCQIRTGCEVNF  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST+E+G       I+  +  +E YDGC+MA HAPDTLKMLGK+AT+DE RILGAFQY+ 
Sbjct  241   VSTNEEGCT-----IACNDGAKEVYDGCVMAGHAPDTLKMLGKEATYDETRILGAFQYIC  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++F+PR+ AAWSA NFLGT+N+R  +TYWLN +QNLG T+QPY VTLNPP T
Sbjct  296   SDIFLHRDKTFLPRDPAAWSALNFLGTMNSRGSMTYWLNIIQNLGGTEQPYCVTLNPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  +LKWTTGHPVPSVAAS ASSEL +IQGKR IWFCGAYQGYG HEDGLKAG+ AA G
Sbjct  356   PEHTMLKWTTGHPVPSVAASIASSELHQIQGKRGIWFCGAYQGYGLHEDGLKAGVTAADG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L++ CS L+NP HMVP+WPETGARLLVTRFL SFI TG IILLE GGT+FTF+GTDKK 
Sbjct  416   VLRRNCSILDNPKHMVPTWPETGARLLVTRFLKSFIETGCIILLENGGTIFTFQGTDKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKV +RVHS QFYWKVATQ DLGLADA+IHGD SFVDK EGLLNLF IFVANRDL ASV
Sbjct  476   SLKVSLRVHSTQFYWKVATQGDLGLADAFIHGDFSFVDKNEGLLNLFMIFVANRDLKASV  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             +RS+ KRGWWTPLL T+A++SAKYFI+H+S QNTLT+ARRNISRHYDLSNELFSLFLDET
Sbjct  536   TRSSKKRGWWTPLLSTAALSSAKYFIQHVSNQNTLTKARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FKSE+EDLK AQ+RKISLLI KAKISKEHHILEIG GWGSLA+E V++TGCKY
Sbjct  596   MTYSCAIFKSENEDLKVAQLRKISLLIKKAKISKEHHILEIGFGWGSLAVEVVKQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TG+TLSEQQLKYA+  V++AGLQD I FLLCDYRQ+P+N +YDRIISC MLE VGH+F+ 
Sbjct  656   TGVTLSEQQLKYAQSIVQQAGLQDQITFLLCDYRQMPNNYKYDRIISCGMLEHVGHDFIG  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CE+ LAE+G+LV+QFISIPDERY+EYR+SSDFIKEYIFPGGCLP+L+RVTSAMAA
Sbjct  716   EFFSCCETALAEDGLLVVQFISIPDERYEEYRRSSDFIKEYIFPGGCLPALNRVTSAMAA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCV HLE+IGIHYYQTLRCWR  FL+ QSQI  LGFD KFIRTWEYYFDYCAAGF T
Sbjct  776   ASRLCVVHLEEIGIHYYQTLRCWREKFLKNQSQIRALGFDDKFIRTWEYYFDYCAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             CTLGDYQIVFSRPGNV  FGDPY G+ SAY
Sbjct  836   CTLGDYQIVFSRPGNVAVFGDPYNGVPSAY  865



>ref|XP_006493505.1| PREDICTED: uncharacterized protein LOC102615883 isoform X1 [Citrus 
sinensis]
 ref|XP_006493506.1| PREDICTED: uncharacterized protein LOC102615883 isoform X2 [Citrus 
sinensis]
Length=869

 Score =  1400 bits (3624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/871 (77%), Positives = 760/871 (87%), Gaps = 5/871 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KMRVAV+GAGISGLVSAYVLAK G  VV+YEK+DYLGGHAKTVT DGVDLDLGFMVFNRV
Sbjct  4     KMRVAVIGAGISGLVSAYVLAKAGVEVVLYEKDDYLGGHAKTVTFDGVDLDLGFMVFNRV  63

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFWQM+
Sbjct  64    TYPNMMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFWQML  123

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK+DVL YL+E ++NPD+DR++TLG+F+ SRGYSELFQKAY+IP+C SIWSC SE
Sbjct  124   REIIKFKDDVLGYLKELESNPDIDRSETLGQFVNSRGYSELFQKAYLIPICGSIWSCPSE  183

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV +FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RSHSYVNKVR++LE  GC+IR   EV 
Sbjct  184   GVTSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHSYVNKVRKQLESWGCQIRTSSEVC  243

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV   ++G      I+ G    +E Y+ C+MA HAPD LK+LG QATFDE RILGAFQYV
Sbjct  244   SVLPADKG----CTIVCGDG-SREFYNSCVMALHAPDALKILGNQATFDETRILGAFQYV  298

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDI+LHR++ FMP+N AAWSAWNFL + +++VCLTYWLN LQNLG+T  P+LVTLNP  
Sbjct  299   YSDIFLHRDKRFMPQNPAAWSAWNFLESFDSKVCLTYWLNVLQNLGETSLPFLVTLNPDH  358

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
              PE  LLKW+TGHPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM AAH
Sbjct  359   VPEHTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMTAAH  418

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             G+L K C+ L+NP HMVPS  ETGARL V RFL  +I TGS+ILLEEGGT+FTFEGT K 
Sbjct  419   GVLGKSCTLLSNPRHMVPSLKETGARLFVARFLGQYISTGSMILLEEGGTIFTFEGTRKN  478

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++R+HSPQFYWKV TQADLGLADAYI+GD SFVDK EGLLNLF I +ANRDL +S
Sbjct  479   CHLKTVLRIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNLFMILIANRDLDSS  538

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             VS+   KRGWW+P+LFT+ IASAKYF RHISRQNTLTQARRNISRHYDLSNELFSLFLDE
Sbjct  539   VSKLKQKRGWWSPMLFTAGIASAKYFFRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  598

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             +MTYSCAVFKSEDEDLK AQMRK+SLLI+KA++SK   +LEIGCGWG+LAIE V+RTGCK
Sbjct  599   SMTYSCAVFKSEDEDLKAAQMRKVSLLIEKARVSKGQEVLEIGCGWGTLAIEIVKRTGCK  658

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSE+QLKYAE KV+EAGLQD+IR  LCDYRQL    +YDRIISCEM+EAVGHEFM
Sbjct  659   YTGITLSEEQLKYAEMKVKEAGLQDHIRLYLCDYRQLAKANKYDRIISCEMIEAVGHEFM  718

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFFG CES+L E+G+LVLQFISIPDERY+EYR SSDFIKEYIFPGGCLPSLSR+TSAM+
Sbjct  719   EEFFGCCESLLVEDGLLVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPSLSRITSAMS  778

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             A+SRLCVE +E+IGIHYYQTLRCWR NF+E+QS+IL LGF+ KFIRTWEYYFDYCAAGF 
Sbjct  779   AASRLCVEQVENIGIHYYQTLRCWRKNFMEKQSKILALGFNDKFIRTWEYYFDYCAAGFK  838

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             + TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  839   SYTLGNYQIVFSRPGNVAAFSNPYKGFPSAY  869



>ref|XP_009357997.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357998.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357999.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009358000.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
Length=863

 Score =  1397 bits (3615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/865 (77%), Positives = 760/865 (88%), Gaps = 6/865 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+GAGISGLVSAYVLAK G  VVVYEK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVIGAGISGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME SDMSFS SLDNG G EWGSRNG SGLFAQK NL+NPYFWQM+R
Sbjct  61    YPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGSRNGLSGLFAQKTNLINPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D ++YLEE +NNPD+DR++TLG+FIKSRGYSELFQKAY++P+C SIWSC SEG
Sbjct  121   EITKFKHDAINYLEELENNPDIDRSETLGQFIKSRGYSELFQKAYLVPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RSH YV KVRE LE +GC IR   EVH 
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCHIRTSSEVHR  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST ++G      +ISG  + +E ++GCIMA HAPD +++LG QAT DELR+LGAFQYVY
Sbjct  241   VSTSDEG----CTVISGDGL-EEVFNGCIMAVHAPDAVRILGDQATSDELRVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MPRN AAWSAWNFLG+  N+VCLTYWLN LQN+ +T  P+LVTLNP  T
Sbjct  296   SDIFLHRDKNLMPRNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDETGLPFLVTLNPEHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAYQGYGFHEDGLKAGM AAHG
Sbjct  356   PKHTLLKWSTSHPVPSVAASKASLELPRIQGKRGIWFCGAYQGYGFHEDGLKAGMAAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
              L K C+ L+NP HMVPS  ETGARL VTRFL  FI TG +I LEEGGT+FTFEGT K  
Sbjct  416   FLGKGCALLDNPKHMVPSLTETGARLFVTRFLTHFISTGCLIFLEEGGTIFTFEGTGKGC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VH+PQFYWKV TQADLGLADAYI+GD SFVDK +GLLNL  I +ANRD ++S 
Sbjct  476   SLKCVIKVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDKGLLNLIMILIANRDANSSD  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+   KRGWWTPLLFT++IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDET
Sbjct  536   SKLTKKRGWWTPLLFTASIASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYS AVFK+E+EDLK AQ+RKIS+LI+KA+I K H +LEIGCGWGSLAI+ V++TGCKY
Sbjct  596   MTYSSAVFKTENEDLKVAQLRKISILIEKARIEKNHEVLEIGCGWGSLAIKVVKQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYA++KV+EAGLQD I+FLLCDYRQL +N +YDRIISCEMLE+VGHEFM+
Sbjct  656   TGITLSEEQLKYAQEKVKEAGLQDRIKFLLCDYRQLANN-KYDRIISCEMLESVGHEFMD  714

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CESVLAENG+LVLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAA
Sbjct  715   EFFSCCESVLAENGLLVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAA  774

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLCVEHLE+IGIHY+QTLR WR NFLERQS+IL LGFD+KFIRTWEYYFDYCAAGF T
Sbjct  775   SSRLCVEHLENIGIHYFQTLRYWRKNFLERQSEILALGFDEKFIRTWEYYFDYCAAGFRT  834

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKG  2997
             CTLG+YQ+VFSRPGNV AF +PY+G
Sbjct  835   CTLGNYQMVFSRPGNVPAFSNPYEG  859



>ref|XP_009358001.1| PREDICTED: uncharacterized protein LOC103948676 isoform X2 [Pyrus 
x bretschneideri]
Length=862

 Score =  1396 bits (3613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/865 (77%), Positives = 760/865 (88%), Gaps = 6/865 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+GAGISGLVSAYVLAK G  VVVYEK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVIGAGISGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME SDMSFS SLDNG G EWGSRNG SGLFAQK NL+NPYFWQM+R
Sbjct  61    YPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGSRNGLSGLFAQKTNLINPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D ++YLEE +NNPD+DR++TLG+FIKSRGYSELFQKAY++P+C SIWSC SEG
Sbjct  121   EITKFKHDAINYLEELENNPDIDRSETLGQFIKSRGYSELFQKAYLVPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RSH YV KVRE LE +GC IR   EVH 
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCHIRTSSEVHR  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST ++G      +ISG  + +E ++GCIMA HAPD +++LG QAT DELR+LGAFQYVY
Sbjct  241   VSTSDEG----CTVISGDGL-EEVFNGCIMAVHAPDAVRILGDQATSDELRVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MPRN AAWSAWNFLG+  N+VCLTYWLN LQN+ +T  P+LVTLNP  T
Sbjct  296   SDIFLHRDKNLMPRNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDETGLPFLVTLNPEHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAYQGYGFHEDGLKAGM AAHG
Sbjct  356   PKHTLLKWSTSHPVPSVAASKASLELPRIQGKRGIWFCGAYQGYGFHEDGLKAGMAAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
              L K C+ L+NP HMVPS  ETGARL VTRFL  FI TG +I LEEGGT+FTFEGT K  
Sbjct  416   FLGKGCALLDNPKHMVPSLTETGARLFVTRFLTHFISTGCLIFLEEGGTIFTFEGTGKGC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VH+PQFYWKV TQADLGLADAYI+GD SFVDK +GLLNL  I +ANRD ++S 
Sbjct  476   SLKCVIKVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDKGLLNLIMILIANRDANSSD  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+   KRGWWTPLLFT++IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDET
Sbjct  536   SKLTKKRGWWTPLLFTASIASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYS AVFK+E+EDLK AQ+RKIS+LI+KA+I K H +LEIGCGWGSLAI+ V++TGCKY
Sbjct  596   MTYSSAVFKTENEDLKVAQLRKISILIEKARIEKNHEVLEIGCGWGSLAIKVVKQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYA++KV+EAGLQD I+FLLCDYRQL +N +YDRIISCEMLE+VGHEFM+
Sbjct  656   TGITLSEEQLKYAQEKVKEAGLQDRIKFLLCDYRQLANN-KYDRIISCEMLESVGHEFMD  714

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CESVLAENG+LVLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAA
Sbjct  715   EFFSCCESVLAENGLLVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAA  774

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLCVEHLE+IGIHY+QTLR WR NFLERQS+IL LGFD+KFIRTWEYYFDYCAAGF T
Sbjct  775   SSRLCVEHLENIGIHYFQTLRYWRKNFLERQSEILALGFDEKFIRTWEYYFDYCAAGFRT  834

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKG  2997
             CTLG+YQ+VFSRPGNV AF +PY+G
Sbjct  835   CTLGNYQMVFSRPGNVPAFSNPYEG  859



>ref|XP_007227011.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
 gb|EMJ28210.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
Length=866

 Score =  1396 bits (3613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 668/869 (77%), Positives = 759/869 (87%), Gaps = 6/869 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFWQM+R
Sbjct  61    YPNMMELFERLGVDMETSDMSFSASLDKGQGCEWGSRNGLSSLFAQKRNLFNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D ++YLEE +NNPD+DRN+TLG+FIKSRGYSELFQKAY++P+C SIWSC SEG
Sbjct  121   EITKFKHDAINYLEELENNPDIDRNETLGQFIKSRGYSELFQKAYLVPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RSH YV KVR+ LE +GC+IR   EVH 
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVRQVLESKGCQIRTSSEVHR  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST ++G +    ++SG  + +E YD C+MA HAPD +++LG QAT DELR+LGAFQYVY
Sbjct  241   VSTTDEGCS----VLSGDGL-EEIYDRCVMAVHAPDAVRILGDQATSDELRVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MP+N AAWSAWNFLG+  N+VCLTYWLN LQN+ +   P+LVTLNP  T
Sbjct  296   SDIFLHRDKTLMPQNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDEKGLPFLVTLNPDHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAYQGYGFHEDGLKAGM AAHG
Sbjct  356   PEHTLLKWSTSHPVPSVAASKASVELHRIQGKRGIWFCGAYQGYGFHEDGLKAGMAAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K CS L+NP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT+F FEGT K  
Sbjct  416   MLGKGCSLLSNPKHMVPSLTETGARLFVTRFLRHYISTGCLILLEEGGTIFNFEGTRKGC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK ++RVH+PQFYWKV TQADLGLADAYI+ D SF+DK +GLLNLF I +ANRD ++S 
Sbjct  476   SLKCVLRVHTPQFYWKVMTQADLGLADAYINRDFSFIDKDKGLLNLFMILIANRDSNSSD  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ N KRGWWTPLLFT++IASAKYF +H+SRQNTLTQARRNISRHYDLSN+LFSLFLDET
Sbjct  536   SKLNKKRGWWTPLLFTASIASAKYFFQHVSRQNTLTQARRNISRHYDLSNDLFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYS AVFK+EDEDLKTAQ+RKISL I+K++I K H +LEIGCGWGSLAIE V++TGCKY
Sbjct  596   MTYSSAVFKTEDEDLKTAQLRKISLFIEKSRIEKNHEVLEIGCGWGSLAIEVVKQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYA+ KV++AGLQD IRFLLCDYRQLP N +YDRIISCEMLE+VGHEFM+
Sbjct  656   TGITLSEEQLKYAQKKVKDAGLQDRIRFLLCDYRQLP-NYKYDRIISCEMLESVGHEFMD  714

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAA
Sbjct  715   EFFACCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAA  774

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLCVEHLE+IGIHYYQTLRCWR NFLER S+IL LGF++ FIRTWEYYFDYCAAGF T
Sbjct  775   SSRLCVEHLENIGIHYYQTLRCWRKNFLERHSEILALGFNENFIRTWEYYFDYCAAGFKT  834

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
              TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  835   YTLGNYQIVFSRPGNTPAFADPYKGFPSA  863



>ref|XP_008224157.1| PREDICTED: uncharacterized protein LOC103323914 isoform X1 [Prunus 
mume]
Length=871

 Score =  1394 bits (3607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 670/870 (77%), Positives = 758/870 (87%), Gaps = 6/870 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KMRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRV
Sbjct  5     KMRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRV  64

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFWQM+
Sbjct  65    TYPNMMELFERLGVDMETSDMSFSASLDKGRGCEWGSRNGLSSLFAQKRNLFNPYFWQML  124

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI KFK+D ++YLEE +NNPD+DRN+TLG+FIKSRGYSELFQKAY++P+C SIWSC SE
Sbjct  125   REITKFKHDAINYLEELENNPDIDRNETLGQFIKSRGYSELFQKAYLVPVCGSIWSCPSE  184

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM+FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RSH YV KVRE LE +GC+IR   EVH
Sbjct  185   GVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCQIRTSSEVH  244

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
              VST ++G +    I+SG  + +E YDGCIMA HAPD +++LG QAT DELR+LGAFQYV
Sbjct  245   RVSTTDEGCS----ILSGDGL-EEIYDGCIMAVHAPDAVRILGDQATSDELRVLGAFQYV  299

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDI+LHR+++ MP+N AAWSAWNFLG+  N+VCLTYWLN LQN+ +   P+LVTLNP  
Sbjct  300   YSDIFLHRDKTLMPQNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDEKGLPFLVTLNPDH  359

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TPE  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAYQGYGFHEDGLKAGM AA 
Sbjct  360   TPEHTLLKWSTSHPVPSVAASKASVELHRIQGKRGIWFCGAYQGYGFHEDGLKAGMAAAR  419

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             G+L K CS L+NP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT+F FEGT K 
Sbjct  420   GILGKGCSLLSNPKHMVPSLTETGARLFVTRFLRHYISTGCLILLEEGGTIFNFEGTRKG  479

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++RVH+PQFYWKV TQADLGLADAYI+GD SF+DK +GLLNLF I +ANRD ++S
Sbjct  480   CSLKCVLRVHTPQFYWKVMTQADLGLADAYINGDFSFIDKDKGLLNLFMILIANRDSNSS  539

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S  N KRGWWTPLLFT++IASAKYF +H+SR+NTLTQARRNISRHYDLSN+LFS FLDE
Sbjct  540   DSTLNKKRGWWTPLLFTASIASAKYFFQHVSRKNTLTQARRNISRHYDLSNDLFSQFLDE  599

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFK+EDEDLKTAQ+RKISLLI+K++I K H +LEIGCGWGSLAIE V++TGCK
Sbjct  600   TMTYSSAVFKTEDEDLKTAQLRKISLLIEKSRIEKNHEVLEIGCGWGSLAIEVVKQTGCK  659

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSE+QLKYA+ KV++AGLQD IRFLLCDYRQL  N +YDRIISCEMLE+VGHEFM
Sbjct  660   YTGITLSEEQLKYAQQKVKDAGLQDRIRFLLCDYRQL-SNYKYDRIISCEMLESVGHEFM  718

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
             +EFF  CESVL +NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMA
Sbjct  719   DEFFACCESVLTDNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMA  778

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             ASSRLCVEHLE+IGIHYYQTLRCWR NFLER S+IL LGF++ FIRTWEYYFDYCAAGF 
Sbjct  779   ASSRLCVEHLENIGIHYYQTLRCWRKNFLERHSEILALGFNENFIRTWEYYFDYCAAGFK  838

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  839   TYTLGNYQIVFSRPGNTPAFTDPYKGFPSA  868



>ref|XP_008224158.1| PREDICTED: uncharacterized protein LOC103323914 isoform X2 [Prunus 
mume]
Length=866

 Score =  1391 bits (3601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 669/869 (77%), Positives = 757/869 (87%), Gaps = 6/869 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFWQM+R
Sbjct  61    YPNMMELFERLGVDMETSDMSFSASLDKGRGCEWGSRNGLSSLFAQKRNLFNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D ++YLEE +NNPD+DRN+TLG+FIKSRGYSELFQKAY++P+C SIWSC SEG
Sbjct  121   EITKFKHDAINYLEELENNPDIDRNETLGQFIKSRGYSELFQKAYLVPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RSH YV KVRE LE +GC+IR   EVH 
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCQIRTSSEVHR  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST ++G +    I+SG  + +E YDGCIMA HAPD +++LG QAT DELR+LGAFQYVY
Sbjct  241   VSTTDEGCS----ILSGDGL-EEIYDGCIMAVHAPDAVRILGDQATSDELRVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MP+N AAWSAWNFLG+  N+VCLTYWLN LQN+ +   P+LVTLNP  T
Sbjct  296   SDIFLHRDKTLMPQNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDEKGLPFLVTLNPDHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAYQGYGFHEDGLKAGM AA G
Sbjct  356   PEHTLLKWSTSHPVPSVAASKASVELHRIQGKRGIWFCGAYQGYGFHEDGLKAGMAAARG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K CS L+NP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT+F FEGT K  
Sbjct  416   ILGKGCSLLSNPKHMVPSLTETGARLFVTRFLRHYISTGCLILLEEGGTIFNFEGTRKGC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK ++RVH+PQFYWKV TQADLGLADAYI+GD SF+DK +GLLNLF I +ANRD ++S 
Sbjct  476   SLKCVLRVHTPQFYWKVMTQADLGLADAYINGDFSFIDKDKGLLNLFMILIANRDSNSSD  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S  N KRGWWTPLLFT++IASAKYF +H+SR+NTLTQARRNISRHYDLSN+LFS FLDET
Sbjct  536   STLNKKRGWWTPLLFTASIASAKYFFQHVSRKNTLTQARRNISRHYDLSNDLFSQFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYS AVFK+EDEDLKTAQ+RKISLLI+K++I K H +LEIGCGWGSLAIE V++TGCKY
Sbjct  596   MTYSSAVFKTEDEDLKTAQLRKISLLIEKSRIEKNHEVLEIGCGWGSLAIEVVKQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYA+ KV++AGLQD IRFLLCDYRQL  N +YDRIISCEMLE+VGHEFM+
Sbjct  656   TGITLSEEQLKYAQQKVKDAGLQDRIRFLLCDYRQL-SNYKYDRIISCEMLESVGHEFMD  714

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CESVL +NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAA
Sbjct  715   EFFACCESVLTDNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAA  774

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLCVEHLE+IGIHYYQTLRCWR NFLER S+IL LGF++ FIRTWEYYFDYCAAGF T
Sbjct  775   SSRLCVEHLENIGIHYYQTLRCWRKNFLERHSEILALGFNENFIRTWEYYFDYCAAGFKT  834

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
              TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  835   YTLGNYQIVFSRPGNTPAFTDPYKGFPSA  863



>ref|XP_010264925.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264926.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
Length=865

 Score =  1391 bits (3600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/870 (76%), Positives = 763/870 (88%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGLVSAYVLA  G  VV+YEKEDYLGGH++TVT+DG+DLDLGFMVFNRVT
Sbjct  1     MRVAVVGAGISGLVSAYVLANAGVDVVLYEKEDYLGGHSRTVTIDGLDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGV+ME SDMSFSVSLD GH YEWGSRNG + LFAQK N LNPYFW+M+R
Sbjct  61    YPNMMEFFESLGVEMETSDMSFSVSLDKGHDYEWGSRNGLASLFAQKTNALNPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV  YLEE +NNPD+DRN+TLG FI+S GYSELF+KAY+ PMCASIWSCSSEG
Sbjct  121   EIIKFKEDVFKYLEELENNPDLDRNETLGHFIESHGYSELFEKAYLAPMCASIWSCSSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
              M FSA+S+LSFCRNHHLLQLFGRPQWLTVK RSH+YVNKV+EELEKR CEI+ G  V S
Sbjct  181   AMGFSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHAYVNKVQEELEKRNCEIKTGYAVQS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST +    GG  +I G++  Q+ Y+GC++A HAPD L MLG +AT++E R+LGAFQY Y
Sbjct  241   VSTFD----GGCTVI-GEDGSQDTYNGCVIAVHAPDALTMLGTEATYEERRVLGAFQYAY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLHR++  MP+N  AWSAWNFLGT +N+VCLTYWLN LQN+G+T  P+LVTLNPP  
Sbjct  296   SDIYLHRDKKLMPQNPTAWSAWNFLGTTDNKVCLTYWLNVLQNIGETSLPFLVTLNPPYI  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  +LKW+T HPVPSVAAS AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAH 
Sbjct  356   PEHNILKWSTSHPVPSVAASNASLELDEIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHT  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
              L K C+ L NP  MVPS  ETGARL+VTRFL  +I  G ++LLEEGGTVFTFEG++KK 
Sbjct  416   FLGKNCAVLKNPEQMVPSLAETGARLIVTRFLRHYISAGCLMLLEEGGTVFTFEGSNKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VH+PQFYWKVAT+AD+GLADAYI+GD SFVDK+EGLLNLF IF+ANR+L +S 
Sbjct  476   PLKCVLKVHNPQFYWKVATEADIGLADAYINGDFSFVDKEEGLLNLFMIFIANRNLDSSD  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             +R+N++RGWWTPL  T+AIASAKYF  HISRQNTLTQARRNISRHYDLSN+LF+LFLD+T
Sbjct  536   ARNNNRRGWWTPLFLTAAIASAKYFFWHISRQNTLTQARRNISRHYDLSNDLFALFLDKT  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FK+E+EDLK AQ+RKIS+LI+KA+I + H ILEIGCGWGSLAIE V++TGCKY
Sbjct  596   MTYSCAIFKAENEDLKVAQLRKISVLIEKARIERNHEILEIGCGWGSLAIEVVKQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYAE +V+EAGLQD+I+FLLCDYRQLP + +YDRIISCEMLEAVGHE+M 
Sbjct  656   TGITLSEEQLKYAEQRVKEAGLQDHIKFLLCDYRQLPYSHKYDRIISCEMLEAVGHEYME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EF G CESVLAENG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGC+PSLSRVTSAMA+
Sbjct  716   EFLGCCESVLAENGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCIPSLSRVTSAMAS  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEHLE+IGIHYYQTL  WR +F+E+QS+IL LGFD+KFIRTWEYYF YCAAGF +
Sbjct  776   ASRLCVEHLENIGIHYYQTLIYWRNSFMEKQSEILALGFDEKFIRTWEYYFIYCAAGFRS  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TLG+YQIVFSRPGN+TAF DPYKGL SA+
Sbjct  836   RTLGNYQIVFSRPGNLTAFSDPYKGLPSAF  865



>ref|XP_004296397.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
Length=865

 Score =  1390 bits (3599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 663/870 (76%), Positives = 756/870 (87%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG+GISGLV+AYVLAK G  V +YEKEDYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVVGSGISGLVAAYVLAKDGVEVDLYEKEDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGV+MEISDMSFS SLD G GYEWGSRNG S LFAQK N+LNPYFWQM+R
Sbjct  61    YPNMMEFFESLGVEMEISDMSFSASLDKGKGYEWGSRNGLSSLFAQKSNVLNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D LSYLE  +NNPD+DRN+TLG+FI+SR YSELFQKAY++P+C SIWSC +EG
Sbjct  121   EITKFKHDALSYLEVRENNPDIDRNETLGKFIESRHYSELFQKAYLVPICGSIWSCPAEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RSH YV KVRE LE +GC IR  CEVH 
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCRIRTSCEVHK  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST+++GS     ++SG    +E Y+GCIMA HAPD +++LG QAT DELR+LGAFQYVY
Sbjct  241   VSTNDEGS----TVVSGDEF-EEIYNGCIMAVHAPDAVRILGDQATSDELRVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR++  MP+N AAWSAWNFLG+ +N+VCLTYWLN LQNLG+T  P+LVTLNP  T
Sbjct  296   SDIFLHRDKDLMPQNPAAWSAWNFLGSTDNKVCLTYWLNVLQNLGETSLPFLVTLNPDHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+T HP+PSVAAS+A+ EL  IQGKR IWFCGAYQGYGFHEDGLKAGM AAHG
Sbjct  356   PKHTLLKWSTTHPIPSVAASKAALELPHIQGKRGIWFCGAYQGYGFHEDGLKAGMAAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L   C+ L+NP HMVPS  ETGARL VTRF+  +I TG +ILLEEGGT+FTFEGT K  
Sbjct  416   ILGNNCALLSNPKHMVPSLTETGARLFVTRFIRHYISTGCLILLEEGGTMFTFEGTRKGC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VH+PQFYWKV TQADLGLADAYI+GD SFVDK  GLLNLF I +ANRD  +S 
Sbjct  476   SLKCVLKVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDRGLLNLFMILIANRDNDSSD  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+   KRGWWTP+LFT++IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDET
Sbjct  536   SKLIKKRGWWTPMLFTASIASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYS AVFK+EDE+LK AQ+RKIS+LI+KAKISK H +LEIGCGWGSLAIE V +TGC+Y
Sbjct  596   MTYSSAVFKTEDEELKIAQLRKISILIEKAKISKNHEVLEIGCGWGSLAIEVVRQTGCRY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLS++QLKYA+ KV++A LQD IRFLLCDYRQ+P N + DRIISCEMLE+VGHEFMN
Sbjct  656   TGITLSQEQLKYAQQKVKDADLQDRIRFLLCDYRQMPANYKCDRIISCEMLESVGHEFMN  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             +FF  CESVLAENG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAM  
Sbjct  716   DFFASCESVLAENGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMVN  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLCVEH+E+IGIHYYQTLR WR NFLERQS+IL LGF++KFIRTWEYYFDYCAAGF T
Sbjct  776   SSRLCVEHIENIGIHYYQTLRYWRKNFLERQSEILALGFNEKFIRTWEYYFDYCAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  836   YTLGNYQIVFSRPGNVPAFSNPYKGFPSAY  865



>ref|XP_002314493.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEF00664.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=869

 Score =  1389 bits (3596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 662/872 (76%), Positives = 760/872 (87%), Gaps = 6/872 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             +MRVAVVGAGISGLVSAYVLAK GA VV+YEKED LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3     RMRVAVVGAGISGLVSAYVLAKAGAEVVLYEKEDSLGGHAKTVCFDGVDLDLGFMVFNRV  62

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LG+DME+SDMSFSVSLD G G EWGSRNGFSGLFAQKKN LNPYFW+M+
Sbjct  63    TYPNMMEFFENLGIDMELSDMSFSVSLDQGKGCEWGSRNGFSGLFAQKKNALNPYFWKML  122

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK+DVLSYLE  +N+P +DRN+TLG+F+KSRGYSELFQKAY++P+C SIWSC SE
Sbjct  123   REIVKFKDDVLSYLEVLENDPVVDRNETLGQFVKSRGYSELFQKAYLVPVCGSIWSCPSE  182

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM FSA+S+LSFCRNHHLLQLFGRPQWLTV+RRSHSYVNKVRE+LE  GC+IR GCEV 
Sbjct  183   GVMNFSAFSVLSFCRNHHLLQLFGRPQWLTVRRRSHSYVNKVREKLESWGCQIRTGCEVQ  242

Query  1120  SVST-DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
             +VST DE G A  V+ I G   + E Y GCIMA HAPD L +LG+QATFDE RILGAFQY
Sbjct  243   AVSTTDEAGCA--VLCIDG---LLEMYSGCIMAVHAPDALGLLGEQATFDETRILGAFQY  297

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
             +YS+I+LHR++++MP+N AAWSAWNFLG+  N+VCLTYWLN LQN+ +T  P+LVTLNP 
Sbjct  298   MYSEIFLHRDKTYMPQNSAAWSAWNFLGSTENKVCLTYWLNVLQNIDETGLPFLVTLNPD  357

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
               P+  LLKW+TG PVPSVAA++AS EL+ IQGKRRIWF GAYQGYGF+EDGLK+GM+AA
Sbjct  358   NAPDHTLLKWSTGRPVPSVAATKASLELDHIQGKRRIWFGGAYQGYGFYEDGLKSGMVAA  417

Query  1657  HGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1836
             HGLL K C  L NP HMVPS  ETGARL VTRFL   I TG + LLE+GGTVF+FEGT K
Sbjct  418   HGLLGKSCDILRNPKHMVPSMLETGARLFVTRFLGHHISTGCLTLLEDGGTVFSFEGTSK  477

Query  1837  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2016
             K  LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFVDK EGL+NLF I + NRD   
Sbjct  478   KCSLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLINLFMILIVNRDADN  537

Query  2017  SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLD  2196
             S S+ N KRGWWTPLLFT+ IASAK+FI+H+SRQNTLTQARRNISRHYDLSNELF+LFLD
Sbjct  538   STSKLNKKRGWWTPLLFTAGIASAKFFIQHVSRQNTLTQARRNISRHYDLSNELFALFLD  597

Query  2197  ETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGC  2376
             ETMTYSCA+FK EDEDLK AQ+RKISLLI+KA+++K+H +LEIGCGWG+LAIE V+RTGC
Sbjct  598   ETMTYSCALFKKEDEDLKAAQIRKISLLIEKARVNKDHEVLEIGCGWGTLAIEVVQRTGC  657

Query  2377  KYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEF  2556
             KYTGITLSE+QLKYAE KV+EAGLQD+I+F LCDYRQLP   +YD IISCEM+EAVGHE+
Sbjct  658   KYTGITLSEEQLKYAELKVKEAGLQDSIKFHLCDYRQLPKTHKYDTIISCEMIEAVGHEY  717

Query  2557  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2736
             M EFFG CESVLAENG+ VLQFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAM
Sbjct  718   MEEFFGCCESVLAENGLFVLQFISIPEERYDEYRKSSDFIKEYIFPGGCLPSLTRITSAM  777

Query  2737  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2916
             A+SSRLCVEH+E+IGI YYQTLR WR NFLE Q + L LGF++KFIRTWEYYFDYCAAGF
Sbjct  778   ASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQRETLSLGFNEKFIRTWEYYFDYCAAGF  837

Query  2917  HTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  838   KTHTLGNYQVVFSRPGNVVALSNPYRGFPSAY  869



>ref|XP_010650134.1| PREDICTED: uncharacterized protein LOC100242555 isoform X3 [Vitis 
vinifera]
Length=865

 Score =  1387 bits (3590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/870 (76%), Positives = 759/870 (87%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+VT
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61    YPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK+DVL YLEE +NNPD+DRN TLG+FIK RGYSELFQKAY++P+CASIW CS+EG
Sbjct  121   EMIKFKDDVLKYLEELENNPDIDRNQTLGDFIKCRGYSELFQKAYLVPICASIWPCSAEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+ +LSFCRNHHLLQLFG PQWLTVK  SH YVNKVREELE +GC+IR  CEV S
Sbjct  181   VMSFSAFLVLSFCRNHHLLQLFGHPQWLTVKCCSHYYVNKVREELESKGCQIRTACEVVS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST + G      I  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV 
Sbjct  241   VSTTDDG----CTIFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVS  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++FMP+N AAWSAWNFLGT+ N+VCL+YWLN LQN+  T  P+LVTLNP  T
Sbjct  296   SDIFLHRDKNFMPQNPAAWSAWNFLGTIENKVCLSYWLNVLQNIDQTSLPFLVTLNPSHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAH 
Sbjct  356   PDHTLLKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHS  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK 
Sbjct  416   ILGKGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSGKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
             LLKV +++H+PQFYWK+ATQADLGLADAYI+GD S VDK EGL +LF IF+ANRDL +S+
Sbjct  476   LLKVALKIHNPQFYWKIATQADLGLADAYINGDFSLVDKDEGLQSLFMIFIANRDLDSSL  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             SR N KRGWWTPL FT+ IASAKY+ +H+SRQNTLTQARRN+SRHYDLSNELFSLFLDET
Sbjct  536   SRLNKKRGWWTPLFFTAGIASAKYYFQHVSRQNTLTQARRNVSRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK+E EDLK AQ+RKISLLI+KA+I K+H +LEIGCGWGSLAIE V++TGCKY
Sbjct  596   MTYSCAVFKTEGEDLKVAQLRKISLLIEKARIDKKHEVLEIGCGWGSLAIEVVKQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGIT S++QLK+AE KV+EAGLQDNIRFLLCDYRQLP++ +YDRIISC MLE+VGHE+M 
Sbjct  656   TGITPSKEQLKFAEMKVKEAGLQDNIRFLLCDYRQLPNSYKYDRIISCGMLESVGHEYME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMA 
Sbjct  716   EFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAT  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T
Sbjct  776   ASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  836   RTLGDYQIVFSRPGNATAFSDPYKSVVSPY  865



>emb|CDO99279.1| unnamed protein product [Coffea canephora]
Length=851

 Score =  1385 bits (3586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/871 (76%), Positives = 764/871 (88%), Gaps = 22/871 (3%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             K+RVAVVGAGISGLV+A+VLAK G  VV+YEKEDYLGGHAKTVT+DG+DLDLGFMVFNRV
Sbjct  3     KLRVAVVGAGISGLVAAHVLAKEGVDVVIYEKEDYLGGHAKTVTMDGIDLDLGFMVFNRV  62

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMMELFE+LGVDME+SDMSFSVSLD G G EWGSRNG S LFAQKKN+LNP FWQMI
Sbjct  63    TYPNMMELFENLGVDMELSDMSFSVSLDKGKGCEWGSRNGLSSLFAQKKNVLNPKFWQMI  122

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DV+SY+EE + NPD+DRN+TLG FI+SRGYSELFQKAY++P+CASIWSCSSE
Sbjct  123   REIVKFKADVISYVEELEKNPDLDRNETLGHFIRSRGYSELFQKAYLVPICASIWSCSSE  182

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV+ FSAYSILSFCRNHHLLQLFGRPQWLTV+ RS +Y++KV+++LE+RGC+IR GCEV 
Sbjct  183   GVLNFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSQTYISKVKDDLERRGCQIRNGCEVR  242

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             +VST ++G      +++ +N   E Y+ CI+AAHAPD LK+LG+QAT+DE RILGAFQY 
Sbjct  243   AVSTKDEG-----CVVTCENGSIEVYNSCIVAAHAPDALKILGEQATYDESRILGAFQYA  297

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDI+LHR+++FMP+N AAWSAWNFLGTV+N+VC+TYWLN LQNLG+T  PYLVTLNPP 
Sbjct  298   YSDIFLHRDKNFMPQNPAAWSAWNFLGTVDNKVCVTYWLNILQNLGETGLPYLVTLNPPH  357

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TPE  LL+W+TGHPVPSVAAS+AS+ L  IQGKR IWFCGAYQGYGFHEDGLKAG +AA 
Sbjct  358   TPENTLLRWSTGHPVPSVAASKASTRLNDIQGKRGIWFCGAYQGYGFHEDGLKAGTVAAQ  417

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
              LL+K C+ L+NP HMVPSW ETGARLLVT+FL  FI TGS++LLEEGGT+F        
Sbjct  418   SLLRKSCTILSNPKHMVPSWTETGARLLVTKFLNGFIATGSLMLLEEGGTIF--------  469

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
                   +  HS      VATQADLGLADAYI+GDISFVDK EGLLNLF ++VANRDL AS
Sbjct  470   ------IGRHSISL---VATQADLGLADAYINGDISFVDKNEGLLNLFMVYVANRDLKAS  520

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             V+ S+ +RGWWTPLL T+ +ASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDE
Sbjct  521   VTSSSYQRGWWTPLLLTAGLASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDE  580

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYSCA+FKSEDEDLK AQ+RKISLLI++A+ISK+HH+LEIGCGWGSLAIE V+RTGC+
Sbjct  581   TMTYSCAIFKSEDEDLKIAQLRKISLLIERARISKDHHVLEIGCGWGSLAIEVVKRTGCQ  640

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSE+QL YAE KVRE G+QD+I+FLLCDYRQLP+  +YDRIISCEMLEAVGHEFM
Sbjct  641   YTGITLSEKQLTYAEQKVREVGMQDHIKFLLCDYRQLPETYKYDRIISCEMLEAVGHEFM  700

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              ++F  C SVLAE+GILVLQFISIPDERY+EYRQSSDFI+EYIFPGGCLPSLSRVTSAMA
Sbjct  701   EKYFSSCNSVLAEDGILVLQFISIPDERYEEYRQSSDFIREYIFPGGCLPSLSRVTSAMA  760

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             A+S LCVEHLE+ GIHYY TLR WR NFL +QS+IL+LGFD+KFIRTWEYYFDYCAAGF 
Sbjct  761   AASGLCVEHLENFGIHYYHTLRRWRTNFLSKQSEILELGFDEKFIRTWEYYFDYCAAGFK  820

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             TCTLG+YQ+VFSRPGNV +FG+  KG+ SAY
Sbjct  821   TCTLGNYQVVFSRPGNVVSFGNLQKGVPSAY  851



>ref|XP_010650133.1| PREDICTED: uncharacterized protein LOC100242555 isoform X2 [Vitis 
vinifera]
Length=866

 Score =  1383 bits (3580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/871 (76%), Positives = 759/871 (87%), Gaps = 6/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR-V  579
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+ V
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQQV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
              E++KFK+DVL YLEE +NNPD+DRN TLG+FIK RGYSELFQKAY++P+CASIW CS+E
Sbjct  121   GEMIKFKDDVLKYLEELENNPDIDRNQTLGDFIKCRGYSELFQKAYLVPICASIWPCSAE  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM+FSA+ +LSFCRNHHLLQLFG PQWLTVK  SH YVNKVREELE +GC+IR  CEV 
Sbjct  181   GVMSFSAFLVLSFCRNHHLLQLFGHPQWLTVKCCSHYYVNKVREELESKGCQIRTACEVV  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST + G      I  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV
Sbjct  241   SVSTTDDG----CTIFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYV  295

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
              SDI+LHR+++FMP+N AAWSAWNFLGT+ N+VCL+YWLN LQN+  T  P+LVTLNP  
Sbjct  296   SSDIFLHRDKNFMPQNPAAWSAWNFLGTIENKVCLSYWLNVLQNIDQTSLPFLVTLNPSH  355

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP+  LLKW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAH
Sbjct  356   TPDHTLLKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAH  415

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
              +L K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK
Sbjct  416   SILGKGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSGKK  475

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
              LLKV +++H+PQFYWK+ATQADLGLADAYI+GD S VDK EGL +LF IF+ANRDL +S
Sbjct  476   CLLKVALKIHNPQFYWKIATQADLGLADAYINGDFSLVDKDEGLQSLFMIFIANRDLDSS  535

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             +SR N KRGWWTPL FT+ IASAKY+ +H+SRQNTLTQARRN+SRHYDLSNELFSLFLDE
Sbjct  536   LSRLNKKRGWWTPLFFTAGIASAKYYFQHVSRQNTLTQARRNVSRHYDLSNELFSLFLDE  595

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYSCAVFK+E EDLK AQ+RKISLLI+KA+I K+H +LEIGCGWGSLAIE V++TGCK
Sbjct  596   TMTYSCAVFKTEGEDLKVAQLRKISLLIEKARIDKKHEVLEIGCGWGSLAIEVVKQTGCK  655

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGIT S++QLK+AE KV+EAGLQDNIRFLLCDYRQLP++ +YDRIISC MLE+VGHE+M
Sbjct  656   YTGITPSKEQLKFAEMKVKEAGLQDNIRFLLCDYRQLPNSYKYDRIISCGMLESVGHEYM  715

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMA
Sbjct  716   EEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMA  775

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
              +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF 
Sbjct  776   TASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFK  835

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  836   TRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  866



>emb|CBI23697.3| unnamed protein product [Vitis vinifera]
Length=898

 Score =  1381 bits (3575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/903 (74%), Positives = 762/903 (84%), Gaps = 38/903 (4%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGF-------  561
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV   LGF       
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVTGILGFRNGTIMS  60

Query  562   ----------------MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  693
                             M+   VTYPNMME FE+LGVDME+SDMSF+VSLD G G EWGSR
Sbjct  61    VNFVLLGTYILLDLIGMMARDVTYPNMMEFFETLGVDMELSDMSFAVSLDEGRGCEWGSR  120

Query  694   NGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGY  873
             NG S LFAQKKN+LNPYFWQMI +++KFK+DVL YLEE +NNPDMDRN TLG+FIK RGY
Sbjct  121   NGLSSLFAQKKNILNPYFWQMIGDVIKFKDDVLKYLEELENNPDMDRNQTLGDFIKCRGY  180

Query  874   SELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSY  1053
             SELFQKAY++P+CASIWSC +EGVM FSA+S+LSFCRNHHLLQLFGRPQWLTVK RSH Y
Sbjct  181   SELFQKAYLVPICASIWSCPAEGVMTFSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHYY  240

Query  1054  VNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDT  1233
             VNKVREELE +GC+IR GCEV SVST + G      +  G    QE +DGCIMA HAPD 
Sbjct  241   VNKVREELESKGCQIRTGCEVVSVSTTDDG----CTVFCGDG-SQEMHDGCIMAVHAPDA  295

Query  1234  LKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYW  1413
             L +LG +ATFDE+R+LGAFQYV SDI+LH +++FMP+N AAWSAWNFLGT++N+VCLTYW
Sbjct  296   LNILGNKATFDEMRVLGAFQYVSSDIFLHCDKNFMPQNPAAWSAWNFLGTIDNKVCLTYW  355

Query  1414  LNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWF  1593
             LN LQN+  T +P+LVTLNPP TP+  LLKW+T HP PSVAAS+AS EL+ IQGKR IWF
Sbjct  356   LNVLQNIDQTSRPFLVTLNPPHTPDHTLLKWSTSHPFPSVAASKASLELDHIQGKRGIWF  415

Query  1594  CGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIV  1773
             CGAYQGYGFHEDGLKAGM+AAHG+L K C+ LNNP HMVPS  ETGARL VTRFL  +I 
Sbjct  416   CGAYQGYGFHEDGLKAGMVAAHGMLGKGCAVLNNPKHMVPSLLETGARLFVTRFLGHYIS  475

Query  1774  TGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWK----------VATQADLGLAD  1923
             TG +ILLEEGGT++TFEG+ KK LLKV +++H+PQFYWK          +ATQADLGLAD
Sbjct  476   TGCLILLEEGGTIYTFEGSRKKCLLKVSLKIHNPQFYWKAWPFHLHSLQIATQADLGLAD  535

Query  1924  AYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIR  2103
             AYI+GD S VDK EGL NLF IF+ANRDL +S+SR N+KRGWWTPL FT+ IASA+YF +
Sbjct  536   AYINGDFSLVDKDEGLQNLFMIFIANRDLDSSLSRLNNKRGWWTPLFFTAGIASARYFFQ  595

Query  2104  HISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLI  2283
             H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK+E EDLK AQ+RKISLLI
Sbjct  596   HVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKTEGEDLKVAQLRKISLLI  655

Query  2284  DKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIR  2463
             +K +I K+H +LEIGCGWGSLAIE V+RTGCKYTGITLSE+QLK+AE KV+EAGLQDNIR
Sbjct  656   EKVRIDKKHEVLEIGCGWGSLAIEVVKRTGCKYTGITLSEEQLKFAEMKVKEAGLQDNIR  715

Query  2464  FLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDER  2643
             FLLCDYRQL D+ +YDRIISCEMLEAVGHE+M EFFG CESVLAE+G+LVLQFISIPDER
Sbjct  716   FLLCDYRQLSDSYKYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDER  775

Query  2644  YDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANF  2823
             YDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYYQTLR WR NF
Sbjct  776   YDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNF  835

Query  2824  LERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLA  3003
             LE QS+I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  AF +PY+ + 
Sbjct  836   LENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVV  895

Query  3004  SAY  3012
             S Y
Sbjct  896   STY  898



>ref|XP_007035209.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035210.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035211.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06135.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06136.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06137.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
Length=865

 Score =  1380 bits (3573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/869 (75%), Positives = 760/869 (87%), Gaps = 5/869 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+G GISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1     MRTAVIGGGISGLVSAYVLAKSGVNVVLYEKEDYLGGHAKTVNFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME SDMSF+VSLD G G EWGSRNG S LFA+K N+LNPYFW+M+R
Sbjct  61    YPNMMEFFESLGVDMEASDMSFAVSLDEGKGCEWGSRNGLSSLFAKKMNILNPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+DV+SYLE  +NNPD+DRN+TLG+FI+SRGYSELFQKAY++P+C SIWSC +E 
Sbjct  121   EISKFKDDVISYLEVLENNPDIDRNETLGQFIESRGYSELFQKAYLVPICGSIWSCPTER  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSA+SILSFCRNHHLLQLFGRPQW+TV+ RSH YVNKVR+ELE RGC+IR GCEVHS
Sbjct  181   VMGFSAFSILSFCRNHHLLQLFGRPQWMTVRWRSHRYVNKVRKELESRGCQIRTGCEVHS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V T    +A G  ++ G +  QE Y+GC+MA HAPD L++LG QAT+DELR+LGAFQYVY
Sbjct  241   VLT----TAEGCTVLCGDDS-QETYEGCVMAVHAPDALRLLGNQATYDELRVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MP+N AAWSAWNFLG+ + +VCLTYWLN LQNLG+T  P+LVTLNP   
Sbjct  296   SDIFLHRDKNLMPKNPAAWSAWNFLGSTDKKVCLTYWLNVLQNLGETSLPFLVTLNPDYI  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+Q LLKW TGHPVPSVAA++AS EL++IQGKR IWFCGAYQGYGFHEDGLKAG +AA+G
Sbjct  356   PQQTLLKWKTGHPVPSVAATKASLELDQIQGKRGIWFCGAYQGYGFHEDGLKAGTVAANG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K CS L+NP HMVPS  ETGARL VTRFL+ FI+TGS+ILLEEGGT+FTFEGT  K 
Sbjct  416   VLGKSCSILSNPKHMVPSLVETGARLFVTRFLSHFILTGSVILLEEGGTMFTFEGTSTKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VH+P  YWKV T+ADLGLADAYI+G+ SFVDKKEGLLNL  I +ANRDL++S 
Sbjct  476   PLKTVLKVHNPHIYWKVMTEADLGLADAYINGEFSFVDKKEGLLNLIMILIANRDLNSSN  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ + +RGWWTPLLFT+ + SAKYF++H+ R N+LTQARRNISRHYDLSN+LF+LFLDET
Sbjct  536   SKLSKQRGWWTPLLFTAGLTSAKYFLKHVLRHNSLTQARRNISRHYDLSNDLFALFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK+EDEDLK AQ RKISLLI+KA+I  +H ILEIGCGWGSLAIE V+RTGCKY
Sbjct  596   MTYSCAVFKTEDEDLKDAQQRKISLLIEKARIDSKHEILEIGCGWGSLAIEVVKRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK+AE+ V+EA LQDNIRF LCDYRQLP   +YDRIISCEM+EAVGHE+M 
Sbjct  656   TGITLSEEQLKFAENIVKEARLQDNIRFQLCDYRQLPSTNKYDRIISCEMVEAVGHEYME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             +FF  CESVLAE+G+LVLQFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A
Sbjct  716   DFFSCCESVLAEDGLLVLQFISIPEERYDEYRRSSDFIKEYIFPGGCLPSLTRITSAMSA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEH+E+IG+HYYQTLR WR NFLE+QS+IL LGF++KFIRTWEYYFDYCAAGF +
Sbjct  776   ASRLCVEHVENIGLHYYQTLRHWRKNFLEKQSKILALGFNEKFIRTWEYYFDYCAAGFKS  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
              TLG+YQ+VFSRPGNV A G+PYK   +A
Sbjct  836   NTLGNYQVVFSRPGNVAALGNPYKRFPTA  864



>ref|XP_010650132.1| PREDICTED: uncharacterized protein LOC100242555 isoform X1 [Vitis 
vinifera]
Length=868

 Score =  1379 bits (3568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 658/873 (75%), Positives = 759/873 (87%), Gaps = 8/873 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR-V  579
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+ V
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQQV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
              E++KFK+DVL YLEE +NNPD+DRN TLG+FIK RGYSELFQKAY++P+CASIW CS+E
Sbjct  121   GEMIKFKDDVLKYLEELENNPDIDRNQTLGDFIKCRGYSELFQKAYLVPICASIWPCSAE  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM+FSA+ +LSFCRNHHLLQLFG PQWLTVK  SH YVNKVREELE +GC+IR  CEV 
Sbjct  181   GVMSFSAFLVLSFCRNHHLLQLFGHPQWLTVKCCSHYYVNKVREELESKGCQIRTACEVV  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST + G      I  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV
Sbjct  241   SVSTTDDG----CTIFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYV  295

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
              SDI+LHR+++FMP+N AAWSAWNFLGT+ N+VCL+YWLN LQN+  T  P+LVTLNP  
Sbjct  296   SSDIFLHRDKNFMPQNPAAWSAWNFLGTIENKVCLSYWLNVLQNIDQTSLPFLVTLNPSH  355

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP+  LLKW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAH
Sbjct  356   TPDHTLLKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAH  415

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
              +L K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK
Sbjct  416   SILGKGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSGKK  475

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
              LLKV +++H+PQFYWK+ATQADLGLADAYI+GD S VDK EGL +LF IF+ANRDL +S
Sbjct  476   CLLKVALKIHNPQFYWKIATQADLGLADAYINGDFSLVDKDEGLQSLFMIFIANRDLDSS  535

Query  2020  VSRSNSK--RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2193
             +SR N K  RGWWTPL FT+ IASAKY+ +H+SRQNTLTQARRN+SRHYDLSNELFSLFL
Sbjct  536   LSRLNKKSFRGWWTPLFFTAGIASAKYYFQHVSRQNTLTQARRNVSRHYDLSNELFSLFL  595

Query  2194  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2373
             DETMTYSCAVFK+E EDLK AQ+RKISLLI+KA+I K+H +LEIGCGWGSLAIE V++TG
Sbjct  596   DETMTYSCAVFKTEGEDLKVAQLRKISLLIEKARIDKKHEVLEIGCGWGSLAIEVVKQTG  655

Query  2374  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHE  2553
             CKYTGIT S++QLK+AE KV+EAGLQDNIRFLLCDYRQLP++ +YDRIISC MLE+VGHE
Sbjct  656   CKYTGITPSKEQLKFAEMKVKEAGLQDNIRFLLCDYRQLPNSYKYDRIISCGMLESVGHE  715

Query  2554  FMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSA  2733
             +M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+A
Sbjct  716   YMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTA  775

Query  2734  MAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAG  2913
             MA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAG
Sbjct  776   MATASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAG  835

Query  2914  FHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             F T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  836   FKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  868



>gb|KDP40373.1| hypothetical protein JCGZ_02371 [Jatropha curcas]
Length=869

 Score =  1379 bits (3568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/872 (75%), Positives = 763/872 (88%), Gaps = 6/872 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAY-VLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             +MRVAV+G GISGL+SAY V++  GA VV+YEKEDYLGGHA+TV+ DGVDLDLGFMVFNR
Sbjct  3     RMRVAVIGGGISGLISAYYVVSNSGAEVVLYEKEDYLGGHARTVSFDGVDLDLGFMVFNR  62

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNMMELFESLGVDME+SDMSFSVSLD G+GYEWGSRNG SG+FAQKKN+LNPYFWQM
Sbjct  63    VTYPNMMELFESLGVDMELSDMSFSVSLDKGNGYEWGSRNGLSGVFAQKKNILNPYFWQM  122

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             +REI+KFK+DVLSYL   + NPD+DR++TLG FI SRGYSELFQK Y++PMC SIWSC S
Sbjct  123   LREIIKFKDDVLSYLGTLEKNPDIDRSETLGHFINSRGYSELFQKGYLVPMCGSIWSCPS  182

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             + VM+FSA+SILSFCRNHHLLQLFGRPQWLTVK RS SYVNKV+E+LE  GC IR GCEV
Sbjct  183   DKVMSFSAFSILSFCRNHHLLQLFGRPQWLTVKSRSQSYVNKVKEKLETWGCRIRTGCEV  242

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
              SVST+++G    V    G    ++ Y GCIMA HAPD LK+LG+QATF+E R+LGAFQY
Sbjct  243   ASVSTNDEGCT--VFCTDGS---EDMYSGCIMAVHAPDALKILGEQATFEEKRVLGAFQY  297

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
             +YS I+LHR++ FMP+N AAWSAWNFLG+  N+VCLTYWLN LQNLG+T  P+LVTLNP 
Sbjct  298   MYSHIFLHRDRKFMPQNQAAWSAWNFLGSTENKVCLTYWLNVLQNLGETGPPFLVTLNPD  357

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
               P+  LLKW+TGHPVPSVAAS+AS EL+ IQG+R +WFCGAYQGYGFHEDGLK+GM+AA
Sbjct  358   NIPDHTLLKWSTGHPVPSVAASKASLELQHIQGRRGLWFCGAYQGYGFHEDGLKSGMVAA  417

Query  1657  HGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1836
             +GLL K C+ L NP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT+FTFEG+ K
Sbjct  418   NGLLGKSCTILCNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTMFTFEGSAK  477

Query  1837  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2016
             K  LK +++VH+P+ YWK+ TQADLGLADAYI+GD SFV+K EGLLNL  + + NRD + 
Sbjct  478   KCDLKTVLKVHNPRLYWKITTQADLGLADAYINGDFSFVNKDEGLLNLIMVLIVNRDANK  537

Query  2017  SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLD  2196
             +V+R N K+GWWTPLLFT++IASA++F+ H+SRQNTLTQARRNISRHYDLSNELF LFLD
Sbjct  538   TVARLNKKKGWWTPLLFTASIASAQFFVHHVSRQNTLTQARRNISRHYDLSNELFGLFLD  597

Query  2197  ETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGC  2376
             ETMTYSCAVFK+EDEDLK AQMRKISLLI+KA+I+KEH ILEIGCGWG+LAIE V+RTGC
Sbjct  598   ETMTYSCAVFKTEDEDLKAAQMRKISLLIEKARITKEHEILEIGCGWGALAIEVVKRTGC  657

Query  2377  KYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEF  2556
             +YTGITLSE+QLK+AE KV+EAGLQD+IRFLLCDYRQLP N RYDRIISCEM+EAVGHE+
Sbjct  658   RYTGITLSEEQLKFAEMKVKEAGLQDSIRFLLCDYRQLPKNYRYDRIISCEMIEAVGHEY  717

Query  2557  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2736
             M EFFG CESVLAE+G++VLQFISIP+ERY+EYRQSSDFIKEYIFPGGCLPSL+R+ SAM
Sbjct  718   MEEFFGCCESVLAEDGLIVLQFISIPEERYEEYRQSSDFIKEYIFPGGCLPSLTRIASAM  777

Query  2737  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2916
             +A+SRLC+EH+E+IGIHYYQTLR WR NFL+ Q +IL LGF++KFIRTWEYYFDYCAAGF
Sbjct  778   SAASRLCMEHVENIGIHYYQTLRYWRKNFLDNQGKILALGFNEKFIRTWEYYFDYCAAGF  837

Query  2917  HTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              T TLG+YQ+V SRPGN+ A G+P++G  SAY
Sbjct  838   KTHTLGNYQVVLSRPGNIAALGNPFQGFPSAY  869



>ref|XP_002528810.1| methyltransferase, putative [Ricinus communis]
 gb|EEF33544.1| methyltransferase, putative [Ricinus communis]
Length=865

 Score =  1377 bits (3564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/869 (75%), Positives = 754/869 (87%), Gaps = 5/869 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG GISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV  DGVDLDLGFMVFN VT
Sbjct  1     MRVAVVGGGISGLVSAYVLAKDGVEVVLYEKEEYLGGHAKTVCFDGVDLDLGFMVFNCVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME+SDMSFSVSLDNG GYEWGSRNG  GLFAQK N  NPYFWQMIR
Sbjct  61    YPNMMEFFESLGVDMELSDMSFSVSLDNGKGYEWGSRNGLPGLFAQKTNAFNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK+DVLSYLE  +NNPD+DRN+TLG FIKSRGYSELFQKAY++PMC SIWSC SE 
Sbjct  121   EVIKFKDDVLSYLEVLENNPDIDRNETLGNFIKSRGYSELFQKAYLVPMCGSIWSCPSEK  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSAYSILSFCRNHHLLQLFGRPQWLTVK RSHSYV+KVRE+LE  GC IR G EVH 
Sbjct  181   VMSFSAYSILSFCRNHHLLQLFGRPQWLTVKCRSHSYVHKVREKLESWGCVIRTGHEVHL  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST+++G      ++ G    +E Y  CI+  HAPD LK+LG QATFDE R+LGAFQY+Y
Sbjct  241   VSTNDKG----CTVLCGDGS-EEQYSRCIIGVHAPDALKLLGNQATFDEKRVLGAFQYLY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             S+I+LHR++ FMP+   AWSAWNFLG  +N+VCLTYWLN LQNLG+T  P+LVTLNP  T
Sbjct  296   SEIFLHRDKKFMPQKPTAWSAWNFLGNTDNKVCLTYWLNVLQNLGETNLPFLVTLNPDHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKWTTGHPVPSVAAS+AS ELE IQG+R +WFCGAYQGYGFHEDGLK+GM+AAH 
Sbjct  356   PDNTLLKWTTGHPVPSVAASKASLELEHIQGRRGLWFCGAYQGYGFHEDGLKSGMVAAHS  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL+K C+ L+NP HMVPS  ETGARL V+RFL  +I TG +ILLEEGGT+FTFEGT KK 
Sbjct  416   LLEKSCAILSNPKHMVPSLLETGARLFVSRFLGQYISTGRVILLEEGGTIFTFEGTAKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
               + +++VH+PQFYWK+ TQADLGLADAYI+GD SFVDK EGLLNLF + + NRD +   
Sbjct  476   FSQTVMKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLLNLFMVLIVNRDANKPE  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S  N ++GWWTP+LFT++IASAK+F RH+SRQN+LTQARRNISRHYDLSN+LFSLFLDET
Sbjct  536   SELNKRKGWWTPMLFTASIASAKFFFRHVSRQNSLTQARRNISRHYDLSNDLFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYS AVFK+EDEDLK AQMRKISLLI KA+I+KEH ILEIGCGWG+LAIE V+RTGCKY
Sbjct  596   MTYSSAVFKTEDEDLKAAQMRKISLLIGKARINKEHEILEIGCGWGTLAIEVVKRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYAE++V+EAGLQD+IRF L DYRQLPD C+YDRIISCEM+EAVGHE+M 
Sbjct  656   TGITLSEEQLKYAEERVKEAGLQDSIRFQLRDYRQLPDTCKYDRIISCEMIEAVGHEYME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             +FF  CESVLA++G++VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+T+AMAA
Sbjct  716   KFFSCCESVLAKDGVIVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLTRITTAMAA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             S+RLCVEH+E+IGIHYYQTLR WR NF+E +S+I+ LGF++KFIRTWEYYFDYCAAGF T
Sbjct  776   STRLCVEHVENIGIHYYQTLRYWRKNFVENKSKIMALGFNEKFIRTWEYYFDYCAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
              TLG+YQ+V SRPGNV A G+PYK   +A
Sbjct  836   LTLGNYQVVLSRPGNVAALGNPYKEFPAA  864



>emb|CAN68017.1| hypothetical protein VITISV_025151 [Vitis vinifera]
Length=874

 Score =  1377 bits (3563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 659/864 (76%), Positives = 750/864 (87%), Gaps = 18/864 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV LDLGFMVFNRVT
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVPLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGV+ME+SDMSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61    YPNMMEFFETLGVBMELSDMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             +++KFK+DVL YLEE +NNPDMDRN TLG+FIK RGYSELFQKAY++P+CASIWSC +EG
Sbjct  121   DVIKFKDDVLKYLEELENNPDMDRNQTLGDFIKCRGYSELFQKAYLVPICASIWSCPAEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSA+S+LSFCRNHHLLQLFGRPQWLTVK RSH YV+KVREELE +GC IR GCEV S
Sbjct  181   VMTFSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHYYVHKVREELESKGCRIRTGCEVVS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST + G      +  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV 
Sbjct  241   VSTTDDG----CTVFCGDG-SQEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVS  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LH +++FMP+N AAWSAWNFLGT++N+VCLTYWLN LQN+  T +P+LVTLNPP T
Sbjct  296   SDIFLHCDKNFMPQNPAAWSAWNFLGTIDNKVCLTYWLNVLQNIDQTSRPFLVTLNPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+T HP PSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAHG
Sbjct  356   PDHTLLKWSTSHPFPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++T EG+ KK 
Sbjct  416   MLGKGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTVEGSRKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
             LLK+             ATQADLGLADAYI+GD S VDK EGL NLF IF+ANRDL +S+
Sbjct  476   LLKI-------------ATQADLGLADAYINGDFSLVDKDEGLQNLFMIFIANRDLDSSL  522

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             SR N+KRGWWTPL FT+ IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDET
Sbjct  523   SRLNNKRGWWTPLFFTAGIASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDET  582

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK+E EDLK AQ+RKISLLI+K +I K+H +LEIGCGWGSLAIE V++TGCKY
Sbjct  583   MTYSCAVFKTEREDLKVAQLRKISLLIEKVRIDKKHEVLEIGCGWGSLAIEVVKQTGCKY  642

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK+AE KV+EAGLQDNIRFLLCDYRQL D+ +YDRIISCEMLEAVGHE+M 
Sbjct  643   TGITLSEEQLKFAEMKVKEAGLQDNIRFLLCDYRQLSDSYKYDRIISCEMLEAVGHEYME  702

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAA
Sbjct  703   EFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAA  762

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLC+EHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T
Sbjct  763   ASRLCMEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKT  822

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYK  2994
              TLG+YQIVFSRPGN  AF +PYK
Sbjct  823   HTLGNYQIVFSRPGNAAAFSNPYK  846



>ref|XP_009625534.1| PREDICTED: uncharacterized protein LOC104116392 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =  1375 bits (3560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 655/812 (81%), Positives = 733/812 (90%), Gaps = 5/812 (1%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNMME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFWQM
Sbjct  2     VTYPNMMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFWQM  61

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IREI+KFK DV+SYLE  DNNPD+DRN+TLG FI++ GYSELFQKAY+IP+CASIWSC S
Sbjct  62    IREIIKFKRDVISYLEALDNNPDIDRNETLGHFIQTHGYSELFQKAYLIPICASIWSCPS  121

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             EGVM FSAYSILSFCRNHHLLQLFGRPQWLTV+ RS +YVNKV+EE+EKRGC++R G EV
Sbjct  122   EGVMCFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEEMEKRGCQLRTGYEV  181

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
             +S+ST+E+G       ++  +  ++ YDGC+MAAHAPDTL+MLGK+AT+DE RILGAFQY
Sbjct  182   NSISTNEEGCT-----VACTDGSKDVYDGCVMAAHAPDTLRMLGKEATYDETRILGAFQY  236

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
             VYSDIYLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPP
Sbjct  237   VYSDIYLHCDKTFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPP  296

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
             RTPE  LLKWTTGHPVPSVAAS ASSEL++IQG+R IWFCGAYQGYGFHEDG+KAG IAA
Sbjct  297   RTPEHTLLKWTTGHPVPSVAASIASSELDQIQGERGIWFCGAYQGYGFHEDGVKAGAIAA  356

Query  1657  HGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1836
              GLLK+  S LNNP HMVP+WPETGARLLVTRFL SFI T  IILLEEGGT+FTFEGT+ 
Sbjct  357   QGLLKRNYSVLNNPKHMVPTWPETGARLLVTRFLKSFISTECIILLEEGGTMFTFEGTEN  416

Query  1837  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2016
             K+ LKV +RVHSPQFYWKVATQ DLGLADA+I GD SFVDK +GLLNLF IFV NRDL A
Sbjct  417   KSSLKVSLRVHSPQFYWKVATQGDLGLADAFIQGDFSFVDKNDGLLNLFMIFVNNRDLKA  476

Query  2017  SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLD  2196
             SV+RS+ KRGWWTPLLFT+A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLFLD
Sbjct  477   SVTRSSKKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLFLD  536

Query  2197  ETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGC  2376
             ETMTYSCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RTGC
Sbjct  537   ETMTYSCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRTGC  596

Query  2377  KYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEF  2556
             KYTGITLSEQQLKYA+ +V++AGLQD+I F+LCDYRQLP+  RYDRIISCEMLEAVGHEF
Sbjct  597   KYTGITLSEQQLKYAQIRVQQAGLQDHITFILCDYRQLPNMSRYDRIISCEMLEAVGHEF  656

Query  2557  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2736
             M+EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAM
Sbjct  657   MDEFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAM  716

Query  2737  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2916
             AA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF
Sbjct  717   AAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGF  776

Query  2917  HTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  777   KTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  808



>ref|XP_009617891.1| PREDICTED: uncharacterized protein LOC104110155 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009617892.1| PREDICTED: uncharacterized protein LOC104110155 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =  1370 bits (3545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 652/812 (80%), Positives = 728/812 (90%), Gaps = 5/812 (1%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNM+E FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQM
Sbjct  2     VTYPNMLEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGLSGLFAQKKNVLNPYFWQM  61

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IREI+KFK DV+SYLE  DNNPD+DRN+TLG FI+S  YSELFQKAY+IP+CASIWSC S
Sbjct  62    IREIIKFKQDVISYLEALDNNPDIDRNETLGHFIQSHSYSELFQKAYLIPICASIWSCPS  121

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             +GVM FSAYSILSFCRNHHLLQLFGRPQWLTV+ RS +YVNKV+EELEKRGC+++ GCEV
Sbjct  122   DGVMGFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEELEKRGCQLKTGCEV  181

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
             +S+ST+E+G       ++  +  ++ YDGCIMAAHAPDTL+MLGK+AT+DE RILGAFQY
Sbjct  182   NSLSTNEEGCT-----VACTDGCKDVYDGCIMAAHAPDTLRMLGKEATYDETRILGAFQY  236

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
             VYSDIYLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPP
Sbjct  237   VYSDIYLHCDKNFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPP  296

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
              TPE  +LKWTTGHPVPSVAAS ASSEL +IQGKR IWFCGAYQGYGFHEDGLKAG IAA
Sbjct  297   HTPEHTMLKWTTGHPVPSVAASIASSELHQIQGKRGIWFCGAYQGYGFHEDGLKAGAIAA  356

Query  1657  HGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1836
              GLLK+  S LNNP HMVP+W ETGARLLVTRFL SFI TG IILLEEGGT+FTFEGT+ 
Sbjct  357   QGLLKRNYSVLNNPKHMVPTWKETGARLLVTRFLKSFISTGCIILLEEGGTMFTFEGTEN  416

Query  1837  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2016
             K+ LKV +RVHSP+FYWKVATQ DLGLADA+I GD SFVDK EGLLNLF IFV NRDL A
Sbjct  417   KSSLKVSLRVHSPRFYWKVATQGDLGLADAFIQGDFSFVDKNEGLLNLFMIFVNNRDLKA  476

Query  2017  SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLD  2196
             SV+RS+ KRGWWTPLLFT+A++SAKYF+RH+S QNTLTQARRNISRHYDLSNELFSLFLD
Sbjct  477   SVTRSSKKRGWWTPLLFTAAVSSAKYFVRHVSNQNTLTQARRNISRHYDLSNELFSLFLD  536

Query  2197  ETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGC  2376
             ETMTYSCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E  +RTGC
Sbjct  537   ETMTYSCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVAKRTGC  596

Query  2377  KYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEF  2556
             KYTGITLSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGHEF
Sbjct  597   KYTGITLSEQQLKYAQLRVQQAGLQDHITFLLCDYRQLPNMSRYDRIISCEMLEAVGHEF  656

Query  2557  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2736
             M EFF  CES LA +G+LVLQFISIPDERYDEYRQSSDFIKEYIFPG CLP+LSRVTSAM
Sbjct  657   MEEFFTCCESALAGDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGACLPALSRVTSAM  716

Query  2737  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2916
             AA+SRL VEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF
Sbjct  717   AAASRLSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDNKFIRTWEYYFDYCAAGF  776

Query  2917  HTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TCTLGDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  777   KTCTLGDYQIVFSRPGNIAAFGDPYSAVPSAY  808



>gb|KEH42686.1| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=860

 Score =  1368 bits (3542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 649/864 (75%), Positives = 752/864 (87%), Gaps = 7/864 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG GISGLVSAYVLAKGG  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVVGGGISGLVSAYVLAKGGVNVVLYEKEDYLGGHAKTVNADGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGV+ME+SDMSFSVSLD G G EWGSR+  SGLFAQK+N LNPYFWQMIR
Sbjct  61    YPNMMEFFESLGVEMELSDMSFSVSLDKGRGCEWGSRS-LSGLFAQKRNALNPYFWQMIR  119

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+D +SY++ F+NNPDMD N++LG+F+KSRGYSELFQKAY+IP+C SIWSCSSEG
Sbjct  120   EIVKFKDDAISYIDMFENNPDMDHNESLGQFLKSRGYSELFQKAYLIPICGSIWSCSSEG  179

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             V++FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RS +YV KV+EEL+  G +I   CEV  
Sbjct  180   VLSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSQNYVKKVKEELQSNGSQIITNCEVDF  239

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VS+ E+G      ++ GK+  +E YDGCIM+ HAPD L++LG +AT+DE RI+GAFQY Y
Sbjct  240   VSSSEKG-----CVVYGKDGSEEVYDGCIMSVHAPDALRLLGDEATYDERRIIGAFQYAY  294

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLHR+++ MP+N AAWSAWNFLG+ NN+VC+TYWLN LQN+ +  +P+ VTLNP   
Sbjct  295   SDIYLHRDKNLMPQNPAAWSAWNFLGSNNNKVCVTYWLNILQNIEEAGKPFFVTLNPDHV  354

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKW+TGHPVPSVAA +AS EL+RIQGKR+IWF GAYQGYGFHEDGLKAGM AAHG
Sbjct  355   PENTLLKWSTGHPVPSVAAYKASVELDRIQGKRKIWFSGAYQGYGFHEDGLKAGMTAAHG  414

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L   C+   NP HMVPSW E GAR+ VTRFL+SFI TGS+ LLEEGGT+FTFEGT KK 
Sbjct  415   ILGDCCTLKTNPKHMVPSWKELGARIFVTRFLSSFITTGSLTLLEEGGTMFTFEGTGKKC  474

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
               K ++RVHSPQFYWKV TQADLGLADAYI+GD SFVDK EGLLN F + +ANRDL++S 
Sbjct  475   SPKSVLRVHSPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNFFLVLIANRDLNSSN  534

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
              +  S RGWWTP+LFT+ + SAK+F+ H+SR+NTLTQARRNISRHYDLSNELF+LFLDET
Sbjct  535   PKLKS-RGWWTPILFTAGLTSAKFFMDHVSRKNTLTQARRNISRHYDLSNELFALFLDET  593

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK EDEDLK AQMRKISLLI+KA+I K+H ILEIGCGWGSLAIE V+RTGCKY
Sbjct  594   MTYSCAVFKDEDEDLKEAQMRKISLLIEKARIEKKHEILEIGCGWGSLAIEVVKRTGCKY  653

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK AE +V++AGLQDNI+FLLCDYRQLP   +YDRIISCEM+EAVGHE+M 
Sbjct  654   TGITLSEEQLKLAEKRVKDAGLQDNIKFLLCDYRQLPKTYKYDRIISCEMIEAVGHEYME  713

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESV+A +G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TS+MA+
Sbjct  714   EFFGCCESVMANDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSSMAS  773

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEH+E+ GIHYYQTLR WR NFLERQS+IL LGF++KFIRTWEYYFDYC AGF +
Sbjct  774   TSRLCVEHVENFGIHYYQTLRLWRKNFLERQSEILALGFNEKFIRTWEYYFDYCGAGFKS  833

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYK  2994
              TLG+YQ+VFSRPGNVTAF DPYK
Sbjct  834   RTLGNYQVVFSRPGNVTAFTDPYK  857



>ref|XP_008460674.1| PREDICTED: uncharacterized protein LOC103499444 isoform X1 [Cucumis 
melo]
Length=865

 Score =  1365 bits (3534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/870 (74%), Positives = 750/870 (86%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1     MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGV+ME SDMSFSVSLD G G EWGSRNG S LFAQKKNLLNPYFWQMIR
Sbjct  61    YPNMMEFFENLGVEMETSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNLLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV++YLE  +NN D+DRN+TLG+FIKSRGYSELFQ AY+IPMC SIWSC SEG
Sbjct  121   EIVKFKDDVINYLEVIENNSDIDRNETLGQFIKSRGYSELFQNAYLIPMCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             V++FSA+S+LSFCRNHHLLQLFGRPQWLTVK RSHSYV KV+E LE  GC+IR   EV+S
Sbjct  181   VLSFSAFSVLSFCRNHHLLQLFGRPQWLTVKGRSHSYVKKVQEVLESHGCQIRTSSEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             +ST ++G       +S  + +QE +D CI+A HAPDTL+MLG QAT +ELR+LGAFQY Y
Sbjct  241   ISTMDKGCK-----VSYGDDLQEIFDACIIATHAPDTLRMLGNQATSEELRVLGAFQYAY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MP+N AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLNP + 
Sbjct  296   SDIFLHRDKNLMPQNPAAWSAWNFLGNTDKKVCLTYWLNILQNLGETGPPFLVTLNPDKE  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+TGHP+PSVAAS+AS+E   IQG RRIWFCGAYQGYGFHEDGLKAG++AA  
Sbjct  356   PKNILLKWSTGHPIPSVAASKASNEFHSIQGNRRIWFCGAYQGYGFHEDGLKAGIVAAQN  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL    + L+NP HM PS  +TGARL VTRFL  +I +GS+ L+E+GGT+FTFEGTDKK 
Sbjct  416   LLGNSFTLLSNPKHMAPSLVDTGARLFVTRFLGQYITSGSLTLIEDGGTIFTFEGTDKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
             L KV V+VHSPQFYWK+ T+ADLGLADAYI+GD SFVDK EGLLN F I +A+RD ++S+
Sbjct  476   LPKVAVKVHSPQFYWKIMTRADLGLADAYINGDFSFVDKDEGLLNFFLIIIASRDTNSSI  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             ++   KRGWWTP LFT+ IASAKYF +H SRQNTLTQARRNISRHYDLSNELFSLFLD+T
Sbjct  536   AKQKKKRGWWTPPLFTACIASAKYFFQHASRQNTLTQARRNISRHYDLSNELFSLFLDDT  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FK E+EDLK AQMRKISLLI+KA+I+K HH+LEIGCGWGSLAIE V++TGC Y
Sbjct  596   MTYSCAIFKGENEDLKVAQMRKISLLIEKARINKNHHVLEIGCGWGSLAIEIVKKTGCHY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYAE +V++A LQD IRFLLCDYR+LP   RYDRIISCEM+EAVGHEFM 
Sbjct  656   TGITLSEEQLKYAEKRVKDANLQDRIRFLLCDYRKLPSTERYDRIISCEMIEAVGHEFME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             +FFG CESVLAENG+ VLQFISIPDERYDEYR SSDFIKEYIFPGGCLP LSR+T+AMA 
Sbjct  716   DFFGSCESVLAENGLFVLQFISIPDERYDEYRLSSDFIKEYIFPGGCLPCLSRLTTAMAN  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEHLE+IGIHY+QTLRCWR NFLE QS+IL LGFD+ FIRTWEYYFDYCAAGF +
Sbjct  776   ASRLCVEHLENIGIHYHQTLRCWRKNFLENQSKILQLGFDESFIRTWEYYFDYCAAGFKS  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  836   HTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  865



>ref|XP_009625535.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625536.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625538.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =  1363 bits (3529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/807 (81%), Positives = 728/807 (90%), Gaps = 5/807 (1%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFWQMIREI+
Sbjct  1     MMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFWQMIREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK DV+SYLE  DNNPD+DRN+TLG FI++ GYSELFQKAY+IP+CASIWSC SEGVM 
Sbjct  61    KFKRDVISYLEALDNNPDIDRNETLGHFIQTHGYSELFQKAYLIPICASIWSCPSEGVMC  120

Query  952   FSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1131
             FSAYSILSFCRNHHLLQLFGRPQWLTV+ RS +YVNKV+EE+EKRGC++R G EV+S+ST
Sbjct  121   FSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEEMEKRGCQLRTGYEVNSIST  180

Query  1132  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1311
             +E+G       ++  +  ++ YDGC+MAAHAPDTL+MLGK+AT+DE RILGAFQYVYSDI
Sbjct  181   NEEGCT-----VACTDGSKDVYDGCVMAAHAPDTLRMLGKEATYDETRILGAFQYVYSDI  235

Query  1312  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1491
             YLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPPRTPE 
Sbjct  236   YLHCDKTFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPRTPEH  295

Query  1492  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1671
              LLKWTTGHPVPSVAAS ASSEL++IQG+R IWFCGAYQGYGFHEDG+KAG IAA GLLK
Sbjct  296   TLLKWTTGHPVPSVAASIASSELDQIQGERGIWFCGAYQGYGFHEDGVKAGAIAAQGLLK  355

Query  1672  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1851
             +  S LNNP HMVP+WPETGARLLVTRFL SFI T  IILLEEGGT+FTFEGT+ K+ LK
Sbjct  356   RNYSVLNNPKHMVPTWPETGARLLVTRFLKSFISTECIILLEEGGTMFTFEGTENKSSLK  415

Query  1852  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2031
             V +RVHSPQFYWKVATQ DLGLADA+I GD SFVDK +GLLNLF IFV NRDL ASV+RS
Sbjct  416   VSLRVHSPQFYWKVATQGDLGLADAFIQGDFSFVDKNDGLLNLFMIFVNNRDLKASVTRS  475

Query  2032  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2211
             + KRGWWTPLLFT+A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  476   SKKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLFLDETMTY  535

Query  2212  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2391
             SCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RTGCKYTGI
Sbjct  536   SCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRTGCKYTGI  595

Query  2392  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2571
             TLSEQQLKYA+ +V++AGLQD+I F+LCDYRQLP+  RYDRIISCEMLEAVGHEFM+EFF
Sbjct  596   TLSEQQLKYAQIRVQQAGLQDHITFILCDYRQLPNMSRYDRIISCEMLEAVGHEFMDEFF  655

Query  2572  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2751
               CES LAE G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA+SR
Sbjct  656   TCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAAASR  715

Query  2752  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2931
             LCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTL
Sbjct  716   LCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTL  775

Query  2932  GDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             GDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  776   GDYQIVFSRPGNVAAFGDPYNGVPSTY  802



>ref|XP_004234691.1| PREDICTED: uncharacterized protein LOC101256851 isoform X1 [Solanum 
lycopersicum]
Length=868

 Score =  1362 bits (3524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 648/870 (74%), Positives = 749/870 (86%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+V VVGAGI+GL+SAY LAK G  VV+YEKE ++GGHAKTV +DGV+LDLGF++FNRVT
Sbjct  1     MKVGVVGAGINGLISAYALAKCGVKVVIYEKEHFIGGHAKTVAVDGVELDLGFIIFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YP MME FE LGVDME   MS SVSLD+GHG EWG+R GFS LFAQKKNLLNPYF QMIR
Sbjct  61    YPYMMEFFECLGVDMETYHMSLSVSLDHGHGCEWGTRKGFSSLFAQKKNLLNPYFLQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI++FK DV+SYLEE DNNPD+D N+TLG+FIKS GYSELFQKAY+IP+CASIWSC   G
Sbjct  121   EIIRFKQDVISYLEEVDNNPDIDCNETLGQFIKSHGYSELFQKAYLIPICASIWSCPLAG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             V++FS+Y IL F R+HHLLQ+F  PQ LTV+ RS +YVNKV+EELEKRGC+IR GCEV+S
Sbjct  181   VLSFSSYYILLFFRDHHLLQIFDLPQLLTVRWRSQTYVNKVKEELEKRGCQIRTGCEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST+E+G       I+  +   E YDGCI+  HAPDTLKMLG++AT+DE RILGAF Y+Y
Sbjct  241   VSTNEEGCT-----IACTDGATEVYDGCIITTHAPDTLKMLGEEATYDETRILGAFHYIY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++F+P N  AWSA NFLGT+N+R C+TY LN +QNLGD+ QPYLVTL+PP+ 
Sbjct  296   SDIFLHRDKTFLPHNPEAWSACNFLGTMNDRSCVTYSLNIMQNLGDSNQPYLVTLDPPQE  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKWTTGH VPSVAAS+AS+EL +IQGKR IWFCG YQGYGFHEDGLKAGM+AA G
Sbjct  356   PDHTLLKWTTGHLVPSVAASKASNELHQIQGKRGIWFCGTYQGYGFHEDGLKAGMVAADG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L++ C  L+NP HMVP+W ETGARL+VTRFL SFI TG IILLEEGGT+FTF+GTD+K 
Sbjct  416   MLRRNCRILDNPKHMVPTWTETGARLVVTRFLKSFIETGCIILLEEGGTIFTFQGTDRKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKVL+R+HS +FYWKVATQADLGLADA+IHGD SFVDK EGLLNL  IFVANRD+ ASV
Sbjct  476   CLKVLLRIHSTKFYWKVATQADLGLADAFIHGDFSFVDKNEGLLNLLMIFVANRDMKASV  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
              RS+ KRGWW PL+FT+A++SAKYFI+H+S  NTLTQARRNISRHYDLSNELFSLFLDET
Sbjct  536   KRSSKKRGWWMPLIFTAALSSAKYFIQHVSNHNTLTQARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FKSEDEDLK AQ+RKI  LI KAKIS EHHILEIG GWGSLA+E V++TGCKY
Sbjct  596   MTYSCAIFKSEDEDLKDAQLRKIRRLISKAKISAEHHILEIGFGWGSLAMEVVKQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQL+YA+ +V +AGLQD I FLLCDYRQ+P+  +YDRIISC MLE VGH+F+ 
Sbjct  656   TGITLSEQQLEYAQLRVEQAGLQDQITFLLCDYRQIPNKDKYDRIISCGMLEHVGHDFIG  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CES LAE G+LVLQFISIPDERY+EYRQSSDF+KEYIFPGGC+P+LSRVTSAMAA
Sbjct  716   EFFTCCESALAEYGLLVLQFISIPDERYEEYRQSSDFMKEYIFPGGCVPALSRVTSAMAA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEHLE+IGIHYYQTLRCWR NFL+ +SQI  LGFD KFIRTWEYYFDYCAAGF T
Sbjct  776   ASRLCVEHLEEIGIHYYQTLRCWRENFLKNKSQIRSLGFDDKFIRTWEYYFDYCAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             CT+GDYQIVFSRPGNV  FGDPY    S Y
Sbjct  836   CTIGDYQIVFSRPGNVAVFGDPYNYSPSTY  865



>ref|XP_011030438.1| PREDICTED: uncharacterized protein LOC105129890 isoform X3 [Populus 
euphratica]
Length=868

 Score =  1360 bits (3521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/871 (74%), Positives = 753/871 (86%), Gaps = 5/871 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             +MRVAVVGAG+SGLVSAYVLA+ GA VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3     RMRVAVVGAGLSGLVSAYVLARAGAEVVLYEKEDYLGGHAKTVRFDGVDLDLGFMVFNRV  62

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             T PNMME FE+LG+DME+SD+SFSVSLD G GYEWGSRNGFSGLFAQKKN+L+PYFW+++
Sbjct  63    TCPNMMEFFENLGIDMELSDVSFSVSLDQGKGYEWGSRNGFSGLFAQKKNVLSPYFWKVL  122

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK+DVLSYLE  +NNP +DRN+TLG+F+KS GYSELFQKAY++P+C SIWSC SE
Sbjct  123   REIVKFKDDVLSYLEVLENNPVVDRNETLGQFVKSGGYSELFQKAYLVPVCGSIWSCPSE  182

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM FSA+S+LSF RNHHLLQLFGRP WL V+R+S SYVNKVRE+LE  GC+IR GCEV 
Sbjct  183   GVMNFSAFSVLSFFRNHHLLQLFGRPPWLRVRRQSRSYVNKVREKLESWGCQIRTGCEVQ  242

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             +VST ++G A     +  ++   E Y GCIMA HAPD L +LG+QATFDE RILGAFQY+
Sbjct  243   AVSTTDEGCA-----VLCRDGSLEMYSGCIMAVHAPDALGILGEQATFDETRILGAFQYM  297

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YS+I+LHR++ FMP+N AAW AWNFLG+  N+ CLTYWLN LQN+ +T  P+LVTLNP  
Sbjct  298   YSEIFLHRDKKFMPQNSAAWCAWNFLGSTENKACLTYWLNVLQNIDETGLPFLVTLNPDN  357

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
              P+  LL+W+TGHP+PSVAA++AS ELE IQGKRRIWF GAYQGYGFHED LK+GM+AAH
Sbjct  358   APDHTLLQWSTGHPIPSVAATKASLELEHIQGKRRIWFGGAYQGYGFHEDRLKSGMVAAH  417

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K C  + NP HMVPS  ETGARL VTRFL   I TG + LLE+GGTVF+FEGT KK
Sbjct  418   GLLGKSCDIMRNPKHMVPSMLETGARLFVTRFLGHHISTGCLTLLEDGGTVFSFEGTSKK  477

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFVDK EGL+NLF I + NRD   S
Sbjct  478   CSLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLINLFMILIVNRDADNS  537

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S+ N KRGWWTPLLFT+ IASAK+FI+H+SR+NTLTQARRNISRHYDLSNELF+LFLDE
Sbjct  538   TSKLNKKRGWWTPLLFTAGIASAKFFIQHVSRKNTLTQARRNISRHYDLSNELFALFLDE  597

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYSCA+FK EDEDLK+AQ++KISLLI+KA+++K+H +LEIGCGWG+LAIE V+RTGC+
Sbjct  598   TMTYSCALFKKEDEDLKSAQIQKISLLIEKARVNKDHEVLEIGCGWGTLAIEVVQRTGCR  657

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSE+QLKYAE KV+EAGLQD+I+F LCDYRQLP   +YDRIISCEM+EAVGHE+M
Sbjct  658   YTGITLSEEQLKYAELKVKEAGLQDSIKFHLCDYRQLPMTHKYDRIISCEMIEAVGHEYM  717

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFFG CESVL ENG+ VLQFISIP+ERYD YRQSSDFIKEYIFPGGCLPSL+++TSAMA
Sbjct  718   EEFFGCCESVLDENGLFVLQFISIPEERYDLYRQSSDFIKEYIFPGGCLPSLTKITSAMA  777

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL LGF++KFIRTWEYYFDYCAAGF 
Sbjct  778   SSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAAGFK  837

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  838   THTLGNYQVVFSRPGNVAALSNPYRGFPSAY  868



>ref|XP_011030435.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
 ref|XP_011030436.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
Length=869

 Score =  1360 bits (3521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/871 (74%), Positives = 754/871 (87%), Gaps = 4/871 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             +MRVAVVGAG+SGLVSAYVLA+ GA VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3     RMRVAVVGAGLSGLVSAYVLARAGAEVVLYEKEDYLGGHAKTVRFDGVDLDLGFMVFNRV  62

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             T PNMME FE+LG+DME+SD+SFSVSLD G GYEWGSRNGFSGLFAQKKN+L+PYFW+++
Sbjct  63    TCPNMMEFFENLGIDMELSDVSFSVSLDQGKGYEWGSRNGFSGLFAQKKNVLSPYFWKVL  122

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK+DVLSYLE  +NNP +DRN+TLG+F+KS GYSELFQKAY++P+C SIWSC SE
Sbjct  123   REIVKFKDDVLSYLEVLENNPVVDRNETLGQFVKSGGYSELFQKAYLVPVCGSIWSCPSE  182

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM FSA+S+LSF RNHHLLQLFGRP WL V+R+S SYVNKVRE+LE  GC+IR GCEV 
Sbjct  183   GVMNFSAFSVLSFFRNHHLLQLFGRPPWLRVRRQSRSYVNKVREKLESWGCQIRTGCEVQ  242

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             +VST ++  AG  V+    ++  E Y GCIMA HAPD L +LG+QATFDE RILGAFQY+
Sbjct  243   AVSTTDE--AGCAVLCRDGSL--EMYSGCIMAVHAPDALGILGEQATFDETRILGAFQYM  298

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YS+I+LHR++ FMP+N AAW AWNFLG+  N+ CLTYWLN LQN+ +T  P+LVTLNP  
Sbjct  299   YSEIFLHRDKKFMPQNSAAWCAWNFLGSTENKACLTYWLNVLQNIDETGLPFLVTLNPDN  358

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
              P+  LL+W+TGHP+PSVAA++AS ELE IQGKRRIWF GAYQGYGFHED LK+GM+AAH
Sbjct  359   APDHTLLQWSTGHPIPSVAATKASLELEHIQGKRRIWFGGAYQGYGFHEDRLKSGMVAAH  418

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K C  + NP HMVPS  ETGARL VTRFL   I TG + LLE+GGTVF+FEGT KK
Sbjct  419   GLLGKSCDIMRNPKHMVPSMLETGARLFVTRFLGHHISTGCLTLLEDGGTVFSFEGTSKK  478

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFVDK EGL+NLF I + NRD   S
Sbjct  479   CSLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLINLFMILIVNRDADNS  538

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S+ N KRGWWTPLLFT+ IASAK+FI+H+SR+NTLTQARRNISRHYDLSNELF+LFLDE
Sbjct  539   TSKLNKKRGWWTPLLFTAGIASAKFFIQHVSRKNTLTQARRNISRHYDLSNELFALFLDE  598

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYSCA+FK EDEDLK+AQ++KISLLI+KA+++K+H +LEIGCGWG+LAIE V+RTGC+
Sbjct  599   TMTYSCALFKKEDEDLKSAQIQKISLLIEKARVNKDHEVLEIGCGWGTLAIEVVQRTGCR  658

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSE+QLKYAE KV+EAGLQD+I+F LCDYRQLP   +YDRIISCEM+EAVGHE+M
Sbjct  659   YTGITLSEEQLKYAELKVKEAGLQDSIKFHLCDYRQLPMTHKYDRIISCEMIEAVGHEYM  718

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFFG CESVL ENG+ VLQFISIP+ERYD YRQSSDFIKEYIFPGGCLPSL+++TSAMA
Sbjct  719   EEFFGCCESVLDENGLFVLQFISIPEERYDLYRQSSDFIKEYIFPGGCLPSLTKITSAMA  778

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL LGF++KFIRTWEYYFDYCAAGF 
Sbjct  779   SSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAAGFK  838

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  839   THTLGNYQVVFSRPGNVAALSNPYRGFPSAY  869



>ref|XP_008340636.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340637.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340639.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340640.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
Length=863

 Score =  1360 bits (3521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/865 (76%), Positives = 750/865 (87%), Gaps = 6/865 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+GAG+SGLVSAYVLAK G  VVVYEK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVIGAGMSGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME SDMSFS SLDNG G EWGSRNG S LFAQK NL+NPYFWQM+R
Sbjct  61    YPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGSRNGLSSLFAQKTNLINPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D ++YLEE +NN D+DR++TLG+FIKSRGYSELFQKAY +P+C SIWSC SEG
Sbjct  121   EITKFKHDAINYLEELENNQDIDRSETLGQFIKSRGYSELFQKAYXVPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RSH YV KVRE LE +GC IR   EVH 
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCHIRTSSEVHR  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST ++G      +ISG  + +E ++GCI+A H PD +++LG QAT DELR+LGAFQYVY
Sbjct  241   VSTSDEG----CTVISGDGL-EEVFNGCIIAVHXPDAVRILGDQATSDELRVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR++  MPRN AAWSAWNFLG+  N+VCLTYWLN LQN+ +T  P+LVTLNP  T
Sbjct  296   SDIFLHRDKXLMPRNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDETGLPFLVTLNPEHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAY GYGFHEDGLKAGM AAHG
Sbjct  356   PKHTLLKWSTSHPVPSVAASKASLELPRIQGKRGIWFCGAYXGYGFHEDGLKAGMDAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL K  + L+NP HMVPS  ETGARL VTRFL  FI TG +I LEEGGT+FTFEGT K  
Sbjct  416   LLGKGXALLDNPKHMVPSLTETGARLFVTRFLTHFISTGCLIFLEEGGTIFTFEGTRKGC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VH+PQFYWKV TQADLGLADAYI+GD SFVDK +GLLNL  I +ANRD ++S 
Sbjct  476   SLKCVIKVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDKGLLNLIMILIANRDANSSD  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+   KRGWWTPLLFT++IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFS FLDET
Sbjct  536   SKLTKKRGWWTPLLFTASIASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSQFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYS AVFK+EDEDLK AQ+RKIS+LI+KA+I K H +LEIGCGWGSLAI+ V++TGCKY
Sbjct  596   MTYSSAVFKTEDEDLKVAQLRKISILIEKARIEKNHEVLEIGCGWGSLAIKVVKQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYA++KV+EAGLQD I+FLLCDYRQL  + +YDRIISCEMLE+VGHEFM+
Sbjct  656   TGITLSEEQLKYAQEKVKEAGLQDRIKFLLCDYRQLA-SYKYDRIISCEMLESVGHEFMD  714

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CESVLAENG+LVLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAA
Sbjct  715   EFFSCCESVLAENGLLVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAA  774

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLCVEHLE+IGIHY+QTLR WR NFL+RQ +IL LGFD+KFIRTWEYYFDYCAAGF T
Sbjct  775   SSRLCVEHLENIGIHYFQTLRYWRKNFLDRQGEILALGFDEKFIRTWEYYFDYCAAGFRT  834

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKG  2997
              TLG+YQIVFSRPGNV AF +PYKG
Sbjct  835   YTLGNYQIVFSRPGNVPAFSNPYKG  859



>ref|XP_009617893.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009617894.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =  1358 bits (3515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 647/807 (80%), Positives = 723/807 (90%), Gaps = 5/807 (1%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             M+E FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQMIREI+
Sbjct  1     MLEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGLSGLFAQKKNVLNPYFWQMIREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK DV+SYLE  DNNPD+DRN+TLG FI+S  YSELFQKAY+IP+CASIWSC S+GVM 
Sbjct  61    KFKQDVISYLEALDNNPDIDRNETLGHFIQSHSYSELFQKAYLIPICASIWSCPSDGVMG  120

Query  952   FSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1131
             FSAYSILSFCRNHHLLQLFGRPQWLTV+ RS +YVNKV+EELEKRGC+++ GCEV+S+ST
Sbjct  121   FSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEELEKRGCQLKTGCEVNSLST  180

Query  1132  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1311
             +E+G       ++  +  ++ YDGCIMAAHAPDTL+MLGK+AT+DE RILGAFQYVYSDI
Sbjct  181   NEEGCT-----VACTDGCKDVYDGCIMAAHAPDTLRMLGKEATYDETRILGAFQYVYSDI  235

Query  1312  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1491
             YLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPP TPE 
Sbjct  236   YLHCDKNFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPHTPEH  295

Query  1492  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1671
              +LKWTTGHPVPSVAAS ASSEL +IQGKR IWFCGAYQGYGFHEDGLKAG IAA GLLK
Sbjct  296   TMLKWTTGHPVPSVAASIASSELHQIQGKRGIWFCGAYQGYGFHEDGLKAGAIAAQGLLK  355

Query  1672  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1851
             +  S LNNP HMVP+W ETGARLLVTRFL SFI TG IILLEEGGT+FTFEGT+ K+ LK
Sbjct  356   RNYSVLNNPKHMVPTWKETGARLLVTRFLKSFISTGCIILLEEGGTMFTFEGTENKSSLK  415

Query  1852  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2031
             V +RVHSP+FYWKVATQ DLGLADA+I GD SFVDK EGLLNLF IFV NRDL ASV+RS
Sbjct  416   VSLRVHSPRFYWKVATQGDLGLADAFIQGDFSFVDKNEGLLNLFMIFVNNRDLKASVTRS  475

Query  2032  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2211
             + KRGWWTPLLFT+A++SAKYF+RH+S QNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  476   SKKRGWWTPLLFTAAVSSAKYFVRHVSNQNTLTQARRNISRHYDLSNELFSLFLDETMTY  535

Query  2212  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2391
             SCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E  +RTGCKYTGI
Sbjct  536   SCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVAKRTGCKYTGI  595

Query  2392  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2571
             TLSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGHEFM EFF
Sbjct  596   TLSEQQLKYAQLRVQQAGLQDHITFLLCDYRQLPNMSRYDRIISCEMLEAVGHEFMEEFF  655

Query  2572  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2751
               CES LA +G+LVLQFISIPDERYDEYRQSSDFIKEYIFPG CLP+LSRVTSAMAA+SR
Sbjct  656   TCCESALAGDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGACLPALSRVTSAMAAASR  715

Query  2752  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2931
             L VEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTL
Sbjct  716   LSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDNKFIRTWEYYFDYCAAGFKTCTL  775

Query  2932  GDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             GDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  776   GDYQIVFSRPGNIAAFGDPYSAVPSAY  802



>gb|KGN61573.1| hypothetical protein Csa_2G171940 [Cucumis sativus]
Length=865

 Score =  1358 bits (3514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/870 (73%), Positives = 748/870 (86%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1     MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LF+QKKNLLNPYFWQMIR
Sbjct  61    YPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFSQKKNLLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV +YLE  +NN D+DRN+TLG+FIKS GYSELFQ  Y+IPMC SIWSC SEG
Sbjct  121   EIVKFKDDVTNYLEVLENNSDIDRNETLGQFIKSMGYSELFQNGYLIPMCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             V++FSA+S+LSFCRNHHLLQLFGRPQWLTVK RSHSYV KV+E LE  GC+IR   EV+S
Sbjct  181   VLSFSAFSVLSFCRNHHLLQLFGRPQWLTVKGRSHSYVKKVQEVLESHGCQIRTSSEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             +ST ++G       +S  + +QE +D CI+A HAPDTL++LG +AT DELR+LGAFQY Y
Sbjct  241   ISTMDKGCK-----VSYGDDLQEMFDACIIATHAPDTLRILGNEATSDELRVLGAFQYAY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MP+N AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLNP + 
Sbjct  296   SDIFLHRDKNLMPQNPAAWSAWNFLGNTDKKVCLTYWLNVLQNLGETGPPFLVTLNPDKE  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+TGHP+P+ AAS+AS+E   IQG RRIWFCGAYQGYGFHEDGLKAG++AA  
Sbjct  356   PKNILLKWSTGHPIPTDAASKASNEFHSIQGNRRIWFCGAYQGYGFHEDGLKAGIVAAQN  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL    + L+NP HM PS  +TGARL VTRFL  +I +GS+ L+EEGGT+FTFEGTDKK 
Sbjct  416   LLGNSLTLLSNPKHMAPSLVDTGARLFVTRFLGQYITSGSLTLIEEGGTIFTFEGTDKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
             L KV+V+VHSPQFYWK+ T+ADLGLADAYI+GD SFVDK EGLLN F I +A+RD ++S+
Sbjct  476   LPKVVVKVHSPQFYWKIMTRADLGLADAYINGDFSFVDKDEGLLNFFLIIIASRDTNSSI  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             ++   KRGWWTP LFT+ IASAKYF +H SRQNTLTQARRNISRHYDLSNELFSLFLD+T
Sbjct  536   AKQKKKRGWWTPPLFTACIASAKYFFQHASRQNTLTQARRNISRHYDLSNELFSLFLDDT  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FK E+EDLK AQMRKISLLI+KA+I+K HH+LEIGCGWGSLAIE V++TGC Y
Sbjct  596   MTYSCAIFKGENEDLKVAQMRKISLLIEKARINKNHHVLEIGCGWGSLAIEIVKKTGCHY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYAE +V++A LQD IRFLLCDYR+LP   +YDRIISCEM+EAVGHEFM 
Sbjct  656   TGITLSEEQLKYAEKRVKDANLQDRIRFLLCDYRKLPSTEKYDRIISCEMIEAVGHEFME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             +FFG CESVLAENG+ VLQFISIPDERY+EYR SSDFIKEYIFPGGCLP LSR+T+AMA 
Sbjct  716   DFFGSCESVLAENGLFVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPCLSRLTTAMAN  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEHLE+IGIHY+QTLRCWR NFLE +S+IL LGFD+ FIRTWEYYFDYCAAGF +
Sbjct  776   ASRLCVEHLENIGIHYHQTLRCWRKNFLENKSKILQLGFDESFIRTWEYYFDYCAAGFKS  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  836   HTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  865



>ref|XP_010023867.1| PREDICTED: uncharacterized protein LOC104414444 [Eucalyptus grandis]
 gb|KCW60266.1| hypothetical protein EUGRSUZ_H02976 [Eucalyptus grandis]
Length=865

 Score =  1356 bits (3510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 643/855 (75%), Positives = 738/855 (86%), Gaps = 5/855 (1%)
 Frame = +1

Query  445   SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  624
             +AY  A+GGA VVVYEKEDYLGGHAKTV+ DGVDLDLGFMVFNRVTYPNMMELFESL VD
Sbjct  15    AAYEAARGGAKVVVYEKEDYLGGHAKTVSFDGVDLDLGFMVFNRVTYPNMMELFESLRVD  74

Query  625   MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLE  804
             MEISDMSFSVSLD G G EWGSRNG  GLFAQK N+LNPYFWQM+REI+KFK DVLSYLE
Sbjct  75    MEISDMSFSVSLDEGRGCEWGSRNGLLGLFAQKSNVLNPYFWQMLREIIKFKEDVLSYLE  134

Query  805   EFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCR  984
               + NPD+DRN+TLG+F+KSRGYSELFQ+AYIIP+C SIWSCSS+GVM+FSA+S+LSFCR
Sbjct  135   GLERNPDIDRNETLGQFVKSRGYSELFQRAYIIPICGSIWSCSSKGVMSFSAFSVLSFCR  194

Query  985   NHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVI  1164
             NHHLLQ+ GRPQWLTV+RRSHSYVNKVR+ELE RGCEIR  CEV S+ST +QG     V+
Sbjct  195   NHHLLQVLGRPQWLTVRRRSHSYVNKVRDELECRGCEIRTSCEVRSISTSDQG----CVV  250

Query  1165  ISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPR  1344
             ++G    +E YD CI+A HAPD L++LG QAT+DE+R+LGAFQY YSDIYLHR+++FMP+
Sbjct  251   LTGDG-SEELYDKCIVAVHAPDALRLLGDQATYDEMRVLGAFQYAYSDIYLHRDKTFMPK  309

Query  1345  NLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpv  1524
             N AAWSAWNFLG+  N+VCLTYWL+ LQNL     P+LVTLNP R P+  LLKW TGHP+
Sbjct  310   NPAAWSAWNFLGSTENKVCLTYWLDVLQNLDQKDLPFLVTLNPSREPQNTLLKWCTGHPI  369

Query  1525  psvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNH  1704
             PSVAAS+AS EL++IQGKR IWFCGAYQGYGFHEDGLKAGM AAHG++ +  S L NP H
Sbjct  370   PSVAASKASQELDQIQGKRGIWFCGAYQGYGFHEDGLKAGMAAAHGVIGQSHSVLENPQH  429

Query  1705  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1884
             MVPS  E GARL VTRFL  +I TGS+ILLEEGGT+FTFEGT K   L V +R+HSPQFY
Sbjct  430   MVPSLMEMGARLFVTRFLGRYISTGSLILLEEGGTMFTFEGTTKGCPLTVNLRIHSPQFY  489

Query  1885  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2064
             WKV TQADLGLADAYI+GD SFVDK  GLLNLF+I +ANRD   +VS+ + KRGWWTP+L
Sbjct  490   WKVMTQADLGLADAYINGDFSFVDKDRGLLNLFQILIANRDSDTTVSKLSKKRGWWTPML  549

Query  2065  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2244
              T+ IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK E ED
Sbjct  550   LTAGIASAKYFFKHVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKMEGED  609

Query  2245  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2424
             LK AQMRKI LLI KA+I K H +LEIGCGWGS AIE V +TGCKYTGITLS++QLKYAE
Sbjct  610   LKVAQMRKICLLIKKARIEKTHEVLEIGCGWGSFAIEVVRQTGCKYTGITLSKEQLKYAE  669

Query  2425  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2604
              +V+EAGLQD+I+FLLCDYRQLP   +YDRIISCEM+EAVGHE+M EFF  CESVLA++G
Sbjct  670   SRVKEAGLQDHIKFLLCDYRQLPSTYKYDRIISCEMIEAVGHEYMEEFFSCCESVLAKDG  729

Query  2605  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGI  2784
             ++VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMA++SRLCVEHL++IGI
Sbjct  730   LVVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMASASRLCVEHLDNIGI  789

Query  2785  HYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2964
             HYYQTL+CWR NF+E++ +IL LGF+++FIRTWEYYFDYCAAGF   TLG+YQIVFSRPG
Sbjct  790   HYYQTLQCWRKNFMEKKRKILALGFNEEFIRTWEYYFDYCAAGFKLHTLGNYQIVFSRPG  849

Query  2965  NVTAFGDPYKGLASA  3009
             N  AF DPY    S+
Sbjct  850   NDDAFADPYVSFPSS  864



>gb|AAT74602.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =  1355 bits (3506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/869 (74%), Positives = 747/869 (86%), Gaps = 5/869 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M++AV+G GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1     MKIAVIGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFESLG+DME  DMS SVSL+ G G EWGSRNG S LFAQK NL NPYFWQM+R
Sbjct  61    YPNMMELFESLGIDMEPFDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EILKFKNDV+SYLE  +NNPD+DRN+TLG+FIKS+GYS+LFQKAY++P+C SIWSC +E 
Sbjct  121   EILKFKNDVISYLELLENNPDIDRNETLGQFIKSKGYSDLFQKAYLVPVCGSIWSCPTER  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSA+SILSFCRNHHLLQ+FGRPQW+TV+ RSH YVNKVREELE  GC+IR GCEVHS
Sbjct  181   VMDFSAFSILSFCRNHHLLQIFGRPQWMTVRWRSHRYVNKVREELESTGCQIRTGCEVHS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V +D    A G  ++ G +   E Y GCIMA HAP  L++LG QAT+DE  +LGAFQYVY
Sbjct  241   VLSD----AEGCTVLCGDDS-HELYQGCIMAVHAPYALRLLGNQATYDESTVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLHR+++ MP+N AAWSAWNFLG+ +  V LTYWLN LQNLG+T  P+LVTLNP  T
Sbjct  296   SDIYLHRDKNLMPKNPAAWSAWNFLGSTDKNVSLTYWLNVLQNLGETSLPFLVTLNPDYT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW TGHPVPSVAA++AS EL+RIQGKR IWFCGAY GYGFHEDGLKAGMIAA+G
Sbjct  356   PKHTLLKWRTGHPVPSVAATKASLELDRIQGKRGIWFCGAYLGYGFHEDGLKAGMIAANG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL K C+ L+NP HMVPS  ETGARL VTRFL+ FI TG +ILLEEGGT+FTFEGT  K 
Sbjct  416   LLGKSCNILSNPKHMVPSLMETGARLFVTRFLSHFISTGCVILLEEGGTMFTFEGTSNKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VHSP FYWKV T+ADLGLAD+YI+GD SFVDKK+GLLNL  I +ANRDL +S 
Sbjct  476   SLKTVIKVHSPHFYWKVMTEADLGLADSYINGDFSFVDKKDGLLNLVMILIANRDLISSN  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ + KRGWWTPLLFT+ + SAKYF +H+ RQNTLTQARRNISRHYDLSN+LF+LFLDET
Sbjct  536   SKLSKKRGWWTPLLFTAGLTSAKYFFKHVLRQNTLTQARRNISRHYDLSNDLFALFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK+EDEDLK AQ RKISLLI+KA+I  +H ILEIGCGW SLAIE V+RTGCKY
Sbjct  596   MTYSCAVFKTEDEDLKDAQHRKISLLIEKARIDSKHEILEIGCGWXSLAIEVVKRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK AE +V+EAGLQ+NIRF LCDYRQLP   +YDRIISCEM+EAVGHE+M 
Sbjct  656   TGITLSEEQLKLAEKRVKEAGLQENIRFQLCDYRQLPSTYKYDRIISCEMIEAVGHEYME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             +FFG CESVLA++G+LVLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+T+AM A
Sbjct  716   DFFGCCESVLADDGLLVLQFISIPEERYNEYRRSSDFIKEYIFPGGCLPSLARITTAMNA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +S+LCVEH+E+IG+HYYQTLR WR NFLE+QS+I  LGF+ KFIRTWEYYFDYCAAGF +
Sbjct  776   ASKLCVEHVENIGLHYYQTLRYWRKNFLEKQSKIHALGFNDKFIRTWEYYFDYCAAGFKS  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
              TLG+YQ+VFSRPGNV A G+PYK   SA
Sbjct  836   NTLGNYQVVFSRPGNVVALGNPYKDFPSA  864



>ref|XP_004495453.1| PREDICTED: uncharacterized protein LOC101501999 [Cicer arietinum]
Length=864

 Score =  1353 bits (3503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 641/866 (74%), Positives = 748/866 (86%), Gaps = 7/866 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG+GISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVVGSGISGLVSAYVLAKAGVNVVLYEKENYLGGHAKTVNADGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME+SDMSFSVSLD G G EWGSRNG SGLFAQK+N+LNPYFWQMIR
Sbjct  61    YPNMMEFFESLGVDMELSDMSFSVSLDKGRGCEWGSRNGLSGLFAQKRNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+D +SY+   +NN  +D N++LG+F+KSRGYSELFQKAY+IP+C SIWSCS EG
Sbjct  121   EIIKFKDDAISYIAMIENNLQIDHNESLGQFLKSRGYSELFQKAYLIPICGSIWSCSYEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             V++FSA+S+LSFCRNHHLLQLFGRPQWLTVK RS +YV KV+EEL+  G +I   CEV  
Sbjct  181   VLSFSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSQNYVKKVKEELQSNGSQIVANCEVDL  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VS  E G      ++  K+  +E YDGCIMA HAPD L++LG +AT+DE RI+GAFQY Y
Sbjct  241   VSASENG-----CVVHCKDGSEEMYDGCIMAIHAPDALRLLGDEATYDERRIIGAFQYAY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR++S MP+N AAWSAWNFLG+ NN+VC+TYWLN LQN+ +  +P+ VTLNP   
Sbjct  296   SDIFLHRDESLMPQNPAAWSAWNFLGSTNNKVCVTYWLNILQNIEEAGKPFFVTLNPDHV  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKW+TGHPVPSVAA +AS+EL+ IQGKRRIWF GAYQGYGFHEDGLKAGM AAHG
Sbjct  356   PENTLLKWSTGHPVPSVAAYKASAELDSIQGKRRIWFSGAYQGYGFHEDGLKAGMAAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L + C+ L NP HMVPSW E GARL VTRFL+ FI TGS+ LLEEGGT+FTFEGT K  
Sbjct  416   ILGRCCALLTNPIHMVPSWKELGARLFVTRFLSCFITTGSLTLLEEGGTMFTFEGTGKMC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
               K ++RVH+PQFYWKV TQADLGLADAYI+GD SFVDK EGLLN F + +ANRDL+AS 
Sbjct  476   SPKSVLRVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNFFLVLIANRDLNASN  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+    RGWWTP+LFT+ + SAK+F+ H+SR+NTLTQARRNISRHYDLSNELF++FLDET
Sbjct  536   SKLKKSRGWWTPILFTAGLTSAKFFMDHVSRKNTLTQARRNISRHYDLSNELFAIFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK+EDEDLK AQMRKISLLI+KAKI K+H ILEIGCGWGSLAIE V++TGCKY
Sbjct  596   MTYSCAVFKNEDEDLKDAQMRKISLLIEKAKIEKKHEILEIGCGWGSLAIEVVKKTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLS++QLK AE +V++AGLQD+I+FLLCDYRQLP   ++DRIISCEM+EAVGHE+M 
Sbjct  656   TGITLSKEQLKLAEKRVQDAGLQDHIKFLLCDYRQLPKTYKFDRIISCEMIEAVGHEYME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CES+LA++G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMA+
Sbjct  716   EFFGCCESLLADDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAS  775

Query  2743  SSRLC--VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2916
             +S+LC  VEH+E++GIHYYQTLR WR NFLERQS+ILDLGF++KFIRTWEYYFDYC  GF
Sbjct  776   TSKLCCSVEHVENMGIHYYQTLRWWRKNFLERQSEILDLGFNEKFIRTWEYYFDYCGGGF  835

Query  2917  HTCTLGDYQIVFSRPGNVTAFGDPYK  2994
              + TLG+YQ+VFSRPGNVT F DPYK
Sbjct  836   KSRTLGNYQVVFSRPGNVTTFSDPYK  861



>ref|XP_006606354.1| PREDICTED: uncharacterized protein LOC100815937 isoform X1 [Glycine 
max]
Length=861

 Score =  1348 bits (3490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 645/864 (75%), Positives = 746/864 (86%), Gaps = 4/864 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG+GISGL SAY+LAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNRVT
Sbjct  1     MRVAVVGSGISGLASAYLLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDVDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM++ FE+LGVDME SDMSFSVSLD G G EWGSRNG S LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMLDFFENLGVDMESSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV+SYL+  +NNPD+DRN+ LGEFIKSRGYSELFQKAY+IP+C SIWSCSSEG
Sbjct  121   EIVKFKDDVISYLDMLENNPDIDRNEPLGEFIKSRGYSELFQKAYLIPICGSIWSCSSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RS +YVNKV++ELE+ G +I    EVH 
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSQTYVNKVKQELEREGSQIITNREVHL  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST  +       ++   +  QE YDGCIMA HAPD L++LG +AT+DE RILGAFQY Y
Sbjct  241   VSTTSEKGC----VVYCNDGSQEMYDGCIMAVHAPDALRLLGDEATYDERRILGAFQYAY  296

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MP+N AAWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   
Sbjct  297   SDIFLHRDKNLMPQNPAAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHI  356

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAYQGYGFHEDG KAGMIAAHG
Sbjct  357   PENTLLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYQGYGFHEDGFKAGMIAAHG  416

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L   C+   NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K  
Sbjct  417   ILGSCCALQTNPKHMVPSWKELGARIFVTRFLSCYITTGCLMLLEEGGTMFTFEGTGKNC  476

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK ++RVH PQFYWKV TQADLGLADAYI+GD SFVDK EGLLNL  I +ANRD +AS 
Sbjct  477   GLKSVLRVHDPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNLILILIANRDSNASN  536

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+    RGWWTP+ FTSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSN+LF+ FLDET
Sbjct  537   SKLKKNRGWWTPVFFTSALTSAKFFMDHVSRRNTLTQARRNISRHYDLSNDLFATFLDET  596

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKY
Sbjct  597   MTYSCAVFKNKDEDLKDAQKRKISLLIEKARIDKTHEILEIGCGWGSLAIEVVKQTGCKY  656

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK AE +V++AGLQD I F+LCDYRQLP   +YDRIISCEM+EAVGHE+M 
Sbjct  657   TGITLSEEQLKLAEQRVKDAGLQDRINFVLCDYRQLPKTYKYDRIISCEMIEAVGHEYME  716

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA
Sbjct  717   EFFGCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAA  776

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEH+E+IGIHYYQTLRCWR NFL+RQ++IL LGF++KFIRTWEYYFDYC AGF +
Sbjct  777   TSRLCVEHVENIGIHYYQTLRCWRKNFLKRQNEILALGFNEKFIRTWEYYFDYCGAGFKS  836

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYK  2994
              TLG+YQ+VFSRPGNV A GDPYK
Sbjct  837   LTLGNYQVVFSRPGNVPALGDPYK  860



>emb|CBI23694.3| unnamed protein product [Vitis vinifera]
Length=881

 Score =  1348 bits (3488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 650/886 (73%), Positives = 751/886 (85%), Gaps = 21/886 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+VT
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61    YPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSEL-FQKAYIIPMCASIWSCSSE  939
             E++KFK+DVL YLEE +NNPD+DRN TLG+FIK   YS +      I+P+CASIW CS+E
Sbjct  121   EMIKFKDDVLKYLEELENNPDIDRNQTLGDFIKCPLYSVISLSFKLIVPICASIWPCSAE  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM+FSA+ +LSFCRNHHLLQLFG PQWLTVK  SH YVNKVREELE +GC+IR  CEV 
Sbjct  181   GVMSFSAFLVLSFCRNHHLLQLFGHPQWLTVKCCSHYYVNKVREELESKGCQIRTACEVV  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST + G      I  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV
Sbjct  241   SVSTTDDG----CTIFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYV  295

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
              SDI+LHR+++FMP+N AAWSAWNFLGT+ N+VCL+YWLN LQN+  T  P+LVTLNP  
Sbjct  296   SSDIFLHRDKNFMPQNPAAWSAWNFLGTIENKVCLSYWLNVLQNIDQTSLPFLVTLNPSH  355

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLK-------  1638
             TP+  LLKW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLK       
Sbjct  356   TPDHTLLKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKVAIIKHP  415

Query  1639  ---AGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGT  1809
                AGM+AAH +L K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT
Sbjct  416   CSQAGMVAAHSILGKGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGT  475

Query  1810  VFTFEGTDKKNLLKVLVRVHSPQFYWK-----VATQADLGLADAYIHGDISFVDKKEGLL  1974
             ++TFEG+ KK LLKV +++H+PQFYWK     +ATQADLGLADAYI+GD S VDK EGL 
Sbjct  476   IYTFEGSGKKCLLKVALKIHNPQFYWKESKKRIATQADLGLADAYINGDFSLVDKDEGLQ  535

Query  1975  NLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISR  2154
             +LF IF+ANRDL +S+SR N KRGWWTPL FT+ IASAKY+ +H+SRQNTLTQARRN+SR
Sbjct  536   SLFMIFIANRDLDSSLSRLNKKRGWWTPLFFTAGIASAKYYFQHVSRQNTLTQARRNVSR  595

Query  2155  HYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCG  2334
             HYDLSNELFSLFLDETMTYSCAVFK+E EDLK AQ+RKISLLI+KA+I K+H +LEIGCG
Sbjct  596   HYDLSNELFSLFLDETMTYSCAVFKTEGEDLKVAQLRKISLLIEKARIDKKHEVLEIGCG  655

Query  2335  WGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDR  2514
             WGSLAIE V++TGCKYTGIT S++QLK+AE KV+EAGLQDNIRFLLCDYRQLP++ +YDR
Sbjct  656   WGSLAIEVVKQTGCKYTGITPSKEQLKFAEMKVKEAGLQDNIRFLLCDYRQLPNSYKYDR  715

Query  2515  IISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFP  2694
             IISC MLE+VGHE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFP
Sbjct  716   IISCGMLESVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFP  775

Query  2695  GGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFI  2874
             GGCLPSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFI
Sbjct  776   GGCLPSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFI  835

Query  2875  RTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             RTWEYYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  836   RTWEYYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  881



>ref|XP_009586642.1| PREDICTED: uncharacterized protein LOC104084479 isoform X3 [Nicotiana 
tomentosiformis]
Length=864

 Score =  1346 bits (3483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 651/869 (75%), Positives = 740/869 (85%), Gaps = 6/869 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLV AY LAK G  VVVYEKEDYLGGHAKTVT+DGV LDLGFM FN+VT
Sbjct  1     MKVAVVGAGISGLVCAYELAKSGVKVVVYEKEDYLGGHAKTVTVDGVHLDLGFMFFNQVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME F  LG D EISDMSFSVSLD+GHG EWG+RNGFS LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFVFLGADTEISDMSFSVSLDHGHGCEWGTRNGFSSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK DV SYLE  DNNPD+D + T+G+FIKS GYSELFQK+Y+IP+C+SIWSC SEG
Sbjct  121   EISKFKQDVTSYLEALDNNPDIDCDKTIGQFIKSHGYSELFQKSYLIPICSSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSAYSILSF R+HHLLQLFG  Q LTV+  SH+ VNKV+EELEKRGC+IR  CEV+S
Sbjct  181   VMGFSAYSILSFFRDHHLLQLFGLSQLLTVRWGSHTSVNKVKEELEKRGCQIRTDCEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VSTD +G       I+  +  +E YDGCIMAAHAPDTL+MLGK+AT DE RILGAFQY Y
Sbjct  241   VSTDGEGCT-----IACNDGAKEVYDGCIMAAHAPDTLRMLGKEATCDETRILGAFQYSY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++F+PR+ AAWSA NFLGT  NR  +TYWLN +QNLGD+K PYLVT++PP T
Sbjct  296   SDIFLHRDKTFLPRDPAAWSALNFLGTTKNRGRMTYWLNVIQNLGDSKLPYLVTVDPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKWTTGH VPSVAAS+AS EL++IQGKR IWFCGAYQGYGFHEDGLK G+ AA G
Sbjct  356   PEHILLKWTTGHLVPSVAASKASRELDQIQGKRGIWFCGAYQGYGFHEDGLKVGVAAADG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L++ CS L+N  HMVP+WPETGARL+VTRF  SFI TG IIL E GGTVFTF+GT++K 
Sbjct  416   VLRRNCSILDNSKHMVPTWPETGARLVVTRFFRSFIKTGCIILFE-GGTVFTFQGTERKC  474

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKV +R+H PQFYWK AT+A++GLADA+IHGD SFVDK EGLLNL  IFVAN DL ASV
Sbjct  475   SLKVSLRIHGPQFYWKTATEAEIGLADAFIHGDFSFVDKNEGLLNLIMIFVANSDLKASV  534

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             + S+ KRGWWTP LFT+A+ SAKYFI+H+  QNTLTQARRNISRHYDLSNELFSLFLD T
Sbjct  535   TSSSKKRGWWTPFLFTAALPSAKYFIQHVLNQNTLTQARRNISRHYDLSNELFSLFLDGT  594

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FKSEDEDLK AQ+RKIS+LI KAKISKEHHILEIG GWGS A+E V++TGCKY
Sbjct  595   MTYSCAIFKSEDEDLKDAQLRKISVLIRKAKISKEHHILEIGFGWGSFAVEVVKQTGCKY  654

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQL+YA+  V +AGLQD I FLLCDYRQ+P+  +Y RIIS EM+E VGHEFM+
Sbjct  655   TGITLSEQQLEYAQLIVEQAGLQDRITFLLCDYRQMPNKDKYHRIISIEMIEHVGHEFMD  714

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CES LAE+G+LV+QF S+PDERYDEYR S  FIKEYIFPGGCLPSL+RVTSAMA+
Sbjct  715   EFFTCCESALAEDGLLVVQFTSVPDERYDEYRHSIGFIKEYIFPGGCLPSLNRVTSAMAS  774

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCV HLE+IGIHYYQTLRCWR NFL+ QSQI  LGFD KFIRTWEYYFDYCAAGF T
Sbjct  775   ASRLCVNHLEEIGIHYYQTLRCWRDNFLKNQSQIRVLGFDDKFIRTWEYYFDYCAAGFKT  834

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
               +G+YQIVFSRPGN+ AFGDPY  + SA
Sbjct  835   RAIGNYQIVFSRPGNIAAFGDPYSAVPSA  863



>ref|XP_006406021.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
 gb|ESQ47474.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
Length=870

 Score =  1345 bits (3482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/871 (73%), Positives = 735/871 (84%), Gaps = 5/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMM+ FE LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFWQMI
Sbjct  61    TYPNMMDFFEKLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y+EE ++NPD+ RN+TLGEF+ SRGYSELFQKAY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLKYIEELESNPDISRNETLGEFLNSRGYSELFQKAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV++FSAYS+LSFC NHHLLQ+FGRPQWLTV  RS SYV KVR ELE+ GC+IR  C++ 
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQSYVAKVRAELERLGCKIRTSCDIK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV T E G     V ++  +  QE +D CIMA HAPD L++LG+Q T+DE RILGAF+YV
Sbjct  241   SVLTSEDG----CVTVTSGDGSQEEFDRCIMAMHAPDALRLLGEQVTYDETRILGAFRYV  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+ ++P+ VTLNP +
Sbjct  297   YSDIYLHHDTDLMPRNRAAWSAWNFLGSTEKKVCVTYWLNILQNLGEDREPFFVTLNPDQ  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM AA 
Sbjct  357   TPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNMWFCGAYQGYGFHEDGLKAGMAAAR  416

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K  + LNNP HMVPS  E+GARL VTRF+  FI TGS+ +LEEGGT+FTF G D  
Sbjct  417   GLLGKEAALLNNPRHMVPSLTESGARLFVTRFMGQFISTGSVTILEEGGTMFTFGGKDST  476

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GL+NL  I +ANRDLS++
Sbjct  477   CSLKSVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLVNLIMILIANRDLSST  536

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S    KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF LFLD+
Sbjct  537   KSNLAKKRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGLFLDD  596

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFKS+DEDLKTAQMRKISLLI+KA+I K H +LEIGCGWG+LAIE V RTGCK
Sbjct  597   TMTYSSAVFKSDDEDLKTAQMRKISLLIEKARIEKNHEVLEIGCGWGTLAIEVVRRTGCK  656

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAE+KV+EAGL+D I+F LCDYRQL D  +YDRIISCEMLEAVGHEFM
Sbjct  657   YTGITLSIEQLKYAEEKVKEAGLEDRIKFELCDYRQLSDTQKYDRIISCEMLEAVGHEFM  716

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCE+ LA++G++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAMA
Sbjct  717   EMFFSRCEAALAQDGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMA  776

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGIHYY+TLR WR NFLERQ  I+ LGFD +FIRTWEYYFDYCAAGF 
Sbjct  777   SSSRLCIEHVENIGIHYYKTLRLWRKNFLERQKPIIALGFDDQFIRTWEYYFDYCAAGFK  836

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGN+ AF D YKG  SAY
Sbjct  837   TLTLGNYQVVFSRPGNLAAFADSYKGFPSAY  867



>ref|XP_006296683.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
 gb|EOA29581.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
Length=867

 Score =  1343 bits (3477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 636/871 (73%), Positives = 734/871 (84%), Gaps = 8/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQK N+LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKTNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y+EE + NPD+DRN TLG+F+ +RGYSELFQ AY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLKYIEELEGNPDIDRNQTLGDFLNARGYSELFQNAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV+ FSAYS+LSFC NHHLLQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C+V 
Sbjct  181   GVLNFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDVK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF+YV
Sbjct  241   SVSTSENG----CVTVTSGDESEEVFDRCILAMHAPDALRLLGEEVTFDETRVLGAFRYV  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWS+WNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP +
Sbjct  297   YSDIYLHHDIDLMPRNQAAWSSWNFLGSTEKKVCVTYWLNILQNLGENGEPFFVTLNPDQ  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM AA 
Sbjct  357   TPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNLWFCGAYQGYGFHEDGLKAGMAAAR  416

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K  + LNNP HMVPS  ETGARL VTRF+  FI TGS+ LLEEGGT+FTF G D  
Sbjct  417   GLLGKEAALLNNPRHMVPSLTETGARLFVTRFMGQFISTGSVTLLEEGGTMFTFGGKDST  476

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNL  I +ANRD  ++
Sbjct  477   CPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLLNLIMILIANRDTKSN  536

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             +++   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+
Sbjct  537   LTK---KRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDD  593

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFKS+DEDLKTAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V RTGCK
Sbjct  594   TMTYSSAVFKSDDEDLKTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTGCK  653

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAE KV+EAGLQD+I+F LCDYRQL D  +YDRIISCEMLEAVGHEFM
Sbjct  654   YTGITLSIEQLKYAEQKVKEAGLQDHIKFELCDYRQLSDVHKYDRIISCEMLEAVGHEFM  713

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCE+ LAENG++VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSAM+
Sbjct  714   EMFFSRCEAALAENGLIVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMS  773

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD+KFIRTWEYYFDYCAAGF 
Sbjct  774   SSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFDEKFIRTWEYYFDYCAAGFK  833

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  834   TLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_006589307.1| PREDICTED: uncharacterized protein LOC100801659 isoform X1 [Glycine 
max]
Length=860

 Score =  1342 bits (3472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 642/864 (74%), Positives = 744/864 (86%), Gaps = 5/864 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGL SAYVLAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNRVT
Sbjct  1     MRVAVVGAGISGLASAYVLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDIDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM++ FE+LGVDME+SDMSFSVSLD G G EWGSRNG + LFAQK+N+LNPYFWQMIR
Sbjct  61    YPNMLDFFENLGVDMELSDMSFSVSLDKGRGCEWGSRNGLTSLFAQKRNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV+SYL+  +NNPD+DRN+ LGEFIKSRGYSELFQKAY+IP+C SIWSCSSEG
Sbjct  121   EIVKFKDDVISYLDMLENNPDIDRNEPLGEFIKSRGYSELFQKAYLIPICGSIWSCSSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFC NHHLLQLFGRPQWLTV+ RS +YVNKV+EELE+ G +I    EV  
Sbjct  181   VMSFSAFSVLSFCHNHHLLQLFGRPQWLTVRWRSQTYVNKVKEELEREGSQIITNREVQL  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST E+       ++  K+  +E YDGCIMA HAPD L++LG +ATFDE RILGAFQY Y
Sbjct  241   VSTSEKE-----CVVHCKDGSEEMYDGCIMAVHAPDALRLLGDEATFDERRILGAFQYAY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MP+N AAWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   
Sbjct  296   SDIFLHRDKNLMPQNPAAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHI  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAY GYGFHEDG KAGMIAAHG
Sbjct  356   PENTLLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYLGYGFHEDGFKAGMIAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL   C    NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K  
Sbjct  416   LLGSCCVLQTNPKHMVPSWKELGARIFVTRFLSYYINTGCLMLLEEGGTMFTFEGTGKNC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK ++RVH+PQFYWKV TQADLGLADAYI+GD SFVDK EGLL L  I +ANRD +AS 
Sbjct  476   GLKSVLRVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLILILILIANRDSNASN  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
              +    RGWWTP+  TSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSNELF++FLDET
Sbjct  536   LKLKKNRGWWTPVFLTSALTSAKFFMEHVSRRNTLTQARRNISRHYDLSNELFAIFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKY
Sbjct  596   MTYSCALFKNKDEDLKDAQKRKISLLIEKARIDKTHEILEIGCGWGSLAIEVVKQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLS++QLK AE +V++AGLQD I+FLLCDYRQLP   +YDRIISCEM+EAVGHE+M 
Sbjct  656   TGITLSKEQLKLAEQRVKDAGLQDRIKFLLCDYRQLPKAYKYDRIISCEMIEAVGHEYME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA
Sbjct  716   EFFGCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLC EH+E+IGIHYYQTLRCWR NFLERQ++I+ LGF++KFIRTWEYYFDYC AGF +
Sbjct  776   TSRLCGEHVENIGIHYYQTLRCWRKNFLERQNEIMALGFNEKFIRTWEYYFDYCGAGFKS  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYK  2994
              TLG+YQ+VFSRPGNV A GDPYK
Sbjct  836   LTLGNYQVVFSRPGNVAALGDPYK  859



>ref|XP_010023868.1| PREDICTED: uncharacterized protein LOC104414445 [Eucalyptus grandis]
 gb|KCW60265.1| hypothetical protein EUGRSUZ_H02975 [Eucalyptus grandis]
Length=865

 Score =  1339 bits (3465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 633/855 (74%), Positives = 733/855 (86%), Gaps = 5/855 (1%)
 Frame = +1

Query  445   SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  624
             +AY   +GGA VVVYEKEDYLGGHAKTV++DGVDLDLGFMVFNRVTYPNMMELFESLGVD
Sbjct  15    AAYEAVRGGAKVVVYEKEDYLGGHAKTVSIDGVDLDLGFMVFNRVTYPNMMELFESLGVD  74

Query  625   MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLE  804
             MEISDMSFSVSLD G G EWG RNG   LFAQK N+LNPYFWQM+REI+KFK DVLSYLE
Sbjct  75    MEISDMSFSVSLDEGQGCEWGGRNGLWSLFAQKSNVLNPYFWQMLREIIKFKEDVLSYLE  134

Query  805   EFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCR  984
               + NPD+DRN+TLG+F+KSRGYSELFQ+A+IIP+C SIWSCSS+GVM+FSA+S+LSFCR
Sbjct  135   GLERNPDIDRNETLGQFVKSRGYSELFQRAFIIPICGSIWSCSSKGVMSFSAFSVLSFCR  194

Query  985   NHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVI  1164
             NHHLLQ+ GRPQWLTV+RRSHSYVNKVR ELE RGCEIR  CEV S+ST +QG     V+
Sbjct  195   NHHLLQVLGRPQWLTVRRRSHSYVNKVRGELECRGCEIRTSCEVRSISTSDQG----CVV  250

Query  1165  ISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPR  1344
             ++G    +E YD CI+A HAPD L++LG QAT+DE+R+LGAFQY YSDIYLH +++FMP+
Sbjct  251   LTGDG-SEELYDKCIVAVHAPDALRLLGDQATYDEMRVLGAFQYAYSDIYLHHDKTFMPK  309

Query  1345  NLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpv  1524
               AAWSAWNFLG+  N++CLTYWL+ +QNL     P+LVTLNP R P+  LLKW TGHP+
Sbjct  310   KPAAWSAWNFLGSTENKLCLTYWLDVIQNLDQKDLPFLVTLNPSREPQNTLLKWCTGHPI  369

Query  1525  psvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNH  1704
             PSVAAS+AS EL++IQGKR IWFCGAYQGYGFHEDGLKAGM AAHG++ +  S L NP H
Sbjct  370   PSVAASKASQELDQIQGKRGIWFCGAYQGYGFHEDGLKAGMAAAHGVIGQSHSVLENPQH  429

Query  1705  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1884
             MVPS  E GARL VTRFL  +I TGS+ILLEEGG +FTFEGT K+  L V +R+HSPQFY
Sbjct  430   MVPSLMEMGARLFVTRFLGRYISTGSLILLEEGGKMFTFEGTTKRCPLTVNLRIHSPQFY  489

Query  1885  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2064
             WKV TQADLGLADAYI+GD SFVDK  GLLNLF+I +ANRD   +VS+ + KRGWWTP+L
Sbjct  490   WKVMTQADLGLADAYINGDFSFVDKDRGLLNLFQILIANRDSDTTVSKLSKKRGWWTPML  549

Query  2065  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2244
              T+ IASAKY+ +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK   ED
Sbjct  550   LTAGIASAKYYFKHVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKMAGED  609

Query  2245  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2424
             LK AQMRKI LLI KA+I K H +LEIGCGWGS AIE V +TGCKYTGITLS++QLKYAE
Sbjct  610   LKVAQMRKICLLIKKARIEKTHEVLEIGCGWGSFAIEVVRQTGCKYTGITLSKEQLKYAE  669

Query  2425  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2604
              +V+EAGLQD I+FLLC+YRQLP   +YDRIISCEM+EAVGHE+M EFF  CESVLA+NG
Sbjct  670   SRVKEAGLQDRIKFLLCNYRQLPSTYKYDRIISCEMIEAVGHEYMEEFFSCCESVLAKNG  729

Query  2605  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGI  2784
             +LVLQFISIPDERYDE+R+SS F+KEYIFPGGCLPSLSR+TSAMA++SRLCVEHL++IGI
Sbjct  730   LLVLQFISIPDERYDEHRRSSSFMKEYIFPGGCLPSLSRITSAMASASRLCVEHLDNIGI  789

Query  2785  HYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2964
             HYYQTL+CWR NFLE++ +IL LGF+++FIRTWEYYFDYCAAGF + TLG+YQIVFSRPG
Sbjct  790   HYYQTLQCWRKNFLEKKRKILALGFNEEFIRTWEYYFDYCAAGFKSHTLGNYQIVFSRPG  849

Query  2965  NVTAFGDPYKGLASA  3009
             N  AF DPY G  S+
Sbjct  850   NDAAFADPYVGFLSS  864



>gb|AAL57657.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAN64525.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
Length=867

 Score =  1338 bits (3464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/871 (73%), Positives = 734/871 (84%), Gaps = 8/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DVL Y+EE + NPD+DR +TLGEF+ SRGYSELFQ+AY++P+C SIWSC S+
Sbjct  121   REIVRFKEDVLKYIEELEGNPDIDRKETLGEFLNSRGYSELFQQAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV++FSAYS+LSFC NHHLLQ+FGRPQWLTV  RS +YV KVR ELE+ GC IR  C+V 
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRTELERLGCRIRTSCDVK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST E G     V ++G +  +E +D CI+A HAPD L++LG++ TFDE R+LGAFQYV
Sbjct  241   SVSTSENG----CVTVTGGDGSKEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAFQYV  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP  
Sbjct  297   YSDIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLNPDE  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR IWFCGAYQGYGFHEDGLKAGM AA 
Sbjct  357   TPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNIWFCGAYQGYGFHEDGLKAGMAAAR  416

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K  + LNNP HMVPS  ETGARL VTRFL  FI TGS+ +LEEGGT+FTF G D  
Sbjct  417   GLLGKETALLNNPRHMVPSLTETGARLFVTRFLGQFISTGSVTILEEGGTMFTFGGKDST  476

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +ANRD  ++
Sbjct  477   CPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNLIMILIANRDTKSN  536

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             +S+   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+
Sbjct  537   LSK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDD  593

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFKS+DEDL+TAQMRKISLLIDKA+I K+H +LEIGCGWG+LAIE V RTGCK
Sbjct  594   TMTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCGWGTLAIEVVRRTGCK  653

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDRIISCEMLEAVGHEFM
Sbjct  654   YTGITLSIEQLKYAEEKVKEAGLQDWITFELRDYRQLSDAQKYDRIISCEMLEAVGHEFM  713

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVT+AM+
Sbjct  714   EMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTTAMS  773

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+ LGFD KF+RTWEYYFDYCAAGF 
Sbjct  774   SSSRLCIEHVENIGIHYYQTLRLWRKNFLARQKQIMALGFDDKFVRTWEYYFDYCAAGFK  833

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  834   TLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_002883433.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59692.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
Length=867

 Score =  1338 bits (3463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 632/871 (73%), Positives = 734/871 (84%), Gaps = 8/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGISGLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DVL Y+EE + NPD+DR +TLGEF+ +RGYSELFQKAY++P+C SIWSC S+
Sbjct  121   REIVRFKEDVLKYIEELEGNPDIDRKETLGEFLNARGYSELFQKAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV++FSAYS+LSFC NHHLLQ+FGRPQWLTV  RS +YV KVR ELE+ GC I+  C++ 
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCTIKTSCDIK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF+YV
Sbjct  241   SVSTSEDG----CVTVTSGDGSEEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAFRYV  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+ ++P+ VTLNP  
Sbjct  297   YSDIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENREPFFVTLNPDE  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM AA 
Sbjct  357   TPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNLWFCGAYQGYGFHEDGLKAGMAAAR  416

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K  + LNNP HMVPS  ETGARL VTRFL  FI TGS+ +LEEGGT+FTFEG D  
Sbjct  417   GLLGKETALLNNPRHMVPSLTETGARLFVTRFLGQFISTGSVTILEEGGTMFTFEGKDST  476

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNL  I +ANRD  ++
Sbjct  477   CPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLLNLIMILIANRDTKSN  536

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             +++   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+
Sbjct  537   LTK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDD  593

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVF+S+DEDL+TAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V RTGCK
Sbjct  594   TMTYSSAVFQSDDEDLRTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTGCK  653

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDRIISCEMLEAVGHEFM
Sbjct  654   YTGITLSIEQLKYAEEKVKEAGLQDRITFELRDYRQLSDAHKYDRIISCEMLEAVGHEFM  713

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM+
Sbjct  714   EMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMS  773

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD KFIRTWEYYFDYCAAGF 
Sbjct  774   SSSRLCIEHVENIGIHYYQTLRVWRKNFLERQKQIMALGFDDKFIRTWEYYFDYCAAGFK  833

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  834   TLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_011073567.1| PREDICTED: uncharacterized protein LOC105158481 isoform X2 [Sesamum 
indicum]
Length=802

 Score =  1337 bits (3461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 638/807 (79%), Positives = 722/807 (89%), Gaps = 5/807 (1%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FE+LGVDME+SDMSF+VSLD G G EWGSRNGFSGLFAQK N+LNPYFW MIREI+
Sbjct  1     MMEFFETLGVDMELSDMSFAVSLDGGRGCEWGSRNGFSGLFAQKTNILNPYFWTMIREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK+DVL+YLE+ DNNPD+DR +TLG F++S GYSELFQKAY+IP+C SIWSCSSEGVM+
Sbjct  61    KFKDDVLNYLEQLDNNPDIDRTETLGHFVQSHGYSELFQKAYLIPICGSIWSCSSEGVMS  120

Query  952   FSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1131
             FSAYSILSFCRNHHLLQLFGRPQWLTVK RS  YVN+VR+ LE RG  IR   EV SVST
Sbjct  121   FSAYSILSFCRNHHLLQLFGRPQWLTVKWRSQDYVNRVRDVLESRGSHIRTNSEVCSVST  180

Query  1132  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1311
             ++ G       IS K+  ++ YDGCI+AAHAPD LKMLG+QATFDELRILGAFQY YSDI
Sbjct  181   NDDGCT-----ISCKDGSEDTYDGCIIAAHAPDALKMLGQQATFDELRILGAFQYAYSDI  235

Query  1312  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1491
             +LHR+++ MPRN AAWSAWNFLG+V+N+VC+TYWLN LQN+ +T  P+LVTLNPP TPE 
Sbjct  236   FLHRDKTLMPRNPAAWSAWNFLGSVDNKVCVTYWLNILQNISETGLPFLVTLNPPSTPEH  295

Query  1492  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1671
              LLKW+TGHP+PSVAA++ASSEL  IQGKRRIWFCGAYQGYGFHEDGLKAG++AA+GLL+
Sbjct  296   TLLKWSTGHPIPSVAATKASSELNLIQGKRRIWFCGAYQGYGFHEDGLKAGVVAANGLLR  355

Query  1672  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1851
             +RC+  NNP HMVP+W ETGARLLVTRFL SFI TG IILLE GGT+FTFEGT KK+ LK
Sbjct  356   ERCTLHNNPKHMVPTWLETGARLLVTRFLDSFIATGCIILLETGGTMFTFEGTKKKSSLK  415

Query  1852  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2031
             V +R+H+PQFYWKVAT+ADLGLADAYI+GD SFVDK EGLLNLF IFVANRDLS S S+ 
Sbjct  416   VSLRIHTPQFYWKVATEADLGLADAYINGDFSFVDKNEGLLNLFMIFVANRDLSTSTSKL  475

Query  2032  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2211
             N+KRGWWTPLLFTSAIASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  476   NNKRGWWTPLLFTSAIASAKYFFQHMSRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  535

Query  2212  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2391
             SCA+FK++DEDLK AQ+RK+ LLI+KA+I+K HHILEIGCGWG+LAIEAV RTGCKYTGI
Sbjct  536   SCAIFKTQDEDLKIAQLRKVFLLIEKARINKNHHILEIGCGWGTLAIEAVRRTGCKYTGI  595

Query  2392  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2571
             TLSEQQL+YAE KV+EAGLQD I+FLLCDYRQLP+  +YDRIISCEMLEAVGHE+M EFF
Sbjct  596   TLSEQQLQYAEAKVKEAGLQDRIKFLLCDYRQLPNTDKYDRIISCEMLEAVGHEYMEEFF  655

Query  2572  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2751
               CESVL E+GILVLQFISIPDERY+EYRQS+DFIKEYIFPGGCLPSLSRVT+AM+A+SR
Sbjct  656   RCCESVLQEDGILVLQFISIPDERYNEYRQSADFIKEYIFPGGCLPSLSRVTTAMSAASR  715

Query  2752  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2931
             LCVEHLEDIGIHYYQTLR WR +FLE+QS+I  LGFD+KFIRTWEYYFDYCAAGF TCTL
Sbjct  716   LCVEHLEDIGIHYYQTLRRWRESFLEKQSKIQALGFDEKFIRTWEYYFDYCAAGFKTCTL  775

Query  2932  GDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             G+YQIVFSRPGNV AFGDPYK + SAY
Sbjct  776   GNYQIVFSRPGNVEAFGDPYKTIPSAY  802



>ref|XP_009102608.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
 ref|XP_009102609.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
Length=870

 Score =  1337 bits (3460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/871 (72%), Positives = 730/871 (84%), Gaps = 5/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   +V+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLATQGVEELVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGVDMEISDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVDMEISDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y+EE + NPD+DR++TLGEF+  RGYSE+FQKAY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLRYIEELEANPDIDRSETLGEFLNGRGYSEMFQKAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV++FSAYS+LSFC NHHLLQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C++ 
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDIK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV T + G     V ++  +  +E +D CI+A HAPD L++LG+Q TFDE R+LGAF+YV
Sbjct  241   SVLTSDDGR----VTVTSGDGSEEVFDKCILAMHAPDALRLLGEQVTFDETRVLGAFRYV  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+ ++P+ VTLNP +
Sbjct  297   YSDIYLHHDTDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGEDREPFFVTLNPDQ  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR IWFCGAYQGYGFHEDGLKAGM AA 
Sbjct  357   TPKKTLLKWTTGHPVPSVAALTASQELHKIQGKRNIWFCGAYQGYGFHEDGLKAGMAAAR  416

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K  + LNNP HMVPS  ETGARL VTRFL  FI TG + +LEEGGT+F FEG D  
Sbjct  417   GLLGKEAALLNNPRHMVPSLTETGARLFVTRFLGQFISTGCVTILEEGGTMFNFEGKDPT  476

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVD+  GLLN   I +ANRDLS+ 
Sbjct  477   CPLKSVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDRDSGLLNFMMILIANRDLSSP  536

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S    KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF LFLD+
Sbjct  537   KSNLAKKRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGLFLDD  596

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFKS+DEDL+ AQMRKISLLIDKA++ K H +LEIGCGWG+LAIE V RTGC+
Sbjct  597   TMTYSSAVFKSDDEDLRAAQMRKISLLIDKARVEKHHEVLEIGCGWGTLAIEVVRRTGCR  656

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAE+KV+EAGL+D I F LCDYRQL D  +YDRIISCEMLEAVGHEFM
Sbjct  657   YTGITLSIEQLKYAEEKVKEAGLEDRITFKLCDYRQLSDAHKYDRIISCEMLEAVGHEFM  716

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM+
Sbjct  717   EMFFSRCEAALAENGLMVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMS  776

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ  I+ LGFD KFIRTWEYYFDYCAAGF 
Sbjct  777   SSSRLCIEHVENIGIHYYQTLRMWRKNFLDRQKPIMALGFDDKFIRTWEYYFDYCAAGFK  836

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGNV AF + YKG  SAY
Sbjct  837   TLTLGNYQVVFSRPGNVAAFANSYKGFPSAY  867



>ref|NP_188995.2| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAL38380.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAP21152.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AEE76773.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =  1337 bits (3460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/871 (73%), Positives = 733/871 (84%), Gaps = 8/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DVL Y+EE + NPD+DR +TLGEF+ SRGYSELFQ+AY++P+C SIWSC S+
Sbjct  121   REIVRFKEDVLKYIEELEGNPDIDRKETLGEFLNSRGYSELFQQAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV++FSAYS+LSFC NHHLLQ+FGRPQWLTV  RS +YV KVR ELE+ GC IR  C+V 
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRTELERLGCRIRTSCDVK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAFQYV
Sbjct  241   SVSTSENG----CVTVTSGDGSKEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAFQYV  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP  
Sbjct  297   YSDIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLNPDE  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR IWFCGAYQGYGFHEDGLKAGM AA 
Sbjct  357   TPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNIWFCGAYQGYGFHEDGLKAGMAAAR  416

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K  + LNNP HMVPS  ETGARL VTRFL  FI TGS+ +LEEGGT+FTF G D  
Sbjct  417   GLLGKETALLNNPRHMVPSLTETGARLFVTRFLGQFISTGSVTILEEGGTMFTFGGKDST  476

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +ANRD  ++
Sbjct  477   CPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNLIMILIANRDTKSN  536

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             +S+   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+
Sbjct  537   LSK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDD  593

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFKS+DEDL+TAQMRKISLLIDKA+I K+H +LEIGCGWG+LAIE V RTGCK
Sbjct  594   TMTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCGWGTLAIEVVRRTGCK  653

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDRIISCEMLEAVGHEFM
Sbjct  654   YTGITLSIEQLKYAEEKVKEAGLQDWITFELRDYRQLSDAQKYDRIISCEMLEAVGHEFM  713

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVT+AM+
Sbjct  714   EMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTTAMS  773

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+ LGFD KF+RTWEYYFDYCAAGF 
Sbjct  774   SSSRLCIEHVENIGIHYYQTLRLWRKNFLARQKQIMALGFDDKFVRTWEYYFDYCAAGFK  833

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  834   TLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>dbj|BAD44154.1| unnamed protein product [Arabidopsis thaliana]
Length=867

 Score =  1336 bits (3458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/871 (73%), Positives = 733/871 (84%), Gaps = 8/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DVL Y+EE + NPD+DR +TLGEF+ SRGYSELFQ+AY++P+C SIWSC S+
Sbjct  121   REIVRFKEDVLKYIEELEGNPDIDRKETLGEFLNSRGYSELFQQAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV++FSAYS+LSFC NHHLLQ+FGRPQWLTV  RS +YV KVR ELE+ GC IR  C+V 
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRTELERLGCRIRTSCDVK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAFQYV
Sbjct  241   SVSTSENG----CVTVTSGDGSKEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAFQYV  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP  
Sbjct  297   YSDIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLNPDE  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR IWFCGAYQGYGFHEDGLKAGM AA 
Sbjct  357   TPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNIWFCGAYQGYGFHEDGLKAGMAAAR  416

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K  + LNNP HMVPS  ETGARL VTRFL  FI TGS+ +LEEGGT+FTF G D  
Sbjct  417   GLLGKETALLNNPRHMVPSLTETGARLFVTRFLGQFISTGSVTILEEGGTMFTFGGKDST  476

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +ANRD  ++
Sbjct  477   CPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNLIMILIANRDTKSN  536

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             +S+   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+
Sbjct  537   LSK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDD  593

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFKS+DEDL+TAQMRKISLLIDKA+I K+H +LEIGCGWG+LAIE V RTGCK
Sbjct  594   TMTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCGWGTLAIEVVRRTGCK  653

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDRIISCEMLEAVGHEFM
Sbjct  654   YTGITLSIEQLKYAEEKVKEAGLQDWITFELRDYRQLSDAQKYDRIISCEMLEAVGHEFM  713

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVT+AM+
Sbjct  714   EMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTTAMS  773

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+ LGFD KF+RTWEYYFDYCAAGF 
Sbjct  774   SSSRLCIEHVENIGIHYYQTLRLWRENFLARQKQIMALGFDDKFVRTWEYYFDYCAAGFK  833

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  834   TLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_010466687.1| PREDICTED: uncharacterized protein LOC104746847 [Camelina sativa]
Length=867

 Score =  1334 bits (3453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 631/871 (72%), Positives = 733/871 (84%), Gaps = 8/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAVVG+GISGL SAYVLA  G   +V+YEKE+ LGGHA+TV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVVGSGISGLGSAYVLANQGVEEIVLYEKEESLGGHARTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE LGV+ME+SDMSFSVSLDNG G EWGSRNG SGLF+QKKN+LNPYFWQMI
Sbjct  61    TYPNMMEFFEKLGVEMEVSDMSFSVSLDNGKGCEWGSRNGVSGLFSQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y++E + NPD+DRN+TLGEF+ +RGYSELFQKAY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLKYIDELEGNPDIDRNETLGEFLNARGYSELFQKAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV+ FSAYS+LSFC NHHLLQ+FGRPQWLT+  RS +YV KVR ELE+ GC+IR  C+V 
Sbjct  181   GVLNFSAYSVLSFCCNHHLLQIFGRPQWLTIAGRSQTYVAKVRAELERLGCKIRTSCDVK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST E GS    V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF+YV
Sbjct  241   SVSTSENGS----VTVTSGDGSEEVFDRCILAMHAPDALRLLGEEVTFDETRVLGAFRYV  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWS+WNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP  
Sbjct  297   YSDIYLHHDIDLMPRNQAAWSSWNFLGSTEKKVCVTYWLNILQNLGEKCEPFFVTLNPDY  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
              P++ LLKWTTGHPVPSVAA  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM AA 
Sbjct  357   PPKKALLKWTTGHPVPSVAAWTASQELHKIQGKRNLWFCGAYQGYGFHEDGLKAGMAAAR  416

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
              LL K  + LNNP HMVPS  ETGARL VTRF+  FI TG + +LEEGGT+FTF G D  
Sbjct  417   SLLGKETALLNNPRHMVPSLTETGARLFVTRFMGQFISTGCVTILEEGGTMFTFGGKDST  476

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNL  I +ANRD  ++
Sbjct  477   CPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLLNLIMILIANRDTKSN  536

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             +++   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+
Sbjct  537   LTK---KRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDD  593

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFKS+DEDLKTAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V+RTGCK
Sbjct  594   TMTYSSAVFKSDDEDLKTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVKRTGCK  653

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAE+KV+EAGLQD I+F LCDYRQL D  +YDRIISCEMLEAVGHEFM
Sbjct  654   YTGITLSIEQLKYAEEKVKEAGLQDRIKFELCDYRQLSDVQKYDRIISCEMLEAVGHEFM  713

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM+
Sbjct  714   EMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMS  773

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD KFIRTWEYYFDYCAAGF 
Sbjct  774   SSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFDDKFIRTWEYYFDYCAAGFK  833

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  834   TLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  864



>ref|XP_010527410.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
 ref|XP_010527411.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
Length=870

 Score =  1333 bits (3450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 637/873 (73%), Positives = 737/873 (84%), Gaps = 8/873 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK---GGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFN  573
             MRVAV+G GISGL SAYVLA    GG  VV+YEK+D LGGHAKTV  D  D+DLGFMVFN
Sbjct  1     MRVAVIGGGISGLGSAYVLATRHGGGDEVVLYEKDDALGGHAKTVRFDSADVDLGFMVFN  60

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  753
             RVTYPNMME FE LGVDME+SDMSFSVSLD+G G EWGSRNGFSGLFAQK N  NPYFW+
Sbjct  61    RVTYPNMMEFFEELGVDMEVSDMSFSVSLDDGRGCEWGSRNGFSGLFAQKSNAFNPYFWK  120

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MIREI+KFK+DVL Y+E  + NPD+DR++TLG+F+ S GYSELFQKAY++P+C SIWSC 
Sbjct  121   MIREIVKFKDDVLRYIESRELNPDLDRSETLGQFLDSHGYSELFQKAYLVPICGSIWSCP  180

Query  934   SEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCE  1113
             ++GV++FSA+S+LSFCRNHHLLQLFGRPQWLTV  RSH+YV KVR ELE+RGC IR  C+
Sbjct  181   ADGVLSFSAFSVLSFCRNHHLLQLFGRPQWLTVAGRSHTYVAKVRTELERRGCRIRTSCD  240

Query  1114  VHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQ  1293
             V SVST + G     V +   +  +E +D CI+A HAPD L++LG+QATFDE R+LGAFQ
Sbjct  241   VQSVSTSDNG-----VTVRCGDGSEELFDRCILAMHAPDALRLLGEQATFDETRVLGAFQ  295

Query  1294  YVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNP  1473
             YVYSDIYLH +   MPRN +AWSAWNFLG+  NRVC+TYWLN LQNLG+  +P+ VTLNP
Sbjct  296   YVYSDIYLHHDTDLMPRNQSAWSAWNFLGSTENRVCVTYWLNILQNLGEKGEPFFVTLNP  355

Query  1474  PRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIA  1653
              R P++ +LKW TGHPVPSVAA +AS EL +IQGKRR+WFCGAYQGYGFHEDGLKAG  A
Sbjct  356   NRIPKKTMLKWRTGHPVPSVAAWKASQELHKIQGKRRLWFCGAYQGYGFHEDGLKAGFSA  415

Query  1654  AHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTD  1833
             AH LL K    LNNP HMVPS  ETGAR+ VTRF+  FI TG ++LLEEGGT+FTF+G  
Sbjct  416   AHALLGKDIELLNNPTHMVPSLAETGARVFVTRFMGQFISTGCVMLLEEGGTMFTFDGKH  475

Query  1834  KKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLS  2013
              K  LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLN+  I +ANRDL+
Sbjct  476   PKCTLKTVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKNNGLLNMIMILIANRDLN  535

Query  2014  ASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2193
             +  S    KRGWWTP+ FT+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF+LFL
Sbjct  536   SPKSNLAKKRGWWTPMFFTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFALFL  595

Query  2194  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2373
             D+TMTYS AVFKSEDEDL+TAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V RTG
Sbjct  596   DDTMTYSSAVFKSEDEDLRTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTG  655

Query  2374  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHE  2553
             CKYTGITLS +QLKYAE KV+EAGLQD+I F LCDYRQL D+ +YDRIISCEMLEAVGHE
Sbjct  656   CKYTGITLSIEQLKYAEAKVKEAGLQDHITFQLCDYRQLSDSRKYDRIISCEMLEAVGHE  715

Query  2554  FMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSA  2733
             FM  FF RCES LAE+G++VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSA
Sbjct  716   FMETFFSRCESALAEDGVIVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSA  775

Query  2734  MAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAG  2913
             MA+SSRLC+EH+E+IGIHYYQTLRCWR NFLERQ QI+ LGF+++FIRTWEYYFDYCAAG
Sbjct  776   MASSSRLCIEHVENIGIHYYQTLRCWRKNFLERQKQIMALGFNEEFIRTWEYYFDYCAAG  835

Query  2914  FHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             F T TLG+YQ+VFSRPGN  AFGDPY+   SA+
Sbjct  836   FKTLTLGNYQVVFSRPGNTAAFGDPYRSFPSAH  868



>ref|XP_009586641.1| PREDICTED: uncharacterized protein LOC104084479 isoform X2 [Nicotiana 
tomentosiformis]
Length=864

 Score =  1333 bits (3450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 646/869 (74%), Positives = 738/869 (85%), Gaps = 6/869 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGL+SAY LAK G  VVVYE EDYLGGHAKTVT+D VDLDLGFM+FNRVT
Sbjct  1     MKVAVVGAGISGLISAYELAKSGVKVVVYENEDYLGGHAKTVTVDCVDLDLGFMIFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE LGV+MEIS MSFSV+LD G G EWG+RNG S LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFEFLGVNMEISHMSFSVTLDQGRGCEWGTRNGISSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV+SYLE  DNNPD+D ++TL +FIKS G SELF KAY+IP+C+SIWSC  EG
Sbjct  121   EIIKFKQDVISYLEALDNNPDIDCDETLWQFIKSNGCSELFLKAYLIPICSSIWSCPLEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSAYSILS  R+HHLLQLFG  Q LTV+  SH+ VNKV+EELEKRGC+IR  CEV+S
Sbjct  181   VMGFSAYSILSVFRDHHLLQLFGLSQLLTVRWGSHTSVNKVKEELEKRGCQIRTDCEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VSTD +G       I+  +  +E YDGCIMAAHAPDTL+MLGK+AT DE RILGAFQY Y
Sbjct  241   VSTDGEGCT-----IACNDGAKEVYDGCIMAAHAPDTLRMLGKEATCDETRILGAFQYSY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++F+PR+ AAWSA NFLGT  NR  +TYWLN +QNLGD+K PYLVT++PP T
Sbjct  296   SDIFLHRDKTFLPRDPAAWSALNFLGTTKNRGRMTYWLNVIQNLGDSKLPYLVTVDPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKWTTGH VPSVAAS+AS EL++IQGKR IWFCGAYQGYGFHEDGLK G+ AA G
Sbjct  356   PEHILLKWTTGHLVPSVAASKASRELDQIQGKRGIWFCGAYQGYGFHEDGLKVGVAAADG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L++ CS L+N  HMVP+WPETGARL+VTRF  SFI TG IIL E GGTVFTF+GT++K 
Sbjct  416   VLRRNCSILDNSKHMVPTWPETGARLVVTRFFRSFIKTGCIILFE-GGTVFTFQGTERKC  474

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKV +R+H PQFYWK AT+A++GLADA+IHGD SFVDK EGLLNL  IFVAN DL ASV
Sbjct  475   SLKVSLRIHGPQFYWKTATEAEIGLADAFIHGDFSFVDKNEGLLNLIMIFVANSDLKASV  534

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             + S+ KRGWWTP LFT+A+ SAKYFI+H+  QNTLTQARRNISRHYDLSNELFSLFLD T
Sbjct  535   TSSSKKRGWWTPFLFTAALPSAKYFIQHVLNQNTLTQARRNISRHYDLSNELFSLFLDGT  594

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FKSEDEDLK AQ+RKIS+LI KAKISKEHHILEIG GWGS A+E V++TGCKY
Sbjct  595   MTYSCAIFKSEDEDLKDAQLRKISVLIRKAKISKEHHILEIGFGWGSFAVEVVKQTGCKY  654

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQL+YA+  V +AGLQD I FLLCDYRQ+P+  +Y RIIS EM+E VGHEFM+
Sbjct  655   TGITLSEQQLEYAQLIVEQAGLQDRITFLLCDYRQMPNKDKYHRIISIEMIEHVGHEFMD  714

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CES LAE+G+LV+QF S+PDERYDEYR S  FIKEYIFPGGCLPSL+RVTSAMA+
Sbjct  715   EFFTCCESALAEDGLLVVQFTSVPDERYDEYRHSIGFIKEYIFPGGCLPSLNRVTSAMAS  774

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCV HLE+IGIHYYQTLRCWR NFL+ QSQI  LGFD KFIRTWEYYFDYCAAGF T
Sbjct  775   ASRLCVNHLEEIGIHYYQTLRCWRDNFLKNQSQIRVLGFDDKFIRTWEYYFDYCAAGFKT  834

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
               +G+YQIVFSRPGN+ AFGDPY  + SA
Sbjct  835   RAIGNYQIVFSRPGNIAAFGDPYSAVPSA  863



>ref|XP_010512493.1| PREDICTED: uncharacterized protein LOC104788434 isoform X1 [Camelina 
sativa]
Length=867

 Score =  1332 bits (3448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/871 (72%), Positives = 733/871 (84%), Gaps = 8/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHA+TV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHARTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW+MI
Sbjct  61    TYPNMMEFFEKLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWRMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y++E + NPD+DRN+TLGEF+ +RGYSELFQ+AY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLKYIKELEGNPDIDRNETLGEFLNARGYSELFQQAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV+ FSAYS+LSFC NHHLLQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C+V 
Sbjct  181   GVLNFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDVK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST E GS    V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF+YV
Sbjct  241   SVSTSENGS----VTVTSGDGSEEVFDRCILAMHAPDALRLLGEEVTFDETRVLGAFRYV  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWS+WNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP  
Sbjct  297   YSDIYLHHDIDLMPRNQAAWSSWNFLGSTEKKVCVTYWLNILQNLGEKCEPFFVTLNPDH  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
              P++ LLKWTTGHPVPSV+A  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM AA 
Sbjct  357   PPKKALLKWTTGHPVPSVSAWTASQELHKIQGKRNLWFCGAYQGYGFHEDGLKAGMAAAR  416

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K  + LNNP HMVPS  ETGARL VTRF+  FI TG + +LEEGGT+FTF G D  
Sbjct  417   GLLGKETALLNNPRHMVPSLTETGARLFVTRFMGQFISTGCVTILEEGGTMFTFGGKDST  476

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNL  I +ANRD  ++
Sbjct  477   FPLKSVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLLNLIMILIANRDTKSN  536

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             +++   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+
Sbjct  537   LTK---KRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDD  593

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFKS+DEDLKTAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V+RTGCK
Sbjct  594   TMTYSSAVFKSDDEDLKTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVKRTGCK  653

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAE+KV+ AGLQD+I+F LCDYRQL D  +YDRIISCEMLEAVGHEFM
Sbjct  654   YTGITLSIEQLKYAEEKVKVAGLQDSIKFELCDYRQLSDVQKYDRIISCEMLEAVGHEFM  713

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM+
Sbjct  714   EMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMS  773

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LG D KFIRTWEYYFDYCAAGF 
Sbjct  774   SSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGIDDKFIRTWEYYFDYCAAGFK  833

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  834   TLTLGNYQLVFSRPGNVAAFADSYQGFPSAY  864



>ref|NP_188993.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 dbj|BAC41919.1| putative cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis 
thaliana]
 gb|AEE76772.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =  1332 bits (3446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 630/871 (72%), Positives = 736/871 (85%), Gaps = 8/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNM+E FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMIEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DVL+Y+E+ + NPD+DR +TLGEF+ +RGYSELFQ+AY++P+C SIWSC S+
Sbjct  121   REIVRFKEDVLNYIEKLEGNPDIDRKETLGEFLNTRGYSELFQQAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV++FSAYS+LSFC NHHLLQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C+V 
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDVK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAFQYV
Sbjct  241   SVSTSENG----CVTVTSGDGSEEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAFQYV  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP  
Sbjct  297   YSDIYLHHDIDLMPRNKAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLNPDE  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP++ LLKWTTGHPVPSVAAS AS EL +IQGKR IWFCGAYQGYGFHEDGLKAGM AA 
Sbjct  357   TPKKALLKWTTGHPVPSVAASIASQELHQIQGKRNIWFCGAYQGYGFHEDGLKAGMAAAR  416

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K  + LNNP HMVPS  ETGARL VTRFL  FI TGS+ +LEEGGT+FTF G D  
Sbjct  417   GLLGKETALLNNPRHMVPSLTETGARLFVTRFLGQFISTGSVTILEEGGTMFTFGGKDST  476

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +ANRD  ++
Sbjct  477   CPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNLIMILIANRDTKSN  536

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             +++   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF LFLD+
Sbjct  537   LTK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGLFLDD  593

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFKS+DEDL+TAQMRKISLLIDKA+I K+H +LEIGCGWG+LAIE V RTGCK
Sbjct  594   TMTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCGWGTLAIEVVRRTGCK  653

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDRIISCEMLEAVGHEFM
Sbjct  654   YTGITLSIEQLKYAEEKVKEAGLQDRITFELRDYRQLSDAHKYDRIISCEMLEAVGHEFM  713

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCE+ LAE+G++VLQFIS P+ERY+EYR SSDFIKEYIFPG C+PSL++VTSAM+
Sbjct  714   EMFFSRCEAALAEDGLMVLQFISTPEERYNEYRLSSDFIKEYIFPGACVPSLAKVTSAMS  773

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD KF+RTWEYYFDYCAAGF 
Sbjct  774   SSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFDDKFVRTWEYYFDYCAAGFK  833

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLGDYQ+VFSRPGNV AF D Y+G  SAY
Sbjct  834   TRTLGDYQLVFSRPGNVAAFADSYRGFPSAY  864



>ref|XP_011030437.1| PREDICTED: uncharacterized protein LOC105129890 isoform X2 [Populus 
euphratica]
Length=869

 Score =  1328 bits (3436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/849 (74%), Positives = 737/849 (87%), Gaps = 4/849 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             +MRVAVVGAG+SGLVSAYVLA+ GA VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3     RMRVAVVGAGLSGLVSAYVLARAGAEVVLYEKEDYLGGHAKTVRFDGVDLDLGFMVFNRV  62

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             T PNMME FE+LG+DME+SD+SFSVSLD G GYEWGSRNGFSGLFAQKKN+L+PYFW+++
Sbjct  63    TCPNMMEFFENLGIDMELSDVSFSVSLDQGKGYEWGSRNGFSGLFAQKKNVLSPYFWKVL  122

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK+DVLSYLE  +NNP +DRN+TLG+F+KS GYSELFQKAY++P+C SIWSC SE
Sbjct  123   REIVKFKDDVLSYLEVLENNPVVDRNETLGQFVKSGGYSELFQKAYLVPVCGSIWSCPSE  182

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM FSA+S+LSF RNHHLLQLFGRP WL V+R+S SYVNKVRE+LE  GC+IR GCEV 
Sbjct  183   GVMNFSAFSVLSFFRNHHLLQLFGRPPWLRVRRQSRSYVNKVREKLESWGCQIRTGCEVQ  242

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             +VST ++  AG  V+    ++  E Y GCIMA HAPD L +LG+QATFDE RILGAFQY+
Sbjct  243   AVSTTDE--AGCAVLCRDGSL--EMYSGCIMAVHAPDALGILGEQATFDETRILGAFQYM  298

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YS+I+LHR++ FMP+N AAW AWNFLG+  N+ CLTYWLN LQN+ +T  P+LVTLNP  
Sbjct  299   YSEIFLHRDKKFMPQNSAAWCAWNFLGSTENKACLTYWLNVLQNIDETGLPFLVTLNPDN  358

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
              P+  LL+W+TGHP+PSVAA++AS ELE IQGKRRIWF GAYQGYGFHED LK+GM+AAH
Sbjct  359   APDHTLLQWSTGHPIPSVAATKASLELEHIQGKRRIWFGGAYQGYGFHEDRLKSGMVAAH  418

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K C  + NP HMVPS  ETGARL VTRFL   I TG + LLE+GGTVF+FEGT KK
Sbjct  419   GLLGKSCDIMRNPKHMVPSMLETGARLFVTRFLGHHISTGCLTLLEDGGTVFSFEGTSKK  478

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFVDK EGL+NLF I + NRD   S
Sbjct  479   CSLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLINLFMILIVNRDADNS  538

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S+ N KRGWWTPLLFT+ IASAK+FI+H+SR+NTLTQARRNISRHYDLSNELF+LFLDE
Sbjct  539   TSKLNKKRGWWTPLLFTAGIASAKFFIQHVSRKNTLTQARRNISRHYDLSNELFALFLDE  598

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYSCA+FK EDEDLK+AQ++KISLLI+KA+++K+H +LEIGCGWG+LAIE V+RTGC+
Sbjct  599   TMTYSCALFKKEDEDLKSAQIQKISLLIEKARVNKDHEVLEIGCGWGTLAIEVVQRTGCR  658

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSE+QLKYAE KV+EAGLQD+I+F LCDYRQLP   +YDRIISCEM+EAVGHE+M
Sbjct  659   YTGITLSEEQLKYAELKVKEAGLQDSIKFHLCDYRQLPMTHKYDRIISCEMIEAVGHEYM  718

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFFG CESVL ENG+ VLQFISIP+ERYD YRQSSDFIKEYIFPGGCLPSL+++TSAMA
Sbjct  719   EEFFGCCESVLDENGLFVLQFISIPEERYDLYRQSSDFIKEYIFPGGCLPSLTKITSAMA  778

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL LGF++KFIRTWEYYFDYCAAGF 
Sbjct  779   SSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAAGFK  838

Query  2920  TCTLGDYQI  2946
             T TLG+YQ+
Sbjct  839   THTLGNYQV  847



>ref|XP_010023866.1| PREDICTED: uncharacterized protein LOC104414443 [Eucalyptus grandis]
Length=865

 Score =  1323 bits (3423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/863 (72%), Positives = 732/863 (85%), Gaps = 5/863 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+V V+G G+SGLV+AY  A+GGA VVVYEKEDYLGGHAKTV+++GVDLDLGFMVFNRVT
Sbjct  1     MKVGVIGGGMSGLVAAYEAARGGAKVVVYEKEDYLGGHAKTVSVNGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFESLGV+MEISDMS SVSLD G GYEWGSRNG   LFAQK NLLNPYFWQM+R
Sbjct  61    YPNMMELFESLGVEMEISDMSISVSLDEGQGYEWGSRNGLLSLFAQKTNLLNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK DVLSYLE  ++NPD+DR++TLG+FIKSRGYSELFQKAY+IP+C SIWSC SEG
Sbjct  121   EVIKFKEDVLSYLEGLESNPDIDRSETLGQFIKSRGYSELFQKAYLIPICGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLLQ+FGRPQWLT++RRSHSYVNKVR+ LE +GCEIR  CEV  
Sbjct  181   VMSFSAFSVLSFCRNHHLLQVFGRPQWLTLRRRSHSYVNKVRDVLESKGCEIRSSCEVRF  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             +ST ++G     ++++G    +E YD CI+A HAPD L+MLG QAT+DE R+LGAF+Y Y
Sbjct  241   ISTSDEG----CIVLTGDGS-EEVYDKCIVAVHAPDALRMLGDQATYDETRVLGAFKYAY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLH +++FMP+N AAWSAWN LG   N+VCLTYWLN LQNL     P+LVTLNP   
Sbjct  296   SDIYLHHDKTFMPKNSAAWSAWNVLGCAENKVCLTYWLNVLQNLDQKDFPFLVTLNPSHE  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKW TG P+PSVAAS+A  +L  IQGKR IWFCGAYQGYGFHEDGLK GM AAHG
Sbjct  356   PEHTLLKWCTGSPIPSVAASKALLQLHEIQGKRGIWFCGAYQGYGFHEDGLKGGMAAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             ++ +    L+NP HMVPS  E GAR  VT FL  +I TG I LLEEGGT+FTFEGT K+ 
Sbjct  416   VIGQSHFLLDNPQHMVPSLKEIGARFFVTGFLRRYISTGLITLLEEGGTMFTFEGTTKRC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              L V +R+HSP+FYWKV TQADLGLADAYI+GD S VDK +GLLNLF+I +ANRD   ++
Sbjct  476   PLTVTLRIHSPEFYWKVMTQADLGLADAYINGDFSCVDKNKGLLNLFQILIANRDSDITM  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ + +RGWWTP+L T+ IASAKYF +HI RQNTLTQARRNIS+HYDLSNELFSLFLDET
Sbjct  536   SKLSKRRGWWTPMLSTAGIASAKYFFKHILRQNTLTQARRNISQHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVF+   EDLK AQMRKISLLI KA+I K H +LEIGCGWGSLAIE V +TGCKY
Sbjct  596   MTYSCAVFEMAGEDLKAAQMRKISLLIKKARIEKTHEVLEIGCGWGSLAIEVVRQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLS++QLKYA+ +V+EAGLQD+I+F+LCDYRQLP   +YDRIISCEM+EAVGHE+M 
Sbjct  656   TGITLSKEQLKYAKSRVKEAGLQDSIKFILCDYRQLPSAYKYDRIISCEMIEAVGHEYME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CESVLA++G+LVLQF SIPDERY+EYRQSSDFIKEYIFPG C+PSLSR+TSAMA+
Sbjct  716   EFFSCCESVLAKDGLLVLQFTSIPDERYEEYRQSSDFIKEYIFPGCCVPSLSRITSAMAS  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRL VEH+++IGIH+YQTLRCWR NF+E+Q +IL LGF++KFIRTWEYYFDYCAAGF +
Sbjct  776   ASRLSVEHVDNIGIHFYQTLRCWRKNFMEKQRKILALGFNEKFIRTWEYYFDYCAAGFKS  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPY  2991
              TLG+YQIVFSRPGN  AF D Y
Sbjct  836   HTLGNYQIVFSRPGNEAAFTDLY  858



>gb|KGN61574.1| hypothetical protein Csa_2G171950 [Cucumis sativus]
Length=865

 Score =  1323 bits (3423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/870 (72%), Positives = 730/870 (84%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVG GISGLVSAYVLAK G  VV+ EKEDY+GGH+KTV   G DLDLGFMVFN VT
Sbjct  1     MKVAVVGGGISGLVSAYVLAKAGVEVVLLEKEDYVGGHSKTVHFHGFDLDLGFMVFNHVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LFAQKKNLLNPYFWQMIR
Sbjct  61    YPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFAQKKNLLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV++YLE  +NN D+DRN+TLG+FI S GYSELFQ AY++PMC SIWSCSSE 
Sbjct  121   EIVKFKDDVINYLEVLENNSDVDRNETLGQFINSNGYSELFQNAYLVPMCGSIWSCSSEK  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             V++FSA+S+LSFCRNHHLLQL GRPQWLTVK RSHSYV KV+E LE +GC+IR  CEV+S
Sbjct  181   VLSFSAFSVLSFCRNHHLLQLVGRPQWLTVKGRSHSYVKKVQEVLESQGCQIRTSCEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             +ST  +G       +S  + +QE +D CI+A HAPDTL++LG +AT DELR+LGAFQY Y
Sbjct  241   ISTLVKGCK-----VSYGDDLQEMFDACIIATHAPDTLRILGNEATSDELRVLGAFQYAY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR++S MP+N AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLNP + 
Sbjct  296   SDIFLHRDKSLMPQNPAAWSAWNFLGNTDKKVCLTYWLNVLQNLGETGPPFLVTLNPDKE  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P   LLKW+TGHP+PS AAS+AS+EL  IQGKRRIWFCGAYQGYGFHEDGLK G+IAA  
Sbjct  356   PTNILLKWSTGHPIPSGAASKASNELHSIQGKRRIWFCGAYQGYGFHEDGLKGGIIAAQN  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L  R + L+NP HMVPS  +TGARL VTRFL  FI +GS+ L+EEGGT+FTFEGTDKK 
Sbjct  416   MLGNRFTLLSNPKHMVPSLADTGARLFVTRFLRQFITSGSLTLMEEGGTIFTFEGTDKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
             LLKV ++VH+PQFYWK+ T+AD+GLADAYI+GD SFVDK EGLLN F I VA R+ + S+
Sbjct  476   LLKVALKVHNPQFYWKITTRADIGLADAYINGDFSFVDKDEGLLNFFMIIVACRETNFSI  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             ++   K GWWTP L TS IASAKYF  H SR+NTLTQARRNISRHYDLSNELFSLF+D+T
Sbjct  536   AKLKKKGGWWTPPLLTSCIASAKYFFHHTSRRNTLTQARRNISRHYDLSNELFSLFMDDT  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             M YSCA+FKSE+EDLK AQMRK+SLLI KA+I+K HH+LEIGCGWGSLAIE V++TGC+Y
Sbjct  596   MQYSCAIFKSENEDLKVAQMRKMSLLIKKARINKSHHVLEIGCGWGSLAIEIVKQTGCRY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQLKYAE KV++A LQD I  LLCDYR +P   +YDRIISCEM+EAVGHEFM 
Sbjct  656   TGITLSEQQLKYAEKKVKDANLQDRINLLLCDYRNVPSTKKYDRIISCEMIEAVGHEFME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             +FFG CESVLAENGI V QF ++PD RYD YR SS+FIKEYIFPGGCLP LSRVT+AM  
Sbjct  716   DFFGTCESVLAENGIFVQQFTAMPDARYDAYRLSSEFIKEYIFPGGCLPCLSRVTTAMTK  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SR C+EHLE+IGIHY+QTLR WR +FLE +S+IL LGFD+ FIRTWEYYFDYCAAGF +
Sbjct  776   ASRFCIEHLENIGIHYHQTLRYWRKDFLENKSKILQLGFDESFIRTWEYYFDYCAAGFKS  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TL +YQIV+SRPGNV  F +PY+G  SAY
Sbjct  836   RTLNNYQIVYSRPGNVAVFNNPYQGFPSAY  865



>ref|XP_010670961.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010670962.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=866

 Score =  1321 bits (3420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 629/852 (74%), Positives = 729/852 (86%), Gaps = 6/852 (1%)
 Frame = +1

Query  445   SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  624
             +AY LAK G  VV++EKEDYLGGHAKTV  DG+DLDLGFMVFNRVTYPNMMELFESLG++
Sbjct  15    AAYELAKAGVNVVLHEKEDYLGGHAKTVHFDGIDLDLGFMVFNRVTYPNMMELFESLGIE  74

Query  625   MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLE  804
             ME+SDMSFSVSLD G G EWGSRNG  GLFAQK N +NPYFW+MI+EI+KFKN+V+ YLE
Sbjct  75    MELSDMSFSVSLDKGRGCEWGSRNGLRGLFAQKANAVNPYFWKMIQEIIKFKNEVIMYLE  134

Query  805   EFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCR  984
             E +NN D+DR +TLG FIKSRGYSELFQKAY++PMCASIWSC S+ VM FSA+SILSF R
Sbjct  135   ELENNADIDRTETLGHFIKSRGYSELFQKAYLVPMCASIWSCPSDTVMNFSAFSILSFSR  194

Query  985   NHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVI  1164
             NHHLLQLFGRPQWLTVK RSH YV+KVREELE RG +++  CEV SVST ++G       
Sbjct  195   NHHLLQLFGRPQWLTVKGRSHCYVSKVREELEVRGVQVKTSCEVQSVSTSDEGCT-----  249

Query  1165  ISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPR  1344
             +S  +   E YD CI+A HAPD +++LGK+AT+DE  ILGAFQYVYSDI+LHR+++FMP+
Sbjct  250   LSCSDGSNEVYDKCIIAVHAPDAIRILGKEATYDETTILGAFQYVYSDIFLHRDKTFMPQ  309

Query  1345  NLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpv  1524
             N AAWSAWNFLGT+++++CLTYWLN LQN+ +T  PYLVTLNPP  PE  LLKW TGHPV
Sbjct  310   NPAAWSAWNFLGTMDSKLCLTYWLNVLQNIEETDLPYLVTLNPPHQPENVLLKWRTGHPV  369

Query  1525  psvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSP-LNNPN  1701
             PSVAA++AS +L  IQG R IWFCGAYQGYGFHEDGLKAGMIAA GLL K  +  L NP 
Sbjct  370   PSVAATKASLDLGNIQGTRGIWFCGAYQGYGFHEDGLKAGMIAARGLLGKSFNNILTNPK  429

Query  1702  HMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQF  1881
              MV S  E  A + VTRFL++FI  G + LLEEGGT+ TFEG+ K   LKV +R+HSPQF
Sbjct  430   QMVASLTEAAACIFVTRFLSNFISAGCLTLLEEGGTILTFEGSSKICPLKVALRIHSPQF  489

Query  1882  YWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPL  2061
             YWKVA +ADLGLADAYI+GD SFVDK EGLLNLF IF+A+RDL+++ +  N KRGWWTP+
Sbjct  490   YWKVAKEADLGLADAYINGDFSFVDKNEGLLNLFMIFIASRDLNSTATLVNKKRGWWTPM  549

Query  2062  LFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDE  2241
             LFT+ IASAKYF  H+SRQNTLTQARRNISRHYDLSN++FSLFLDETMTYSCAVF+SE+E
Sbjct  550   LFTAGIASAKYFYHHVSRQNTLTQARRNISRHYDLSNDMFSLFLDETMTYSCAVFESENE  609

Query  2242  DLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYA  2421
             DLK AQMRKISLL++KA++ K H +LEIGCGWGSLAIE V+RTGC+YTGITLSE+QL+YA
Sbjct  610   DLKVAQMRKISLLLEKARVEKHHEVLEIGCGWGSLAIEVVKRTGCRYTGITLSEEQLRYA  669

Query  2422  EDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAEN  2601
             E++V+EAGLQD IRFLLCDYRQLPD  +Y+RIISCEMLEAVGHE+M EFF  CES+LA N
Sbjct  670   EERVKEAGLQDRIRFLLCDYRQLPDVHKYNRIISCEMLEAVGHEYMEEFFQCCESLLAAN  729

Query  2602  GILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIG  2781
             G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLP LSRVTSAMAA+SRLCVEH+E+IG
Sbjct  730   GLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPCLSRVTSAMAAASRLCVEHIENIG  789

Query  2782  IHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRP  2961
             IHYY+TLRCWR NFLE QS+I  LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRP
Sbjct  790   IHYYKTLRCWRKNFLEHQSKIHSLGFDEKFIRTWEYYFDYCAAGFKTRTLGNYQIVFSRP  849

Query  2962  GNVTAFGDPYKG  2997
             GN+ +FG  Y G
Sbjct  850   GNLASFGGAYAG  861



>ref|XP_010490069.1| PREDICTED: uncharacterized protein LOC104767788, partial [Camelina 
sativa]
Length=862

 Score =  1320 bits (3417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 624/866 (72%), Positives = 729/866 (84%), Gaps = 8/866 (1%)
 Frame = +1

Query  418   VGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNM  594
             +G+GISGL SAYVLA  G   VV+YEKE+ LGGHA+TV  DGVDLDLGFMVFNRVTYPNM
Sbjct  1     IGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHARTVRFDGVDLDLGFMVFNRVTYPNM  60

Query  595   MELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILK  774
             ME FE L VDME+SDMSF+VSLDNG G EWGSRNG SGLFAQ+KN+LNPYFW+MIREI+K
Sbjct  61    MEFFEKLAVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQRKNVLNPYFWRMIREIVK  120

Query  775   FKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAF  954
             FK DVL Y+EE + NPD+DRN+TLGEF+ +RGYSELFQ+AY++P+C SIWSC S+GV+ F
Sbjct  121   FKEDVLKYIEELEGNPDIDRNETLGEFLNARGYSELFQQAYLVPICGSIWSCPSDGVLNF  180

Query  955   SAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTD  1134
             SAYS+LSFC NHHLLQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C+V SVST 
Sbjct  181   SAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDVKSVSTS  240

Query  1135  EQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIY  1314
             E G     V ++  +  +E ++ CI+A HAPD +++LG++ TFDE R+LGAF+YVYSDIY
Sbjct  241   ENG----CVTVTSGDGTEEVFERCILALHAPDAMRLLGEEVTFDETRVLGAFRYVYSDIY  296

Query  1315  LHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQC  1494
             LH +   MPRN AAWS+WNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP + P++ 
Sbjct  297   LHHDIDLMPRNQAAWSSWNFLGSTEKKVCVTYWLNILQNLGEKCEPFFVTLNPDQPPKKA  356

Query  1495  LLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKK  1674
             LLKWTTGHPVPSVAA +AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM AA GLL K
Sbjct  357   LLKWTTGHPVPSVAAWKASQELHKIQGKRNLWFCGAYQGYGFHEDGLKAGMAAARGLLGK  416

Query  1675  RCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKV  1854
               + LNNP HMVPS  ETGARL VTRF+  FI TG + +LEEGGT+FTF G D    LK 
Sbjct  417   ETALLNNPRHMVPSLTETGARLFVTRFMGQFISTGCVTILEEGGTMFTFGGKDSTCPLKS  476

Query  1855  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2034
             ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNL  I +ANRD  +++++  
Sbjct  477   ILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLLNLIMILIANRDTKSNLTK--  534

Query  2035  SKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  2214
              KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+TMTYS
Sbjct  535   -KRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDDTMTYS  593

Query  2215  CAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGIT  2394
              AVFKS+DEDLKTAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V+RTGCKYTGIT
Sbjct  594   SAVFKSDDEDLKTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVKRTGCKYTGIT  653

Query  2395  LSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFG  2574
             LS +QLKYAE+KV+EAGLQD I+F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF 
Sbjct  654   LSIEQLKYAEEKVKEAGLQDRIKFELCDYRQLSDVQKYDRIISCEMLEAVGHEFMEMFFS  713

Query  2575  RCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL  2754
             RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSRL
Sbjct  714   RCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSRL  773

Query  2755  CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLG  2934
             C+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD KFIRTWEYYFDYCAAGF T TLG
Sbjct  774   CIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFDDKFIRTWEYYFDYCAAGFKTLTLG  833

Query  2935  DYQIVFSRPGNVTAFGDPYKGLASAY  3012
             +YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  834   NYQLVFSRPGNVAAFADSYQGFPSAY  859



>ref|XP_006350407.1| PREDICTED: uncharacterized protein LOC102579763 isoform X1 [Solanum 
tuberosum]
Length=866

 Score =  1316 bits (3407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 634/872 (73%), Positives = 738/872 (85%), Gaps = 8/872 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  579
             M++AVVGAGISGLVSAY LAK G  VVVYEKE+Y+  HA KTV +D +DL L FM+F++V
Sbjct  1     MKLAVVGAGISGLVSAYELAKAGVKVVVYEKENYISCHANKTVIVDDIDLSLDFMIFDQV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPN+ME FE LGVDMEIS MSFSVSLD G G EWG+RNGFS LFAQKKN+LNPYFWQMI
Sbjct  61    TYPNLMEFFEFLGVDMEISYMSFSVSLDQGRGCEWGTRNGFSSLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DV+SYLEE DNNPD+DRN TLG+FI+S  YSELFQKAY++P+CASIW C SE
Sbjct  121   REIIRFKQDVISYLEELDNNPDIDRNKTLGQFIESHVYSELFQKAYLVPICASIWFCPSE  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM FSAYSILSFCR+HHL+QLFG PQ LT++RRSH+YVNKV+EELEKRGC+IR GCEV+
Sbjct  181   GVMGFSAYSILSFCRDHHLMQLFGLPQLLTIRRRSHAYVNKVKEELEKRGCQIRTGCEVN  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV T+EQG       I   +   E YDGCI+A H+PDTLKMLGK+AT+DE RILGAF YV
Sbjct  241   SVLTNEQGCT-----IYCNDGSTEVYDGCIIAVHSPDTLKMLGKEATYDETRILGAFHYV  295

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSD +LH++++F+P + AAWSA NFLGT+N+R C TYWLN +QNLGD++ PYLVT +PP 
Sbjct  296   YSDTFLHQDKTFLPHDPAAWSACNFLGTMNDRGCATYWLNVIQNLGDSELPYLVTFDPPH  355

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TPE  L+KW T HPVPSVAAS+AS +L +IQGKR IWFCG YQGYGFHE+GLKAG+IAA 
Sbjct  356   TPEHTLVKWRTSHPVPSVAASKASCKLHQIQGKRGIWFCGPYQGYGFHENGLKAGVIAAD  415

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             G+L++ CS L N  ++VP+WPETGARLLVTRF  S+I TG IILLE GGT+FTF+G D+K
Sbjct  416   GMLRRNCSILYNHKYLVPTWPETGARLLVTRFFKSYIQTGCIILLE-GGTIFTFQGRDRK  474

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LKV + V S QFYWKVATQADLGLADA+IHGD SFVDK EGLLNL  IF+AN +L  S
Sbjct  475   CSLKVSLTVRSMQFYWKVATQADLGLADAFIHGDFSFVDKNEGLLNLITIFIANGELKES  534

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             V  ++ KRGWWTP+LFT+A++SAKYF RH+S QNTLTQARRNISRHYD+SNELFSLFLDE
Sbjct  535   VKPTSKKRGWWTPVLFTAALSSAKYFYRHVSNQNTLTQARRNISRHYDVSNELFSLFLDE  594

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYSCA+FKSEDEDLK AQ+RKI +LI KAK+ KEHHILEIG GWGS A+E V++TGCK
Sbjct  595   TMTYSCAIFKSEDEDLKDAQLRKIYVLIRKAKVRKEHHILEIGFGWGSFAMEVVKQTGCK  654

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSEQQL+YA+ +V++AGLQD I F+LCDYRQ+P   +YDRIIS  M+E VGH++M
Sbjct  655   YTGITLSEQQLEYAQLRVKQAGLQDQITFILCDYRQIPSKDKYDRIISIGMIEHVGHDYM  714

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFF  CES L E+G+L LQFIS+PD RYDEYR S+ FIKEYIFPGGCLPSLSRVTSAMA
Sbjct  715   EEFFTCCESALTEDGLLALQFISMPDGRYDEYRHSTGFIKEYIFPGGCLPSLSRVTSAMA  774

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             A+SRLCV HLE+IGIHYYQTLRCWR NF + +SQI  LGFD KFIRTWEYYFDYCAAGF 
Sbjct  775   ATSRLCVVHLEEIGIHYYQTLRCWRKNFQKNKSQIHALGFDDKFIRTWEYYFDYCAAGFK  834

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKG-LASAY  3012
             TCT+GDYQIVFSRPGNV  FGDPY   + SAY
Sbjct  835   TCTIGDYQIVFSRPGNVATFGDPYNDTMPSAY  866



>ref|XP_006489661.1| PREDICTED: uncharacterized protein LOC102611924 [Citrus sinensis]
Length=864

 Score =  1315 bits (3404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 635/869 (73%), Positives = 739/869 (85%), Gaps = 5/869 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+G GISGLVSAYVLAK G  VV+YEKED LGGHAKTVT+DGVDLDL FMVFNRVT
Sbjct  1     MRAAVIGGGISGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDLCFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD G G EW SRNG SGLFAQKKNLLNPYFWQM+R
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDKGQGCEWSSRNGMSGLFAQKKNLLNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KF +DVLSYLE+ +NN D+DRN+TLG+F++SRGYSELFQKAY++P+C SIWSCSSE 
Sbjct  121   EIIKFNDDVLSYLEDLENNADIDRNETLGQFVESRGYSELFQKAYLVPVCGSIWSCSSEK  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+ SA+S+LSFCRNHH LQ+FGRPQWLTV+ RS SYV+KV E LE  GC+I+ GCEV S
Sbjct  181   VMSCSAFSVLSFCRNHHALQIFGRPQWLTVRSRSRSYVDKVIELLESLGCQIKTGCEVRS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V    +G     + I G +  Q  YDGCIMA HAPD L+MLG QATF+E R+LGAFQYVY
Sbjct  241   VLQYGEGR----IEIRGDDF-QRVYDGCIMAVHAPDALRMLGNQATFEEKRVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++FMPRN AAWSAWNFLG+ + +VCLTYWLN +QN+ +T+ P+LVTLNP  T
Sbjct  296   SDIFLHRDKNFMPRNPAAWSAWNFLGSTDGKVCLTYWLNVVQNIEETRLPFLVTLNPDHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  L KW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGMIAAHG
Sbjct  356   PEHTLFKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMIAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K C+ L NP HM PS  E GAR+ V RFL  FI TG +I LEEGGT+FTFEG  K  
Sbjct  416   MLGKSCAILANPKHMEPSLMEKGARIFVARFLRQFISTGCLIFLEEGGTIFTFEGAQKNC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK EGLLNLF I +AN+DL +S 
Sbjct  476   PLKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKDEGLLNLFLIVLANQDLDSST  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+   KRGWW+P+ FT++IASAKYF RHISR+NTLTQARRNISRHYDLSNELFSLFLD++
Sbjct  536   SKLKQKRGWWSPMFFTASIASAKYFFRHISRKNTLTQARRNISRHYDLSNELFSLFLDKS  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             M YSCA+FKSE EDL+ AQMRK+SLLI KA++SK H +LEIGCGWG+LAIE V++TGCKY
Sbjct  596   MLYSCAIFKSEHEDLEVAQMRKVSLLIQKARVSKGHEVLEIGCGWGTLAIEIVKQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYAE KV+EAGLQD+IR  LCDYRQLP + +YDRIISCEM+EAVGH++M 
Sbjct  656   TGITLSEEQLKYAEMKVKEAGLQDHIRLYLCDYRQLPKSNKYDRIISCEMIEAVGHDYME  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CES+LAE+G+L+LQFIS+PD+ YDE+R S  FIKEYIFPGGCLPSL+R+TSAM +
Sbjct  716   EFFGCCESLLAEHGLLLLQFISVPDQCYDEHRLSPGFIKEYIFPGGCLPSLNRITSAMTS  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLCVE LE+IGIHY+QTLRCWR NFLE+QS+I  LGF +KFIRTWEYYFDYCAAGF +
Sbjct  776   SSRLCVEDLENIGIHYFQTLRCWRKNFLEKQSKIRALGFSEKFIRTWEYYFDYCAAGFKS  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
              TLGDYQIVFSRP NV AF + ++   SA
Sbjct  836   RTLGDYQIVFSRPSNVAAFRNQHESFPSA  864



>ref|XP_006857466.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
 gb|ERN18933.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
Length=866

 Score =  1315 bits (3404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/864 (72%), Positives = 733/864 (85%), Gaps = 5/864 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAV+G GISGLVS+YVLAK G  V +YEKEDYLGGHA+TV LDGVDLDLGFMVFNRVT
Sbjct  1     MKVAVIGGGISGLVSSYVLAKAGVSVTLYEKEDYLGGHARTVKLDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLG+DMEISDMSFSVSLD G GYEWGSR+G +GLFAQK N LNP+FW+M+R
Sbjct  61    YPNMMEFFESLGIDMEISDMSFSVSLDGGQGYEWGSRSGLAGLFAQKSNALNPHFWRMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++ FK DVL Y+EE +NNPD+DRN+TLG FIKS GYS LFQ AY++P+CASIWSCSSE 
Sbjct  121   ELIVFKEDVLKYIEELENNPDLDRNETLGHFIKSHGYSRLFQDAYLVPVCASIWSCSSET  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSA+S+LSFCRNHHLLQLFGRPQWLTVK RSH+YV +V+EELE+ GCEIR  C + S
Sbjct  181   VMTFSAFSVLSFCRNHHLLQLFGRPQWLTVKCRSHTYVKRVKEELERHGCEIRTSCPLQS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             +S  E    GG  +       ++ YDGCI+  HAPD L++LG+ ATF+E R+LGAFQYVY
Sbjct  241   ISPTE----GGWSVFDACG-AKDDYDGCILGVHAPDALEILGQHATFEESRVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SD+YLHR++S MP+N AAWSAWNFLGT  NRVCLTYWLN LQNLGDT  P+LV+LNP   
Sbjct  296   SDVYLHRDKSLMPQNPAAWSAWNFLGTKGNRVCLTYWLNVLQNLGDTSLPFLVSLNPTSL  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+   LKW+T HPVPSVAAS+A  EL++IQG R IWFCGAYQG+GFHEDGLKAGM+AAHG
Sbjct  356   PQHNALKWSTSHPVPSVAASKAICELDKIQGNRGIWFCGAYQGWGFHEDGLKAGMVAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L+++C  L N  HMV S  E GAR ++T FL  FI TG++ LLE+GGTVF FEG ++K 
Sbjct  416   VLQEKCVLLQNKRHMVLSLMELGARSVITEFLNRFISTGNLCLLEDGGTVFYFEGANRKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK ++R+H P FYWKVA QADLGLADAYI+GD SFVDK+EGLLN+F IF+ANRD+  S 
Sbjct  476   YLKSVLRIHHPSFYWKVAAQADLGLADAYINGDFSFVDKEEGLLNMFLIFIANRDMMNSS  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
              +  +KRGWWTP+L+T+ + SAKYF+RHISRQNTLTQ+RRNISRHYDLSN+LF+LFLDET
Sbjct  536   RQQGNKRGWWTPVLYTAGLQSAKYFLRHISRQNTLTQSRRNISRHYDLSNDLFALFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYS A+F+ EDEDLK AQ+RKI LLI+KA++  +H ILEIGCGWGSLA+E V++T CKY
Sbjct  596   MTYSSAIFEHEDEDLKAAQLRKIYLLIEKARVDSDHEILEIGCGWGSLALEVVKQTRCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYA+ KV+EAGL++ I  LLCDYRQLP + +YDRIISCEM+EAVGHE++ 
Sbjct  656   TGITLSEEQLKYAQSKVKEAGLEERITLLLCDYRQLPASHKYDRIISCEMIEAVGHEYIE  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EF  RC+S LAENGILVLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPS SR+TSAMAA
Sbjct  716   EFLMRCDSHLAENGILVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSFSRLTSAMAA  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
              S+LCVEH+E+IGIHYYQTL  WR NF+  +S+I++LGFD+KFIRTWEYYF YCAAGF +
Sbjct  776   VSKLCVEHVENIGIHYYQTLIKWRDNFMANKSKIMELGFDEKFIRTWEYYFIYCAAGFKS  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYK  2994
             CTL DYQ+VFSRPGNV AFG+PYK
Sbjct  836   CTLEDYQVVFSRPGNVNAFGNPYK  859



>emb|CDX85109.1| BnaC07g07970D [Brassica napus]
Length=868

 Score =  1300 bits (3365),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/871 (71%), Positives = 720/871 (83%), Gaps = 7/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   +V+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLATQGVEELVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGVDMEISDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVDMEISDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y+EE + NPD+DR++TLGEF+ +RGYSE+FQKAY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLRYIEELEANPDIDRSETLGEFLNARGYSEMFQKAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV++FSAYS+LSFC NHHLLQ+FGRPQWL+V  RS +YV KVR ELE+ GC+IR  C++ 
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQWLSVAGRSQTYVAKVRAELERLGCKIRTSCDIK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV T + G     V ++  +  +E +D CI+A HAPD L++LG+Q TFDE R+LGAF+YV
Sbjct  241   SVLTSDDGR----VTVTSGDGSEEVFDKCILAMHAPDALRLLGEQVTFDETRVLGAFRYV  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+ ++P+ VTLNP +
Sbjct  297   YSDIYLHHDTDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGEDREPFFVTLNPDQ  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR IWFCGAYQ         +AGM AA 
Sbjct  357   TPKKTLLKWTTGHPVPSVAALTASQELHKIQGKRNIWFCGAYQVLLIFV--FQAGMAAAR  414

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K  + L+NP HMVPS  ETGARL VTRFL  FI TG + +LEEGGT+F  +G D  
Sbjct  415   GLLGKEAALLDNPRHMVPSLTETGARLFVTRFLGQFISTGCVTILEEGGTMFNLKGKDPT  474

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVD+  GLLN   I +ANRDLS+ 
Sbjct  475   CPLKSVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDRDSGLLNFMMILIANRDLSSP  534

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S    KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF LFLD+
Sbjct  535   KSNLAKKRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGLFLDD  594

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFKS+DE L+ AQMRKISLLIDKA++ K H +LEIGCGWG+LAIE V RTGC+
Sbjct  595   TMTYSSAVFKSDDEILRAAQMRKISLLIDKARVEKHHEVLEIGCGWGTLAIEVVRRTGCR  654

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAEDKV+EAGL+D I F LCDYRQL D  +YDRIISCEMLEAVGHEFM
Sbjct  655   YTGITLSIEQLKYAEDKVKEAGLEDRITFKLCDYRQLSDAHKYDRIISCEMLEAVGHEFM  714

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM+
Sbjct  715   EMFFSRCEAALAENGLMVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMS  774

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ  I+ LGFD KFIRTWEYYFDYCAAGF 
Sbjct  775   SSSRLCIEHVENIGIHYYQTLRMWRKNFLDRQKPIMALGFDDKFIRTWEYYFDYCAAGFK  834

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGNV AF D YKG  SAY
Sbjct  835   TLTLGNYQVVFSRPGNVAAFADSYKGFPSAY  865



>ref|XP_008796355.1| PREDICTED: uncharacterized protein LOC103711840 isoform X2 [Phoenix 
dactylifera]
Length=864

 Score =  1298 bits (3358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 617/869 (71%), Positives = 733/869 (84%), Gaps = 6/869 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGL SAYVLAK G  VV+YEKED LGGHAKTV  DGV+LDLGFMVFN VT
Sbjct  1     MRVAVVGAGISGLASAYVLAKAGVDVVLYEKEDCLGGHAKTVNFDGVNLDLGFMVFNGVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSF+VSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61    YPNMMEFFESLGVDMEISDMSFAVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV+ YLE+++NNPD+DRN+TLG FIKS GYS+LFQKAY++P+CA IWSC SEG
Sbjct  121   EIVKFKHDVIRYLEKYENNPDLDRNETLGHFIKSHGYSQLFQKAYLVPICACIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+L+FCRNHHLLQLFGRPQWLTVK+RSH YV KVR ELE R C+IR GC V S
Sbjct  181   VMSFSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHCYVRKVRGELESRCCQIRTGCAVKS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V   + G       + G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+QYVY
Sbjct  241   VLNIDGGCH-----VVGEDQSEETYDGCIISTHAPDALKILGTQATYEESRLLGAYQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP   
Sbjct  296   SDIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNLPFLVTLNPRFV  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+T HP+PSVAAS+AS E+ +IQGKRRIWFCGAYQG+GFHEDGLKAG++AA+ 
Sbjct  356   PKHTLLKWSTSHPIPSVAASKASLEIGKIQGKRRIWFCGAYQGFGFHEDGLKAGIVAANS  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L   C  L NP  MVPS  ETGARL+VTRFL  +I TG + LLEEGGT+F FEGT+KK+
Sbjct  416   VLGMDCVLLRNPRQMVPSLVETGARLIVTRFLEKYISTGCLTLLEEGGTIFVFEGTNKKS  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              +K ++++H P FYWKVAT+ADLGLADAYI+   SFVD++EGLLNLF I + NRD ++S 
Sbjct  476   CIKSILKIHDPLFYWKVATEADLGLADAYINRYFSFVDEQEGLLNLFMILIVNRDQNSS-  534

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+S + RGWWTP+LFT+ + SA+YF+RHISRQNT+ QA +NIS HYDLSNE FSLFLDET
Sbjct  535   SKSKTTRGWWTPILFTAGLQSARYFLRHISRQNTVAQAPKNISHHYDLSNEFFSLFLDET  594

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYS A+FK E+EDLK AQ+ KISLLI+KA+I  +H ILEIGCGWGSLAIE V++TGCKY
Sbjct  595   MTYSGAIFKMENEDLKVAQLHKISLLIEKARIEAKHEILEIGCGWGSLAIEVVKQTGCKY  654

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK+A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGHE+M 
Sbjct  655   TGITLSEEQLKFAKRRAKEACLEDRITFLLCDYRQLPCYRKYDRIISCEMIEGVGHEYME  714

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA
Sbjct  715   EFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAA  774

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF +
Sbjct  775   ASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRS  834

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
              TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  835   RTLGNYQMVFSRPGNSTAFSNPYDGVPSA  863



>ref|XP_004147184.1| PREDICTED: uncharacterized protein LOC101213850 [Cucumis sativus]
Length=1611

 Score =  1294 bits (3349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 622/893 (70%), Positives = 731/893 (82%), Gaps = 32/893 (4%)
 Frame = +1

Query  334   VSNFSSVTR*AVHAVRRKKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGG  513
              + F S T      V  +   + M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GG
Sbjct  751   AAGFKSRTLNNYQIVYSRPGNVAMKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGG  810

Query  514   HAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  693
             H+KTV  DGVDLDLGFMVFN VTYPNMME FE+LGV+MEISDMSFSVSLD G G EWGSR
Sbjct  811   HSKTVHFDGVDLDLGFMVFNTVTYPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSR  870

Query  694   NGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGY  873
             NG S LF+QKKNLLNPYFWQMIREI+KFK+DV +YLE  +NN D+DRN+TLG+FIKS GY
Sbjct  871   NGLSSLFSQKKNLLNPYFWQMIREIVKFKDDVTNYLEVLENNSDIDRNETLGQFIKSMGY  930

Query  874   SELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSY  1053
             SELFQ  Y+IPMC SIWSC SEGV++FSA+S+LSFCRNHHLLQLFGRPQWLTVK RSHSY
Sbjct  931   SELFQNGYLIPMCGSIWSCPSEGVLSFSAFSVLSFCRNHHLLQLFGRPQWLTVKGRSHSY  990

Query  1054  VNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDT  1233
             V KV+E LE  GC+IR   EV+S+ST ++G       +S  + +QE +D CI+A HAPDT
Sbjct  991   VKKVQEVLESHGCQIRTSSEVNSISTMDKGCK-----VSYGDGLQEMFDACIIATHAPDT  1045

Query  1234  LKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYW  1413
             L++LG +AT DELR+LGAFQY YSDI+LHR+++ MP+N AAWSAWNFLG  + +VCLTYW
Sbjct  1046  LRILGNEATSDELRVLGAFQYAYSDIFLHRDKNLMPQNPAAWSAWNFLGNTDKKVCLTYW  1105

Query  1414  LNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWF  1593
             LN LQNLG+T  P+LVTLNP + P+  LLKW+TGHP+PSVAAS+AS+E   IQG RRIWF
Sbjct  1106  LNVLQNLGETGPPFLVTLNPDKEPKNILLKWSTGHPIPSVAASKASNEFHSIQGNRRIWF  1165

Query  1594  CGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIV  1773
             CGAYQGYGFHEDGLKAG++AA  LL    + L+NP HM PS  +TGARL VTRFL  +I 
Sbjct  1166  CGAYQGYGFHEDGLKAGIVAAQNLLGNSLTLLSNPKHMAPSLVDTGARLFVTRFLGQYIT  1225

Query  1774  TGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFV  1953
             +GS+ L+EEGGT+FTFEGTDKK L KV+V+VHSPQFYWK+ T+ADLGLADAYI+GD SFV
Sbjct  1226  SGSLTLIEEGGTIFTFEGTDKKCLPKVVVKVHSPQFYWKIMTRADLGLADAYINGDFSFV  1285

Query  1954  DKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQ  2133
             DK EGLLN F I +A+RD ++S+++   KRGWWTP LFT+ IASAKYF +H SRQNTLTQ
Sbjct  1286  DKDEGLLNFFLIIIASRDTNSSIAKQKKKRGWWTPPLFTACIASAKYFFQHASRQNTLTQ  1345

Query  2134  ARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHH  2313
             ARRNISRHYDLSNELFSLFLD+TMTYSCA+FK E+EDLK AQMRKISLLI+KA+I+K HH
Sbjct  1346  ARRNISRHYDLSNELFSLFLDDTMTYSCAIFKGENEDLKVAQMRKISLLIEKARINKNHH  1405

Query  2314  ILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLP  2493
             +LEIGCGWGSLAIE V++TGC YTGITLSE+QLKYAE +V++A LQD IRFLLCDYR+LP
Sbjct  1406  VLEIGCGWGSLAIEIVKKTGCHYTGITLSEEQLKYAEKRVKDANLQDRIRFLLCDYRKLP  1465

Query  2494  DNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDF  2673
                +YDRIISCEM+EAVGHEFM +FFG CESVLAENG+ VLQFISIPDERY+EYR SSDF
Sbjct  1466  STEKYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGLFVLQFISIPDERYNEYRLSSDF  1525

Query  2674  IKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDL  2853
             IKEYIFPGGCLP LSR+T+AMA +SRLC                           +IL L
Sbjct  1526  IKEYIFPGGCLPCLSRLTTAMANASRLC---------------------------KILQL  1558

Query  2854  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             GFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  1559  GFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  1611


 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/574 (68%), Positives = 457/574 (80%), Gaps = 25/574 (4%)
 Frame = +1

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR++S MP+N AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLNP + 
Sbjct  238   SDIFLHRDKSLMPQNPAAWSAWNFLGNTDKKVCLTYWLNVLQNLGETGPPFLVTLNPDKE  297

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P   LLKW+TGHP+PSVAAS+AS+EL  IQGKRRIWFCGAYQGYGFHEDGLK G+IAA  
Sbjct  298   PTNILLKWSTGHPIPSVAASKASNELHSIQGKRRIWFCGAYQGYGFHEDGLKGGIIAAQN  357

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L  R + L+NP HMVPS  +TGARL VTRFL  FI +GS+ L+EEGGT+FTFEGTDKK 
Sbjct  358   MLGNRFTLLSNPKHMVPSLADTGARLFVTRFLRQFITSGSLTLMEEGGTIFTFEGTDKKC  417

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
             LLKV ++VH+PQFYWK+ T+AD+GLADAYI+GD SFVDK EGLLN F I VA R+ + S+
Sbjct  418   LLKVALKVHNPQFYWKITTRADIGLADAYINGDFSFVDKDEGLLNFFMIIVACRETNFSI  477

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             ++   K GWWTP L TS IASAKYF  H SR+NTLTQARRNISRHYDL            
Sbjct  478   AKLKKKGGWWTPPLLTSCIASAKYFFHHTSRRNTLTQARRNISRHYDL------------  525

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
                      SE+EDLK AQMRK+SLLI KA+I+K HH+LEIGCGWGSLAIE V++TGC+Y
Sbjct  526   ---------SENEDLKVAQMRKMSLLIKKARINKSHHVLEIGCGWGSLAIEIVKQTGCRY  576

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQLKYAE KV++A LQD I  LLCDYR +P   +YDRIISCEM+EAVGHEFM 
Sbjct  577   TGITLSEQQLKYAEKKVKDANLQDRINLLLCDYRNVPSTKKYDRIISCEMIEAVGHEFME  636

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             +FFG CESVLAENGI V QF ++PD RYD YR SS+FIKEYIFPGGCLP LSRVT+AM  
Sbjct  637   DFFGSCESVLAENGIFVQQFTAMPDARYDAYRLSSEFIKEYIFPGGCLPCLSRVTTAMTK  696

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SR C+EHLE+IGIHY+QTLR WR +FLE +S+IL LGFD+ FIRTWEYYFDYCAAGF +
Sbjct  697   ASRFCIEHLENIGIHYHQTLRYWRKDFLENKSKILQLGFDESFIRTWEYYFDYCAAGFKS  756

Query  2923  CTLGDYQIVFSRPGN----VTAFGDPYKGLASAY  3012
              TL +YQIV+SRPGN    V   G    GL SA+
Sbjct  757   RTLNNYQIVYSRPGNVAMKVAVVGGGISGLVSAF  790


 Score =   320 bits (821),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 178/229 (78%), Gaps = 23/229 (10%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFN---  573
             M+VAVVG GISGLVSAYVLAK G  VV+ EKEDY+GGH+KTV   G DLDLGFMVFN   
Sbjct  1     MKVAVVGGGISGLVSAYVLAKAGVEVVLLEKEDYVGGHSKTVHFHGFDLDLGFMVFNHVL  60

Query  574   --------------------RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  693
                                 +VTYPNMME FE+LGV+MEISDMSFSVSLD G G EWGSR
Sbjct  61    PLHFHLSLSLYDYEYSFGFEQVTYPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSR  120

Query  694   NGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGY  873
             NG S LF+QKKNLLNPYFWQMIREI+KFK+DV++YLE  +NN D+DRN+TLG+FI S GY
Sbjct  121   NGLSSLFSQKKNLLNPYFWQMIREIVKFKDDVINYLEVLENNSDVDRNETLGQFINSNGY  180

Query  874   SELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQ  1020
             SELFQ AY++PMC SIWSCSSE V++FSA+S+LSFCRNHHLLQ     Q
Sbjct  181   SELFQNAYLVPMCGSIWSCSSEKVLSFSAFSVLSFCRNHHLLQCLTTTQ  229



>ref|XP_008796354.1| PREDICTED: uncharacterized protein LOC103711840 isoform X1 [Phoenix 
dactylifera]
Length=865

 Score =  1294 bits (3348),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 618/870 (71%), Positives = 735/870 (84%), Gaps = 7/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGL SAYVLAK G  VV+YEKED LGGHAKTV  DGV+LDLGFMVFN VT
Sbjct  1     MRVAVVGAGISGLASAYVLAKAGVDVVLYEKEDCLGGHAKTVNFDGVNLDLGFMVFNGVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSF+VSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61    YPNMMEFFESLGVDMEISDMSFAVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV+ YLE+++NNPD+DRN+TLG FIKS GYS+LFQKAY++P+CA IWSC SEG
Sbjct  121   EIVKFKHDVIRYLEKYENNPDLDRNETLGHFIKSHGYSQLFQKAYLVPICACIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNK-VREELEKRGCEIRCGCEVH  1119
             VM+FSA+S+L+FCRNHHLLQLFGRPQWLTVK+RSH YV K VR ELE R C+IR GC V 
Sbjct  181   VMSFSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHCYVRKQVRGELESRCCQIRTGCAVK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV   +    GG  ++ G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+QYV
Sbjct  241   SVLNID----GGCHVV-GEDQSEETYDGCIISTHAPDALKILGTQATYEESRLLGAYQYV  295

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP  
Sbjct  296   YSDIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNLPFLVTLNPRF  355

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
              P+  LLKW+T HP+PSVAAS+AS E+ +IQGKRRIWFCGAYQG+GFHEDGLKAG++AA+
Sbjct  356   VPKHTLLKWSTSHPIPSVAASKASLEIGKIQGKRRIWFCGAYQGFGFHEDGLKAGIVAAN  415

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
              +L   C  L NP  MVPS  ETGARL+VTRFL  +I TG + LLEEGGT+F FEGT+KK
Sbjct  416   SVLGMDCVLLRNPRQMVPSLVETGARLIVTRFLEKYISTGCLTLLEEGGTIFVFEGTNKK  475

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
             + +K ++++H P FYWKVAT+ADLGLADAYI+   SFVD++EGLLNLF I + NRD ++S
Sbjct  476   SCIKSILKIHDPLFYWKVATEADLGLADAYINRYFSFVDEQEGLLNLFMILIVNRDQNSS  535

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S+S + RGWWTP+LFT+ + SA+YF+RHISRQNT+ QA +NIS HYDLSNE FSLFLDE
Sbjct  536   -SKSKTTRGWWTPILFTAGLQSARYFLRHISRQNTVAQAPKNISHHYDLSNEFFSLFLDE  594

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS A+FK E+EDLK AQ+ KISLLI+KA+I  +H ILEIGCGWGSLAIE V++TGCK
Sbjct  595   TMTYSGAIFKMENEDLKVAQLHKISLLIEKARIEAKHEILEIGCGWGSLAIEVVKQTGCK  654

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSE+QLK+A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGHE+M
Sbjct  655   YTGITLSEEQLKFAKRRAKEACLEDRITFLLCDYRQLPCYRKYDRIISCEMIEGVGHEYM  714

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMA
Sbjct  715   EEFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMA  774

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             A+SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF 
Sbjct  775   AASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFR  834

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  835   SRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  864



>emb|CDX77504.1| BnaA07g06420D [Brassica napus]
Length=861

 Score =  1290 bits (3338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/871 (71%), Positives = 716/871 (82%), Gaps = 14/871 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   +V+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLATQGVEELVLYEKEESLGGHAKTVRCDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGVDMEISDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVDMEISDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y+EE + NPD+DR++TLGEF+  RGYSE+FQKAY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLRYIEELEANPDIDRSETLGEFLNGRGYSEMFQKAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GV++FSAYS+LSFC NHHLLQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C++ 
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDIK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV T + G     V ++  +  +E +D CI+A HAPD L++LG+Q TFDE R+LGAF+YV
Sbjct  241   SVLTSDDGR----VTVTSGDGSEEVFDKCILAMHAPDALRLLGEQVTFDETRVLGAFRYV  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLGD ++P+ VTLNP +
Sbjct  297   YSDIYLHHDTDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGDDREPFFVTLNPDQ  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR I  C     +       +AGM AA 
Sbjct  357   TPKKTLLKWTTGHPVPSVAAFTASQELHKIQGKRNI--CSVDMCF-------QAGMAAAR  407

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL K  + LNNP HMVPS  ETGARL VTRFL  FI TG + +LEEGGT+F FEG D  
Sbjct  408   GLLGKEAALLNNPRHMVPSLTETGARLFVTRFLGQFISTGCVTILEEGGTMFNFEGKDPT  467

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVD+  GLLN   I +ANRDL++ 
Sbjct  468   CPLKSVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDRDSGLLNFMMILIANRDLASP  527

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S    KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF LFLD+
Sbjct  528   KSNLAKKRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGLFLDD  587

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFKS+DEDLK AQMRKISLLIDKA++ K H +LEIGCGWG+LAIE V RTGC+
Sbjct  588   TMTYSSAVFKSDDEDLKAAQMRKISLLIDKARVEKHHEVLEIGCGWGTLAIEVVRRTGCR  647

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAE+KV+EAGL+D I F LCDYRQL D  +YDRIISCEMLEAVGHEFM
Sbjct  648   YTGITLSIEQLKYAEEKVKEAGLEDRITFKLCDYRQLSDAHKYDRIISCEMLEAVGHEFM  707

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM+
Sbjct  708   EMFFSRCEAALAENGLMVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMS  767

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ  I+ LGFD KFIRTWEYYFDYCAAGF 
Sbjct  768   SSSRLCIEHVENIGIHYYQTLRMWRKNFLDRQKPIMALGFDDKFIRTWEYYFDYCAAGFK  827

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TLG+YQ+VFSRPGNV AF D YKG  SAY
Sbjct  828   TLTLGNYQVVFSRPGNVAAFADSYKGFPSAY  858



>ref|XP_006489662.1| PREDICTED: uncharacterized protein LOC102612222 isoform X1 [Citrus 
sinensis]
Length=871

 Score =  1289 bits (3336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/871 (70%), Positives = 726/871 (83%), Gaps = 5/871 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KM+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  
Sbjct  4     KMQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHA  63

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             T PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKNLLNPYFWQM+
Sbjct  64    TSPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNLLNPYFWQML  123

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
              EI +FK+D L Y+EE +NNPD++RN+TLG+F+K RGYSELFQK+Y+IP+C S+WSC SE
Sbjct  124   WEINQFKDDALRYIEELENNPDINRNETLGQFLKLRGYSELFQKSYLIPLCDSVWSCPSE  183

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
               M+FSA+S+LSFCRNHHLL+LFG PQWLT + RSHSYVNKV  +L+  GC+IR  CEV+
Sbjct  184   RAMSFSAFSVLSFCRNHHLLELFGHPQWLTFRNRSHSYVNKVTGQLQSWGCQIRTSCEVY  243

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV   ++G    VV   G    QE Y  C+MA HAPD L++LG QAT DE RILGAF+YV
Sbjct  244   SVYPADEGCT--VVSSDGS---QENYSCCVMAVHAPDALRILGNQATLDETRILGAFRYV  298

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDI+LHR+ +FMP+N AAWSAWNFLG+ + ++CLTYWLN LQN+G+T  P+L TLNP  
Sbjct  299   YSDIFLHRDTNFMPQNTAAWSAWNFLGSTDGKICLTYWLNVLQNIGETGVPFLATLNPDH  358

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TPE   LKW+T + VPSVAAS+AS  ++ IQGKR IWFCGAYQGYGF EDGLKAGMI AH
Sbjct  359   TPENTSLKWSTSYQVPSVAASKASLAVDLIQGKRGIWFCGAYQGYGFQEDGLKAGMITAH  418

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             G+L K C+ L+NP HMVPS  E GARL V RFL  +I TG +ILLEEGGT+FTFEGT + 
Sbjct  419   GVLGKNCAVLSNPKHMVPSLLEKGARLFVARFLRRYISTGCLILLEEGGTIFTFEGTLRN  478

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
             + LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK EGLLNLF I +AN+D  +S
Sbjct  479   SPLKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKDEGLLNLFLIVIANQDFDSS  538

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S+   KRGWW+P+ FT++IASAKYF R+ISR+N+LTQARRN+SRHYDL+NELFSLFLD+
Sbjct  539   TSKLKKKRGWWSPMFFTASIASAKYFFRNISRKNSLTQARRNVSRHYDLNNELFSLFLDK  598

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             +MTYSCA+FKSE EDL+  QMRK+S+LI+KA++SK   +L+IGCGWG+LAIE V++TGCK
Sbjct  599   SMTYSCAIFKSEHEDLEVGQMRKVSVLIEKARVSKGQEVLDIGCGWGTLAIEIVKQTGCK  658

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSE+QLKYAE KVREAGLQD+IRF LCDYRQLP   +YDRIISC M+E VGH++M
Sbjct  659   YTGITLSEEQLKYAEIKVREAGLQDHIRFYLCDYRQLPKANKYDRIISCGMIEHVGHDYM  718

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFFG CES+LA +G+LVLQFIS PD+ YDEYR S  FIKEYIFPGGCLPSL RVTSAM 
Sbjct  719   EEFFGCCESLLATHGLLVLQFISAPDQCYDEYRLSPGFIKEYIFPGGCLPSLGRVTSAMT  778

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL LGF++KFIRTWEYYFDYCAA F 
Sbjct  779   SSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEILALGFNEKFIRTWEYYFDYCAASFK  838

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  839   SRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  869



>ref|XP_010936014.1| PREDICTED: uncharacterized protein LOC105055750 isoform X1 [Elaeis 
guineensis]
Length=864

 Score =  1284 bits (3323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/863 (70%), Positives = 725/863 (84%), Gaps = 6/863 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVA+VGAGISGLVSAYVLAK G  VV+YEKEDYLGGHA+TV  DGV LDLGFMVFNRVT
Sbjct  1     MRVAIVGAGISGLVSAYVLAKAGVDVVLYEKEDYLGGHARTVNFDGVHLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+DV+ YL+E +NNPD+D ++TL  FIKS GYS+LFQKAY++P+CASIWSC SEG
Sbjct  121   EIFKFKHDVIKYLDEHENNPDLDHDETLEHFIKSHGYSQLFQKAYLVPICASIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLLQLFGRPQWLTVK+RSH YV KV  ELE R C+IR G  V S
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVKQRSHCYVRKVTGELESRYCQIRTGYAVQS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V + +    GG  ++ G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+QYVY
Sbjct  241   VLSID----GGCCVV-GEDQSKETYDGCIISIHAPDALKILGTQATYEESRLLGAYQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP   
Sbjct  296   SDIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNMPFLVTLNPYFV  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKWTT HP+PSVAAS+AS ELE+IQGKR IWFCGAYQG+GFHEDG+K G++AA+ 
Sbjct  356   PEHILLKWTTSHPIPSVAASKASLELEKIQGKRGIWFCGAYQGFGFHEDGVKTGIVAANS  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K C  L NP HMVPS  ETGARL+VTRFL  ++ TG + LLEEGGT+F FEGT+KK+
Sbjct  416   VLGKDCVILRNPRHMVPSLVETGARLIVTRFLEKYVATGCLTLLEEGGTIFVFEGTNKKS  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              +K ++++H P FYWKVAT+ADLGLA AYI+   S VD++EGLL+LF I + NRDL+ S 
Sbjct  476   CVKSILKIHDPLFYWKVATEADLGLAYAYINRYFSVVDEQEGLLDLFMILIVNRDLNYSC  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
              +S ++RGWWTP+LFT+ + SA+YF+RHISR N + Q  +NISRHYDLSNE FSLFLDET
Sbjct  536   -KSKTRRGWWTPILFTAGLQSARYFLRHISRHNAVAQTPKNISRHYDLSNEFFSLFLDET  594

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FK E+EDLK AQ+RKISLLI+KA+I  +H IL+IGCGWGSLAIE   +TGCKY
Sbjct  595   MTYSCAIFKMENEDLKVAQLRKISLLIEKARIKAKHEILDIGCGWGSLAIEVARQTGCKY  654

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK+A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGHE+M 
Sbjct  655   TGITLSEEQLKFAKRRAQEACLEDRITFLLCDYRQLPCYQKYDRIISCEMIEGVGHEYME  714

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CE +LAE+G+ VLQFISIPDERYDEYR+SSDFIKEY+FPGGC+PSLSR+TSAMAA
Sbjct  715   EFFGCCELLLAEDGLFVLQFISIPDERYDEYRRSSDFIKEYVFPGGCIPSLSRITSAMAA  774

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SR CVEH+E+IGIHYY+TLRCWR N ++ + +IL LGFD+KFIRTWEYYF YCAAGF +
Sbjct  775   TSRFCVEHVENIGIHYYETLRCWRNNLMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRS  834

Query  2923  CTLGDYQIVFSRPGNVTAFGDPY  2991
              TLG+YQ+VFSRPGN+TA G  Y
Sbjct  835   RTLGNYQMVFSRPGNLTALGSLY  857



>ref|XP_006421140.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
 gb|ESR34380.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
Length=802

 Score =  1280 bits (3313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/807 (76%), Positives = 698/807 (86%), Gaps = 5/807 (1%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFWQM+REI+
Sbjct  1     MMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFWQMLREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK+DVLSYLEE ++NPD+DR++TLG+F+ SRGYSELFQKAY+IP+C SIWSC SEGV +
Sbjct  61    KFKDDVLSYLEELESNPDIDRSETLGQFVNSRGYSELFQKAYLIPICGSIWSCPSEGVTS  120

Query  952   FSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1131
             FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RSHSYVNKVR++LE  GC+IR   EV SV  
Sbjct  121   FSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHSYVNKVRKQLESWGCQIRTSSEVCSVLP  180

Query  1132  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1311
              ++G      I+ G    +E Y+ C+MA HAPD LK+LG QATFDE RILGAFQYVYSD+
Sbjct  181   ADKG----CTIVCGDG-SREFYNSCVMALHAPDALKILGNQATFDETRILGAFQYVYSDV  235

Query  1312  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1491
             +LHR++ FMP+N AAWSAWNFL + +++VCLTYWLN LQNLG+T  P+LVTLNP   PE 
Sbjct  236   FLHRDKRFMPQNPAAWSAWNFLESFDSKVCLTYWLNVLQNLGETSLPFLVTLNPDHVPEH  295

Query  1492  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1671
              LLKW+TGHPVPSVAAS+A  EL  IQGKR IWFCGAYQGYGFHEDGLKAGM AAH +L 
Sbjct  296   TLLKWSTGHPVPSVAASKALLELNHIQGKRGIWFCGAYQGYGFHEDGLKAGMTAAHAVLG  355

Query  1672  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1851
             K C+ L+NP HMVPS  ETGARL V RFL  +I TGS+ILLEEGGT+FTFEGT K   LK
Sbjct  356   KSCTLLSNPRHMVPSLMETGARLFVARFLGQYISTGSMILLEEGGTIFTFEGTRKNCHLK  415

Query  1852  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2031
              ++R+HSPQFYWKV TQADLG+ADAYI+GD SFVDK EGLLNLF I +ANRDL +SVS+ 
Sbjct  416   TVLRIHSPQFYWKVMTQADLGVADAYINGDFSFVDKDEGLLNLFMILIANRDLDSSVSKL  475

Query  2032  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2211
               KRGWW+P+LFT+ IASAKYF RHISRQNTLTQARRNISRHYDLSNELFSLFLDE+MTY
Sbjct  476   KQKRGWWSPMLFTAGIASAKYFFRHISRQNTLTQARRNISRHYDLSNELFSLFLDESMTY  535

Query  2212  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2391
             SCAVFKSEDEDLK AQMRK+SLLI+K ++SK   +LEIGCGWG+LAIE V+RTGCKYTGI
Sbjct  536   SCAVFKSEDEDLKAAQMRKVSLLIEKVRVSKGQEVLEIGCGWGTLAIEIVKRTGCKYTGI  595

Query  2392  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2571
             TLSE+QLKYAE KV+EAGLQD+IR  LCDYRQL    +YDRIISCEM+EAVGHEFM EFF
Sbjct  596   TLSEEQLKYAEMKVKEAGLQDHIRLYLCDYRQLAKANKYDRIISCEMIEAVGHEFMEEFF  655

Query  2572  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2751
             G CES+LAE+G+LVLQFISIPDERY+EYR SSDFIKEYIFPGGCLPSLSR+TSAM+A+SR
Sbjct  656   GCCESMLAEDGLLVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPSLSRITSAMSAASR  715

Query  2752  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2931
             LCVE +E+IGIHYYQTLRCWR NF+E+QS+IL LGF+ KFIRTWEYYFDYCAAGF + TL
Sbjct  716   LCVEQVENIGIHYYQTLRCWRKNFMEKQSKILALGFNDKFIRTWEYYFDYCAAGFKSYTL  775

Query  2932  GDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             G+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  776   GNYQIVFSRPGNVAAFSNPYKGFPSAY  802



>ref|XP_010529627.1| PREDICTED: uncharacterized protein LOC104806424 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529635.1| PREDICTED: uncharacterized protein LOC104806424 isoform X2 [Tarenaya 
hassleriana]
Length=873

 Score =  1272 bits (3292),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/869 (69%), Positives = 713/869 (82%), Gaps = 5/869 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG GISGL SAYVLA+ G  VV+YE+++ LGGHAKTV  DG D+DLGFM+FNRVT
Sbjct  1     MRVAVVGGGISGLGSAYVLAREGVEVVLYERDENLGGHAKTVRFDGADVDLGFMIFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFE LGVDME+SDMSFSVSL+NG G EWGSRNGFS LFAQK N+ N +FWQMIR
Sbjct  61    YPNMMELFEDLGVDMEVSDMSFSVSLENGGGLEWGSRNGFSSLFAQKSNVFNTHFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KF +DV  Y++  ++NP++DR +TLG+F+ S GYSELF+KAY++P+C SIWSC S+ 
Sbjct  121   EIVKFPDDVSRYIDPLESNPNLDRTETLGQFLNSHGYSELFRKAYLVPICGSIWSCPSDR  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             V+ F A+S+LSFCRNH   QLFGRPQWLTV  RSHSYV KVR ELE+RG  IR  C+V  
Sbjct  181   VLTFPAFSVLSFCRNHQAFQLFGRPQWLTVAGRSHSYVAKVRTELERRGGRIRTSCDVQL  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST + G     V +   +  +EA+D CI+A HAPD L+++G+QATFDE RILGAFQYV 
Sbjct  241   VSTSDNG-----VTVRNGDGSEEAFDRCILATHAPDALRLVGEQATFDERRILGAFQYVD  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLHR++ FMPRN  AW AWNFLG+  N+VCLTYWLN +QNLG+  + + VTLNP  T
Sbjct  296   SDIYLHRDKDFMPRNPTAWGAWNFLGSTENKVCLTYWLNLIQNLGENSELFFVTLNPDHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P++ LLKWTT HP PSV+A  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAG+ AA G
Sbjct  356   PKKTLLKWTTSHPFPSVSAWTASQELYKIQGKRGLWFCGAYQGYGFHEDGLKAGIAAAQG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K  + L+NP  MVPS+ ETGARL VTRF+  FI TG +ILLE+GGTVF F G   K 
Sbjct  416   MLGKDAALLSNPKQMVPSFSETGARLFVTRFMGQFISTGCVILLEDGGTVFKFGGKHPKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +V++HSP+FYWKV T+ADLG +DAYI+GD+SFVDK  GLLN+  I +ANRDL++S 
Sbjct  476   SLKSVVKIHSPKFYWKVMTEADLGFSDAYINGDLSFVDKDNGLLNMIMILIANRDLNSSK  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S    KRGWWTP+ FT+ ++SAKYF++H+SR NTLTQARRNIS HYDLSNE F++FLDET
Sbjct  536   SNIPKKRGWWTPMFFTAGLSSAKYFLKHVSRMNTLTQARRNISHHYDLSNEFFAMFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYS A+FKS++EDL+TAQMRKI LLIDKA+I K H +LEIG GWG+ AIE V +TGCKY
Sbjct  596   MTYSSAIFKSDNEDLRTAQMRKIYLLIDKARIGKNHEVLEIGFGWGTFAIEVVRQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLS +QLKYAE KV+EAGL+D I F LCDYRQL D+ +YDRIIS EMLE VGHEF+ 
Sbjct  656   TGITLSVEQLKYAEAKVKEAGLEDRITFQLCDYRQLSDSRKYDRIISIEMLEEVGHEFIE  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
              FF RCESVLAE+G+LVLQ ISIP+ERYDEYR SSDFIKEYIFPGGC+ SL+R+TSAMA+
Sbjct  716   TFFNRCESVLAEDGLLVLQTISIPEERYDEYRLSSDFIKEYIFPGGCILSLARITSAMAS  775

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLC+E +E+IGIHYY+TLRCWR N LERQ +I+DLGFD+KFIRTWEYYFDY AAGF T
Sbjct  776   SSRLCIEQVENIGIHYYRTLRCWRQNLLERQKRIVDLGFDEKFIRTWEYYFDYSAAGFKT  835

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
              TLGDYQ+VFSRPGN   FGDPY+G  SA
Sbjct  836   LTLGDYQMVFSRPGNAALFGDPYRGFPSA  864



>ref|XP_010317817.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317818.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317819.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
Length=805

 Score =  1263 bits (3269),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/807 (75%), Positives = 694/807 (86%), Gaps = 5/807 (1%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FE LGVDME   MS SVSLD+GHG EWG+R GFS LFAQKKNLLNPYF QMIREI+
Sbjct  1     MMEFFECLGVDMETYHMSLSVSLDHGHGCEWGTRKGFSSLFAQKKNLLNPYFLQMIREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             +FK DV+SYLEE DNNPD+D N+TLG+FIKS GYSELFQKAY+IP+CASIWSC   GV++
Sbjct  61    RFKQDVISYLEEVDNNPDIDCNETLGQFIKSHGYSELFQKAYLIPICASIWSCPLAGVLS  120

Query  952   FSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1131
             FS+Y IL F R+HHLLQ+F  PQ LTV+ RS +YVNKV+EELEKRGC+IR GCEV+SVST
Sbjct  121   FSSYYILLFFRDHHLLQIFDLPQLLTVRWRSQTYVNKVKEELEKRGCQIRTGCEVNSVST  180

Query  1132  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1311
             +E+G       I+  +   E YDGCI+  HAPDTLKMLG++AT+DE RILGAF Y+YSDI
Sbjct  181   NEEGCT-----IACTDGATEVYDGCIITTHAPDTLKMLGEEATYDETRILGAFHYIYSDI  235

Query  1312  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1491
             +LHR+++F+P N  AWSA NFLGT+N+R C+TY LN +QNLGD+ QPYLVTL+PP+ P+ 
Sbjct  236   FLHRDKTFLPHNPEAWSACNFLGTMNDRSCVTYSLNIMQNLGDSNQPYLVTLDPPQEPDH  295

Query  1492  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1671
              LLKWTTGH VPSVAAS+AS+EL +IQGKR IWFCG YQGYGFHEDGLKAGM+AA G+L+
Sbjct  296   TLLKWTTGHLVPSVAASKASNELHQIQGKRGIWFCGTYQGYGFHEDGLKAGMVAADGMLR  355

Query  1672  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1851
             + C  L+NP HMVP+W ETGARL+VTRFL SFI TG IILLEEGGT+FTF+GTD+K  LK
Sbjct  356   RNCRILDNPKHMVPTWTETGARLVVTRFLKSFIETGCIILLEEGGTIFTFQGTDRKCCLK  415

Query  1852  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2031
             VL+R+HS +FYWKVATQADLGLADA+IHGD SFVDK EGLLNL  IFVANRD+ ASV RS
Sbjct  416   VLLRIHSTKFYWKVATQADLGLADAFIHGDFSFVDKNEGLLNLLMIFVANRDMKASVKRS  475

Query  2032  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2211
             + KRGWW PL+FT+A++SAKYFI+H+S  NTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  476   SKKRGWWMPLIFTAALSSAKYFIQHVSNHNTLTQARRNISRHYDLSNELFSLFLDETMTY  535

Query  2212  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2391
             SCA+FKSEDEDLK AQ+RKI  LI KAKIS EHHILEIG GWGSLA+E V++TGCKYTGI
Sbjct  536   SCAIFKSEDEDLKDAQLRKIRRLISKAKISAEHHILEIGFGWGSLAMEVVKQTGCKYTGI  595

Query  2392  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2571
             TLSEQQL+YA+ +V +AGLQD I FLLCDYRQ+P+  +YDRIISC MLE VGH+F+ EFF
Sbjct  596   TLSEQQLEYAQLRVEQAGLQDQITFLLCDYRQIPNKDKYDRIISCGMLEHVGHDFIGEFF  655

Query  2572  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2751
               CES LAE G+LVLQFISIPDERY+EYRQSSDF+KEYIFPGGC+P+LSRVTSAMAA+SR
Sbjct  656   TCCESALAEYGLLVLQFISIPDERYEEYRQSSDFMKEYIFPGGCVPALSRVTSAMAAASR  715

Query  2752  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2931
             LCVEHLE+IGIHYYQTLRCWR NFL+ +SQI  LGFD KFIRTWEYYFDYCAAGF TCT+
Sbjct  716   LCVEHLEEIGIHYYQTLRCWRENFLKNKSQIRSLGFDDKFIRTWEYYFDYCAAGFKTCTI  775

Query  2932  GDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             GDYQIVFSRPGNV  FGDPY    S Y
Sbjct  776   GDYQIVFSRPGNVAVFGDPYNYSPSTY  802



>ref|XP_010532680.1| PREDICTED: uncharacterized protein LOC104808649 [Tarenaya hassleriana]
Length=868

 Score =  1255 bits (3248),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/872 (68%), Positives = 711/872 (82%), Gaps = 12/872 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+G GISGL +A+VLA+ G  VV+YEKE+ LGGHA+TV  DGVD+D+GFMVFNRVT
Sbjct  1     MRVAVIGGGISGLGAAHVLARDGVEVVLYEKEENLGGHARTVRFDGVDVDIGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE LGVD+E+SD SFSVSLD+G G EWGSRNG S LFAQK N+ NP+FWQMIR
Sbjct  61    YPNMMEFFEDLGVDLEVSDASFSVSLDSGRGIEWGSRNGLSSLFAQKSNVFNPHFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK+DVL Y+EE ++NP++DR +TLG+F+KS GYSELFQKAY++P+C SIWSC  + 
Sbjct  121   EMVKFKDDVLRYIEELESNPNLDRTETLGQFLKSHGYSELFQKAYVVPLCCSIWSCPYDR  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             V++ SA+++L FCR+HHLLQLFGRPQ LTV   SH+YV KVR EL+KRGC+IR   EV S
Sbjct  181   VLSSSAFTVLYFCRDHHLLQLFGRPQLLTVAGHSHTYVAKVRTELQKRGCKIRTSREVQS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V+T + G     V +  ++  +E +D CI+A HAP  L++LG+QATFDE R+LGAFQYVY
Sbjct  241   VTTTDNG-----VTVRNEDGSEEVFDRCILAMHAPHALRLLGEQATFDERRVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLHR+  FMPRN  AWSAWNFLGT  N+VC+TYWLNT+QNLG+  +P+ VTLNP   
Sbjct  296   SDIYLHRDTDFMPRNPTAWSAWNFLGTTENKVCVTYWLNTIQNLGEKSEPFFVTLNPDYN  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P++ LLKWTTGHP+PSVAA  AS EL ++QGKR +WFCG YQGYGFHEDGLKA MI    
Sbjct  356   PKKTLLKWTTGHPIPSVAALTASRELSKVQGKRGLWFCGGYQGYGFHEDGLKA-MI---N  411

Query  1663  LLKKRCS---PLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTD  1833
              +K  CS    ++N  HMVPS+ E  AR+ VTRF+  FI  G + LLE+GGTVF F G  
Sbjct  412   FIKTSCSFIALVSNLKHMVPSFAEAAARVFVTRFMGQFISMGYVALLEDGGTVFKFGGKH  471

Query  1834  KKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLS  2013
              K  LK ++++HSPQFYWKV T+ADLGLADAYI+GDISFVDK EGLLN+  I +ANRDL+
Sbjct  472   PKCTLKSVIKIHSPQFYWKVMTEADLGLADAYINGDISFVDKDEGLLNMIMILIANRDLN  531

Query  2014  ASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2193
             +S S    KRGWWTP+LFT+++ASAKYF++H+ R+NTLTQ+ RN+S HYDLSNELF+LF+
Sbjct  532   SSKSNLAKKRGWWTPMLFTASLASAKYFLKHVYRKNTLTQSCRNVSFHYDLSNELFALFM  591

Query  2194  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2373
             DETM YSCAVFKS+DEDL+T QMRKISLLIDKA+I K H +LEIGCGWG  AIE V RTG
Sbjct  592   DETMQYSCAVFKSDDEDLRTGQMRKISLLIDKARIEKHHKVLEIGCGWGIFAIEVVRRTG  651

Query  2374  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHE  2553
             CKYTGITLS +QLKYAE KV+EAGLQD I F LCDYRQL D+ +YDRII+C M+EAVGHE
Sbjct  652   CKYTGITLSVEQLKYAEAKVKEAGLQDRITFELCDYRQLSDSRKYDRIIACGMIEAVGHE  711

Query  2554  FMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSA  2733
             FM  FF RCE VLAE+G+LVLQFI++PD RYDE R S  FI EYIFPGGCLPSL+RVTSA
Sbjct  712   FMEIFFNRCEVVLAEDGLLVLQFITVPDSRYDEIRLSPGFITEYIFPGGCLPSLTRVTSA  771

Query  2734  MAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAG  2913
             MA+SSRLC+EH+E+IGIHYY+TLRCWR NF ERQ +I  +GFD+KFIR WEYYFDYCAAG
Sbjct  772   MASSSRLCIEHVENIGIHYYKTLRCWRQNFKERQEEIKAIGFDEKFIRKWEYYFDYCAAG  831

Query  2914  FHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             F T T+GDYQ+VFSRPGN   FGDPY    SA
Sbjct  832   FKTLTVGDYQVVFSRPGNTATFGDPYMNFPSA  863



>gb|KDO50392.1| hypothetical protein CISIN_1g0358701mg, partial [Citrus sinensis]
Length=784

 Score =  1251 bits (3238),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/789 (76%), Positives = 684/789 (87%), Gaps = 5/789 (1%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNMME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFWQM
Sbjct  1     VTYPNMMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFWQM  60

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             +REI+KFK+DVL YLEE ++NPD+DR++TLG+F+ SRGYSELFQKAY+IP+C SIWSC S
Sbjct  61    LREIIKFKDDVLGYLEELESNPDIDRSETLGQFVNSRGYSELFQKAYLIPICGSIWSCPS  120

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             EGV +FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RSHSYVNKVR++LE  GC+IR   EV
Sbjct  121   EGVTSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHSYVNKVRKQLESWGCQIRTSSEV  180

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
              SV   ++G      I+ G    +E Y+ C+MA HAPD LK+LG QATFDE RILGAFQY
Sbjct  181   CSVLPADKG----CTIVCGDG-SREFYNSCVMALHAPDALKILGNQATFDETRILGAFQY  235

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
             VYSDI+LHR++ FMP+N AAWSAWNFL + +++VCLTYWLN LQNLG+T  P+LVTLNP 
Sbjct  236   VYSDIFLHRDKRFMPQNPAAWSAWNFLESFDSKVCLTYWLNVLQNLGETSLPFLVTLNPD  295

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
               PE  LLKW+TGHPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM AA
Sbjct  296   HVPEHTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMTAA  355

Query  1657  HGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1836
             HG+L K C+  +NP HM+PS  ETGARL V RFL  +I TGS+ILLEEGGT+FTFEGT K
Sbjct  356   HGVLGKSCTLSSNPRHMIPSLKETGARLFVARFLGQYISTGSMILLEEGGTIFTFEGTRK  415

Query  1837  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2016
                LK ++R+HSPQFYWKV TQADLGLADAYI+GD SFVDK EGLLNLF I +ANRDL +
Sbjct  416   NCHLKTVLRIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNLFMILIANRDLDS  475

Query  2017  SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLD  2196
             SVS+   KRGWW+P+LFT+ IASAKYF RHISRQNTLTQARRNISRHYDLSNELFSLFLD
Sbjct  476   SVSKLKQKRGWWSPMLFTAGIASAKYFFRHISRQNTLTQARRNISRHYDLSNELFSLFLD  535

Query  2197  ETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGC  2376
             E+MTYSCAVFKSEDEDLK AQMRK+SLLI+KA++SK   +LEIGCGWG+LAIE V+RTGC
Sbjct  536   ESMTYSCAVFKSEDEDLKAAQMRKVSLLIEKARVSKGQEVLEIGCGWGTLAIEIVKRTGC  595

Query  2377  KYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEF  2556
             KYTGITLSE+QLKYAE KV+EAGLQD IR  LCDYRQL    +YDRIISCEM+EAVGHEF
Sbjct  596   KYTGITLSEEQLKYAEMKVKEAGLQDLIRLYLCDYRQLAKANKYDRIISCEMIEAVGHEF  655

Query  2557  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2736
             M EFFG CES+LAE+G+LVLQFISIPDERY+EYR SSDFIKEYIFPGGCLPSLSR+TSAM
Sbjct  656   MEEFFGCCESLLAEDGLLVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPSLSRITSAM  715

Query  2737  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2916
             + +SRLCVE +E+IGIHYYQTLRCWR NF+E+QS+IL LGF+ KFIRTWEYYFDYCAAGF
Sbjct  716   SVASRLCVEQVENIGIHYYQTLRCWRKNFMEKQSKILALGFNDKFIRTWEYYFDYCAAGF  775

Query  2917  HTCTLGDYQ  2943
              + TLG+YQ
Sbjct  776   KSYTLGNYQ  784



>ref|XP_009586643.1| PREDICTED: uncharacterized protein LOC104084479 isoform X4 [Nicotiana 
tomentosiformis]
Length=824

 Score =  1250 bits (3235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/786 (77%), Positives = 689/786 (88%), Gaps = 5/786 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLV AY LAK G  VVVYEKEDYLGGHAKTVT+DGV LDLGFM FN+VT
Sbjct  1     MKVAVVGAGISGLVCAYELAKSGVKVVVYEKEDYLGGHAKTVTVDGVHLDLGFMFFNQVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME F  LG D EISDMSFSVSLD+GHG EWG+RNGFS LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFVFLGADTEISDMSFSVSLDHGHGCEWGTRNGFSSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK DV SYLE  DNNPD+D + T+G+FIKS GYSELFQK+Y+IP+C+SIWSC SEG
Sbjct  121   EISKFKQDVTSYLEALDNNPDIDCDKTIGQFIKSHGYSELFQKSYLIPICSSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSAYSILSF R+HHLLQLF  PQ LTV+ +S++YVNKV+E+LEKRGC+IR GCEV+ 
Sbjct  181   VMGFSAYSILSFFRDHHLLQLFSLPQLLTVRWKSYAYVNKVKEDLEKRGCQIRTGCEVNF  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST+E+G       I+  +  +E YDGC+MA HAPDTLKMLGK+AT+DE RILGAFQY+ 
Sbjct  241   VSTNEEGCT-----IACNDGAKEVYDGCVMAGHAPDTLKMLGKEATYDETRILGAFQYIC  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++F+PR+ AAWSA NFLGT+N+R  +TYWLN +QNLG T+QPY VTLNPP T
Sbjct  296   SDIFLHRDKTFLPRDPAAWSALNFLGTMNSRGSMTYWLNIIQNLGGTEQPYCVTLNPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  +LKWTTGHPVPSVAAS ASSEL +IQGKR IWFCGAYQGYG HEDGLKAG+ AA G
Sbjct  356   PEHTMLKWTTGHPVPSVAASIASSELHQIQGKRGIWFCGAYQGYGLHEDGLKAGVTAADG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L++ CS L+NP HMVP+WPETGARLLVTRFL SFI TG IILLE GGT+FTF+GTDKK 
Sbjct  416   VLRRNCSILDNPKHMVPTWPETGARLLVTRFLKSFIETGCIILLENGGTIFTFQGTDKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKV +RVHS QFYWKVATQ DLGLADA+IHGD SFVDK EGLLNLF IFVANRDL ASV
Sbjct  476   SLKVSLRVHSTQFYWKVATQGDLGLADAFIHGDFSFVDKNEGLLNLFMIFVANRDLKASV  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             +RS+ KRGWWTPLL T+A++SAKYFI+H+S QNTLT+ARRNISRHYDLSNELFSLFLDET
Sbjct  536   TRSSKKRGWWTPLLSTAALSSAKYFIQHVSNQNTLTKARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FKSE+EDLK AQ+RKISLLI KAKISKEHHILEIG GWGSLA+E V++TGCKY
Sbjct  596   MTYSCAIFKSENEDLKVAQLRKISLLIKKAKISKEHHILEIGFGWGSLAVEVVKQTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TG+TLSEQQLKYA+  V++AGLQD I FLLCDYRQ+P+N +YDRIISC MLE VGH+F+ 
Sbjct  656   TGVTLSEQQLKYAQSIVQQAGLQDQITFLLCDYRQMPNNYKYDRIISCGMLEHVGHDFIG  715

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CE+ LAE+G+LV+QFISIPDERY+EYR+SSDFIKEYIFPGGCLP+L+RVTSAMAA
Sbjct  716   EFFSCCETALAEDGLLVVQFISIPDERYEEYRRSSDFIKEYIFPGGCLPALNRVTSAMAA  775

Query  2743  SSRLCV  2760
             +SRLC 
Sbjct  776   ASRLCA  781



>ref|XP_010532681.1| PREDICTED: uncharacterized protein LOC104808651 [Tarenaya hassleriana]
Length=871

 Score =  1247 bits (3227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/870 (68%), Positives = 706/870 (81%), Gaps = 5/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+G G SGL +A+VLA+ G  VV+YEKE+ LGGHAKTV  DGVD+D+GFMVFNRV 
Sbjct  1     MRVAVIGGGTSGLGAAHVLARDGVEVVLYEKEENLGGHAKTVRFDGVDVDIGFMVFNRVM  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE LGVDME+SD SFSVSLD+G G EWGSRNG S LFAQK N+LNP+FWQMIR
Sbjct  61    YPNMMEFFEDLGVDMEVSDASFSVSLDSGRGIEWGSRNGLSSLFAQKSNVLNPHFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK+DVL Y+E  ++NP++DR +TLG+FIKS GYSELFQKAY++PMC SIWSC  + 
Sbjct  121   EMVKFKDDVLRYIEALESNPNLDRTETLGQFIKSHGYSELFQKAYVVPMCCSIWSCPYDR  180

Query  943   VMAFSAYSILSFCRNHHLLQLF-GRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             V++ SA+++L FCR+HHLLQLF GRPQ LTV   SH+YV KVR ELEKRGC+IR   EV 
Sbjct  181   VLSSSAFTVLYFCRDHHLLQLFVGRPQLLTVAGHSHTYVAKVRTELEKRGCKIRTSREVQ  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV+T E     GV + +G    +E +D CI+A HAPD L++LG+QAT DE R+LGAFQY 
Sbjct  241   SVTTSEDN---GVTVRNGDGS-EEVFDRCILAMHAPDALRLLGEQATSDERRVLGAFQYD  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YS IYLHR+  FMPRN   WSA NFLG   N+VC+TYWLN +QNLG+ ++ +  TLNP  
Sbjct  297   YSHIYLHRDTDFMPRNPTVWSACNFLGNTENKVCVTYWLNAIQNLGEKRELFFATLNPDH  356

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP++ LLKWTTGHPVPSVAA  AS EL ++QGKR +WFCGAYQGYGFHEDGLK G+ AA 
Sbjct  357   TPKKALLKWTTGHPVPSVAALTASHELSKVQGKRGLWFCGAYQGYGFHEDGLKGGIAAAQ  416

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
              LL K  +  +NP H+VPS+ ET AR+ VTRF+  +I TG + LLE+GG+VF F G   K
Sbjct  417   DLLGKNITFPSNPKHIVPSFAETTARVFVTRFMGQYISTGYVTLLEDGGSVFKFGGKHPK  476

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++++H+PQFYWKV T+ADLGLADAYI+GDISFVDK EGLLN+  I +ANRDL++S
Sbjct  477   CTLKSVMKIHNPQFYWKVMTEADLGLADAYINGDISFVDKDEGLLNMIMILIANRDLNSS  536

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S    KRGWWTP+ FT+ +ASAKYF++H  R+NTL QARRNIS HYDLSNELF+LFLDE
Sbjct  537   KSNLAKKRGWWTPMFFTAGLASAKYFLKHAYRKNTLIQARRNISDHYDLSNELFALFLDE  596

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYSCAVFKS+DEDL+TAQMRK+SLLIDKA+I K H +L+IGCGWG+LA+EAV RTGCK
Sbjct  597   TMTYSCAVFKSDDEDLRTAQMRKVSLLIDKARIEKNHEVLDIGCGWGTLAVEAVRRTGCK  656

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS +QLKYAE K +EAGL+D I F L DY QL D+ +YDRIISC M+E VGHEFM
Sbjct  657   YTGITLSVEQLKYAEAKAKEAGLEDRITFELRDYHQLSDSRKYDRIISCGMIEHVGHEFM  716

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
               FF RCES LAE G+LVLQF+SIPD RYDE R SSDFIKE+IFPGGCLPSL+RVTSAMA
Sbjct  717   EAFFNRCESALAEEGLLVLQFVSIPDSRYDENRLSSDFIKEHIFPGGCLPSLARVTSAMA  776

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLC+EH+E+IGI+YY+TLRCWR NFLERQ Q+  LGFD+KFIR WEYY DY AAGF 
Sbjct  777   SSSRLCIEHVENIGINYYKTLRCWRHNFLERQEQVKALGFDEKFIRKWEYYLDYFAAGFK  836

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             T TLGDYQ+VFSRPGN   FGDPY    SA
Sbjct  837   TLTLGDYQVVFSRPGNTAVFGDPYMSFPSA  866



>gb|KHG28467.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=833

 Score =  1246 bits (3225),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/864 (69%), Positives = 705/864 (82%), Gaps = 37/864 (4%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M++AV+G GISGL+SAYVL K G  VV                                T
Sbjct  1     MKIAVIGGGISGLISAYVLVKAGVNVV--------------------------------T  28

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFE LGVDME SDMSFSVSL++G+G EWGSRNG S LF QK+NL N YFWQMIR
Sbjct  29    YPNMMELFERLGVDMEPSDMSFSVSLNHGNGIEWGSRNGISSLFVQKRNLFNLYFWQMIR  88

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFKNDV+ YL+  ++NPD DRN+TLG+F+ SRGYSELF KAY++P+C  IWS  +E 
Sbjct  89    EIIKFKNDVICYLKVLESNPDFDRNETLGQFVDSRGYSELFLKAYLVPICGLIWSSPTER  148

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             +M FSA+SILSFC+NHHLLQLFGRPQW+TV+ RS  YVNK+REELE RGC IR GCEVHS
Sbjct  149   IMEFSAFSILSFCQNHHLLQLFGRPQWMTVRWRSRQYVNKIREELENRGCIIRTGCEVHS  208

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V +D++G      ++ G +  QE++ GCI+A HAPD L++LG Q T+DELR+LGAFQYVY
Sbjct  209   VLSDDEG----CTVLCG-DESQESFQGCILAIHAPDALRLLGSQVTYDELRVLGAFQYVY  263

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LH + +FMP+N AAWSAWNFLG+ + +VCLTYWLN LQNLG+T  P+LVTLNP  T
Sbjct  264   SDIFLHHDTTFMPKNPAAWSAWNFLGSTDKKVCLTYWLNVLQNLGETSLPFLVTLNPDYT  323

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P   L KW TGHPVPS+AA++AS EL++IQGKR IWFCGAYQGYGFHEDGLKAGM AA+G
Sbjct  324   PRHTLFKWRTGHPVPSIAATKASLELDQIQGKRGIWFCGAYQGYGFHEDGLKAGMSAANG  383

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K  S L+NP  MVPS  ETGAR  VTRFL+ FI T  +ILLEEGGT+FTFEGT KK 
Sbjct  384   VLGKSYSVLSNPKQMVPSLMETGARSFVTRFLSHFISTSCVILLEEGGTMFTFEGTSKKC  443

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK ++RVH P FYWKV T+ADLGLADAYI+GD +FVDK +GLLNL  I +ANRDL +S 
Sbjct  444   NLKTVIRVHYPHFYWKVMTEADLGLADAYINGDFTFVDKNDGLLNLIMILIANRDLISSN  503

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ + KRGWWTP LFT+ + SAKYF +H+ RQNTLTQARRNISRHYDLSN+L++LFLDET
Sbjct  504   SKLSKKRGWWTPFLFTAGLTSAKYFFKHVLRQNTLTQARRNISRHYDLSNDLYALFLDET  563

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFKSE+E LK AQ RKISLLI+KA+I   H ILEIGCGWGSLAIE V+RTGCKY
Sbjct  564   MTYSCAVFKSENEALKDAQQRKISLLIEKARIDGNHEILEIGCGWGSLAIEVVKRTGCKY  623

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLS++QLK+AE +V+EAGLQDNI F LCDYRQLP   +YDRIISCEM+EAVGHE+M+
Sbjct  624   TGITLSKEQLKFAEMRVKEAGLQDNITFQLCDYRQLPSTYKYDRIISCEMIEAVGHEYMD  683

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESVLAE+G+ VLQFISIP+ERY+ YR+SSDFIKEYIFPGGCLPS +R+TSAM+A
Sbjct  684   EFFGCCESVLAEDGLFVLQFISIPEERYNGYRRSSDFIKEYIFPGGCLPSFTRITSAMSA  743

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEH+E+IG+HYYQTLR WR NFLE QS+I+ LGF+ KFIRTWEYYFDYCAAGF +
Sbjct  744   TSRLCVEHVENIGLHYYQTLRYWRRNFLENQSKIMSLGFNDKFIRTWEYYFDYCAAGFKS  803

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYK  2994
              TLG+YQ+VFSRPGNV A G+PYK
Sbjct  804   NTLGNYQVVFSRPGNVAALGNPYK  827



>ref|XP_009135859.1| PREDICTED: uncharacterized protein LOC103860003 [Brassica rapa]
Length=870

 Score =  1238 bits (3203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/872 (68%), Positives = 699/872 (80%), Gaps = 7/872 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGA--GVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             MRVAV+G G+SGL SAYVLA+  A   +V++EKED LGGHA+T+  DGVDLDLGF VFN 
Sbjct  1     MRVAVIGGGVSGLGSAYVLARDDAVKELVLFEKEDSLGGHARTMRFDGVDLDLGFTVFNS  60

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT+PNMM   ++L VDME SDMSFSVSLDNG GYEWG R+G S LFAQK+N+LNPYFWQM
Sbjct  61    VTHPNMMGFLKNLEVDMEDSDMSFSVSLDNGRGYEWGCRHGLSSLFAQKRNILNPYFWQM  120

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IRE  KFK DV  YLE+ + N D+DR DTLGEF+KS GYS++FQKAY++P+C  IWS SS
Sbjct  121   IRETKKFKEDVQKYLEDLERNLDVDRTDTLGEFLKSHGYSDVFQKAYLVPVCGLIWSGSS  180

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             E V+  SAYS+LSFCRNHHLLQLFGRP+ LTV  RS ++V KVR ELEKRGC+I   C V
Sbjct  181   ESVLNLSAYSVLSFCRNHHLLQLFGRPEGLTVAGRSQTFVAKVRAELEKRGCKIITNCNV  240

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
              SV+T E G     VI++ ++  Q+ +D CI+A HAPD LK+LG + T++E R+LGAFQY
Sbjct  241   QSVATSENG----CVIVTTEDGSQQIFDSCILAVHAPDALKLLGDKVTYEETRVLGAFQY  296

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
               SD+YLHR+   MPR   AWSAWNFLG+  N+  +TYWLN +Q LG+   P+ +T+NP 
Sbjct  297   TDSDLYLHRDTDLMPRKTGAWSAWNFLGSSENKASVTYWLNIIQKLGEEHDPFFITVNPE  356

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
              TP++ L KWTT HPVPSV+  +AS EL +IQGKR IWFCGAYQGYGFHE+GLKAGM A+
Sbjct  357   YTPKKTLFKWTTSHPVPSVSTWKASQELYQIQGKRGIWFCGAYQGYGFHEEGLKAGMAAS  416

Query  1657  HGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTD  1833
               LL K   +   NP HMVPS  E GAR   T+FL +FI TG I + EEGGTVFTFEG D
Sbjct  417   QCLLGKDMVTTFTNPKHMVPSVTEKGARFFFTKFLRNFISTGCITIHEEGGTVFTFEGKD  476

Query  1834  KKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLS  2013
                 LK ++ VHSPQFYWKV TQADLGLADAYI+GD SF DK+ GLL+L  I +AN++L+
Sbjct  477   SSCHLKSILEVHSPQFYWKVMTQADLGLADAYINGDFSFSDKERGLLDLIMILIANKELN  536

Query  2014  ASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2193
             +  S+   KRGWWTP+  T+++ASA  F++H SRQNTLTQARRNISRHYDLSNELF+LFL
Sbjct  537   SKNSKLAKKRGWWTPMFLTASLASANNFLKHFSRQNTLTQARRNISRHYDLSNELFALFL  596

Query  2194  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2373
             D+TMTYS AVFK  DEDL+TAQMRKI LLIDKA+I K H +LEIGCGWG+LAIE V+RTG
Sbjct  597   DDTMTYSSAVFKWVDEDLRTAQMRKIYLLIDKARIEKNHEVLEIGCGWGTLAIEVVKRTG  656

Query  2374  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHE  2553
             CKYTGITLS +QLKYAE+KV+EAGL+D I+F LCDYRQL D  +YDRIISCEMLEAVGHE
Sbjct  657   CKYTGITLSIEQLKYAEEKVKEAGLEDRIKFKLCDYRQLSDAHKYDRIISCEMLEAVGHE  716

Query  2554  FMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSA  2733
             FM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSA
Sbjct  717   FMETFFRHCEAALAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSA  776

Query  2734  MAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAG  2913
             MA+SSRLC+E++E+IGIHYYQTLR WR  FLERQ QI DLGFD KFIRTWEYYFDYCAAG
Sbjct  777   MASSSRLCIENVENIGIHYYQTLRLWRKTFLERQKQINDLGFDDKFIRTWEYYFDYCAAG  836

Query  2914  FHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             F T TLG+YQ+VFSRPGNV A GDP++   SA
Sbjct  837   FKTLTLGNYQVVFSRPGNVAALGDPFRSFPSA  868



>ref|XP_010512500.1| PREDICTED: uncharacterized protein LOC104788434 isoform X2 [Camelina 
sativa]
Length=803

 Score =  1235 bits (3196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/807 (72%), Positives = 678/807 (84%), Gaps = 7/807 (1%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FE LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW+MIREI+
Sbjct  1     MMEFFEKLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWRMIREIV  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK DVL Y++E + NPD+DRN+TLGEF+ +RGYSELFQ+AY++P+C SIWSC S+GV+ 
Sbjct  61    KFKEDVLKYIKELEGNPDIDRNETLGEFLNARGYSELFQQAYLVPICGSIWSCPSDGVLN  120

Query  952   FSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1131
             FSAYS+LSFC NHHLLQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C+V SVST
Sbjct  121   FSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDVKSVST  180

Query  1132  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1311
              E GS    V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF+YVYSDI
Sbjct  181   SENGS----VTVTSGDGSEEVFDRCILAMHAPDALRLLGEEVTFDETRVLGAFRYVYSDI  236

Query  1312  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1491
             YLH +   MPRN AAWS+WNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP   P++
Sbjct  237   YLHHDIDLMPRNQAAWSSWNFLGSTEKKVCVTYWLNILQNLGEKCEPFFVTLNPDHPPKK  296

Query  1492  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1671
              LLKWTTGHPVPSV+A  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM AA GLL 
Sbjct  297   ALLKWTTGHPVPSVSAWTASQELHKIQGKRNLWFCGAYQGYGFHEDGLKAGMAAARGLLG  356

Query  1672  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1851
             K  + LNNP HMVPS  ETGARL VTRF+  FI TG + +LEEGGT+FTF G D    LK
Sbjct  357   KETALLNNPRHMVPSLTETGARLFVTRFMGQFISTGCVTILEEGGTMFTFGGKDSTFPLK  416

Query  1852  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2031
              ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNL  I +ANRD  +++++ 
Sbjct  417   SVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLLNLIMILIANRDTKSNLTK-  475

Query  2032  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2211
               KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+TMTY
Sbjct  476   --KRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDDTMTY  533

Query  2212  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2391
             S AVFKS+DEDLKTAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V+RTGCKYTGI
Sbjct  534   SSAVFKSDDEDLKTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVKRTGCKYTGI  593

Query  2392  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2571
             TLS +QLKYAE+KV+ AGLQD+I+F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF
Sbjct  594   TLSIEQLKYAEEKVKVAGLQDSIKFELCDYRQLSDVQKYDRIISCEMLEAVGHEFMEMFF  653

Query  2572  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2751
              RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSR
Sbjct  654   SRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSR  713

Query  2752  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2931
             LC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LG D KFIRTWEYYFDYCAAGF T TL
Sbjct  714   LCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGIDDKFIRTWEYYFDYCAAGFKTLTL  773

Query  2932  GDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             G+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  774   GNYQLVFSRPGNVAAFADSYQGFPSAY  800



>emb|CDX92987.1| BnaA03g37090D [Brassica napus]
Length=876

 Score =  1233 bits (3189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/878 (67%), Positives = 699/878 (80%), Gaps = 13/878 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGA--GVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             MRVAV+G G+SGL SAYVLA+  A   +V++EKED LGGHA+T+  DGVDLDLGF VFN 
Sbjct  1     MRVAVIGGGVSGLGSAYVLARDDAVKELVLFEKEDSLGGHARTMRFDGVDLDLGFTVFNS  60

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT+PNMM   ++L VDME SDMSFSVSLDNG GYEWG R+G S LFAQK+N+LNPYFWQM
Sbjct  61    VTHPNMMGFLKNLEVDMEDSDMSFSVSLDNGRGYEWGCRHGLSSLFAQKRNILNPYFWQM  120

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IRE  +FK DV  YLE+ + N D+DR +TLGEF+KS GYS +FQKAY++P+C  IWS SS
Sbjct  121   IRETKRFKEDVQKYLEDLERNLDVDRTETLGEFLKSHGYSNVFQKAYLVPVCGLIWSGSS  180

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             E V+  SAYS+LSFCRNHHLLQLFGRP+ LTV  RS ++V KVR ELEKRGC+I   C V
Sbjct  181   ESVLNLSAYSVLSFCRNHHLLQLFGRPEGLTVPGRSQTFVAKVRAELEKRGCKIITNCNV  240

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
              SV+T E G     VI++ ++  Q+ +D CI+A HAPD LK+LG + T++E R+LGAFQY
Sbjct  241   QSVATSENG----CVIVTTEDGSQQIFDSCILAVHAPDALKLLGDKVTYEETRVLGAFQY  296

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
               SD+YLHR+   MPR   AWSAWNFLG+  N+  +TYWLN +QNLG+   P+ +T+NP 
Sbjct  297   TDSDLYLHRDTDLMPRKTGAWSAWNFLGSSENKASVTYWLNIIQNLGEEHDPFFITVNPE  356

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
              TP++ L KWTT HPVPSV+  +AS EL +IQGKR IWFCGAYQGYGFHE+GLKA +I+ 
Sbjct  357   YTPKKTLFKWTTSHPVPSVSTWKASQELYQIQGKRGIWFCGAYQGYGFHEEGLKALIISI  416

Query  1657  HGLLKKRC-------SPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVF  1815
              G+   +C       + L NP HMVPS  E GAR   T+FL +FI TG I + EEGGTVF
Sbjct  417   AGMAASQCLLGKDMVTTLTNPKHMVPSVTEKGARFFFTKFLRNFISTGCITIHEEGGTVF  476

Query  1816  TFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFV  1995
             TFEG D    LK ++ VHSPQFYWKV TQADLGLADAYI+GD SF DK+ GLL+L  I +
Sbjct  477   TFEGKDSSCHLKSILEVHSPQFYWKVMTQADLGLADAYINGDFSFSDKERGLLDLIMILI  536

Query  1996  ANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNE  2175
             AN++L++  S+   KRGWWTP+  T+++ASA  F++H SRQNTLTQARRNISRHYDLSNE
Sbjct  537   ANKELNSKNSKLAKKRGWWTPMFLTASLASANNFLKHFSRQNTLTQARRNISRHYDLSNE  596

Query  2176  LFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIE  2355
             LF+LFLD+TMTYS AVFKS DEDL+TAQMRKI LLIDKA+I K H +LEIGCGWG+LAIE
Sbjct  597   LFALFLDDTMTYSSAVFKSADEDLRTAQMRKIYLLIDKARIEKNHEVLEIGCGWGTLAIE  656

Query  2356  AVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEML  2535
              V RTGC+YTGITLS +QLKYAE+KV++AGL+D I F LCDYRQL D  +YDRIISCEML
Sbjct  657   VVRRTGCRYTGITLSIEQLKYAEEKVKQAGLEDRITFKLCDYRQLSDAHKYDRIISCEML  716

Query  2536  EAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSL  2715
             EAVGHEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL
Sbjct  717   EAVGHEFMETFFRHCEAALAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSL  776

Query  2716  SRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYF  2895
             +RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLERQ QI DLGFD KFIRTWEYYF
Sbjct  777   ARVTSAMASSSRLCIENVENIGIHYYQTLRLWRKTFLERQKQINDLGFDDKFIRTWEYYF  836

Query  2896  DYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             DYCAAGF T TLG+YQ+VFSRPGNV A GDP++   SA
Sbjct  837   DYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFRSFPSA  874



>ref|XP_006489756.1| PREDICTED: uncharacterized protein LOC102615557 [Citrus sinensis]
Length=875

 Score =  1230 bits (3183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/865 (68%), Positives = 714/865 (83%), Gaps = 8/865 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KMRVAV+G G+SGLVSAYVLAK G  VV+YEKED LGGHAKTVT+DGVDLD+GFM+FN V
Sbjct  4     KMRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHV  63

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
              YPNMME  ESLGVDM  SDMSFSVSLD G GYEWG+RNG S LFAQKKN+LNPYFWQM+
Sbjct  64    EYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQML  123

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             RE++KFK+DVLSY+EE +NNPD+DRN+TLG FIKSRGYSELF KAY+IP+C+S+WSC S+
Sbjct  124   REMMKFKDDVLSYVEELENNPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSD  183

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             G M FSA+S+LSFCR   L QLFG PQ +TV+R SHS ++KV E+L+  G +IR  CEV+
Sbjct  184   GAMRFSAFSVLSFCR---LFQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVY  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV   ++G +     I  +N  QE Y+GC+MA HAPD L++LG QATFDE RILGAF+YV
Sbjct  241   SVFPADEGCS-----IVCENGSQEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYV  295

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             Y D++LHR+++FMP+N AAWSAWNF+G+ N ++CLTY LN LQ +G+T  P+L TLNP R
Sbjct  296   YRDVFLHRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQKIGETSMPFLATLNPDR  355

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP+  LLKW+TGH VPSVAAS+AS EL RIQGKR IW+ G YQGYGF EDGLK GMIAAH
Sbjct  356   TPQNTLLKWSTGHSVPSVAASKASLELHRIQGKRGIWYSGVYQGYGFPEDGLKVGMIAAH  415

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             G+L K C+ L NP  MVPS  E GARL V RFL  FI TG  ILLEEGG  FTFEG    
Sbjct  416   GVLGKSCAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTN  475

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK  +R+ +PQFYWKV TQADLGLA++YI+GD+SF+DK EGLLNLF I +AN+ L AS
Sbjct  476   CPLKSDLRIQNPQFYWKVMTQADLGLANSYINGDLSFIDKDEGLLNLFLIVIANQGLDAS  535

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S+ N +R  W+P+ +T++IASAKY+ RHISR+NTL QARRNIS HYD+SNELFSLFL +
Sbjct  536   TSKLNLRRYLWSPMFYTASIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGK  595

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             +M YSCA+FKSE EDL  AQMRK+SLLI+KA+++K   +LEIGCGWG+LAIE V++TGCK
Sbjct  596   SMMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCK  655

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSE+QLKY E KV+EAGLQD+IR  LCDYRQ+P+  +YD IISCEM+E VGHE++
Sbjct  656   YTGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYI  715

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFFG CES+LAE+G+L+LQF S+PD+ YD +R S  FI EY+FPGGCLPSL+R+TSAM 
Sbjct  716   EEFFGCCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMT  775

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             +SSRLCVEHLE+IGIH+YQTLRCWR N +E+QS+IL LGF++KFIRTWEYYFDYCAAGF 
Sbjct  776   SSSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFK  835

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYK  2994
             + TLG+YQIVFSRP NV AF +P++
Sbjct  836   SRTLGNYQIVFSRPSNVAAFSNPHE  860



>ref|NP_001147782.1| cyclopropane fatty acid synthase [Zea mays]
 gb|ACG28704.1| cyclopropane fatty acid synthase [Zea mays]
 tpg|DAA40492.1| TPA: cyclopropane fatty acid synthase [Zea mays]
Length=877

 Score =  1230 bits (3182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/865 (68%), Positives = 708/865 (82%), Gaps = 15/865 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDGVD------LDLGF  561
             MRVAVVGAG+SGL +A+ LA+ GG+ V VYEKEDYLGGHA+TV ++  D      LDLGF
Sbjct  1     MRVAVVGAGVSGLAAAHELARSGGSRVTVYEKEDYLGGHARTVAVEDADAASTVQLDLGF  60

Query  562   MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLD---NGHGYEWGSRNGFSGLFAQKKNL  732
             MVFNRVTYPNM+E FE LGV+MEISDMSFSVS +   +G   EWGSRNG SGL AQK N 
Sbjct  61    MVFNRVTYPNMLEWFEGLGVEMEISDMSFSVSTELGASGSRCEWGSRNGISGLLAQKSNA  120

Query  733   LNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMC  912
             L+P FW+MIREILKFKND L YLE+ +NNPDMDRN+TLG+FI+S GYS+ FQ+AY+ P+C
Sbjct  121   LSPSFWRMIREILKFKNDALRYLEDHENNPDMDRNETLGQFIRSHGYSQFFQEAYLTPIC  180

Query  913   ASIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGC  1092
             A IWSC S+GV+ FSA+ +LSFCRNHHLLQLFGRPQWLTVK RSHSYV+KVREELE  GC
Sbjct  181   ACIWSCPSQGVLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHSYVHKVREELESMGC  240

Query  1093  EIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDEL  1272
             +I+  CE+ SVS+ E G    V +  G    +E YD  I   HAPD LK+LG +AT +EL
Sbjct  241   QIKTSCEIKSVSSSEGGFR--VTVFDGS---EETYDRIIFGVHAPDALKILGAEATHEEL  295

Query  1273  RILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQP  1452
             RILGAFQYVYSDIYLH ++S MPR+L+AWS+WNFLGT +  VC+TYWLN LQN+  T +P
Sbjct  296   RILGAFQYVYSDIYLHSDKSLMPRSLSAWSSWNFLGTTSKGVCVTYWLNLLQNIESTSRP  355

Query  1453  YLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDG  1632
             +LVTLNPP  P+   LKW T HPVPSVAA++AS EL  IQG R IWFCGAYQGYGFHEDG
Sbjct  356   FLVTLNPPHVPDHVFLKWYTSHPVPSVAAAKASLELHHIQGNRGIWFCGAYQGYGFHEDG  415

Query  1633  LKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTV  1812
             LKAG  AA  LL K    L NP  M+PSW E GARLLVTRFL  ++  G+++LLEEGGT+
Sbjct  416   LKAGKAAAQDLLGKESDLLVNPKQMIPSWSEAGARLLVTRFLGQYVSVGNLVLLEEGGTM  475

Query  1813  FTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIF  1992
             F+F    KK  +K ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDK+EGLLNLF I 
Sbjct  476   FSFGEVGKKCHVKSVLRVHDPMFYWKVATEADLGLADAYINGYFSFVDKREGLLNLFLIL  535

Query  1993  VANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSN  2172
             +ANRD + S S +  KRGWWTPLL T+ +ASAKYF+RHI+R+N+++Q R+NIS+HYDLSN
Sbjct  536   IANRDANKSSSSAAGKRGWWTPLLLTAGVASAKYFLRHIARRNSVSQTRQNISQHYDLSN  595

Query  2173  ELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAI  2352
             E FSLFLD +MTYSCA+FK+ED+ L+ AQ++K+ LLIDKAK+ ++HH+LEIGCGWGSLAI
Sbjct  596   EFFSLFLDPSMTYSCAIFKTEDQSLEAAQLQKVCLLIDKAKVERDHHVLEIGCGWGSLAI  655

Query  2353  EAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEM  2532
             + V++TGCKYTGITLS +QLKYA+ KV+EAGL+D+I F+LCDYRQ+P   +YDRIISCEM
Sbjct  656   QLVKQTGCKYTGITLSVEQLKYAQRKVKEAGLEDHISFMLCDYRQIPTQRKYDRIISCEM  715

Query  2533  LEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPS  2712
             +E VGHE+M++FFG CES+LA++GI VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPS
Sbjct  716   IEGVGHEYMDDFFGCCESLLAQDGIFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPS  775

Query  2713  LSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYY  2892
             L+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  IL LGFD+KFIR WEYY
Sbjct  776   LARITSAMSAASRLCIEHLENIGYHYYPTLIQWRDNFMANKDAILALGFDEKFIRIWEYY  835

Query  2893  FDYCAAGFHTCTLGDYQIVFSRPGN  2967
             F YCAAGF + TLG+YQIVFSRPGN
Sbjct  836   FIYCAAGFKSRTLGNYQIVFSRPGN  860



>dbj|BAJ93367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =  1230 bits (3182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/873 (67%), Positives = 711/873 (81%), Gaps = 9/873 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAG+SGL +A+ LA+G A V VYE E+ LGGHA+T  +DGV LDLGFMVFNRVT
Sbjct  5     MRVAVVGAGVSGLAAAHELARGAARVTVYEAEEALGGHARTADVDGVHLDLGFMVFNRVT  64

Query  583   YPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             YPNM+E FE LGV+MEISDMS SVS  L  G   EWGSRNG SGL AQK N + P FW M
Sbjct  65    YPNMLEWFEELGVEMEISDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNAVRPAFWHM  124

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IREILKFK D L YLE+ ++NPD+DR++TLG+FIK+ GYS+LFQ+AY+IP+CASIWSC S
Sbjct  125   IREILKFKEDALKYLEDHESNPDLDRHETLGQFIKTHGYSQLFQEAYLIPICASIWSCPS  184

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             +GV+ FSA+ +LSFCRNHHLLQ+FGRPQWLTVK RSH+YVNKVREELE  GC+I+  C+V
Sbjct  185   QGVLGFSAFFVLSFCRNHHLLQIFGRPQWLTVKGRSHTYVNKVREELESMGCQIKASCQV  244

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
              SVS+ + G    V+ + G    +E YD  I  AHAP+ L+MLG +AT +ELRILGAFQY
Sbjct  245   KSVSSFDGGYK--VLEVGGS---EEVYDKIIFGAHAPEVLRMLGGEATHEELRILGAFQY  299

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
             V+SDIYLHR+ + MP+N +AWSAWNFLGT ++ V +TYWLN LQN+  T +P+LVTLNPP
Sbjct  300   VHSDIYLHRDDTLMPQNPSAWSAWNFLGTTSSGVSVTYWLNLLQNIESTGRPFLVTLNPP  359

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
               P+  LLKW TGHPVPSVAA++AS EL++IQG R IWFCGAYQGYGFHEDG KAG  AA
Sbjct  360   HVPDHVLLKWNTGHPVPSVAAAKASLELQQIQGNRGIWFCGAYQGYGFHEDGHKAGKSAA  419

Query  1657  HGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1836
              GLL ++ S L NP  MVPSW ETGARLLVTRFL  ++  G++ +LEEGGT+++F   DK
Sbjct  420   QGLLGQKSSLLLNPKQMVPSWTETGARLLVTRFLNQYVTIGNMTILEEGGTMYSFGEVDK  479

Query  1837  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2016
             K L+K ++RVH P FYWKVAT+ADLG+ADAYI+G  SFVDK+EGLLNLF I +ANRD   
Sbjct  480   KCLVKTVLRVHDPLFYWKVATEADLGMADAYINGYFSFVDKREGLLNLFLILIANRDAQK  539

Query  2017  SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLD  2196
             S + + SKRGWWTP+L T+ IASAKYF+RHISR+NT+TQ RRNIS+HYDLSN+ FSLFLD
Sbjct  540   SNNSAASKRGWWTPMLLTAGIASAKYFLRHISRKNTVTQTRRNISQHYDLSNDFFSLFLD  599

Query  2197  ETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGC  2376
              +MTYSCAVFK EDE L+ AQ RK++LLI KAK+ + HH+LEIG GWGSLA++ V++TGC
Sbjct  600   PSMTYSCAVFKVEDESLEVAQRRKVNLLIKKAKVERNHHVLEIGSGWGSLAMQVVKQTGC  659

Query  2377  KYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEF  2556
             KYTGITLSE+QLKYAE KV+EAGL+D I FLLCDYRQ+P   +YDRIISCEM+E VGHEF
Sbjct  660   KYTGITLSEEQLKYAEMKVKEAGLEDRITFLLCDYRQIPSRSKYDRIISCEMIEGVGHEF  719

Query  2557  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2736
             M++FFG CES+LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM
Sbjct  720   MDDFFGCCESLLAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAM  779

Query  2737  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2916
             +A+SRLC+E +E+IG HYY TL  WR NF+  +  IL LGFD KFIR WEYYF YCAAGF
Sbjct  780   SAASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAILALGFDDKFIRVWEYYFIYCAAGF  839

Query  2917  HTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  3009
              + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  840   KSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  872



>ref|XP_009102616.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
 ref|XP_009102617.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
Length=871

 Score =  1227 bits (3174),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/874 (67%), Positives = 704/874 (81%), Gaps = 8/874 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKED-YLGGHAKTVTLDGVDLDLGFMVFN  573
             M+VAV+G G+SGL SA+ LA+  G   VV++EKE+ + GGH KT+  +GVDLD+GF+VFN
Sbjct  1     MKVAVIGGGVSGLGSAHDLAREDGIKEVVLFEKEESFFGGHGKTMRFEGVDLDIGFIVFN  60

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  753
              VT PNMMELF++LGVD+E+SDMSFSVSL+NG GYEWG+RNG S LFAQK+N+LNPYFW 
Sbjct  61    PVTCPNMMELFKNLGVDIEVSDMSFSVSLNNGRGYEWGTRNGLSSLFAQKRNILNPYFWH  120

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MI E  KFK D L+Y+EE + NPD DRN+TL EF+KS GYS LFQKAY++P C+SIW+C 
Sbjct  121   MITEFNKFKEDALNYIEEMERNPDTDRNETLREFVKSHGYSALFQKAYLVPACSSIWTCP  180

Query  934   SEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCE  1113
              +  + FSAYS+LSFCRNHHLLQ+F RPQWLTV  RS +Y  KVR ELE+RGC+IR  C 
Sbjct  181   IDSALNFSAYSVLSFCRNHHLLQIFERPQWLTVAGRSETYAAKVRAELEQRGCKIRTSCN  240

Query  1114  VHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQ  1293
             V SVST E G     ++++ ++  QE +D CI+A +APD L++LG+ AT DE R+LGAFQ
Sbjct  241   VQSVSTSEDG----YILVTTEDGSQEVFDRCILAVNAPDALRLLGEDATPDETRVLGAFQ  296

Query  1294  YVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNP  1473
             Y YSDIYLHR+   MPRN  AWSAWNFL +  N+  LT+WLN +QNL +    Y +TLNP
Sbjct  297   YAYSDIYLHRDTDLMPRNRVAWSAWNFLTSSENKASLTHWLNIIQNLDEEHDSYFLTLNP  356

Query  1474  PRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIA  1653
               +P++ L KWT+G P+PSV+A +AS EL +IQGKR IWFCGAYQG GFHEDGLKAGM A
Sbjct  357   EVSPKKTLYKWTSGRPLPSVSAWKASQELNKIQGKRGIWFCGAYQGSGFHEDGLKAGMGA  416

Query  1654  AHGLLKKRCSPL-NNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1830
             A  LL K   PL +NP HMVPS  E GAR L TRFL  FI TG + + EEGGT+FTF+G 
Sbjct  417   AQSLLGKDMVPLLSNPKHMVPSLTEKGARFLFTRFLRHFISTGCVTVYEEGGTMFTFKGK  476

Query  1831  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2010
             D +  L+ ++++ SP FYWKV TQADLGLADAYI+GD SFV+K+ GLLNL  I +ANR+L
Sbjct  477   DLRCNLESVIKIRSPHFYWKVMTQADLGLADAYINGDFSFVNKETGLLNLIMILIANREL  536

Query  2011  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2190
             ++       KRGWWTP+  T+ + SA  F+RH SRQNTLT+ARRNISRHYDLSNELF+LF
Sbjct  537   NSKNLNLAKKRGWWTPMFMTAGLTSATQFLRHFSRQNTLTKARRNISRHYDLSNELFALF  596

Query  2191  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2370
             LD+TM+YS AVFKS+DEDLKTAQMRKI+LLIDKA+I K+H +LEIGCGWG+LAIE V++T
Sbjct  597   LDDTMSYSTAVFKSDDEDLKTAQMRKINLLIDKARIEKDHEVLEIGCGWGTLAIEVVKKT  656

Query  2371  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2550
             GCKYTGITLS +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRIISCEM+E VGH
Sbjct  657   GCKYTGITLSIEQLKYAEEKVKEAGLQDRITFELCDYRQLSDARKYDRIISCEMIEHVGH  716

Query  2551  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2730
             EFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV S
Sbjct  717   EFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVIS  776

Query  2731  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2910
             AMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDYCAA
Sbjct  777   AMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAA  836

Query  2911  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             GF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  837   GFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  870



>gb|KCW60262.1| hypothetical protein EUGRSUZ_H02971, partial [Eucalyptus grandis]
Length=807

 Score =  1226 bits (3171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/805 (72%), Positives = 681/805 (85%), Gaps = 5/805 (1%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNMMELFESLGV+MEISDMSFSVSLD G G EWGSRNG   LFAQK N+LNPYFWQM
Sbjct  1     VTYPNMMELFESLGVEMEISDMSFSVSLDEGRGCEWGSRNGLLSLFAQKTNVLNPYFWQM  60

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             +REI+KFK DVLSYLE  ++NPD++R++TLG+FIKSRGYSELFQKAY+IP+C SIWSC S
Sbjct  61    LREIIKFKEDVLSYLEGLESNPDINRSETLGQFIKSRGYSELFQKAYLIPICGSIWSCPS  120

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             E VM+FSA+SILSFCRNHHLLQ+ GRPQWLTV+RRSHSYVNKVR+ LE +GCEIR  CEV
Sbjct  121   EEVMSFSAFSILSFCRNHHLLQVVGRPQWLTVRRRSHSYVNKVRDVLESKGCEIRPSCEV  180

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
              S+ST ++G     ++++G    +E YD CI+A HAPD L+MLG QAT+DE R+LGAF+Y
Sbjct  181   RSISTSDEG----CIVLTGDG-SEEVYDKCIVAVHAPDALRMLGDQATYDETRVLGAFKY  235

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
              YS+IYLH +++FMP+N AAWSAWNFLG+  N+VCLTYWLN LQNL     PYLVTLNP 
Sbjct  236   AYSEIYLHHDKTFMPKNSAAWSAWNFLGSAENKVCLTYWLNVLQNLDQKDFPYLVTLNPS  295

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
               PE  LLKW TGHP+PSVAAS+A  +L  IQGKR IWFCGAYQGYGFHEDGLKAGM AA
Sbjct  296   HEPEHTLLKWCTGHPIPSVAASKALLQLHEIQGKRGIWFCGAYQGYGFHEDGLKAGMSAA  355

Query  1657  HGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1836
             HG++ +    L+NP HMVPS  E GAR  VT FL  +I TG + LLEEGGT+FTFEGT K
Sbjct  356   HGVMGQSHFLLDNPRHMVPSLKEIGARFFVTGFLRRYISTGLVTLLEEGGTMFTFEGTTK  415

Query  1837  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2016
             +  L V +R+HSP+FYWKV TQADLGLADAYI+GD S VDK +GLLNLF+I +ANRD   
Sbjct  416   RCPLTVTLRIHSPEFYWKVMTQADLGLADAYINGDFSCVDKNKGLLNLFQILIANRDSDV  475

Query  2017  SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLD  2196
             ++S+ + +RGWW P+L T+ IASAKYF +H+SRQNTLTQARRNIS+HYDLSNELFSLFLD
Sbjct  476   AISKLSKRRGWWAPMLLTAGIASAKYFFKHVSRQNTLTQARRNISQHYDLSNELFSLFLD  535

Query  2197  ETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGC  2376
             ETMTYSCA+F+   EDLK AQMRKISLLI KAKI K H +LEIGCGWG+LAIE V +TGC
Sbjct  536   ETMTYSCALFEMAGEDLKAAQMRKISLLIKKAKIEKTHEVLEIGCGWGNLAIEVVRQTGC  595

Query  2377  KYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEF  2556
             KYTGITLS++QLKYA+ +V+EAGLQD+I+ +LCDYRQLP   RYDRIISCEM+EAVGHE+
Sbjct  596   KYTGITLSKEQLKYAKSRVKEAGLQDSIKLILCDYRQLPSAYRYDRIISCEMIEAVGHEY  655

Query  2557  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2736
             M EFFG CESVLA++G+ VLQFISIPDERY+EYR+SSDFIKEYIFPGGCLPSLSRVTSAM
Sbjct  656   MEEFFGCCESVLAKDGLFVLQFISIPDERYEEYRRSSDFIKEYIFPGGCLPSLSRVTSAM  715

Query  2737  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2916
             A++SRL VEH+++IGIHY+QTLRCWR NF+E+Q +IL  GF++KFIRTW+YYFDYCAAGF
Sbjct  716   ASASRLSVEHVDNIGIHYHQTLRCWRKNFMEKQRKILAPGFNEKFIRTWQYYFDYCAAGF  775

Query  2917  HTCTLGDYQIVFSRPGNVTAFGDPY  2991
              + TLG+YQIVF RPGN  AF D Y
Sbjct  776   KSHTLGNYQIVFLRPGNDAAFTDLY  800



>ref|XP_006406026.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
 gb|ESQ47479.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
Length=855

 Score =  1223 bits (3165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/874 (67%), Positives = 695/874 (80%), Gaps = 26/874 (3%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKEDYLGGHAKTVTLDGVDLDL--GFMVF  570
             M+VAV+G GISGLVSA+VLA+  G   +V++EKE+ LGGHAKTV  DGVDLDL  GF+ F
Sbjct  1     MKVAVIGGGISGLVSAFVLAREDGVEELVLFEKEETLGGHAKTVRFDGVDLDLDLGFIAF  60

Query  571   NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  750
             NR+TYP+MME F++LGVD+E+ DMSFSVSLD+G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61    NRITYPSMMEFFKNLGVDLEVLDMSFSVSLDSGKGCEWGSRNGLSSLFAQKKNILNPYFW  120

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSC  930
             +MI E +KFK DV  Y+EE ++NPD+DR +TLGEF+KS  YS +FQKAY++P C SIW C
Sbjct  121   KMITENMKFKKDVEKYIEELEHNPDIDRKETLGEFVKSHRYSNMFQKAYLVPACCSIWPC  180

Query  931   SSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1110
             S + V+ FSAYS+LSFCRNH LLQLFGRPQWL V  RS +YV KV  EL+++GC+IR GC
Sbjct  181   SPDRVLNFSAYSVLSFCRNHQLLQLFGRPQWLAVAGRSQAYVAKVTAELKQQGCKIRTGC  240

Query  1111  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1290
              V SVST E G     V ++ ++  QE +D                 ++T DE RILGAF
Sbjct  241   NVQSVSTSEDG----CVRVTTEDGSQEVFD-----------------KSTSDETRILGAF  279

Query  1291  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1470
             QY YSD+YLHR+   MPRNL AWS WNFL +  N+  LTYWLN +QNLG+   P+ +T N
Sbjct  280   QYAYSDLYLHRDTDLMPRNLVAWSVWNFLTSSGNKASLTYWLNIIQNLGEEHDPFFLTFN  339

Query  1471  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1650
             P  TP++ L KWTT HP+PSV+A +AS E+ +IQGK  +WFCGAYQGYG HED LKAGM 
Sbjct  340   PEVTPKKTLFKWTTAHPLPSVSAWKASQEMNKIQGKHGLWFCGAYQGYGLHEDKLKAGMA  399

Query  1651  AAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEG  1827
             AA GLL K   +PL+NP HMVPS  E GAR   TRFL  FI TG I +LEEGG+V TFEG
Sbjct  400   AAQGLLGKDMVTPLSNPKHMVPSLTEKGARFFFTRFLRHFISTGCITILEEGGSVSTFEG  459

Query  1828  TDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD  2007
              D +  LK ++ +HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +AN++
Sbjct  460   KDSRCHLKSVLEIHSPQFYWKVMTQADLGLADAYINGDFSFVDKETGLLNLIMILIANKE  519

Query  2008  LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSL  2187
             +++  S    KRGWWTP+  T+ IAS K+F++H+SRQNTLTQARRNISRHYDLSNELF+L
Sbjct  520   MNSKNSNGAKKRGWWTPMFLTAGIASTKHFLKHVSRQNTLTQARRNISRHYDLSNELFAL  579

Query  2188  FLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVER  2367
             FLD+TMTYS AV+KS DEDL+TAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V R
Sbjct  580   FLDDTMTYSSAVYKSNDEDLRTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRR  639

Query  2368  TGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVG  2547
             TGCKYTGITLS +QLKYAE+KV+EAGL+D I+F LCDYRQL +  +YDRIISCEMLEAVG
Sbjct  640   TGCKYTGITLSIEQLKYAEEKVKEAGLEDRIKFELCDYRQLSNAHKYDRIISCEMLEAVG  699

Query  2548  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  2727
             HEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVT
Sbjct  700   HEFMETFFTHCEAALAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVT  759

Query  2728  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  2907
             SAMA+SSRLC+E++E+IGIHYYQTLR WR  FLER+ QI+DLGFD KFIRTWEYYFDYCA
Sbjct  760   SAMASSSRLCIENVENIGIHYYQTLRSWRKTFLEREKQIMDLGFDDKFIRTWEYYFDYCA  819

Query  2908  AGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             AGF T TLG+YQ+VFSRPGNV A GDP+    SA
Sbjct  820   AGFKTLTLGNYQVVFSRPGNVAALGDPFHSFPSA  853



>gb|KHG28468.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=828

 Score =  1220 bits (3156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/864 (68%), Positives = 698/864 (81%), Gaps = 42/864 (5%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M++AV+G GISGL+SAYVL K G  VV                                T
Sbjct  1     MKIAVIGGGISGLISAYVLVKAGVNVV--------------------------------T  28

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFE LGVDME SDMSFSVSL++G+G EWGSRNG S LF QK+NL N YFWQMIR
Sbjct  29    YPNMMELFERLGVDMEPSDMSFSVSLNHGNGIEWGSRNGISSLFVQKRNLFNLYFWQMIR  88

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFKNDV+ YL+  ++NPD DRN+TLG+F+ SRGYSELF KAY++P+C  IWS  +E 
Sbjct  89    EIIKFKNDVICYLKVLESNPDFDRNETLGQFVDSRGYSELFLKAYLVPICGLIWSSPTER  148

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             +M FSA+SILSFC+NHHLLQLFGRPQW+TV+ RS  YVNK+REELE RGC IR GCEVHS
Sbjct  149   IMEFSAFSILSFCQNHHLLQLFGRPQWMTVRWRSRQYVNKIREELENRGCIIRTGCEVHS  208

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V +D++G      ++ G +  QE++ GCI+A HAPD L++LG Q T+DELR+LGAFQYVY
Sbjct  209   VLSDDEG----CTVLCG-DESQESFQGCILAIHAPDALRLLGSQVTYDELRVLGAFQYVY  263

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LH + +FMP+N AAWSAWNFLG+ + +VCLTYWLN LQNLG+T  P+LVTLNP  T
Sbjct  264   SDIFLHHDTTFMPKNPAAWSAWNFLGSTDKKVCLTYWLNVLQNLGETSLPFLVTLNPDYT  323

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P   L KW TGHPVPS+AA++AS EL++IQGKR IWFCGAYQGYGFHEDGLKAGM AA+G
Sbjct  324   PRHTLFKWRTGHPVPSIAATKASLELDQIQGKRGIWFCGAYQGYGFHEDGLKAGMSAANG  383

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K  S L+NP  MVPS  ETGAR  VTRFL+ FI T  +ILLEEGGT+FTFEGT KK 
Sbjct  384   VLGKSYSVLSNPKQMVPSLMETGARSFVTRFLSHFISTSCVILLEEGGTMFTFEGTSKKC  443

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK ++RVH P FYWKV T+ADLGLADAYI+GD +FVDK +GLLNL  I +ANRDL +S 
Sbjct  444   NLKTVIRVHYPHFYWKVMTEADLGLADAYINGDFTFVDKNDGLLNLIMILIANRDLISSN  503

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ + KR        ++ + SAKYF +H+ RQNTLTQARRNISRHYDLSN+L++LFLDET
Sbjct  504   SKLSKKR-----YTVSAGLTSAKYFFKHVLRQNTLTQARRNISRHYDLSNDLYALFLDET  558

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFKSE+E LK AQ RKISLLI+KA+I   H ILEIGCGWGSLAIE V+RTGCKY
Sbjct  559   MTYSCAVFKSENEALKDAQQRKISLLIEKARIDGNHEILEIGCGWGSLAIEVVKRTGCKY  618

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLS++QLK+AE +V+EAGLQDNI F LCDYRQLP   +YDRIISCEM+EAVGHE+M+
Sbjct  619   TGITLSKEQLKFAEMRVKEAGLQDNITFQLCDYRQLPSTYKYDRIISCEMIEAVGHEYMD  678

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESVLAE+G+ VLQFISIP+ERY+ YR+SSDFIKEYIFPGGCLPS +R+TSAM+A
Sbjct  679   EFFGCCESVLAEDGLFVLQFISIPEERYNGYRRSSDFIKEYIFPGGCLPSFTRITSAMSA  738

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEH+E+IG+HYYQTLR WR NFLE QS+I+ LGF+ KFIRTWEYYFDYCAAGF +
Sbjct  739   TSRLCVEHVENIGLHYYQTLRYWRRNFLENQSKIMSLGFNDKFIRTWEYYFDYCAAGFKS  798

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYK  2994
              TLG+YQ+VFSRPGNV A G+PYK
Sbjct  799   NTLGNYQVVFSRPGNVAALGNPYK  822



>ref|XP_006406025.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
 gb|ESQ47478.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
Length=869

 Score =  1217 bits (3150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/872 (66%), Positives = 702/872 (81%), Gaps = 8/872 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             MRVAV+G+GISGL SAYVLAK  G   +V++EKE+ LGGHAKT+  DGVDLDLGF VFN 
Sbjct  1     MRVAVIGSGISGLGSAYVLAKEDGIEELVLFEKENSLGGHAKTMRFDGVDLDLGFTVFNP  60

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT PNMME F++LGVD+E+S+MS SVSLDNG G EWGSRNG S LFAQKKN+LNPYFW+M
Sbjct  61    VTSPNMMEFFKNLGVDLEVSEMSLSVSLDNGTGCEWGSRNGLSSLFAQKKNVLNPYFWKM  120

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             + E  KFK DV  Y+EE +  PD+DRN+TLGEF+KS GYS++FQKAY++P C SIW CS 
Sbjct  121   LIENNKFKEDVEKYIEELERKPDIDRNETLGEFLKSHGYSDMFQKAYLVPACCSIWPCSP  180

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             + V+ FSAYS+LSFCRN+ LLQL+GRPQWL V   S +YV+KVR ELE+RGC+IR  C V
Sbjct  181   DRVLNFSAYSVLSFCRNYQLLQLYGRPQWLNVAGHSKTYVSKVRVELEQRGCKIRTSCIV  240

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
              SVST E G     V ++ ++  QE +D CI+A HAPD L++LG+QAT DE R+LGAFQY
Sbjct  241   KSVSTSEDG----YVTVTTEDGSQEVFDRCILAVHAPDALRLLGEQATTDETRVLGAFQY  296

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
              YSD+YLHR+   MPRNL AWSAWNFL +  N+  LTYWLN +QNLGD   P+ +T NP 
Sbjct  297   NYSDLYLHRDTDLMPRNLVAWSAWNFLSS-QNKANLTYWLNLMQNLGDEHDPFFLTFNPE  355

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
              TP+  LLKWTTGHP+PSV+A +AS E+ +IQGKR +WFCG+YQGYGFHEDGLKAG+ AA
Sbjct  356   VTPKNTLLKWTTGHPMPSVSAWKASQEMIKIQGKRSVWFCGSYQGYGFHEDGLKAGIAAA  415

Query  1657  HGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTD  1833
             H LL K   +PL NP HMV S  E GAR   TRFL  FI TG + ++EEGG V+TFEG D
Sbjct  416   HSLLGKDMVTPLRNPKHMVLSLTEKGARFFFTRFLRHFISTGCLQIIEEGGLVYTFEGKD  475

Query  1834  KKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLS  2013
              +  LK ++ +HSP+FYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +AN++L+
Sbjct  476   SRCHLKSVLEIHSPEFYWKVMTQADLGLADAYINGDFSFVDKETGLLNLIMILIANKELN  535

Query  2014  ASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2193
             +  S    KRGWW P+   + IAS K+F++H+S+QNTLTQARRNISRHYDLSNELF+LFL
Sbjct  536   SKNSTFAKKRGWWPPMFLIAGIASTKHFLKHVSKQNTLTQARRNISRHYDLSNELFALFL  595

Query  2194  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2373
             D+TM+YS AV+KS+DEDL+TAQ+RKISLLIDKA+I K H +LEIG GWG+ AIE V +TG
Sbjct  596   DDTMSYSSAVYKSDDEDLRTAQLRKISLLIDKARIEKNHEVLEIGFGWGTFAIEVVRKTG  655

Query  2374  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHE  2553
             CKYTGITLS +QLKYA++KV+EAGL+D I+F LCDYRQL +  +YDRIISCEM+E +GHE
Sbjct  656   CKYTGITLSVEQLKYAKEKVKEAGLEDRIKFELCDYRQLSNAHKYDRIISCEMMEHIGHE  715

Query  2554  FMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSA  2733
             FM  FF  CE+ LAE+GI+V QFI+IP+ERY+EYR +SDF++EYIFPGGCLPSL+RVTSA
Sbjct  716   FMETFFSHCEAALAEDGIIVHQFIAIPEERYNEYRLNSDFVREYIFPGGCLPSLARVTSA  775

Query  2734  MAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAG  2913
             MA+SSRLCVE++E+IG HYY+TLR WR NFLE + QI+DLGFD KFIRTWEYYFDY AA 
Sbjct  776   MASSSRLCVENVENIGNHYYKTLRSWRKNFLENEKQIMDLGFDDKFIRTWEYYFDYSAAA  835

Query  2914  FHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
               T T+ DYQ+VFSRPGNV A GDP++   SA
Sbjct  836   LKTLTIADYQVVFSRPGNVAALGDPFRSFPSA  867



>ref|XP_004957293.1| PREDICTED: uncharacterized protein LOC101772901 [Setaria italica]
Length=880

 Score =  1217 bits (3150),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/880 (67%), Positives = 704/880 (80%), Gaps = 16/880 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG--VVVYEKEDYLGGHAKTVTLDG-----VDLDLGF  561
             MRVAVVGAG+SGL +A+ LA+ GAG  V VYEKED LGGHA+TV ++      V LDLGF
Sbjct  1     MRVAVVGAGVSGLAAAHELARSGAGARVTVYEKEDCLGGHARTVAVEDAAAGTVHLDLGF  60

Query  562   MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHG---YEWGSRNGFSGLFAQKKNL  732
             MVFNRVTYPNM+E FE LGV+MEISDMSFSVS   G G    EWGSRNG SGL AQK N 
Sbjct  61    MVFNRVTYPNMLEWFEGLGVEMEISDMSFSVSTQLGTGGSRCEWGSRNGISGLLAQKSNA  120

Query  733   LNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMC  912
             ++P FW MIREILKFK+D L YLE+ +NNPDMDRN+TLG+FI+S GYS+ FQ+AY+IP+C
Sbjct  121   ISPSFWCMIREILKFKDDALKYLEDRENNPDMDRNETLGQFIQSHGYSQFFQEAYLIPIC  180

Query  913   ASIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGC  1092
             A IWSC S+GV+ FSA+ +LSFCRNHHLLQLFGRPQWLTVK RSH+YV KVREELE  GC
Sbjct  181   ACIWSCPSQGVLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHTYVQKVREELESLGC  240

Query  1093  EIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDEL  1272
              I+  CE+ SVS+ + G    V  + G    +E YD  I   HAPD LK+LG +AT +EL
Sbjct  241   LIKTSCEIKSVSSSDGGLR--VTTVDGS---EETYDRVIFGVHAPDALKLLGAEATHEEL  295

Query  1273  RILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQP  1452
             RILGAFQYVYSDIYLH ++S MPR+ +AWS+WNFLGT +  VC+TYWLN LQN+  T +P
Sbjct  296   RILGAFQYVYSDIYLHCDKSMMPRSSSAWSSWNFLGTTSKGVCVTYWLNLLQNIESTDRP  355

Query  1453  YLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDG  1632
             +LVTLNPP  P+  LLKW T HPVPSVAA++AS EL  IQG R IWFCGAYQGYGFHEDG
Sbjct  356   FLVTLNPPHVPDHVLLKWYTSHPVPSVAAAKASLELHHIQGNRGIWFCGAYQGYGFHEDG  415

Query  1633  LKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTV  1812
             LKAG  AA  LL  +   L NP  M+PSW E GARLLV RFL  +I  G+++LLEEGGT+
Sbjct  416   LKAGKSAAQDLLGNKKGLLENPKQMIPSWTEAGARLLVARFLGQYISVGNLVLLEEGGTM  475

Query  1813  FTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIF  1992
             F+F    KK   K ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDK+EGLLNLF I 
Sbjct  476   FSFGEAGKKCHAKSVLRVHDPMFYWKVATEADLGLADAYINGYFSFVDKREGLLNLFLIL  535

Query  1993  VANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSN  2172
             +ANRD + S S   SKRGWWTPLL T+ +ASAKYF+RHISR+N++TQ R+NIS+HYDLSN
Sbjct  536   IANRDANKSTSSGTSKRGWWTPLLLTAGVASAKYFLRHISRKNSVTQTRQNISQHYDLSN  595

Query  2173  ELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAI  2352
             E FSLFLD +MTYSCA+FK+EDE L+ AQ RKI LLIDKAK+ ++HH+LEIGCGWGSLAI
Sbjct  596   EFFSLFLDPSMTYSCAIFKTEDESLEAAQRRKIGLLIDKAKVERDHHVLEIGCGWGSLAI  655

Query  2353  EAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEM  2532
             + V++TGCKYTGITLS +QL+YA+ KV+EAGL+D+I F+LCDYRQ+P   +YDRIISCEM
Sbjct  656   QLVKQTGCKYTGITLSVEQLQYAQKKVKEAGLEDHISFMLCDYRQIPTRRKYDRIISCEM  715

Query  2533  LEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPS  2712
             +E VGHE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPS
Sbjct  716   IEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPS  775

Query  2713  LSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYY  2892
             L+R+TSAM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  I  LGFD KFIR WEYY
Sbjct  776   LARITSAMSAASRLCIEHLENIGYHYYPTLIRWRDNFMANKDAISALGFDDKFIRIWEYY  835

Query  2893  FDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGDPYKGLASA  3009
             F YCAAGF + TLG+YQIVFSRPGN      DPY    +A
Sbjct  836   FIYCAAGFKSRTLGNYQIVFSRPGNDKLGDNDPYASFPAA  875



>ref|XP_011091265.1| PREDICTED: uncharacterized protein LOC105171752 isoform X1 [Sesamum 
indicum]
Length=867

 Score =  1217 bits (3148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/870 (67%), Positives = 712/870 (82%), Gaps = 8/870 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             +MR+AVVG G+SGL +AYVLAK GA VVVYEKED LGG AKT T+DG  LDLGFMVF+RV
Sbjct  3     RMRMAVVGGGVSGLAAAYVLAKDGAEVVVYEKEDRLGGQAKTATIDGTPLDLGFMVFSRV  62

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
              YP+ MELFE+LGVD E+SD+SFSVSLD G G EWG+RNG S LFAQKKN+LNPYFW MI
Sbjct  63    IYPDTMELFENLGVDRELSDLSFSVSLDEGQGCEWGTRNGLSSLFAQKKNVLNPYFWNMI  122

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK D  +Y+EE +NNPD+DRN+TL ++I+SRGYSELFQKA++IP CASIWSCSS 
Sbjct  123   REIIKFKGDASAYVEELENNPDIDRNETLEDYIRSRGYSELFQKAFLIPTCASIWSCSS-  181

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             G+M+FSAYS+LS   N   LQL GRP  LT +  S SYV++V++ELE RGC IR   EV+
Sbjct  182   GMMSFSAYSVLSLLHNDPALQLIGRPHRLTPRWCSQSYVDRVKKELESRGCHIRTNSEVY  241

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             S+ T+++G A    IIS K+ ++E YDGCI+A +APD LK+LGKQAT+DE RILGAFQY 
Sbjct  242   SILTNDEGCA----IIS-KDGLEEVYDGCIIAVNAPDALKVLGKQATYDESRILGAFQYA  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSD++LH + + MP+N A WS+ NF GT+ N+  +TYWLN LQN+G+T  P+ +TLNPP+
Sbjct  297   YSDLFLHHDNNLMPKNPAVWSSRNFRGTIKNKAYITYWLNNLQNVGET-VPFFLTLNPPK  355

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP+  L KW+T  P+PSVAAS+A  +L  IQGKRR+WFCGAYQGYGF EDG+KAG++AA+
Sbjct  356   TPKLTLFKWSTSQPIPSVAASKALHQLNVIQGKRRMWFCGAYQGYGFPEDGVKAGIVAAN  415

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             GLL+K  +   +  H+VPS  E+GARLLVTRFL  FI TG +ILLEEGGT+FTFEGT KK
Sbjct  416   GLLRKSYTVQKHSKHLVPSSLESGARLLVTRFLERFITTGCLILLEEGGTIFTFEGTRKK  475

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
             + LKV +RVH+P FYWKVAT+ADLG ADAYI GD SF+DK EGLLN F+IF+AN + +  
Sbjct  476   STLKVTLRVHNPAFYWKVATKADLGFADAYIDGDFSFIDKNEGLLNFFQIFIANAEFNTY  535

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             +S+   KRGWWTPLL+TS IASAK F++H+ RQNT+ QARRNIS HYDLSNELFSLF+DE
Sbjct  536   ISKLGKKRGWWTPLLYTSMIASAKSFLKHVLRQNTIDQARRNISDHYDLSNELFSLFMDE  595

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TM+YSCA+F++ +EDLK AQ+RKI  LI+KA+ISKEHH+LEIGCGWG LAIE V+RTGC+
Sbjct  596   TMSYSCAIFRTPNEDLKNAQLRKIHTLIEKARISKEHHVLEIGCGWGGLAIEVVKRTGCR  655

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLS++QL+Y E KV+EAGLQD +  LLCDYRQLP NC+YDRIISCEM+EAVGHE++
Sbjct  656   YTGITLSQEQLQYTESKVKEAGLQDQVELLLCDYRQLPKNCKYDRIISCEMIEAVGHEYI  715

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFF  CES L ENGILVLQFI+I DE+YDE+  S+ FIKEYIFPG  L SLSR+TSAMA
Sbjct  716   EEFFRCCESALTENGILVLQFIAIADEKYDEFTHSAGFIKEYIFPGSWLASLSRLTSAMA  775

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             A+SRL V HLE+ G+HY+QTL CWR N L  QS+IL+LGFD+KF+RTW YYFDYCAAG  
Sbjct  776   AASRLSVVHLEERGLHYFQTLECWRENLLRNQSKILELGFDEKFMRTWIYYFDYCAAGLK  835

Query  2920  TCTLGDYQIVFSRPGNVTAFGD-PYKGLAS  3006
                +G YQ+VF+RPG++ AFG+ PY  + +
Sbjct  836   YGVVGSYQVVFTRPGDIAAFGNKPYNPVPA  865



>ref|XP_003581006.1| PREDICTED: uncharacterized protein LOC100842201 isoform X1 [Brachypodium 
distachyon]
Length=876

 Score =  1209 bits (3128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/875 (68%), Positives = 704/875 (80%), Gaps = 12/875 (1%)
 Frame = +1

Query  406   RVAVVGAGISGLVSAYVLAKGGAG---VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             RVAVVGAG+SGL +A+ L + G     V VYE E+ LGGHA+T  +DGV LDLGFMVFNR
Sbjct  7     RVAVVGAGVSGLAAAHELCRAGGNGVRVTVYEAEERLGGHARTADVDGVQLDLGFMVFNR  66

Query  577   VTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  750
             VTYPNM+E FE LGV+ME SDMS SVS  L  G   EWGSRNG SGL AQK N L P FW
Sbjct  67    VTYPNMLEWFEGLGVEMETSDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALRPGFW  126

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSC  930
              MIREILKFK DVLSYL   +NNPD+DRN+TLGEFIK  GYS+LFQ+AY+IP+CA IWSC
Sbjct  127   HMIREILKFKEDVLSYLSNHENNPDLDRNETLGEFIKMHGYSQLFQEAYLIPICACIWSC  186

Query  931   SSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1110
              S+GV+ FSA+ +LSFCRNHHLLQ+FGRPQWLT+K RSHSYVNKVREELE  GC I+  C
Sbjct  187   PSQGVLGFSAFFVLSFCRNHHLLQIFGRPQWLTIKGRSHSYVNKVREELESMGCRIKTNC  246

Query  1111  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1290
             +V SVS+ E G    V+ + G    +E YD  I  AHAPD L+ML  +AT +ELRILGAF
Sbjct  247   QVKSVSSFEGGHR--VLEVDGS---EEVYDKIIFGAHAPDALRMLRDEATHEELRILGAF  301

Query  1291  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1470
             QYVYSDIYLHR++S MPRN +AWSAWNFLGT ++ V +TYWLN LQN+    +P+LVTLN
Sbjct  302   QYVYSDIYLHRDKSLMPRNSSAWSAWNFLGTTSSGVSVTYWLNLLQNIESKGRPFLVTLN  361

Query  1471  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1650
             PP  P+  LLKW T HPVPSVAA++AS EL +IQGKR IWFCGAYQGYGFHEDG KAG  
Sbjct  362   PPHVPDHVLLKWNTSHPVPSVAAAKASLELNQIQGKRGIWFCGAYQGYGFHEDGSKAGKS  421

Query  1651  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1830
             AA GLL K+   L NP  MVPSW E GARLLVTRFL  +I  G++ +LE+GGT+F+F   
Sbjct  422   AAQGLLGKKIDLLLNPKQMVPSWTEAGARLLVTRFLNQYITIGNLTILEQGGTMFSFGEV  481

Query  1831  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2010
             DKK L+K ++RVH P FYWKVAT+ADLGLADAY++G  SFVDK+EGLLNLF I +ANRD 
Sbjct  482   DKKCLVKSVLRVHDPLFYWKVATEADLGLADAYVNGYFSFVDKREGLLNLFLILIANRDT  541

Query  2011  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2190
               S S + SKRGWWTPLL T+ IASAKYF+RH+SR+NT+TQ R+NIS+HYDLSN+ FSLF
Sbjct  542   QKSSSSAASKRGWWTPLLLTAGIASAKYFLRHVSRKNTVTQTRQNISQHYDLSNDFFSLF  601

Query  2191  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2370
             LD +MTYSCA+FK EDE L+ AQ+RK++LLIDKAK+ ++HH+LEIG GWG LA++ V++T
Sbjct  602   LDPSMTYSCAIFKVEDESLEVAQLRKVNLLIDKAKVERDHHVLEIGSGWGCLAMQVVKQT  661

Query  2371  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2550
             GCKYTGITLSE+QLKYA+ KV+EAGL+D I FLLCDYRQ+P   +YDRIISCEM+E VGH
Sbjct  662   GCKYTGITLSEEQLKYAQMKVKEAGLEDRITFLLCDYRQIPILRKYDRIISCEMIEGVGH  721

Query  2551  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2730
             EFM++FFG CES+LA++G+LVLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TS
Sbjct  722   EFMDDFFGCCESLLAQDGLLVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITS  781

Query  2731  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2910
             AM+A+SRLC+E +E+IG HYY TL  WR NF   +  I  LGFD KFIR WEYYF YCAA
Sbjct  782   AMSAASRLCIEQVENIGYHYYPTLVRWRDNFFANKYAISALGFDDKFIRIWEYYFMYCAA  841

Query  2911  GFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  3009
             GF + TLG+YQIVFSRPGN   A+ D PY  L +A
Sbjct  842   GFKSRTLGNYQIVFSRPGNDKLAYADNPYASLPAA  876



>ref|XP_007035221.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
 gb|EOY06147.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
Length=858

 Score =  1207 bits (3124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/870 (67%), Positives = 708/870 (81%), Gaps = 12/870 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAV+G GI GLVSA VLAK GA VVVYEKE+ +GG AKT   +G+DLDLGF+ FN   
Sbjct  1     MKVAVIGGGIGGLVSACVLAKAGANVVVYEKEEQVGGQAKT--FNGIDLDLGFITFNPAM  58

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
              P+ +ELF+SLGVD+E  +MSFSVSLDNG  YEWG+RNGFS LFAQK+N+LNPYFW+M+R
Sbjct  59    NPSTLELFDSLGVDVEACNMSFSVSLDNGQDYEWGTRNGFSSLFAQKQNVLNPYFWKMLR  118

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK+DV+SYL+  +NNPD+D  +TLG+FIK R YSE FQKAY+IP+C SIW C+ E 
Sbjct  119   ELIKFKDDVISYLQMLENNPDIDGYETLGQFIKLRDYSEPFQKAYLIPICCSIWCCTVEQ  178

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+  LS  R +HL QL GRPQ LTV R S+ + NKVRE LE RGC+IR GCE+ S
Sbjct  179   VMSFSAFYTLSIFRRYHLHQLLGRPQLLTVSRHSY-FANKVREMLESRGCQIRTGCEIRS  237

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V TD+ GS     I+ G    QE Y+GCIMA  AP  LK+LG QATFDELR+LGAFQYVY
Sbjct  238   VQTDDDGSN----IVFGDGF-QEKYNGCIMAVDAPAALKLLGNQATFDELRLLGAFQYVY  292

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+ HR+  FMP+N + WSA NF+    N+ CLTY L+ LQ++G+T  P+LVT+NP +T
Sbjct  293   SDIFFHRDVKFMPKNSSTWSALNFVKGAENKACLTYLLDVLQDVGETSVPFLVTINPDQT  352

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+Q L KW+TGHP+ SVAAS+AS +L +IQGKR IWFCG    YGFHED LKA M+ A+ 
Sbjct  353   PKQTLHKWSTGHPIASVAASKASLQLNQIQGKRGIWFCG----YGFHEDKLKAAMVTANN  408

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL K+CS LN P H+VPS+ ETGARL VTRFL  +I TG I +LEEGGTVFTF+G+ +K 
Sbjct  409   LLGKQCSALNQPKHIVPSFMETGARLFVTRFLGQYISTGCITILEEGGTVFTFKGSMRKC  468

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              +K +++VH+PQFYWKV T+A LGLADA+I+GD SF DK+EGLLNLF I +AN D ++S 
Sbjct  469   SVKTVLKVHNPQFYWKVMTEAGLGLADAFINGDFSFTDKEEGLLNLFIILIANGDSNSSA  528

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             +R N KRGWWTP  FT++IASAKYF +H  RQN++TQARRNISRHYDLSNELF+LFLDET
Sbjct  529   TRLNKKRGWWTPSFFTASIASAKYFFKHALRQNSVTQARRNISRHYDLSNELFALFLDET  588

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             M YS  +FK+EDEDLK AQ+RK+S LIDKA+I K H +L+IGCGWG  AIE V RTGCKY
Sbjct  589   MQYSSGIFKNEDEDLKVAQLRKMSSLIDKARIEKHHEVLDIGCGWGRFAIEVVRRTGCKY  648

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK+AE KV+EAGLQDNIRFLLCDYRQLPD  +YDRIISCEM+E +G E++ 
Sbjct  649   TGITLSEEQLKFAEAKVKEAGLQDNIRFLLCDYRQLPDTRKYDRIISCEMIEHLGDEYVE  708

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             +FF  CES LAE+G+LVLQFISIP+ER++EYR+SSDFIKEYIFPGGCLPSL+R+ + MAA
Sbjct  709   QFFRCCESALAEDGLLVLQFISIPEERFEEYRRSSDFIKEYIFPGGCLPSLNRIVTGMAA  768

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEH+E+IG++YY TLRCWR NFLE QS+IL LGFD+KF+RTWEYYFDYCAAGF T
Sbjct  769   ASRLCVEHVENIGMNYYLTLRCWRKNFLENQSKILALGFDEKFMRTWEYYFDYCAAGFRT  828

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              TLGDYQ+VFSRPGN  A G PY+G  SAY
Sbjct  829   YTLGDYQVVFSRPGNYKALGYPYQGFPSAY  858



>emb|CDX94854.1| BnaC03g43340D [Brassica napus]
Length=892

 Score =  1204 bits (3115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/896 (65%), Positives = 693/896 (77%), Gaps = 31/896 (3%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGA--GVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             MRVAV+G G+SGL SAYVLA+  A   +V++EKED LGGHA+T+  DGVDLDLGF VFN 
Sbjct  1     MRVAVIGGGVSGLGSAYVLARDDAVKELVLFEKEDSLGGHARTMRFDGVDLDLGFTVFNS  60

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT+PNMM   ++L VDME SDMSFSVSLDNG GYEWG R+G S LFAQK+N+LNP+FWQM
Sbjct  61    VTHPNMMGFLKNLEVDMEDSDMSFSVSLDNGRGYEWGCRHGLSSLFAQKRNILNPFFWQM  120

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IRE  KFK DV  YLE+ + N D+DR +TLGEF++S GYS +FQKAY++P+C  IW  SS
Sbjct  121   IRETKKFKEDVQKYLEDLERNLDVDRTETLGEFLESHGYSNVFQKAYLVPVCGLIWPGSS  180

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNK------------------  1062
             E V+  SAYS+LSFCRNHHLLQLFGRP+ LTV  RS ++V K                  
Sbjct  181   ESVLNLSAYSVLSFCRNHHLLQLFGRPEGLTVAGRSQTFVAKCERIYYNAFIRDILLADQ  240

Query  1063  VREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKM  1242
             VR ELEKRGC+I   C+V SV+T    S  G V ++ ++  Q+ +D CI+A HA D L+ 
Sbjct  241   VRAELEKRGCKIITNCKVQSVAT----SGNGCVRVTTEDGSQQVFDKCILAVHAQDALRF  296

Query  1243  LGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNT  1422
             LG + T+DE R+LGAFQY  SD+YLHR+   MPR   AWSAWNFLG+  N+  +TYWLN 
Sbjct  297   LGDKVTYDETRVLGAFQYTDSDLYLHRDTDLMPRKTGAWSAWNFLGSSENKASVTYWLNI  356

Query  1423  LQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGA  1602
             +Q LG+   P+ +T+NP  TP++ L KWTT HPVPSV+  +AS E+ +IQGKR IWFCGA
Sbjct  357   IQKLGEEHDPFFITVNPEYTPKRTLFKWTTSHPVPSVSTWKASQEIYQIQGKRGIWFCGA  416

Query  1603  YQGYGFHEDGLKA------GMIAAHGLLKKRCSP-LNNPNHMVPSWPETGARLLVTRFLA  1761
             YQGYGFHE+GLKA      GM A+ GLL K   P L N  HMVPS  E GAR   T+FL 
Sbjct  417   YQGYGFHEEGLKALIISIAGMAASQGLLGKDMVPTLTNLKHMVPSVTEKGARFFFTKFLR  476

Query  1762  SFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGD  1941
             +FI TG I + EEG TV TFEG D    LK ++ VH PQFYWKV TQADLGLADAYI+GD
Sbjct  477   NFISTGCITIHEEGDTVLTFEGKDSSCHLKSILEVHKPQFYWKVMTQADLGLADAYINGD  536

Query  1942  ISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQN  2121
              SF DK+ GLL+L  I +AN++L++  S+   KRGWWTP+  T+++ASA  F++H+SRQN
Sbjct  537   FSFADKERGLLDLIMILIANKELNSKNSKLAKKRGWWTPMFLTASLASANNFLKHVSRQN  596

Query  2122  TLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKIS  2301
             TLTQARRNISRHYDLSNELF+LFLD+TMTYS AVFKS DEDL+TAQMRKI LLIDKA+I 
Sbjct  597   TLTQARRNISRHYDLSNELFALFLDDTMTYSSAVFKSADEDLRTAQMRKIYLLIDKARIE  656

Query  2302  KEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDY  2481
             K H +LEIGCGWG+LAIE V+RTGCKYTGITLS +QLKYAE+KV+EAGL+D I F LCDY
Sbjct  657   KNHEVLEIGCGWGTLAIEVVKRTGCKYTGITLSIEQLKYAEEKVKEAGLEDRITFKLCDY  716

Query  2482  RQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQ  2661
             RQL D  +YDRIISCEMLEAVGHEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR 
Sbjct  717   RQLSDAHKYDRIISCEMLEAVGHEFMETFFRHCEAALAEDGIFVLQFISIPEERYDEYRL  776

Query  2662  SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQ  2841
             SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  FLERQ Q
Sbjct  777   SSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRLWRKTFLERQKQ  836

Query  2842  ILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             I DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP +   SA
Sbjct  837   INDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPSRSFPSA  892



>ref|XP_002528378.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
 gb|EEF34050.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
Length=809

 Score =  1203 bits (3112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/869 (66%), Positives = 693/869 (80%), Gaps = 61/869 (7%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAV+G GISGLVS YVLA+ G  VV+YEKE+Y+GGHAKTV  DGV+LDLGFMVFNRVT
Sbjct  1     MKVAVIGGGISGLVSTYVLARNGVKVVLYEKEEYIGGHAKTVCFDGVELDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM E FESLGVD+E+SDMSFSVSLD+G GYEWGSRNG SGLFAQK N +NPYFWQMIR
Sbjct  61    YPNMTEFFESLGVDLELSDMSFSVSLDHGKGYEWGSRNGLSGLFAQKTNAINPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DVLSYLE  +NNPD+DRN+TL  FI+SRGYSELFQKAY++P+C  IWSC SE 
Sbjct  121   EIIKFKDDVLSYLEVLENNPDIDRNETLENFIRSRGYSELFQKAYLVPICGLIWSCPSEK  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             +M+FSAYS LS+CRNHHL +LFG PQWLTVK RSHSYVNKVRE+LE  GC IR GCE+HS
Sbjct  181   IMSFSAYSSLSYCRNHHLFELFGHPQWLTVKHRSHSYVNKVREKLENYGCTIRTGCEIHS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VSTD++       ++ G    +E +  CI+A H+PD LK+LG QATFDE R+LGAFQY++
Sbjct  241   VSTDDKS----CTVLCGDGS-EEQFSRCIIAVHSPDALKLLGNQATFDEKRLLGAFQYMH  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             ++I+LH ++ FMPR  AAWSAWNFLG+ NN++CLTYWLN +QNLG+T  P+LVTLNP  T
Sbjct  296   NEIFLHCDKKFMPRIPAAWSAWNFLGSTNNKLCLTYWLNVIQNLGETNPPFLVTLNPDHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKWT  HPV S+AAS+AS E   IQG+R +WFCGAYQGYGF+EDGLK+GM+AAH 
Sbjct  356   PEHTLLKWTASHPVLSLAASKASLEFVHIQGRRGLWFCGAYQGYGFYEDGLKSGMVAAHS  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL++ C+ L+NP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT+FTF+GT KK 
Sbjct  416   LLERHCTILSNPKHMVPSLLETGARLFVTRFLGKYISTGCLILLEEGGTIFTFQGTVKKY  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
               K +++VH+ QFYWK+ TQADLGLADAYI GDISF DK EGLL LF + +ANRD + SV
Sbjct  476   FPKSILKVHNLQFYWKIMTQADLGLADAYISGDISFPDKDEGLLKLFMVLIANRDANISV  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S  N K+GWWTP+  T++IASAK+F RH+SR+N+LTQARRNISRHYDLSNE+FS+FLDET
Sbjct  536   SERNKKKGWWTPMFVTASIASAKFFFRHVSRKNSLTQARRNISRHYDLSNEMFSMFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK+EDEDLK+AQMRKISLLI+KA+I+KEH +LEIGCGWG+LAIE V+RTGCKY
Sbjct  596   MTYSCAVFKTEDEDLKSAQMRKISLLIEKARINKEHEVLEIGCGWGTLAIEVVKRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK+AE++V++AGLQ         +  +P+  RYD                 
Sbjct  656   TGITLSEEQLKFAEERVKQAGLQ---------FISMPEE-RYD-----------------  688

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
                                          EYR+SS+F+KEYIFPG C PSL+R+T+AMA+
Sbjct  689   -----------------------------EYRKSSEFLKEYIFPGLCAPSLTRITTAMAS  719

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             S+RLC+EH+E+IGIHYYQTLR WR NFLE +S+IL LGF++KFIRTWEYYFDYCA+GF T
Sbjct  720   STRLCMEHVENIGIHYYQTLRYWRKNFLENKSKILALGFNEKFIRTWEYYFDYCASGFKT  779

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
              TLGDYQ+V SRP NV A G+PY   A+A
Sbjct  780   RTLGDYQVVLSRPRNVAALGNPYDEFAAA  808



>ref|XP_009102765.1| PREDICTED: uncharacterized protein LOC103828879 [Brassica rapa]
Length=862

 Score =  1201 bits (3107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/874 (66%), Positives = 689/874 (79%), Gaps = 17/874 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKED-YLGGHAKTVTLDGVDLDLGFMVFN  573
             MRVAV+G G+ GL SAYVLA+  G   VV++EKE+  LGGHAKT+ LDGVDLD+GF+V N
Sbjct  1     MRVAVIGGGVCGLGSAYVLAREDGIEEVVLFEKEESVLGGHAKTMRLDGVDLDVGFIVCN  60

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  753
              VT+PNMME F++LGV ME+SDMSFSVSLDNG G EWGSRNG S LFAQK+N+ NPYFWQ
Sbjct  61    PVTHPNMMEFFKNLGVKMEVSDMSFSVSLDNGRGCEWGSRNGLSSLFAQKRNIFNPYFWQ  120

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MI E  KF  D L Y+EE + NPD DRN+TLGEF+KS GYS LFQKAY++P C SIW C 
Sbjct  121   MITEFYKFNKDALKYIEEMERNPDTDRNETLGEFLKSHGYSALFQKAYLVPACRSIWPCP  180

Query  934   SEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCE  1113
              + ++ FSAYS+LSFCRNHHLLQ+F RPQWLTV  RS +Y  KVR ELE+RGC+IR  C 
Sbjct  181   PDSILNFSAYSVLSFCRNHHLLQIFERPQWLTVAGRSETYAAKVRAELERRGCKIRMNCN  240

Query  1114  VHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQ  1293
             V SVST E G     ++++ ++  QE +D CI+A +APD L++LG+ AT DE R+LGAF 
Sbjct  241   VQSVSTSEDG----CILVTTEDGSQEVFDRCILAVNAPDALRLLGEDATSDEARVLGAFH  296

Query  1294  YVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNP  1473
             Y YSDIYLHR+   MPRN  AWSAWNFL +  N+  LTYWLN +QNLG+   P+ +T NP
Sbjct  297   YAYSDIYLHRDTDLMPRNRVAWSAWNFLTSSGNKASLTYWLNIIQNLGEEHDPFFLTFNP  356

Query  1474  PRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIA  1653
               TP+  L KWT+GHP+PSV+A +AS EL  IQGKR         GYG HED +KAGM A
Sbjct  357   EVTPKMTLFKWTSGHPLPSVSAWKASQELNNIQGKR---------GYGCHEDEIKAGMAA  407

Query  1654  AHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1830
             A  LL K+  SP +NP HM PS  E GAR L TRFL  FI TG + + EEGGT+FTF+G 
Sbjct  408   AQSLLGKEMVSPPSNPKHMAPSITEKGARFLFTRFLRHFISTGCLTVDEEGGTMFTFKGN  467

Query  1831  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2010
             D +  L+ ++++HSP FYWKV TQADLGLADAYI+GD SF DK  GLLNL  I +AN++L
Sbjct  468   DLRCNLESVIKIHSPHFYWKVMTQADLGLADAYINGDFSFADKDSGLLNLIMILIANKEL  527

Query  2011  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2190
             ++   + + KRGWWTP+  T+ + SA  F+++ SRQNTLT+ARRNISRHYDLSNELF+LF
Sbjct  528   NSKNLKLSKKRGWWTPMFMTAGLTSATQFLKNFSRQNTLTKARRNISRHYDLSNELFALF  587

Query  2191  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2370
             LD+TM+YS AVFKS+DEDLKTAQMRKI+LLIDKA+I K H +LEIGCGWG+LAIE V++T
Sbjct  588   LDDTMSYSTAVFKSDDEDLKTAQMRKINLLIDKARIEKNHEVLEIGCGWGTLAIEVVKKT  647

Query  2371  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2550
             GCKYTGITLS +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRIISCEM+E VGH
Sbjct  648   GCKYTGITLSIEQLKYAEEKVKEAGLQDRITFELCDYRQLSDARKYDRIISCEMIEHVGH  707

Query  2551  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2730
             EFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV S
Sbjct  708   EFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVIS  767

Query  2731  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2910
             AMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDYCAA
Sbjct  768   AMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAA  827

Query  2911  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             GF T TL DYQ+VFSRPGNV AFGDP+     A+
Sbjct  828   GFKTLTLEDYQVVFSRPGNVAAFGDPFHSFPYAH  861



>gb|KDO54095.1| hypothetical protein CISIN_1g038410mg [Citrus sinensis]
Length=850

 Score =  1199 bits (3103),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/869 (67%), Positives = 706/869 (81%), Gaps = 19/869 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+G G+SGLVSAYVLAK G  VV+YEKED LGGHAKTVT+DGVDLD+GFM+FN V 
Sbjct  1     MRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHVE  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME  ESLGVDM  SDMSFSVSLD G GYEWG+RNG S LFAQKKN+LNPYFWQM+R
Sbjct  61    YPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK+DVLSY+EE +N+PD+DRN+TLG FIKSRGYSELF KAY+IP+C+S+WSC S+G
Sbjct  121   EMMKFKDDVLSYVEELENSPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSDG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
              M FSA+S+LSFCR   L QLFG PQ +TV+R SHS ++KV E+L+  G +IR  CEV+S
Sbjct  181   AMRFSAFSVLSFCR---LFQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVYS  237

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V   ++G +  +V ++G    QE Y+GC+MA HAPD L++LG QATFDE RILGAF+YVY
Sbjct  238   VFPADEGCS--IVCVNGS---QEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVY  292

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
              D++LHR+++FMP+N AAWSAWNF+G+ N ++CLTY LN LQN+G+T  P+L TLNP RT
Sbjct  293   RDVFLHRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQNIGETSMPFLATLNPDRT  352

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+TGH VPSVAAS+AS EL  IQGKR IW+ G  QGYGF EDGLK GMIAAHG
Sbjct  353   PQNTLLKWSTGHSVPSVAASKASLELHLIQGKRGIWYSGVDQGYGFPEDGLKVGMIAAHG  412

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K C+ L NP  MVPS  E GARL V RFL  FI TG  ILLEEGG  FTFEG     
Sbjct  413   VLGKSCAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNC  472

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK  +R+ +PQFYWKV TQADLGLA++YI+GD SF+DK EGLLNLF I +AN+ L +S 
Sbjct  473   PLKSDLRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQGLDSST  532

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ N +           +IASAKY+ RHISR+NTL QARRNIS HYD+SNELFSLFL ++
Sbjct  533   SKLNLR-----------SIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKS  581

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             M YSCA+FKSE EDL  AQMRK+SLLI+KA+++K   +LEIGCGWG+LAIE V++TGCKY
Sbjct  582   MMYSCAIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKY  641

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKY E KV+EAGLQD+IR  LCDYRQ+P+  +YD IISCEM+E VGHE++ 
Sbjct  642   TGITLSEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIE  701

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CES+LAE+G+L+LQF S+PD+ YD +R S  FI EY+FPGGCLPSL+R+TSAM +
Sbjct  702   EFFGCCESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTS  761

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLCVEHLE+IGIH+YQTLRCWR N +E+QS+IL LGF++KFIRTWEYYFDYCAAGF +
Sbjct  762   SSRLCVEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKS  821

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
              TLG+YQIVFSRP  V AF +P++   SA
Sbjct  822   RTLGNYQIVFSRPSIVAAFSNPHESFPSA  850



>ref|XP_002531842.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF30540.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=868

 Score =  1197 bits (3096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 570/871 (65%), Positives = 698/871 (80%), Gaps = 7/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  579
             MRVAV+G GISGL SAYVLAK GA VVVYEKED LGGHA KTV   GVD+DLGF+ FN  
Sbjct  1     MRVAVIGGGISGLASAYVLAKAGAEVVVYEKEDCLGGHANKTVNYKGVDVDLGFLAFNPA  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             +YPNM E FES+GVDME+SDMSFSVS+D G GYEWGSR G S LFAQKKN  NPYFWQM+
Sbjct  61    SYPNM-EFFESIGVDMELSDMSFSVSIDKGKGYEWGSRKGLSSLFAQKKNSFNPYFWQML  119

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             R+I KFK+D LSYLE+ +NN D++ N+ LG+FI SRGYSE+FQKAY++P+C SIWSC  E
Sbjct  120   RDINKFKHDALSYLEQIENNTDINENERLGQFIDSRGYSEVFQKAYLLPICRSIWSCPLE  179

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             G+M FSA+++LSF   HHLLQ+FG   WL VKR+S  ++NKVRE LE  GC+IR GC+V+
Sbjct  180   GIMNFSAFAVLSFFHKHHLLQIFGCSNWLIVKRQSQHFINKVRELLESWGCQIRTGCKVN  239

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
              VST ++G      ++S  N+ +E Y+GCI+  HAP++LK+LGKQATFDE RILGAFQY 
Sbjct  240   FVSTSDKG-----CLVSCGNVSEEMYNGCIINVHAPNSLKLLGKQATFDERRILGAFQYE  294

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
              SDI LH ++S+MP+N AAW AWNFLG+ + + CLTYWLN L+N+G    P  +T+NP  
Sbjct  295   CSDIVLHHDKSYMPKNPAAWCAWNFLGSTDTKGCLTYWLNVLENVGKISSPLFLTMNPDH  354

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
               +  LLKW+T HP+ S+A+S+A  E + IQGKR IWFC  YQG+G + DGLK GM+AAH
Sbjct  355   ELKNTLLKWSTSHPILSIASSKAFLEFDSIQGKRGIWFCEPYQGFGCYGDGLKDGMVAAH  414

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
              LL   C+ L+   HM+PS  E GAR  V R L   I TGSI+LLE+GGT+FT EG  K 
Sbjct  415   NLLGDSCATLSKLKHMLPSLLEFGARYFVIRLLGHIISTGSIVLLEDGGTIFTIEGASKN  474

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK +++VH+ QFYWK+ T+A++GLA+AYI+GD SF+DK+EGLLNLF IFVANRD +  
Sbjct  475   CSLKTILKVHNFQFYWKIMTRAEIGLAEAYINGDFSFIDKEEGLLNLFMIFVANRDATNP  534

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             VS+   KRG W P L T+ I SA YF  HI RQNTL QA RNIS HY++SNE F++FLDE
Sbjct  535   VSKFWEKRGRWIPFLLTACIPSAIYFFGHILRQNTLVQAPRNISHHYNVSNEFFAMFLDE  594

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYSCAVFK++DEDLK AQ+RKISLLI+KA+I K+H +LEIGCGWGSLAIE V++TGCK
Sbjct  595   TMTYSCAVFKTQDEDLKVAQLRKISLLIEKARIDKKHEVLEIGCGWGSLAIEVVKKTGCK  654

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSE+QLK AEDKV++AGLQDNI+FLLCDYR+LP++ +YDRIISC M+E VGHE+M
Sbjct  655   YTGITLSEEQLKIAEDKVKQAGLQDNIKFLLCDYRELPESYKYDRIISCGMIEHVGHEYM  714

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFF  CESVLAE+G+LVLQFI+IPD+RYDE R+S DF+KEYIFPGGCLPSL R+TSAM 
Sbjct  715   EEFFDCCESVLAEDGLLVLQFIAIPDKRYDEVRKSIDFLKEYIFPGGCLPSLYRITSAMR  774

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
              +SRLC+EH+E+IG +YY TL+CWR NFL+ + +IL +GFD+KFIRTWEYYFDYCAAGF 
Sbjct  775   TASRLCMEHVENIGSNYYLTLKCWRKNFLKNKEKILAMGFDEKFIRTWEYYFDYCAAGFK  834

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             + TL DYQIVFSRPGN+ A G+PYKG  SAY
Sbjct  835   SYTLLDYQIVFSRPGNIAALGNPYKGFPSAY  865



>ref|XP_010026810.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104417196 
[Eucalyptus grandis]
Length=841

 Score =  1193 bits (3087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/859 (68%), Positives = 685/859 (80%), Gaps = 49/859 (6%)
 Frame = +1

Query  445   SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  624
             +AY  A+GGA VVVYEKEDYLGGHAKTV+ +GVDLDLGFMVFNRVTYPNMMELFESLGV+
Sbjct  15    AAYEAARGGAKVVVYEKEDYLGGHAKTVSFNGVDLDLGFMVFNRVTYPNMMELFESLGVE  74

Query  625   MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLE  804
             MEISDMSFSVSLD G G EWGSRNG   LFAQK N+LNPYFWQM+REI+KFK DVLSYLE
Sbjct  75    MEISDMSFSVSLDEGRGCEWGSRNGLLSLFAQKTNVLNPYFWQMLREIIKFKEDVLSYLE  134

Query  805   EFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCR  984
               ++NPD++R++TLG+FIKSRGYSELFQKAY+IP+C SIWSC SE VM+FSA+SILSFCR
Sbjct  135   GLESNPDINRSETLGQFIKSRGYSELFQKAYLIPICGSIWSCPSEEVMSFSAFSILSFCR  194

Query  985   NHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVI  1164
             NHHLLQ+ GRPQWLTV+RRSHSYVNKVR+ LE +GCEIR  CEV S+ST ++G     ++
Sbjct  195   NHHLLQVVGRPQWLTVRRRSHSYVNKVRDVLESKGCEIRPSCEVRSISTSDEG----CIV  250

Query  1165  ISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPR  1344
             ++G    +E YD CI+A HAPD L+MLG QAT+DE R+LGAF+Y Y              
Sbjct  251   LTGDGS-EEVYDKCIVAVHAPDALRMLGDQATYDETRVLGAFKYAYR------------Y  297

Query  1345  NLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpv  1524
             N  A S+ + LG  ++ +CLTYWLN LQNL     PYLVTLNP   PE  LLKW TGHP+
Sbjct  298   NWLACSS-HILGXCHDXLCLTYWLNVLQNLDQKDFPYLVTLNPSHEPEHTLLKWCTGHPI  356

Query  1525  psvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNH  1704
             PSVAAS+A  +L  IQGKR IWFCGAYQGYGFHEDGLKAGM AAHG++ +    L+NP H
Sbjct  357   PSVAASKALLQLHEIQGKRGIWFCGAYQGYGFHEDGLKAGMSAAHGVMGQSHFLLDNPRH  416

Query  1705  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1884
             MVPS  E GAR  VT FL  +I TG + LLEEGGT+FTFEGT K+  L V +R+HSP+FY
Sbjct  417   MVPSLKEIGARFFVTGFLRRYISTGLVTLLEEGGTMFTFEGTTKRCPLTVTLRIHSPEFY  476

Query  1885  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2064
             WKV TQADLGLAD                     I +ANRD   ++S+ + +RGWW P+L
Sbjct  477   WKVMTQADLGLAD---------------------ILIANRDSDVAISKLSKRRGWWAPML  515

Query  2065  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2244
              T+ IASAKYF +H+SRQNTLTQARRNIS+HYDLSNELFSLFLDETMTYSCA+F+   ED
Sbjct  516   LTAGIASAKYFFKHVSRQNTLTQARRNISQHYDLSNELFSLFLDETMTYSCALFEMAGED  575

Query  2245  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2424
             LK AQMRKISLLI KAKI K H +LEIGCGWG+LAIE V +TGCKYTGITLS++QLKYA+
Sbjct  576   LKAAQMRKISLLIKKAKIEKTHEVLEIGCGWGNLAIEVVRQTGCKYTGITLSKEQLKYAK  635

Query  2425  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2604
              +V+EAGLQD+I+ +LCDYRQLP   RYDRIISCEM+EAVGHE+M EFFG CESVLA++G
Sbjct  636   SRVKEAGLQDSIKLILCDYRQLPSAYRYDRIISCEMIEAVGHEYMEEFFGCCESVLAKDG  695

Query  2605  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL----------  2754
             + VLQFISIPDERY+EYR+SSDFIKEYIFPGGCLPSLSRVTSAMA++SRL          
Sbjct  696   LFVLQFISIPDERYEEYRRSSDFIKEYIFPGGCLPSLSRVTSAMASASRLRYNCITSSAQ  755

Query  2755  CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLG  2934
              VEH+++IGIHY+QTLRCWR NF+E+Q +IL  GF++KFIRTW+YYFDYCAAGF + TLG
Sbjct  756   SVEHVDNIGIHYHQTLRCWRKNFMEKQRKILAPGFNEKFIRTWQYYFDYCAAGFKSHTLG  815

Query  2935  DYQIVFSRPGNVTAFGDPY  2991
             +YQIVF RPGN  AF D Y
Sbjct  816   NYQIVFLRPGNDAAFTDLY  834



>ref|XP_006420314.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
 gb|ESR33554.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
Length=810

 Score =  1189 bits (3077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/815 (71%), Positives = 680/815 (83%), Gaps = 14/815 (2%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FESLGVDMEISDMSFSVSLD G G EW SRNG SGLFAQKKNLLN YFWQM+REI+
Sbjct  1     MMEFFESLGVDMEISDMSFSVSLDKGQGCEWSSRNGMSGLFAQKKNLLNLYFWQMLREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KF +DVLSYLE+ +NN D+DRN+TLG+F++SRGYSELFQKAY++P+C SIWSCSSE VM+
Sbjct  61    KFNDDVLSYLEDLENNADIDRNETLGQFVESRGYSELFQKAYLVPVCGSIWSCSSEKVMS  120

Query  952   FSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1131
              SA+S+LSFCRNHH LQ+FGRPQWLTV+ RS SY++KV E LE  GC+I+ GCEV SV  
Sbjct  121   CSAFSVLSFCRNHHALQIFGRPQWLTVRSRSRSYIDKVIELLESWGCQIKTGCEVRSVLQ  180

Query  1132  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1311
               +G     + I G +  Q  YDGCIMA HAPD L+MLG QATF+E R+LGAFQYVYSDI
Sbjct  181   YGEGR----IEIRGDDF-QRVYDGCIMAVHAPDALRMLGNQATFEEKRVLGAFQYVYSDI  235

Query  1312  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1491
             +LHR+++F+PRN AAWSAWNFLG+   +VCLTYWLN +QN+ +T+ P+LVTLNP  TPE 
Sbjct  236   FLHRDKNFLPRNPAAWSAWNFLGSTGGKVCLTYWLNVVQNIEETRLPFLVTLNPDHTPEH  295

Query  1492  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLK---------AG  1644
              L KW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLK         AG
Sbjct  296   TLFKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKVPCNSAPLQAG  355

Query  1645  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1824
             MIAAHG+L K C+ L NP HM PS  E GAR+ V RFL  FI TG +I LEEGGT+FTFE
Sbjct  356   MIAAHGMLGKSCAILANPKHMEPSLMEKGARIFVARFLRQFISTGCLIFLEEGGTIFTFE  415

Query  1825  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2004
             G  K   LK ++R+H+PQFY KV T+ADLGLAD+YI+GD SFVDK EGLLNLF I +AN+
Sbjct  416   GAQKNCPLKTVLRIHNPQFYRKVMTEADLGLADSYINGDFSFVDKDEGLLNLFLIVLANQ  475

Query  2005  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2184
             DL +S S+   KRGWW+P+ FT++IASAKYF RHISR+NTLTQARRNISRHYDLSNELFS
Sbjct  476   DLDSSTSKLKQKRGWWSPMFFTASIASAKYFFRHISRKNTLTQARRNISRHYDLSNELFS  535

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2364
             LFLD++M YSCA+FKSE EDL+ AQMRK+SLLI KA++SK H +LEIGCGWG+LAIE V+
Sbjct  536   LFLDKSMLYSCAIFKSEHEDLEVAQMRKVSLLIQKARVSKGHEVLEIGCGWGTLAIEIVK  595

Query  2365  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2544
             +TGCKYTGITLSE+QLKYAE KV+EAGLQD+IR  LCDYRQLP   +YDRIISCEM+EAV
Sbjct  596   QTGCKYTGITLSEEQLKYAEMKVKEAGLQDHIRLYLCDYRQLPKANKYDRIISCEMIEAV  655

Query  2545  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2724
             GH++M EFFG CES+LAE+G+L+LQFIS+PD+ YDE+R S  FIKEYIFPGGCLPSL+R+
Sbjct  656   GHDYMEEFFGCCESLLAEHGLLLLQFISVPDQCYDEHRLSPGFIKEYIFPGGCLPSLNRI  715

Query  2725  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2904
             TSAM +SSRLCVE LE+IGIHYYQTLRCWR NFLE+QS+IL LGF +KFIRTWEYYFDYC
Sbjct  716   TSAMTSSSRLCVEDLENIGIHYYQTLRCWRKNFLEKQSKILALGFSEKFIRTWEYYFDYC  775

Query  2905  AAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             AAGF + TLGDYQIVFSRP NV AF + ++   SA
Sbjct  776   AAGFKSRTLGDYQIVFSRPSNVAAFRNQHESFPSA  810



>gb|EEC82010.1| hypothetical protein OsI_25960 [Oryza sativa Indica Group]
Length=890

 Score =  1182 bits (3058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/894 (66%), Positives = 712/894 (80%), Gaps = 32/894 (4%)
 Frame = +1

Query  406   RVAVVGAGISGLVSAYVLAKGGAGVVV--YEKEDYLGGHAKTVTLDG----VDLDLGFMV  567
             RVAVVGAG+SGL +A+  A+GG GV V  YE+ED LGGHA+TV +DG    VDLDLGFMV
Sbjct  3     RVAVVGAGVSGLAAAHEAARGGGGVRVTLYEREDSLGGHARTVAVDGDAGPVDLDLGFMV  62

Query  568   FNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNG--HGYEWGSRNGFSGLFAQKKNLL  735
             FNRVTYPNMME FE LGV+ME+SDMSFSVS  L +G     EWGSRNG +GL AQK N +
Sbjct  63    FNRVTYPNMMEWFEELGVEMELSDMSFSVSAQLQDGDEQTMEWGSRNGLAGLLAQKTNAV  122

Query  736   NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             +P FW+MIREILKFK+DVL+YLEE D NPD+DRN+TLG F++S GYS LFQ+AY++P+CA
Sbjct  123   SPAFWRMIREILKFKDDVLTYLEEHDKNPDLDRNETLGHFVQSHGYSRLFQQAYLVPICA  182

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCE  1095
              IWSC S+GV+ FSA+ +LSFCRNHHLLQLFGRPQWLTVK RSH+YVN+VREELE  GC+
Sbjct  183   CIWSCPSQGVLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHTYVNRVREELESLGCQ  242

Query  1096  IRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELR  1275
             I+ GCEV SVS  E G  G  V+ +G    +EAYD  I A HAPD L +LG +AT DE R
Sbjct  243   IKTGCEVQSVSALEGG--GYRVVEAGG--TEEAYDSIIFAVHAPDALNILGDEATHDERR  298

Query  1276  ILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNL----GDT  1443
             ILGAFQYVYSDIYLH ++S MPRN +AWS+WNFLGT  + VC+TYWLN LQN+    G  
Sbjct  299   ILGAFQYVYSDIYLHCDKSLMPRNPSAWSSWNFLGTTTSGVCVTYWLNLLQNIEESAGRG  358

Query  1444  KQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFH  1623
             ++P+LVTLNPPR P+  LL W T HPVPSVAA+ A+ EL R+QG R +WFCGAYQGYGFH
Sbjct  359   RRPFLVTLNPPRVPDHVLLAWKTSHPVPSVAAAAAAGELRRVQGCRGLWFCGAYQGYGFH  418

Query  1624  EDGLKAGMIAAH--------GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTG  1779
             EDGLKAGM AA         G  ++R   L NP  MVPSW E GARLLVTRFLA ++  G
Sbjct  419   EDGLKAGMAAARGLLLAANGGAGERRL--LANPRQMVPSWTEAGARLLVTRFLAGYVSVG  476

Query  1780  SIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDK  1959
             ++ LLEEGGT+F+F    KK   K ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDK
Sbjct  477   NLTLLEEGGTMFSFGEAGKKCQAKCVMRVHDPLFYWKVATEADLGLADAYINGYCSFVDK  536

Query  1960  KEGLLNLFKIFVANRDLSASVSRSNSK-RGWWTPLLFTSAIASAKYFIRHISRQNTLTQA  2136
             K+GLLNL  I +ANRD +   S S S+ RGWWTP+L T+ +ASAKYF+RH+SR+NT+TQ 
Sbjct  537   KQGLLNLLLILIANRDANKQSSTSTSRIRGWWTPMLLTAGVASAKYFLRHVSRKNTVTQT  596

Query  2137  RRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHI  2316
             R+NIS+HYDLSN+ FSLFLD +MTYSCAVFK EDE L+ AQ RK+SLLI KA++ ++HH+
Sbjct  597   RQNISQHYDLSNDFFSLFLDPSMTYSCAVFKDEDESLEAAQQRKVSLLIHKARVERDHHV  656

Query  2317  LEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPD  2496
             LEIG GWGSLAI+ V++TGCKYTG+TLSE+QLKY + KV+EAGL+D++ FLLCDYRQ+P 
Sbjct  657   LEIGSGWGSLAIQVVKQTGCKYTGVTLSEEQLKYCQRKVKEAGLEDHMTFLLCDYRQIPT  716

Query  2497  NCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  2676
               +YDRIISCEM+E VGHE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR+SSDFI
Sbjct  717   VRKYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFI  776

Query  2677  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  2856
             KEYIFPGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + +I  LG
Sbjct  777   KEYIFPGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANREEIKSLG  836

Query  2857  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  3009
             FD KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  837   FDDKFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  890



>ref|XP_010670959.1| PREDICTED: uncharacterized protein LOC104887889 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=877

 Score =  1181 bits (3055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/878 (65%), Positives = 701/878 (80%), Gaps = 14/878 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGA-GVVVYEKEDYLG--GHAKTVTLDGVDLD--LGFMV  567
             MR+AV+G GI G+  A+ LAK G   VV+Y+K+DYLG   H KTV +DGVDLD  LGFM 
Sbjct  1     MRIAVIGGGICGVGVAFELAKAGIHQVVLYDKDDYLGETTHTKTVNIDGVDLDIDLGFMF  60

Query  568   FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  747
             FNRV+YPN+ EL +SLG+D+  SDMSFSVSL+ G G EWG+RNG   L+AQK N L P +
Sbjct  61    FNRVSYPNLTELMDSLGIDIVASDMSFSVSLNKGQGCEWGNRNGLRSLYAQKSNALKPSY  120

Query  748   WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWS  927
             W M++EI KF++DV+ YLE  ++NPDMDR +TL  FI++R +S+LFQK Y++PMCASIWS
Sbjct  121   WGMLQEIKKFEDDVILYLEGLESNPDMDRTETLSHFIETRNFSDLFQKGYLVPMCASIWS  180

Query  928   CSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCG  1107
             CS+E VM FSA+S+LS+CRNHHLLQL G PQWLTV+     YVNK+REELE RGC+IR  
Sbjct  181   CSAEKVMEFSAFSVLSYCRNHHLLQLSGCPQWLTVRGGFQHYVNKLREELEVRGCQIRNN  240

Query  1108  CEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGA  1287
             CEV SV TD++G    +V   G    ++AYDGCI+A  APD +K+LGK+AT DELRILGA
Sbjct  241   CEVPSVYTDDRGCT--LVFGDGS---EDAYDGCILAVPAPDAIKILGKEATHDELRILGA  295

Query  1288  FQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTL  1467
             FQY+YSD+YLH ++SF+P+N A WSA NF+ T  N +CLTYWLN L N+  TKQ  LVT 
Sbjct  296   FQYIYSDLYLHHDKSFLPQNSATWSALNFMETTENNMCLTYWLNVLLNIAKTKQHLLVTC  355

Query  1468  NPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGM  1647
             NPP  P++ LLKW+TG  VPSVAA RAS EL  IQGKR IWFCGAY GYGFHEDGLKAG+
Sbjct  356   NPPHLPKEFLLKWSTGQYVPSVAALRASFELGNIQGKRGIWFCGAYHGYGFHEDGLKAGL  415

Query  1648  IAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEG  1827
             +AAH +LK+  +PL NP  M+ SW E  AR  + +FL  FI  G IILLEEGG V TFEG
Sbjct  416   VAAHAILKRNFTPLTNPKQMILSWTEAAARRFLIKFLEGFISVGCIILLEEGGAVLTFEG  475

Query  1828  TDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD  2007
             +DK+   K ++RVH+PQFYWKVAT+AD G ADAYI+GDISFVDK EGLLNLF+I +AN+ 
Sbjct  476   SDKRYTWKTVLRVHNPQFYWKVATEADFGFADAYINGDISFVDKDEGLLNLFRIILANQY  535

Query  2008  LSASVSRSNSK----RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNE  2175
             LS S + ++ K    +GWWTP+LFT+ IASAKYF +H+ R+NT+T AR+NI+ HYDLSNE
Sbjct  536   LSPSAAMADKKSLDFKGWWTPMLFTAGIASAKYFYKHVCRRNTVTAARQNIASHYDLSNE  595

Query  2176  LFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIE  2355
             +FSLFLDETMTYSCA+FKSE+EDLK AQ+RK+ LLI KA++ + H +L+IGCGWGSLAIE
Sbjct  596   MFSLFLDETMTYSCAIFKSENEDLKVAQLRKLHLLIKKARVEQHHEVLDIGCGWGSLAIE  655

Query  2356  AVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEML  2535
              V +TGCKYTGITL+E+QLK AE +V+EAGLQDNI+FLLCDYRQLP  C+YDRIISC M+
Sbjct  656   VVRKTGCKYTGITLAEEQLKLAEQRVKEAGLQDNIQFLLCDYRQLPAACKYDRIISCGMI  715

Query  2536  EAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSL  2715
             E VGHE+  +FF  CESVLA+NG+LVLQFIS+PDE YD +R+SS F+ EYIFPGGCLPSL
Sbjct  716   EHVGHEYYEDFFRTCESVLADNGLLVLQFISVPDELYDGFRRSSGFVYEYIFPGGCLPSL  775

Query  2716  SRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYF  2895
             SR+TSAM ++SRLCVEH+E+IGIHY QTLRCWR NFLE  S+I  LGFD+KF+R WEYYF
Sbjct  776   SRITSAMVSASRLCVEHVENIGIHYGQTLRCWRKNFLENHSKIRSLGFDEKFMRAWEYYF  835

Query  2896  DYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             DY A+ F T  LGDYQIVFSR GN+ AF DPY+ ++S+
Sbjct  836   DYTASAFKTRALGDYQIVFSRLGNLVAFSDPYETISSS  873



>ref|XP_010532685.1| PREDICTED: uncharacterized protein LOC104808653 isoform X1 [Tarenaya 
hassleriana]
Length=887

 Score =  1180 bits (3052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/873 (65%), Positives = 691/873 (79%), Gaps = 6/873 (1%)
 Frame = +1

Query  400   KMRVAVVGAGIS-GLVSAYVLAKGGAGVVVYEKEDYLGGHAK-TVTLDGVDLDLGFMVFN  573
             +MRVAV+G G S GL SAYVLA+ G GVV+YE+E  LGG+A  T+ +DG D+DLG ++FN
Sbjct  4     EMRVAVIGGGTSTGLASAYVLAREGLGVVLYEEEHCLGGNANDTIRVDGADVDLGLILFN  63

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  753
                 PNMME FE LG+DME+SDMS SVSLD+G G EWG+ NGFS LFAQK N+LNP+FW+
Sbjct  64    PAICPNMMEFFEDLGLDMEVSDMSLSVSLDSGGGTEWGTLNGFSSLFAQKSNVLNPFFWK  123

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MIREI KFK+D   Y++E + + D+DR +TLG+F++S GYSELFQKAY++P+C SIWS  
Sbjct  124   MIREIAKFKDDASIYVDERERDRDLDRTETLGQFLRSYGYSELFQKAYLVPICGSIWSRP  183

Query  934   SEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCE  1113
             S+ V +FSA S+LSF RN+HLLQ+FGRPQWLTV  RS +YV K+R ELE+RGC+IR   E
Sbjct  184   SDDVSSFSALSVLSFFRNNHLLQIFGRPQWLTVAGRSRTYVAKIRTELEQRGCKIRTRRE  243

Query  1114  VHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQ  1293
             V  V+T    S    V I   +  +E +D C++A +A D L++LG QATFDE R+LGAFQ
Sbjct  244   VQWVTT----SVNNGVTIRNGDGSEEIFDRCLLAMNAQDALRLLGDQATFDERRVLGAFQ  299

Query  1294  YVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNP  1473
             YV+SDIYLHR+  FMP   AAWSA NFL +  ++  +TYWLN LQNLG+ ++P+ VTLNP
Sbjct  300   YVHSDIYLHRDTDFMPHKTAAWSACNFLESTEHKGSITYWLNILQNLGEKQEPFFVTLNP  359

Query  1474  PRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIA  1653
              R P++ LLKWTT   VPSVAA  AS +L++IQG+  +WFC + QGYGFHEDGLKAG+ A
Sbjct  360   DRVPKKTLLKWTTARTVPSVAALTASQDLDKIQGQHGLWFCESCQGYGFHEDGLKAGIAA  419

Query  1654  AHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTD  1833
             A  LL+K    L NP  MV S  ETGARL VTRF+  FI TGSI LLEEGGT+F F G  
Sbjct  420   ARNLLRKDIGNLKNPKCMVLSLSETGARLFVTRFMEQFISTGSITLLEEGGTMFRFGGKH  479

Query  1834  KKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLS  2013
              K  L+ ++ +HSPQFYWKV T+ADLGLADAYI+GD SFVDK  GLLN+  I +ANRD++
Sbjct  480   PKCNLRSVLTIHSPQFYWKVMTRADLGLADAYINGDFSFVDKDNGLLNMLMILIANRDMN  539

Query  2014  ASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2193
             +  S    KRGWWTP+  T+ +AS  YF++H+SRQNTLTQARRNISRHYDLSNELF++FL
Sbjct  540   SLKSNLAKKRGWWTPMFLTAGLASVNYFLKHVSRQNTLTQARRNISRHYDLSNELFAMFL  599

Query  2194  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2373
             DETM YS A+F SEDEDLKTAQMRKISLLI+KA+I K H +LEIGCGWG+LAIE V RTG
Sbjct  600   DETMMYSAALFSSEDEDLKTAQMRKISLLIEKARIEKNHEVLEIGCGWGTLAIEVVRRTG  659

Query  2374  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHE  2553
             C+YTGITLS +QLKYAE K REAGLQD I F LCDYRQL D+  YDRIISCEMLEAVGHE
Sbjct  660   CRYTGITLSVEQLKYAEAKAREAGLQDQITFQLCDYRQLSDSRVYDRIISCEMLEAVGHE  719

Query  2554  FMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSA  2733
             FM  FF  CE+ LAE+G+LV+QF  IPD+RYDEYR SSDFIKEYIF GGCLPSL+R+TSA
Sbjct  720   FMETFFRSCEAALAEDGLLVMQFAWIPDQRYDEYRLSSDFIKEYIFHGGCLPSLARLTSA  779

Query  2734  MAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAG  2913
             MA+SSRL ++ +E+IG+HYYQT+RCWR NF ER+ QI+DLGFD+KFIRTWEYYFDYC+AG
Sbjct  780   MASSSRLYIQQVENIGVHYYQTIRCWRKNFTERRRQIMDLGFDEKFIRTWEYYFDYCSAG  839

Query  2914  FHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             F T TLG+YQ+VFSR G+ +AFGDPY+   SAY
Sbjct  840   FRTFTLGNYQMVFSRLGSTSAFGDPYRSFPSAY  872



>ref|XP_006350408.1| PREDICTED: uncharacterized protein LOC102579763 isoform X2 [Solanum 
tuberosum]
Length=812

 Score =  1174 bits (3037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/786 (72%), Positives = 666/786 (85%), Gaps = 7/786 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  579
             M++AVVGAGISGLVSAY LAK G  VVVYEKE+Y+  HA KTV +D +DL L FM+F++V
Sbjct  1     MKLAVVGAGISGLVSAYELAKAGVKVVVYEKENYISCHANKTVIVDDIDLSLDFMIFDQV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPN+ME FE LGVDMEIS MSFSVSLD G G EWG+RNGFS LFAQKKN+LNPYFWQMI
Sbjct  61    TYPNLMEFFEFLGVDMEISYMSFSVSLDQGRGCEWGTRNGFSSLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DV+SYLEE DNNPD+DRN TLG+FI+S  YSELFQKAY++P+CASIW C SE
Sbjct  121   REIIRFKQDVISYLEELDNNPDIDRNKTLGQFIESHVYSELFQKAYLVPICASIWFCPSE  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM FSAYSILSFCR+HHL+QLFG PQ LT++RRSH+YVNKV+EELEKRGC+IR GCEV+
Sbjct  181   GVMGFSAYSILSFCRDHHLMQLFGLPQLLTIRRRSHAYVNKVKEELEKRGCQIRTGCEVN  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV T+EQG       I   +   E YDGCI+A H+PDTLKMLGK+AT+DE RILGAF YV
Sbjct  241   SVLTNEQGCT-----IYCNDGSTEVYDGCIIAVHSPDTLKMLGKEATYDETRILGAFHYV  295

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSD +LH++++F+P + AAWSA NFLGT+N+R C TYWLN +QNLGD++ PYLVT +PP 
Sbjct  296   YSDTFLHQDKTFLPHDPAAWSACNFLGTMNDRGCATYWLNVIQNLGDSELPYLVTFDPPH  355

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TPE  L+KW T HPVPSVAAS+AS +L +IQGKR IWFCG YQGYGFHE+GLKAG+IAA 
Sbjct  356   TPEHTLVKWRTSHPVPSVAASKASCKLHQIQGKRGIWFCGPYQGYGFHENGLKAGVIAAD  415

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             G+L++ CS L N  ++VP+WPETGARLLVTRF  S+I TG IILLE GGT+FTF+G D+K
Sbjct  416   GMLRRNCSILYNHKYLVPTWPETGARLLVTRFFKSYIQTGCIILLE-GGTIFTFQGRDRK  474

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LKV + V S QFYWKVATQADLGLADA+IHGD SFVDK EGLLNL  IF+AN +L  S
Sbjct  475   CSLKVSLTVRSMQFYWKVATQADLGLADAFIHGDFSFVDKNEGLLNLITIFIANGELKES  534

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             V  ++ KRGWWTP+LFT+A++SAKYF RH+S QNTLTQARRNISRHYD+SNELFSLFLDE
Sbjct  535   VKPTSKKRGWWTPVLFTAALSSAKYFYRHVSNQNTLTQARRNISRHYDVSNELFSLFLDE  594

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYSCA+FKSEDEDLK AQ+RKI +LI KAK+ KEHHILEIG GWGS A+E V++TGCK
Sbjct  595   TMTYSCAIFKSEDEDLKDAQLRKIYVLIRKAKVRKEHHILEIGFGWGSFAMEVVKQTGCK  654

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSEQQL+YA+ +V++AGLQD I F+LCDYRQ+P   +YDRIIS  M+E VGH++M
Sbjct  655   YTGITLSEQQLEYAQLRVKQAGLQDQITFILCDYRQIPSKDKYDRIISIGMIEHVGHDYM  714

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFF  CES L E+G+L LQFIS+PD RYDEYR S+ FIKEYIFPGGCLPSLSRVTSAMA
Sbjct  715   EEFFTCCESALTEDGLLALQFISMPDGRYDEYRHSTGFIKEYIFPGGCLPSLSRVTSAMA  774

Query  2740  ASSRLC  2757
             A+SRLC
Sbjct  775   ATSRLC  780



>ref|XP_011029773.1| PREDICTED: uncharacterized protein LOC105129420 isoform X3 [Populus 
euphratica]
Length=732

 Score =  1174 bits (3036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/735 (76%), Positives = 642/735 (87%), Gaps = 4/735 (1%)
 Frame = +1

Query  808   FDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRN  987
              +NNPD+DRN+TLG+F+KSRGYSELFQKAY+IP+C SIWSC SEGVM+FSA+S+LSFCRN
Sbjct  2     LENNPDVDRNETLGKFVKSRGYSELFQKAYLIPVCGSIWSCPSEGVMSFSAFSVLSFCRN  61

Query  988   HHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVII  1167
             HHLL+LFGRPQWLTV RRSHSYVNKVRE+LE  GC+IR GCE+ +VST ++  AG  V+ 
Sbjct  62    HHLLELFGRPQWLTVTRRSHSYVNKVREKLESWGCQIRTGCEIQAVSTKDE--AGCAVLC  119

Query  1168  SGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRN  1347
               ++ + E Y GCIMA HAPD L +LGKQATFDE RILGAFQY+YSDI+LHR++ FMP+N
Sbjct  120   --RDGLLEMYSGCIMAVHAPDALALLGKQATFDETRILGAFQYMYSDIFLHRDKKFMPQN  177

Query  1348  LAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvp  1527
              AAWSAWNFLG+ +N+VCLTYWLN LQN+ +T  P+LVTLNP   P+  L+KW+TGHPVP
Sbjct  178   SAAWSAWNFLGSTDNKVCLTYWLNVLQNIDETGLPFLVTLNPDHVPDHTLVKWSTGHPVP  237

Query  1528  svaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHM  1707
             SVAA++AS EL+ IQGKRRIWFCGAYQGYGFHEDGLK+GM+AAHGLL  RC+ L+NP HM
Sbjct  238   SVAATKASLELDHIQGKRRIWFCGAYQGYGFHEDGLKSGMVAAHGLLGNRCAILSNPKHM  297

Query  1708  VPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYW  1887
              PS  ETGARL VTRFL  +I TG +ILLEEGGTVF+FEGT KK  LK +++VH+PQFYW
Sbjct  298   APSMLETGARLFVTRFLGHYISTGCLILLEEGGTVFSFEGTSKKCSLKTVLKVHNPQFYW  357

Query  1888  KVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLF  2067
             K+ TQADLGLADAYI+GD SFV+K EGLLNL  I + NRD++ S S+ N KRGWWTPLLF
Sbjct  358   KIMTQADLGLADAYINGDFSFVNKDEGLLNLLMILIVNRDVNKSASKLNKKRGWWTPLLF  417

Query  2068  TSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDL  2247
             T+ IASAK+FI+H+SRQNTLTQARRNISRHYDLSNELF+LFLDETMTYSC VFK+EDEDL
Sbjct  418   TAGIASAKFFIQHVSRQNTLTQARRNISRHYDLSNELFALFLDETMTYSCGVFKTEDEDL  477

Query  2248  KTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAED  2427
             K AQMRKISLLI+KA ISK+H ILEIGCGWG+LAIEAV+RTGCKYTGITLSE+QLK+AE 
Sbjct  478   KDAQMRKISLLIEKAGISKDHEILEIGCGWGTLAIEAVQRTGCKYTGITLSEEQLKHAEM  537

Query  2428  KVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGI  2607
             KV+EAGLQD I F LCDYRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLAENG+
Sbjct  538   KVKEAGLQDRIAFHLCDYRQLPKTHKYDRIISCEMIEAVGHEYMEEFFGCCESVLAENGL  597

Query  2608  LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIH  2787
             LVLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TSAMA SSRLCVEH+E+IGIH
Sbjct  598   LVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITSAMATSSRLCVEHVENIGIH  657

Query  2788  YYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  2967
             YYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDY AAGF T TLG+YQ+VFSRPGN
Sbjct  658   YYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYSAAGFKTHTLGNYQVVFSRPGN  717

Query  2968  VTAFGDPYKGLASAY  3012
             V A  +PYK   SAY
Sbjct  718   VVALSNPYKSFPSAY  732



>ref|XP_008796356.1| PREDICTED: uncharacterized protein LOC103711840 isoform X3 [Phoenix 
dactylifera]
Length=811

 Score =  1167 bits (3020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/870 (66%), Positives = 688/870 (79%), Gaps = 61/870 (7%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGL SAYVLAK G  VV+YEKED LGGHAKTV  DGV+LDLGFMVFN VT
Sbjct  1     MRVAVVGAGISGLASAYVLAKAGVDVVLYEKEDCLGGHAKTVNFDGVNLDLGFMVFNGVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSF+VSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61    YPNMMEFFESLGVDMEISDMSFAVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV+ YLE+++NNPD+DRN+TLG FIKS GYS+LFQKAY++P+CA IWSC SEG
Sbjct  121   EIVKFKHDVIRYLEKYENNPDLDRNETLGHFIKSHGYSQLFQKAYLVPICACIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNK-VREELEKRGCEIRCGCEVH  1119
             VM+FSA+S+L+FCRNHHLLQLFGRPQWLTVK+RSH YV K VR ELE R C+IR GC V 
Sbjct  181   VMSFSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHCYVRKQVRGELESRCCQIRTGCAVK  240

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV   +    GG  ++ G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+QYV
Sbjct  241   SVLNID----GGCHVV-GEDQSEETYDGCIISTHAPDALKILGTQATYEESRLLGAYQYV  295

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP  
Sbjct  296   YSDIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNLPFLVTLNPRF  355

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
              P+  LLKW+T HP+PSVAAS+AS E+ +IQGKRRIWFCGAYQG+GFHEDGLKAG++AA+
Sbjct  356   VPKHTLLKWSTSHPIPSVAASKASLEIGKIQGKRRIWFCGAYQGFGFHEDGLKAGIVAAN  415

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
              +L   C  L NP  MVPS  ETGARL+VTRFL  +I TG + LLEEGGT+F FEGT+KK
Sbjct  416   SVLGMDCVLLRNPRQMVPSLVETGARLIVTRFLEKYISTGCLTLLEEGGTIFVFEGTNKK  475

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
             + +K ++++H P FYWKVAT+ADLGLADAYI+   SFVD++EGLLNLF I + NRD ++S
Sbjct  476   SCIKSILKIHDPLFYWKVATEADLGLADAYINRYFSFVDEQEGLLNLFMILIVNRDQNSS  535

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S+S + RGWWTP+LFT+ + SA+YF+RHISRQNT+ QA +NIS HYDLSNE FSLFLDE
Sbjct  536   -SKSKTTRGWWTPILFTAGLQSARYFLRHISRQNTVAQAPKNISHHYDLSNEFFSLFLDE  594

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS A+FK E+EDLK AQ+ KISLLI+K +I+    +L                  C 
Sbjct  595   TMTYSGAIFKMENEDLKVAQLHKISLLIEKDRIT---FLL------------------CD  633

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             Y                          R L C YR+      YDRIISCEM+E VGHE+M
Sbjct  634   Y--------------------------RQLPC-YRK------YDRIISCEMIEGVGHEYM  660

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMA
Sbjct  661   EEFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMA  720

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             A+SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF 
Sbjct  721   AASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFR  780

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  781   SRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  810



>ref|XP_010264927.1| PREDICTED: uncharacterized protein LOC104602804 isoform X2 [Nelumbo 
nucifera]
Length=776

 Score =  1167 bits (3019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 553/741 (75%), Positives = 649/741 (88%), Gaps = 5/741 (1%)
 Frame = +1

Query  790   LSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSI  969
             ++YLEE +NNPD+DRN+TLG FI+S GYSELF+KAY+ PMCASIWSCSSEG M FSA+S+
Sbjct  41    IAYLEELENNPDLDRNETLGHFIESHGYSELFEKAYLAPMCASIWSCSSEGAMGFSAFSV  100

Query  970   LSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSA  1149
             LSFCRNHHLLQLFGRPQWLTVK RSH+YVNKV+EELEKR CEI+ G  V SVST +    
Sbjct  101   LSFCRNHHLLQLFGRPQWLTVKWRSHAYVNKVQEELEKRNCEIKTGYAVQSVSTFD----  156

Query  1150  GGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQ  1329
             GG  +I G++  Q+ Y+GC++A HAPD L MLG +AT++E R+LGAFQY YSDIYLHR++
Sbjct  157   GGCTVI-GEDGSQDTYNGCVIAVHAPDALTMLGTEATYEERRVLGAFQYAYSDIYLHRDK  215

Query  1330  SFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWT  1509
               MP+N  AWSAWNFLGT +N+VCLTYWLN LQN+G+T  P+LVTLNPP  PE  +LKW+
Sbjct  216   KLMPQNPTAWSAWNFLGTTDNKVCLTYWLNVLQNIGETSLPFLVTLNPPYIPEHNILKWS  275

Query  1510  TGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPL  1689
             T HPVPSVAAS AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAH  L K C+ L
Sbjct  276   TSHPVPSVAASNASLELDEIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHTFLGKNCAVL  335

Query  1690  NNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVH  1869
              NP  MVPS  ETGARL+VTRFL  +I  G ++LLEEGGTVFTFEG++KK  LK +++VH
Sbjct  336   KNPEQMVPSLAETGARLIVTRFLRHYISAGCLMLLEEGGTVFTFEGSNKKCPLKCVLKVH  395

Query  1870  SPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGW  2049
             +PQFYWKVAT+AD+GLADAYI+GD SFVDK+EGLLNLF IF+ANR+L +S +R+N++RGW
Sbjct  396   NPQFYWKVATEADIGLADAYINGDFSFVDKEEGLLNLFMIFIANRNLDSSDARNNNRRGW  455

Query  2050  WTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK  2229
             WTPL  T+AIASAKYF  HISRQNTLTQARRNISRHYDLSN+LF+LFLD+TMTYSCA+FK
Sbjct  456   WTPLFLTAAIASAKYFFWHISRQNTLTQARRNISRHYDLSNDLFALFLDKTMTYSCAIFK  515

Query  2230  SEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQ  2409
             +E+EDLK AQ+RKIS+LI+KA+I + H ILEIGCGWGSLAIE V++TGCKYTGITLSE+Q
Sbjct  516   AENEDLKVAQLRKISVLIEKARIERNHEILEIGCGWGSLAIEVVKQTGCKYTGITLSEEQ  575

Query  2410  LKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESV  2589
             LKYAE +V+EAGLQD+I+FLLCDYRQLP + +YDRIISCEMLEAVGHE+M EF G CESV
Sbjct  576   LKYAEQRVKEAGLQDHIKFLLCDYRQLPYSHKYDRIISCEMLEAVGHEYMEEFLGCCESV  635

Query  2590  LAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  2769
             LAENG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGC+PSLSRVTSAMA++SRLCVEHL
Sbjct  636   LAENGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCIPSLSRVTSAMASASRLCVEHL  695

Query  2770  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  2949
             E+IGIHYYQTL  WR +F+E+QS+IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQIV
Sbjct  696   ENIGIHYYQTLIYWRNSFMEKQSEILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQIV  755

Query  2950  FSRPGNVTAFGDPYKGLASAY  3012
             FSRPGN+TAF DPYKGL SA+
Sbjct  756   FSRPGNLTAFSDPYKGLPSAF  776



>dbj|BAB01742.1| unnamed protein product [Arabidopsis thaliana]
Length=793

 Score =  1167 bits (3019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/872 (66%), Positives = 672/872 (77%), Gaps = 84/872 (10%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNM+E FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMIEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DVL+Y+E+ + NPD+DR +TLGEF+ +RGYSELFQ+AY+I            
Sbjct  121   REIVRFKEDVLNYIEKLEGNPDIDRKETLGEFLNTRGYSELFQQAYLI------------  168

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
                                   FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C+V 
Sbjct  169   ----------------------FGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDVK  206

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAFQYV
Sbjct  207   SVSTSENG----CVTVTSGDGSEEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAFQYV  262

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP  
Sbjct  263   YSDIYLHHDIDLMPRNKAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLNPDE  322

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQG-YGFHEDGLKAGMIAA  1656
             TP++ LLKWTTGHPVPSVAAS AS EL +IQGKR IWFCGAYQG YG             
Sbjct  323   TPKKALLKWTTGHPVPSVAASIASQELHQIQGKRNIWFCGAYQGRYGG------------  370

Query  1657  HGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1836
                                           TRFL  FI TGS+ +LEEGGT+FTF G D 
Sbjct  371   -----------------------------CTRFLGQFISTGSVTILEEGGTMFTFGGKDS  401

Query  1837  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2016
                LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +ANRD  +
Sbjct  402   TCPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNLIMILIANRDTKS  461

Query  2017  SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLD  2196
             ++++   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF LFLD
Sbjct  462   NLTK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGLFLD  518

Query  2197  ETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGC  2376
             +TMTYS AVFKS+DEDL+TAQMRKISLLIDKA+I K+H +LEIGCGWG+LAIE V RTGC
Sbjct  519   DTMTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCGWGTLAIEVVRRTGC  578

Query  2377  KYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEF  2556
             KYTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDRIISCEMLEAVGHEF
Sbjct  579   KYTGITLSIEQLKYAEEKVKEAGLQDRITFELRDYRQLSDAHKYDRIISCEMLEAVGHEF  638

Query  2557  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2736
             M  FF RCE+ LAE+G++VLQFIS P+ERY+EYR SSDFIKEYIFPG C+PSL++VTSAM
Sbjct  639   MEMFFSRCEAALAEDGLMVLQFISTPEERYNEYRLSSDFIKEYIFPGACVPSLAKVTSAM  698

Query  2737  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2916
             ++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD KF+RTWEYYFDYCAAGF
Sbjct  699   SSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFDDKFVRTWEYYFDYCAAGF  758

Query  2917  HTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              T TLGDYQ+VFSRPGNV AF D Y+G  SAY
Sbjct  759   KTRTLGDYQLVFSRPGNVAAFADSYRGFPSAY  790



>ref|XP_011091264.1| PREDICTED: uncharacterized protein LOC105171751 [Sesamum indicum]
Length=866

 Score =  1158 bits (2995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/872 (67%), Positives = 687/872 (79%), Gaps = 8/872 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG G+SGL +AYVLAK G  VVVYEKED LGG AKTV + G  LDLGF VF RV 
Sbjct  1     MRVAVVGGGVSGLAAAYVLAKDGVEVVVYEKEDALGGRAKTVDIGGTLLDLGFTVFTRVM  60

Query  583   YPNMMELFESLGVDMEISDMS-FSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             +P  +EL ESLGVD E+ DMS FSVSLD G G EWG+RNG S LFA+K N LNPYFW MI
Sbjct  61    HPETIELLESLGVDRELCDMSSFSVSLDEGQGCEWGTRNGVSSLFARKTNALNPYFWNMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             RE++KFKND  SY+EE ++NPD+DRN+TL  FI+S GYSELFQKA+++P CASIWSCSS 
Sbjct  121   REMVKFKNDASSYVEELESNPDIDRNETLEHFIQSCGYSELFQKAFLVPTCASIWSCSS-  179

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM FSAYS+LS  RN   LQL GR Q LT   RS SYV+KV++ELE RGC+IR   E+ 
Sbjct  180   GVMNFSAYSVLSVLRNDPTLQLIGRSQRLTPTWRSESYVDKVKKELESRGCQIRTNSEIC  239

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV  +++G A     I+ K+  +E YDGCI+A  APD LKMLGK AT DELRILGAFQY 
Sbjct  240   SVFANDEGCA-----ITCKDGSKEGYDGCIIATDAPDALKMLGKHATHDELRILGAFQYA  294

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
              SD +LHR+   MP+N A WS+ NFLGT++ +  +TYWLN +QN+ DT   +  TLNPP 
Sbjct  295   CSDTFLHRDNDLMPKNPALWSSRNFLGTIDKKAYITYWLNNMQNINDTVLLFFFTLNPPH  354

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP+  L KW+T HP+PSVAAS+A  +L  IQGKRR+WF GAYQGYGF EDG+KAG+ AA+
Sbjct  355   TPKSTLFKWSTRHPIPSVAASKALRQLNLIQGKRRLWFYGAYQGYGFPEDGIKAGISAAN  414

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
              LL+K  +   N  H +PSW E GAR LVTRFL  FI TG I LLEEGGT FTFEGT +K
Sbjct  415   DLLRKSYTVQYNRKHTIPSWLEIGARGLVTRFLERFIATGCITLLEEGGTAFTFEGTRRK  474

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
             + LKV +RVH+PQFYWKVAT+ADLG ADAYI+GD SF+DK EGLLNLF I +A+ +L+  
Sbjct  475   SNLKVTLRVHTPQFYWKVATEADLGFADAYINGDFSFIDKDEGLLNLFLICIASTELNTY  534

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
             +++ N KRGWWTPLL+TS ++SAKYF +H +R+NTLTQARRNIS+HYDLSNELFSLFLDE
Sbjct  535   MTKLNKKRGWWTPLLYTSIVSSAKYFFKHAARKNTLTQARRNISQHYDLSNELFSLFLDE  594

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYSCA+FK+ DEDLK AQ+RK   LI+KA+ISKEHHILEIGCGWGSLA+EAV+RTGCK
Sbjct  595   TMTYSCAMFKTPDEDLKNAQLRKTHTLIEKARISKEHHILEIGCGWGSLALEAVKRTGCK  654

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSE+QL+YA+ KV+EAGLQD I  LLCDYRQLP + +YDRIISC M+E VGHE M
Sbjct  655   YTGITLSEKQLQYAQLKVKEAGLQDRIELLLCDYRQLPKSYKYDRIISCGMIEHVGHEVM  714

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFF  CES LAENG+LVLQFI+  DE+YDE R+S  F+KEYIFPGGC PSLS V S MA
Sbjct  715   EEFFRCCESALAENGLLVLQFIASADEKYDESRRSPGFVKEYIFPGGCTPSLSHVISCMA  774

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             A+SRL   HLE+IG HY+ TLR WR N L+  S+IL +GF++KFIRTWEYYFDYCAAGF 
Sbjct  775   AASRLSAVHLEEIGCHYFHTLRRWRENLLKNHSKILAMGFNEKFIRTWEYYFDYCAAGFK  834

Query  2920  TCTLGDYQIVFSRPGNVTAFGD-PYKGLASAY  3012
              C LGDYQIVFSRPG+V AF + PY  +   Y
Sbjct  835   YCILGDYQIVFSRPGDVAAFSNKPYNAVPGDY  866



>gb|KHN01041.1| Putative fatty acid methyltransferase [Glycine soja]
Length=794

 Score =  1153 bits (2983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/864 (66%), Positives = 671/864 (78%), Gaps = 71/864 (8%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG GISGL SAY+LAKGG  VV+YEKED                    + FN   
Sbjct  1     MRVAVVGGGISGLASAYLLAKGGVKVVLYEKEDRWE-----------------ISFN---  40

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
                    F  L ++ E++   F V ++  +                              
Sbjct  41    -------FSGLNIEFELNSKKFKVVMNTNY------------------------------  63

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
                       +YL+  +NNPD+DRN+ LGEFIKSRGYSELFQKAY+IP+C SIWSCSSEG
Sbjct  64    ----------NYLDMLENNPDIDRNEPLGEFIKSRGYSELFQKAYLIPICGSIWSCSSEG  113

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RS +YVNKV++ELE+ G +I    EVH 
Sbjct  114   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSQTYVNKVKQELEREGSQIITNREVHL  173

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST  +       ++   +  QE YDGCIMA HAPD L++LG +AT+DE RILGAFQY Y
Sbjct  174   VSTTSEKGC----VVYCNDGSQEMYDGCIMAVHAPDALRLLGDEATYDERRILGAFQYAY  229

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MP+N AAWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   
Sbjct  230   SDIFLHRDKNLMPQNPAAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHI  289

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAYQGYGFHEDG KAGMIAAHG
Sbjct  290   PENTLLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYQGYGFHEDGFKAGMIAAHG  349

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L   C    NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K  
Sbjct  350   ILGSCCVLQTNPKHMVPSWKELGARIFVTRFLSCYITTGCLMLLEEGGTMFTFEGTGKNC  409

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK ++RVH PQFYWKV TQADLGLADAYI+GD SFVDK EGLLNL  I +ANRD +AS 
Sbjct  410   GLKSVLRVHDPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNLILILIANRDSNASN  469

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+    RGWWTP+ FTSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSN+LF+ FLDET
Sbjct  470   SKLKKNRGWWTPVFFTSALTSAKFFMDHVSRRNTLTQARRNISRHYDLSNDLFATFLDET  529

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKY
Sbjct  530   MTYSCAVFKNKDEDLKDAQKRKISLLIEKARIEKTHEILEIGCGWGSLAIEVVKQTGCKY  589

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK AE +V++AGLQD I F+LCDYRQLP   +YDRIISCEM+EAVGHE+M 
Sbjct  590   TGITLSEEQLKLAEQRVKDAGLQDRINFVLCDYRQLPKTYKYDRIISCEMIEAVGHEYME  649

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA
Sbjct  650   EFFGCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAA  709

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLCVEH+E+IGIHYYQTLRCWR NFL+RQ++IL LGF++KFIRTWEYYFDYC AGF +
Sbjct  710   TSRLCVEHVENIGIHYYQTLRCWRKNFLKRQNEILALGFNEKFIRTWEYYFDYCGAGFKS  769

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYK  2994
              TLG+YQ+VFSRPGNV A GDPYK
Sbjct  770   LTLGNYQVVFSRPGNVPALGDPYK  793



>ref|XP_010670924.1| PREDICTED: uncharacterized protein LOC104887860 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=872

 Score =  1153 bits (2983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/874 (64%), Positives = 689/874 (79%), Gaps = 9/874 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+G GISGL +A+ LAK G  VV+YEKE+ LGGHA+ V ++G+D+DL FMVFNRV+
Sbjct  1     MRFAVIGGGISGLGAAFELAKAGVEVVLYEKEELLGGHAQIVNVNGIDVDLNFMVFNRVS  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YP+  ELF+ LG+D++  DMS SVSLD G G EWGSRNGF  LFAQ  N L P FW+M++
Sbjct  61    YPHTTELFDGLGIDVDAFDMSVSVSLDKGQGCEWGSRNGFRSLFAQTTNALKPNFWRMVQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+DV+ YL+  + NP++DR +T G FIKSR YSELFQKAY+IP+ AS W CSSE 
Sbjct  121   EIKKFKDDVIMYLDGLELNPEIDRAETFGHFIKSRSYSELFQKAYLIPVFASFWCCSSER  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSA+S+LSFCRNHHLL+L G PQWL+V   S  YVNK+REELE RG +IR  CEV+ 
Sbjct  181   VMDFSAFSVLSFCRNHHLLELSGGPQWLSVSGGSQQYVNKLREELEVRGSQIRTSCEVNF  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST ++G A    +  G    ++ YDGCI+A  AP+ LK+LGK+ T DE RILGA QYV 
Sbjct  241   VSTSDKGCA----LFYGDGS-EDLYDGCIIAVPAPNALKILGKEVTDDETRILGALQYVG  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
              DI+LHR++ FMP+N AAWSA NF G+ +N VCLTYW+N LQN+  T QP L+T+NPP  
Sbjct  296   RDIFLHRDKKFMPQNPAAWSALNFQGSTDNTVCLTYWINVLQNISKTDQPLLLTINPPHP  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLK +TG  VPSVA+ +AS EL  IQGKR IWFCG   G GFHEDGLKAG+IAA+ 
Sbjct  356   PENFLLKRSTGVLVPSVASMKASLELRNIQGKRGIWFCGTRHGNGFHEDGLKAGLIAAND  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +LK+   PL NP  M  SW E  AR  + R+L SFI  G +ILLE+GGTV  FEG+DK+ 
Sbjct  416   VLKRTFLPLPNPKKMALSWTEATARRYIIRYLKSFISAGCLILLEDGGTVLKFEGSDKRC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
               K  +RVH+PQFYWKVA +ADLGLADA+I+GDIS VDK +GLL+LF+IF+AN  L   V
Sbjct  476   TWKTAIRVHNPQFYWKVALEADLGLADAFINGDISIVDKDDGLLDLFRIFLANMYLYRCV  535

Query  2023  SRSNSK----RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2190
             S    K    +GWWTP+ FT+ IASAKYF +H+SR+N++T ARRNI+RHYDLSNE+FSLF
Sbjct  536   SMDEKKSFDFKGWWTPMFFTAGIASAKYFYQHLSRKNSVTLARRNIARHYDLSNEMFSLF  595

Query  2191  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2370
             LD+TMTYSCAVFKS+DEDLK AQ+RK+ LLI+KA++ K+H +L+IGCGWGSLAIE V++T
Sbjct  596   LDDTMTYSCAVFKSKDEDLKVAQLRKLHLLIEKARVEKQHEVLDIGCGWGSLAIEIVKKT  655

Query  2371  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2550
             GC+YTGITL+E+QLK AE +V+EAGLQD+I+FLLCDYRQLP + ++DRIISC MLE VG 
Sbjct  656   GCRYTGITLAEEQLKLAEQRVKEAGLQDHIKFLLCDYRQLPASHKFDRIISCGMLEHVGD  715

Query  2551  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2730
             E+  +FF  CES+LA+ G+LVLQ ISIPDERYD +R+SSDF++EYIFPGGCLPSLSR+T+
Sbjct  716   EYYEDFFRHCESLLADTGLLVLQTISIPDERYDGHRKSSDFMREYIFPGGCLPSLSRLTT  775

Query  2731  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2910
             AMA++SRLCVEH+E+IG+HY Q LRCWR NFLE Q +I  LGFD KF+R WEYYFDY A+
Sbjct  776   AMASASRLCVEHVENIGVHYGQALRCWRKNFLENQGKIRSLGFDDKFMRAWEYYFDYMAS  835

Query  2911  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              F T TLGDYQIVFSR GN+ AF DPY+ + S++
Sbjct  836   MFKTRTLGDYQIVFSRQGNLVAFSDPYECIPSSH  869



>gb|EMS55075.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=826

 Score =  1144 bits (2959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/823 (67%), Positives = 663/823 (81%), Gaps = 16/823 (2%)
 Frame = +1

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  747
             +VTYPNM+E FE LGV+MEISDMS SVS  L  G   EWGSRNG SGL AQK N L P F
Sbjct  9     QVTYPNMLEWFEELGVEMEISDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALRPAF  68

Query  748   WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWS  927
             W MIREILKFK D L YLE+ ++NPD+DR++TLG+FI++ GYS+LFQ+AY+IP+CASIWS
Sbjct  69    WHMIREILKFKEDALKYLEDHESNPDLDRHETLGQFIQTHGYSQLFQEAYLIPICASIWS  128

Query  928   CSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCG  1107
             C  +GV+ FSA+ +LSFCRNHHLLQ+FGRPQWLTVK RSH+YVNKVREELE  GC+I+  
Sbjct  129   CPLQGVLGFSAFFVLSFCRNHHLLQIFGRPQWLTVKGRSHTYVNKVREELESMGCQIKTS  188

Query  1108  CEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGA  1287
             C+V SVS  E G    V+ +SG    +E YD  I  AHAPD L+MLG +AT +ELRILGA
Sbjct  189   CQVKSVSNFEGGYK--VLEVSGS---EEVYDKIIFGAHAPDVLRMLGDEATHEELRILGA  243

Query  1288  FQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTL  1467
             FQYV+SDIYLHR+ + MP+N +AWSAWNFL T ++ V +TYWLN LQN+  T +P+LVTL
Sbjct  244   FQYVHSDIYLHRDDTLMPQNPSAWSAWNFLRTTSSGVSVTYWLNLLQNIESTGRPFLVTL  303

Query  1468  NPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQG-------YGFHE  1626
             NPP  P+  LLKW TGHPVPSVAA++AS EL++IQG R IWFCGAYQG       YGFHE
Sbjct  304   NPPHVPDHVLLKWNTGHPVPSVAAAKASLELQQIQGNRGIWFCGAYQGNSFDYTGYGFHE  363

Query  1627  DGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGG  1806
             DGLKAG  AA GLL ++ S L NP  MVPSW E GARLLVTRFL  ++  G++ +LEEGG
Sbjct  364   DGLKAGKSAAQGLLGQKSSLLLNPKQMVPSWTECGARLLVTRFLNQYVTIGNMTILEEGG  423

Query  1807  TVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFK  1986
             T+F+F   DKK L+K ++RVH P FYWKVAT+ADLG+ADAYI+G  SFVDK+EGLLNLF 
Sbjct  424   TMFSFGEVDKKCLVKTVLRVHDPLFYWKVATEADLGMADAYINGYFSFVDKREGLLNLFL  483

Query  1987  IFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDL  2166
             I +ANRD   S + + SKRGWWTP+L T+ IASAKYF+RHISR+NT+TQ RRNIS+HYDL
Sbjct  484   ILIANRDAQKSSNSAASKRGWWTPMLLTAGIASAKYFLRHISRKNTVTQTRRNISQHYDL  543

Query  2167  SNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSL  2346
             SN+ FS+FLD +MTYSCAVFK EDE L+ AQ RK++LLI KAK+ + HH+LEIG GWGSL
Sbjct  544   SNDFFSIFLDPSMTYSCAVFKVEDESLEVAQQRKVNLLIKKAKVERNHHVLEIGSGWGSL  603

Query  2347  AIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISC  2526
             A+E V++TGCKYTGITLSE+QLKYA+ KV+EAGL+D I FLLCDYRQ+P  C+YDRIISC
Sbjct  604   AMEVVKQTGCKYTGITLSEEQLKYAQKKVKEAGLEDRITFLLCDYRQIPGRCKYDRIISC  663

Query  2527  EMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCL  2706
             EM+E VGHEFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCL
Sbjct  664   EMIEGVGHEFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCL  723

Query  2707  PSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWE  2886
             PSL+R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL LGFD KFIR WE
Sbjct  724   PSLARITSAMSAASRLCIEQVENIGYHYYSTLIRWRDNFMANKDAILALGFDDKFIRVWE  783

Query  2887  YYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  3009
             YYF YCAAGF + TLG YQIVFSRPGN  +    +PY  L +A
Sbjct  784   YYFIYCAAGFKSRTLGTYQIVFSRPGNDKLACADNPYASLPAA  826



>dbj|BAB02771.1| mycolic acid methyl transferase-like protein [Arabidopsis thaliana]
Length=842

 Score =  1143 bits (2957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 577/886 (65%), Positives = 674/886 (76%), Gaps = 63/886 (7%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DVL Y+EE + NPD+DR +TLGEF+ SRGYSELFQ+AY+I            
Sbjct  121   REIVRFKEDVLKYIEELEGNPDIDRKETLGEFLNSRGYSELFQQAYLI------------  168

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
                                   FGRPQWLTV  RS +YV KVR ELE+ GC IR  C+V 
Sbjct  169   ----------------------FGRPQWLTVAGRSQTYVAKVRTELERLGCRIRTSCDVK  206

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SVST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAFQYV
Sbjct  207   SVSTSENG----CVTVTSGDGSKEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAFQYV  262

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP  
Sbjct  263   YSDIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLNPDE  322

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQG-YG-----FHEDGLKA  1641
             TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR IWFCGAYQG YG       +    +
Sbjct  323   TPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNIWFCGAYQGWYGCCTRFVRQRNCSS  382

Query  1642  GMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVT---GSIILLEEGGTV  1812
                A +G       P  + N       +    + + RF    I+T   G   +LEEGGT+
Sbjct  383   EQSATYG-------PFLDRNRSSAFRYKILGTIHINRFCN--IITYRYGLNRILEEGGTM  433

Query  1813  FTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKI-  1989
             FTF G D    LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  + 
Sbjct  434   FTFGGKDSTCPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNLIMVK  493

Query  1990  ---FVANRDLSASVSRS--NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISR  2154
                F A R    ++S    NS+RGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISR
Sbjct  494   ALNFSALRIGMQALSPKLFNSRRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISR  553

Query  2155  HYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCG  2334
             HYDLSNELF  FLD+TMTYS AVFKS+DEDL+TAQMRKISLLIDKA+I K+H +LEIGCG
Sbjct  554   HYDLSNELFGFFLDDTMTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCG  613

Query  2335  WGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDR  2514
             WG+LAIE V RTGCKYTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDR
Sbjct  614   WGTLAIEVVRRTGCKYTGITLSIEQLKYAEEKVKEAGLQDWITFELRDYRQLSDAQKYDR  673

Query  2515  IISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFP  2694
             IISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFP
Sbjct  674   IISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFP  733

Query  2695  GGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFI  2874
             GGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+ LGFD KF+
Sbjct  734   GGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQKQIMALGFDDKFV  793

Query  2875  RTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  794   RTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  839



>ref|XP_007035215.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06141.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=917

 Score =  1140 bits (2950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 556/917 (61%), Positives = 688/917 (75%), Gaps = 49/917 (5%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M  AV+G GI GLVSAYVLAK G  VVVYEKED  GGHAKTV    +DLDLGF+  N  T
Sbjct  1     MGFAVIGGGIRGLVSAYVLAKAGVNVVVYEKEDQFGGHAKTVNFHAIDLDLGFLFLNPAT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDN-GHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             YP M+ELF+ LGVD+E SD+SFSVS D  GHGYEWG+ +GFS LFA +KN+LNPYFWQ++
Sbjct  61    YPTMLELFDILGVDVEASDVSFSVSHDKLGHGYEWGTHHGFSSLFAHRKNMLNPYFWQVL  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KF++D +SYL   +NNPD+DRN+TLG+FIKSRGYSE FQ  ++ P+C SIW CS++
Sbjct  121   REIIKFRDDAISYLHMLENNPDIDRNETLGQFIKSRGYSETFQNTFLGPICGSIWCCSTQ  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
              V+ FSA+S LS C +HH+ QLFGRPQWLT+KR S+ +V KVR+ LE RGC+++ GC+VH
Sbjct  181   KVLNFSAFSTLSLCCSHHMFQLFGRPQWLTIKRHSY-FVKKVRDILESRGCQLKLGCQVH  239

Query  1120  SV---------STDEQGSAG--GVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFD  1266
             SV         ++++ G  G  G +++ G    QE Y+GCIMA  AP  L +LG QATF+
Sbjct  240   SVLPADNAILWTSNDNGKKGLAGSIMVCGDGF-QETYNGCIMAVDAPSALALLGNQATFE  298

Query  1267  ELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTK  1446
             E+RILGAFQY  SDI+LHR+ + MP+N +AWSA NFL +  ++ CLTYWLN LQN+G T 
Sbjct  299   EMRILGAFQYSSSDIFLHRDSNLMPKNRSAWSALNFLRSSEDKACLTYWLNVLQNVGKTS  358

Query  1447  QPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFH-  1623
               + VTLNP  TP   LLKW+TG  +PS+AAS+AS EL++IQGKR IWFC +      H 
Sbjct  359   LQFFVTLNPHHTPNNTLLKWSTGLLIPSIAASKASLELDQIQGKRGIWFCESIISTECHL  418

Query  1624  -------------------------EDGL--KAGMIAAHGLLKKRCSPLNNPNHMVPSWP  1722
                                      ED    +AGM+AAHG+L K  S LN+  H+  S+ 
Sbjct  419   SICLQYFQAMTSMRTNLREMLLFTTEDHFFYQAGMVAAHGILGKHSSVLNSQRHLSLSFT  478

Query  1723  ETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQ  1902
             ETGARL+VT+F   +I  G +IL EEGG VFTF+G+ +K  LK +++VH+PQFYWK  T+
Sbjct  479   ETGARLVVTKFFQQYISMGCVILFEEGGGVFTFKGSMEKCSLKAVLKVHNPQFYWKTMTE  538

Query  1903  ADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIA  2082
             ADLGLADAYIHGD SF DK+EGLLNLF IF+ANR+  +S S  N KRGWW P LFT++I+
Sbjct  539   ADLGLADAYIHGDFSFEDKEEGLLNLFLIFIANRESDSSASGLNKKRGWWAPALFTASIS  598

Query  2083  SAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK-------SEDE  2241
             SAKYF++H+ RQNTL QARRNISRHYDL NELF LF+D TM YS A+FK       +E+E
Sbjct  599   SAKYFLKHVLRQNTLIQARRNISRHYDLRNELFELFMDVTMQYSSAIFKVKTPDSMAENE  658

Query  2242  DLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYA  2421
             DLK AQ+RKIS LIDKA+I K H ++E G GWG  AIE V+RTGCKYTG+TLSE+QLKYA
Sbjct  659   DLKVAQLRKISSLIDKARIEKGHEVIEFGSGWGYFAIEVVKRTGCKYTGVTLSEEQLKYA  718

Query  2422  EDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAEN  2601
             E KV+EAGLQDNI+FLLCDYRQLP  C+YDRIISCEM E VG+E++ EFF  CES+LA++
Sbjct  719   EAKVKEAGLQDNIKFLLCDYRQLPKTCKYDRIISCEMTEHVGNEYIEEFFRCCESILAKD  778

Query  2602  GILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIG  2781
             G+ VLQFIS+ +E + EY +S  F KEYIFPGGCL SL+R+ SAM A SRL VEH+E+IG
Sbjct  779   GLFVLQFISVTEELFHEYLRSPGFAKEYIFPGGCLLSLTRMLSAMGAGSRLSVEHVENIG  838

Query  2782  IHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRP  2961
              +Y QTLRCWR NFLE +S+IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRP
Sbjct  839   PNYVQTLRCWRKNFLENKSKILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRP  898

Query  2962  GNVTAFGDPYKGLASAY  3012
              N  A GDPY+G  SAY
Sbjct  899   SNFAALGDPYQGFPSAY  915



>ref|XP_008667917.1| PREDICTED: cyclopropane fatty acid synthase isoform X1 [Zea mays]
Length=807

 Score =  1138 bits (2944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/795 (68%), Positives = 652/795 (82%), Gaps = 8/795 (1%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLD---NGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             M+E FE LGV+MEISDMSFSVS +   +G   EWGSRNG SGL AQK N L+P FW+MIR
Sbjct  1     MLEWFEGLGVEMEISDMSFSVSTELGASGSRCEWGSRNGISGLLAQKSNALSPSFWRMIR  60

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EILKFKND L YLE+ +NNPDMDRN+TLG+FI+S GYS+ FQ+AY+ P+CA IWSC S+G
Sbjct  61    EILKFKNDALRYLEDHENNPDMDRNETLGQFIRSHGYSQFFQEAYLTPICACIWSCPSQG  120

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             V+ FSA+ +LSFCRNHHLLQLFGRPQWLTVK RSHSYV+KVREELE  GC+I+  CE+ S
Sbjct  121   VLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHSYVHKVREELESMGCQIKTSCEIKS  180

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VS+ E G    V +  G    +E YD  I   HAPD LK+LG +AT +ELRILGAFQYVY
Sbjct  181   VSSSEGGFR--VTVFDGS---EETYDRIIFGVHAPDALKILGAEATHEELRILGAFQYVY  235

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLH ++S MPR+L+AWS+WNFLGT +  VC+TYWLN LQN+  T +P+LVTLNPP  
Sbjct  236   SDIYLHSDKSLMPRSLSAWSSWNFLGTTSKGVCVTYWLNLLQNIESTSRPFLVTLNPPHV  295

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+   LKW T HPVPSVAA++AS EL  IQG R IWFCGAYQGYGFHEDGLKAG  AA  
Sbjct  296   PDHVFLKWYTSHPVPSVAAAKASLELHHIQGNRGIWFCGAYQGYGFHEDGLKAGKAAAQD  355

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL K    L NP  M+PSW E GARLLVTRFL  ++  G+++LLEEGGT+F+F    KK 
Sbjct  356   LLGKESDLLVNPKQMIPSWSEAGARLLVTRFLGQYVSVGNLVLLEEGGTMFSFGEVGKKC  415

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              +K ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDK+EGLLNLF I +ANRD + S 
Sbjct  416   HVKSVLRVHDPMFYWKVATEADLGLADAYINGYFSFVDKREGLLNLFLILIANRDANKSS  475

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S +  KRGWWTPLL T+ +ASAKYF+RHI+R+N+++Q R+NIS+HYDLSNE FSLFLD +
Sbjct  476   SSAAGKRGWWTPLLLTAGVASAKYFLRHIARRNSVSQTRQNISQHYDLSNEFFSLFLDPS  535

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FK+ED+ L+ AQ++K+ LLIDKAK+ ++HH+LEIGCGWGSLAI+ V++TGCKY
Sbjct  536   MTYSCAIFKTEDQSLEAAQLQKVCLLIDKAKVERDHHVLEIGCGWGSLAIQLVKQTGCKY  595

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLS +QLKYA+ KV+EAGL+D+I F+LCDYRQ+P   +YDRIISCEM+E VGHE+M+
Sbjct  596   TGITLSVEQLKYAQRKVKEAGLEDHISFMLCDYRQIPTQRKYDRIISCEMIEGVGHEYMD  655

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             +FFG CES+LA++GI VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A
Sbjct  656   DFFGCCESLLAQDGIFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSAMSA  715

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SRLC+EHLE+IG HYY TL  WR NF+  +  IL LGFD+KFIR WEYYF YCAAGF +
Sbjct  716   ASRLCIEHLENIGYHYYPTLIQWRDNFMANKDAILALGFDEKFIRIWEYYFIYCAAGFKS  775

Query  2923  CTLGDYQIVFSRPGN  2967
              TLG+YQIVFSRPGN
Sbjct  776   RTLGNYQIVFSRPGN  790



>ref|XP_010239672.1| PREDICTED: uncharacterized protein LOC100842201 isoform X2 [Brachypodium 
distachyon]
Length=821

 Score =  1136 bits (2939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 557/819 (68%), Positives = 662/819 (81%), Gaps = 10/819 (1%)
 Frame = +1

Query  565   VFNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLN  738
             +FN VTYPNM+E FE LGV+ME SDMS SVS  L  G   EWGSRNG SGL AQK N L 
Sbjct  9     IFN-VTYPNMLEWFEGLGVEMETSDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALR  67

Query  739   PYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCAS  918
             P FW MIREILKFK DVLSYL   +NNPD+DRN+TLGEFIK  GYS+LFQ+AY+IP+CA 
Sbjct  68    PGFWHMIREILKFKEDVLSYLSNHENNPDLDRNETLGEFIKMHGYSQLFQEAYLIPICAC  127

Query  919   IWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEI  1098
             IWSC S+GV+ FSA+ +LSFCRNHHLLQ+FGRPQWLT+K RSHSYVNKVREELE  GC I
Sbjct  128   IWSCPSQGVLGFSAFFVLSFCRNHHLLQIFGRPQWLTIKGRSHSYVNKVREELESMGCRI  187

Query  1099  RCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRI  1278
             +  C+V SVS+ E G    V+ + G    +E YD  I  AHAPD L+ML  +AT +ELRI
Sbjct  188   KTNCQVKSVSSFEGGHR--VLEVDGS---EEVYDKIIFGAHAPDALRMLRDEATHEELRI  242

Query  1279  LGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYL  1458
             LGAFQYVYSDIYLHR++S MPRN +AWSAWNFLGT ++ V +TYWLN LQN+    +P+L
Sbjct  243   LGAFQYVYSDIYLHRDKSLMPRNSSAWSAWNFLGTTSSGVSVTYWLNLLQNIESKGRPFL  302

Query  1459  VTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLK  1638
             VTLNPP  P+  LLKW T HPVPSVAA++AS EL +IQGKR IWFCGAYQGYGFHEDG K
Sbjct  303   VTLNPPHVPDHVLLKWNTSHPVPSVAAAKASLELNQIQGKRGIWFCGAYQGYGFHEDGSK  362

Query  1639  AGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFT  1818
             AG  AA GLL K+   L NP  MVPSW E GARLLVTRFL  +I  G++ +LE+GGT+F+
Sbjct  363   AGKSAAQGLLGKKIDLLLNPKQMVPSWTEAGARLLVTRFLNQYITIGNLTILEQGGTMFS  422

Query  1819  FEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVA  1998
             F   DKK L+K ++RVH P FYWKVAT+ADLGLADAY++G  SFVDK+EGLLNLF I +A
Sbjct  423   FGEVDKKCLVKSVLRVHDPLFYWKVATEADLGLADAYVNGYFSFVDKREGLLNLFLILIA  482

Query  1999  NRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNEL  2178
             NRD   S S + SKRGWWTPLL T+ IASAKYF+RH+SR+NT+TQ R+NIS+HYDLSN+ 
Sbjct  483   NRDTQKSSSSAASKRGWWTPLLLTAGIASAKYFLRHVSRKNTVTQTRQNISQHYDLSNDF  542

Query  2179  FSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEA  2358
             FSLFLD +MTYSCA+FK EDE L+ AQ+RK++LLIDKAK+ ++HH+LEIG GWG LA++ 
Sbjct  543   FSLFLDPSMTYSCAIFKVEDESLEVAQLRKVNLLIDKAKVERDHHVLEIGSGWGCLAMQV  602

Query  2359  VERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLE  2538
             V++TGCKYTGITLSE+QLKYA+ KV+EAGL+D I FLLCDYRQ+P   +YDRIISCEM+E
Sbjct  603   VKQTGCKYTGITLSEEQLKYAQMKVKEAGLEDRITFLLCDYRQIPILRKYDRIISCEMIE  662

Query  2539  AVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLS  2718
              VGHEFM++FFG CES+LA++G+LVLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+
Sbjct  663   GVGHEFMDDFFGCCESLLAQDGLLVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLA  722

Query  2719  RVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFD  2898
             R+TSAM+A+SRLC+E +E+IG HYY TL  WR NF   +  I  LGFD KFIR WEYYF 
Sbjct  723   RITSAMSAASRLCIEQVENIGYHYYPTLVRWRDNFFANKYAISALGFDDKFIRIWEYYFM  782

Query  2899  YCAAGFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  3009
             YCAAGF + TLG+YQIVFSRPGN   A+ D PY  L +A
Sbjct  783   YCAAGFKSRTLGNYQIVFSRPGNDKLAYADNPYASLPAA  821



>ref|XP_009586644.1| PREDICTED: uncharacterized protein LOC104084479 isoform X5 [Nicotiana 
tomentosiformis]
 ref|XP_009586645.1| PREDICTED: uncharacterized protein LOC104084479 isoform X5 [Nicotiana 
tomentosiformis]
Length=747

 Score =  1136 bits (2939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/752 (73%), Positives = 635/752 (84%), Gaps = 6/752 (1%)
 Frame = +1

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MIREI+KFK DV+SYLE  DNNPD+D ++TL +FIKS G SELF KAY+IP+C+SIWSC 
Sbjct  1     MIREIIKFKQDVISYLEALDNNPDIDCDETLWQFIKSNGCSELFLKAYLIPICSSIWSCP  60

Query  934   SEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCE  1113
              EGVM FSAYSILS  R+HHLLQLFG  Q LTV+  SH+ VNKV+EELEKRGC+IR  CE
Sbjct  61    LEGVMGFSAYSILSVFRDHHLLQLFGLSQLLTVRWGSHTSVNKVKEELEKRGCQIRTDCE  120

Query  1114  VHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQ  1293
             V+SVSTD +G       I+  +  +E YDGCIMAAHAPDTL+MLGK+AT DE RILGAFQ
Sbjct  121   VNSVSTDGEGCT-----IACNDGAKEVYDGCIMAAHAPDTLRMLGKEATCDETRILGAFQ  175

Query  1294  YVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNP  1473
             Y YSDI+LHR+++F+PR+ AAWSA NFLGT  NR  +TYWLN +QNLGD+K PYLVT++P
Sbjct  176   YSYSDIFLHRDKTFLPRDPAAWSALNFLGTTKNRGRMTYWLNVIQNLGDSKLPYLVTVDP  235

Query  1474  PRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIA  1653
             P TPE  LLKWTTGH VPSVAAS+AS EL++IQGKR IWFCGAYQGYGFHEDGLK G+ A
Sbjct  236   PHTPEHILLKWTTGHLVPSVAASKASRELDQIQGKRGIWFCGAYQGYGFHEDGLKVGVAA  295

Query  1654  AHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTD  1833
             A G+L++ CS L+N  HMVP+WPETGARL+VTRF  SFI TG IIL E GGTVFTF+GT+
Sbjct  296   ADGVLRRNCSILDNSKHMVPTWPETGARLVVTRFFRSFIKTGCIILFE-GGTVFTFQGTE  354

Query  1834  KKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLS  2013
             +K  LKV +R+H PQFYWK AT+A++GLADA+IHGD SFVDK EGLLNL  IFVAN DL 
Sbjct  355   RKCSLKVSLRIHGPQFYWKTATEAEIGLADAFIHGDFSFVDKNEGLLNLIMIFVANSDLK  414

Query  2014  ASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2193
             ASV+ S+ KRGWWTP LFT+A+ SAKYFI+H+  QNTLTQARRNISRHYDLSNELFSLFL
Sbjct  415   ASVTSSSKKRGWWTPFLFTAALPSAKYFIQHVLNQNTLTQARRNISRHYDLSNELFSLFL  474

Query  2194  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2373
             D TMTYSCA+FKSEDEDLK AQ+RKIS+LI KAKISKEHHILEIG GWGS A+E V++TG
Sbjct  475   DGTMTYSCAIFKSEDEDLKDAQLRKISVLIRKAKISKEHHILEIGFGWGSFAVEVVKQTG  534

Query  2374  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHE  2553
             CKYTGITLSEQQL+YA+  V +AGLQD I FLLCDYRQ+P+  +Y RIIS EM+E VGHE
Sbjct  535   CKYTGITLSEQQLEYAQLIVEQAGLQDRITFLLCDYRQMPNKDKYHRIISIEMIEHVGHE  594

Query  2554  FMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSA  2733
             FM+EFF  CES LAE+G+LV+QF S+PDERYDEYR S  FIKEYIFPGGCLPSL+RVTSA
Sbjct  595   FMDEFFTCCESALAEDGLLVVQFTSVPDERYDEYRHSIGFIKEYIFPGGCLPSLNRVTSA  654

Query  2734  MAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAG  2913
             MA++SRLCV HLE+IGIHYYQTLRCWR NFL+ QSQI  LGFD KFIRTWEYYFDYCAAG
Sbjct  655   MASASRLCVNHLEEIGIHYYQTLRCWRDNFLKNQSQIRVLGFDDKFIRTWEYYFDYCAAG  714

Query  2914  FHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             F T  +G+YQIVFSRPGN+ AFGDPY  + SA
Sbjct  715   FKTRAIGNYQIVFSRPGNIAAFGDPYSAVPSA  746



>ref|XP_008460675.1| PREDICTED: uncharacterized protein LOC103499444 isoform X2 [Cucumis 
melo]
Length=740

 Score =  1135 bits (2936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/739 (73%), Positives = 631/739 (85%), Gaps = 5/739 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1     MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGV+ME SDMSFSVSLD G G EWGSRNG S LFAQKKNLLNPYFWQMIR
Sbjct  61    YPNMMEFFENLGVEMETSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNLLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV++YLE  +NN D+DRN+TLG+FIKSRGYSELFQ AY+IPMC SIWSC SEG
Sbjct  121   EIVKFKDDVINYLEVIENNSDIDRNETLGQFIKSRGYSELFQNAYLIPMCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             V++FSA+S+LSFCRNHHLLQLFGRPQWLTVK RSHSYV KV+E LE  GC+IR   EV+S
Sbjct  181   VLSFSAFSVLSFCRNHHLLQLFGRPQWLTVKGRSHSYVKKVQEVLESHGCQIRTSSEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             +ST ++G       +S  + +QE +D CI+A HAPDTL+MLG QAT +ELR+LGAFQY Y
Sbjct  241   ISTMDKGCK-----VSYGDDLQEIFDACIIATHAPDTLRMLGNQATSEELRVLGAFQYAY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MP+N AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLNP + 
Sbjct  296   SDIFLHRDKNLMPQNPAAWSAWNFLGNTDKKVCLTYWLNILQNLGETGPPFLVTLNPDKE  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+TGHP+PSVAAS+AS+E   IQG RRIWFCGAYQGYGFHEDGLKAG++AA  
Sbjct  356   PKNILLKWSTGHPIPSVAASKASNEFHSIQGNRRIWFCGAYQGYGFHEDGLKAGIVAAQN  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL    + L+NP HM PS  +TGARL VTRFL  +I +GS+ L+E+GGT+FTFEGTDKK 
Sbjct  416   LLGNSFTLLSNPKHMAPSLVDTGARLFVTRFLGQYITSGSLTLIEDGGTIFTFEGTDKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
             L KV V+VHSPQFYWK+ T+ADLGLADAYI+GD SFVDK EGLLN F I +A+RD ++S+
Sbjct  476   LPKVAVKVHSPQFYWKIMTRADLGLADAYINGDFSFVDKDEGLLNFFLIIIASRDTNSSI  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             ++   KRGWWTP LFT+ IASAKYF +H SRQNTLTQARRNISRHYDLSNELFSLFLD+T
Sbjct  536   AKQKKKRGWWTPPLFTACIASAKYFFQHASRQNTLTQARRNISRHYDLSNELFSLFLDDT  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FK E+EDLK AQMRKISLLI+KA+I+K HH+LEIGCGWGSLAIE V++TGC Y
Sbjct  596   MTYSCAIFKGENEDLKVAQMRKISLLIEKARINKNHHVLEIGCGWGSLAIEIVKKTGCHY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYAE +V++A LQD IRFLLCDYR+LP   RYDRIISCEM+EAVGHEFM 
Sbjct  656   TGITLSEEQLKYAEKRVKDANLQDRIRFLLCDYRKLPSTERYDRIISCEMIEAVGHEFME  715

Query  2563  EFFGRCESVLAENGILVLQ  2619
             +FFG CESVLAENG+ VLQ
Sbjct  716   DFFGSCESVLAENGLFVLQ  734



>ref|XP_007035214.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
 gb|EOY06140.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
Length=924

 Score =  1135 bits (2936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/877 (63%), Positives = 682/877 (78%), Gaps = 9/877 (1%)
 Frame = +1

Query  379   RRKKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLG  558
             R++ E  +MRVAV+G GI GLVSAYVLAK G  VVVYEK    GGHA+TV    +DLDL 
Sbjct  55    RQQTEYYRMRVAVIGGGIRGLVSAYVLAKAGVNVVVYEKGKQFGGHARTVNFHAIDLDLA  114

Query  559   FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLN  738
             FM  N   +PN+++ F  LGVD+E SD+SFSVSLDNG GYEWG++ GFS LFAQKKN+ N
Sbjct  115   FMFLNPAKHPNVLDFFTGLGVDVETSDVSFSVSLDNGQGYEWGNQKGFSSLFAQKKNVFN  174

Query  739   PYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCAS  918
             PYFWQM+REI++FK+DV+SYL+E +NNPD  RN+T+G+FI+SRGYSELF+KAY++P+C S
Sbjct  175   PYFWQMLREIIRFKDDVVSYLQELENNPDTGRNETMGQFIESRGYSELFRKAYLVPICCS  234

Query  919   IWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEI  1098
             +WSCS+E VM+FSA+S LSFC  H+L ++ GR QWLTV+  S    NKV++ LE RGC++
Sbjct  235   VWSCSAEEVMSFSAFSTLSFCHTHYLYEILGRQQWLTVRGFS-KLENKVKDLLESRGCQL  293

Query  1099  RCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRI  1278
               GCEVHSV T + G     ++ SG +  QE YDGC+MA  AP  L++LG QATFDE RI
Sbjct  294   SIGCEVHSVLTADDGR---TIVCSGDDF-QEVYDGCMMAVDAPTALRLLGNQATFDESRI  349

Query  1279  LGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYL  1458
             LGAF+Y YSDI+LH + + MP N AAWS+ NFL +  N+ CLTYWLN LQN+G T  P+L
Sbjct  350   LGAFRYAYSDIFLHHDDNLMPNNRAAWSSLNFLRSAENKGCLTYWLNMLQNVGKTTLPFL  409

Query  1459  VTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLK  1638
             +TLNP  TP+  LLKW+T   +PSVAAS+AS ELE IQGKR IWFCG    Y FH D ++
Sbjct  410   LTLNPDSTPKHTLLKWSTSRLIPSVAASKASLELEEIQGKRGIWFCG----YDFHGDAVE  465

Query  1639  AGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFT  1818
             AG+IA +G+L KR S LN P +M PS  E GARL VTRFL  FI TG IILLEEGG VFT
Sbjct  466   AGLIATYGILGKRNSVLNKPENMAPSLLERGARLFVTRFLRQFISTGCIILLEEGGGVFT  525

Query  1819  FEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVA  1998
             F+G   K  LK ++RVHSPQFYWKV T+ADLGLADA+++ D SFVDK++GLL+L  I +A
Sbjct  526   FKGNMNKCSLKTVLRVHSPQFYWKVMTEADLGLADAFMNRDFSFVDKEDGLLHLLTILIA  585

Query  1999  NRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNEL  2178
             NR+   SVSR   KRGWWTP LFT+ +A AKYF +H+ RQN L QARRNIS+HYD SN+ 
Sbjct  586   NRNFEHSVSRLKKKRGWWTPPLFTAGLAYAKYFFKHVMRQNNLMQARRNISQHYDQSNDF  645

Query  2179  FSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEA  2358
             FSLFLDETMTYSCAVFK EDEDLK AQ RKIS+LI+KAKI+ +H ILEIG GWGSLAIE 
Sbjct  646   FSLFLDETMTYSCAVFKKEDEDLKVAQKRKISVLIEKAKINSKHEILEIGFGWGSLAIEV  705

Query  2359  VERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLE  2538
             V+ TGC+YTGITLSE+QLK++E KV+EAGLQD+I+F LCDYR+LP + + DRIISCEM+E
Sbjct  706   VKLTGCRYTGITLSEEQLKFSEKKVKEAGLQDHIKFELCDYRKLPSSYKCDRIISCEMIE  765

Query  2539  AVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLS  2718
              VG E++ EFFG CE VL E+G+LVLQF S  DE Y +YR +SDF+KEYIFPG C PSL 
Sbjct  766   HVGDEYLEEFFGWCEKVLTEDGLLVLQFSSTSDEGYHDYRHTSDFLKEYIFPGICPPSLG  825

Query  2719  RVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFD  2898
             R++SAMAA++RLCVEH+E+IG  Y++T+R W+   L+ +S+I+ LGF+++FIR WEYY D
Sbjct  826   RISSAMAATTRLCVEHVENIGSQYHRTVRFWKNKLLDNKSKIVALGFNEEFIRMWEYYLD  885

Query  2899  YCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             Y AAG ++ T  +YQ+VFSR G   A G+P KG +SA
Sbjct  886   YVAAGMNSRTHLNYQVVFSRHGYPAAPGNPDKGFSSA  922



>emb|CDY09021.1| BnaC01g30700D [Brassica napus]
Length=804

 Score =  1135 bits (2935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/821 (67%), Positives = 650/821 (79%), Gaps = 34/821 (4%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             M+E F++LGVDME+SDMSFSVSLD+G G EWG R+  S LFAQK+N+ +PYFW+MI EI 
Sbjct  1     MIEFFKNLGVDMEVSDMSFSVSLDSGRGCEWGCRS-LSSLFAQKRNIFSPYFWKMITEIK  59

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK DVL YLE+ + N DMDR  TLG F+KSRGYS+LFQKAY++P+C+ IWSC ++ V+ 
Sbjct  60    KFKEDVLKYLEDRERNLDMDRTKTLGGFLKSRGYSDLFQKAYLVPVCSLIWSCPADSVLN  119

Query  952   FSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1131
             FSAYS+LSFCRNHHLLQ+FGRPQWLTV  RS +YV KVR ELE+RGC+IR  C+V SV+T
Sbjct  120   FSAYSVLSFCRNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELEQRGCKIRTSCKVESVAT  179

Query  1132  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1311
              E G     VI++ +   QE YD CI+A HAPD LK+LG+Q +               D+
Sbjct  180   SEDG----CVIVTTEEGSQEVYDKCILAVHAPDALKLLGEQGS--------------RDL  221

Query  1312  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1491
             YLH +   MPRN +AWSAWNFLG   N+  LTYWLN +QNLG+ + P+ +T+NP  TP++
Sbjct  222   YLHGDTDLMPRNTSAWSAWNFLGDSENKASLTYWLNIIQNLGEERDPFFLTINPEHTPKE  281

Query  1492  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKA---------G  1644
                KWTTGHP+PSV+  +AS EL  IQGKR IWFCGAYQGYGFHEDGLKA         G
Sbjct  282   TFFKWTTGHPLPSVSTWKASQELHNIQGKRGIWFCGAYQGYGFHEDGLKALLSYIINTAG  341

Query  1645  MIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1821
             M AA GLL K+  +PL+NP HMVPS  E GAR   TRFL +FI TG + +LEEGG+V+TF
Sbjct  342   MAAAQGLLGKQMVTPLSNPKHMVPSLTEKGARFFFTRFLRNFISTGCVTILEEGGSVYTF  401

Query  1822  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2001
                + +  LK ++ +HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLL+L  I +AN
Sbjct  402   ASKNSRCQLKSVLVIHSPQFYWKVMTQADLGLADAYINGDFSFVDKERGLLDLLMILIAN  461

Query  2002  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2181
             ++L+++ S    +RGWWTP+  T+++ASAK+F++H+SRQNTLTQARRNISRHYDLSNELF
Sbjct  462   KELNSNNSNHAKRRGWWTPMFLTASLASAKHFLKHVSRQNTLTQARRNISRHYDLSNELF  521

Query  2182  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDK-----AKISKEHHILEIGCGWGSL  2346
             +LFLD+TMTYS AVFKS DEDL+TAQMRKISLLIDK     A+I K H +LEIGCGWG+L
Sbjct  522   ALFLDDTMTYSSAVFKSNDEDLRTAQMRKISLLIDKSGKFQARIEKNHEVLEIGCGWGTL  581

Query  2347  AIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISC  2526
             AIE V RTGCKYTG+TLS +QLKYAE KV+EAGL+D I+F L DYRQL D  +YDRIISC
Sbjct  582   AIEVVRRTGCKYTGVTLSIEQLKYAEQKVKEAGLEDRIKFELYDYRQLSDAHKYDRIISC  641

Query  2527  EMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCL  2706
             EMLEAVGHEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCL
Sbjct  642   EMLEAVGHEFMETFFTHCEAALAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCL  701

Query  2707  PSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWE  2886
             PSL RVTSAMA+SSRLCVE++E+IGIHYYQTLRCWR NFLERQ QI+DLGFD KFIRTWE
Sbjct  702   PSLGRVTSAMASSSRLCVENVENIGIHYYQTLRCWRKNFLERQKQIIDLGFDDKFIRTWE  761

Query  2887  YYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             YYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP+    SA
Sbjct  762   YYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFHCFPSA  802



>gb|KDO54097.1| hypothetical protein CISIN_1g0029283mg, partial [Citrus sinensis]
Length=748

 Score =  1134 bits (2934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/753 (73%), Positives = 641/753 (85%), Gaps = 5/753 (1%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNMME FESLGVDMEISDMSFSVSLD G G EW SRNG SGLFAQKKNLLNPYFWQM
Sbjct  1     VTYPNMMEFFESLGVDMEISDMSFSVSLDKGQGCEWSSRNGMSGLFAQKKNLLNPYFWQM  60

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             +REI+KF +DVLSYLE+ +NN D+DRN+TLG+F+++RGYSELFQKAY++P+C SIWSCSS
Sbjct  61    LREIIKFNDDVLSYLEDLENNADIDRNETLGQFVETRGYSELFQKAYLVPVCGSIWSCSS  120

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             E VM+ SA+S+LSFCRNHH LQ+FGRPQWLTV+ RS SYV+KV E LE  GC+I+ GCEV
Sbjct  121   EKVMSCSAFSVLSFCRNHHALQIFGRPQWLTVRSRSRSYVDKVIELLESLGCQIKTGCEV  180

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
              SV    +G     + I G +  Q  YDGCIMA HAPD L+MLG QATF+E R+LGAFQY
Sbjct  181   RSVLQYGEGR----IEIRGDDF-QRVYDGCIMAVHAPDALRMLGNQATFEEKRVLGAFQY  235

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
             VYSDI+LHR+++FMPRN AAWSAWNFLG+   +VCLTYWLN +QN+ +T+ P+LVTLNP 
Sbjct  236   VYSDIFLHRDKNFMPRNPAAWSAWNFLGSTGGKVCLTYWLNVVQNIEETRLPFLVTLNPD  295

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
              TPE  L KW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGMIAA
Sbjct  296   HTPEHTLFKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMIAA  355

Query  1657  HGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1836
             HG+L K C+ L NP HM PS  E GAR+ V RFL  FI TG +I LEEGGT+FTFEG  K
Sbjct  356   HGMLGKSCAILANPKHMEPSLMEKGARIFVARFLRQFISTGCLIFLEEGGTIFTFEGAQK  415

Query  1837  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2016
                LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK EGLLNLF I +AN+DL +
Sbjct  416   NCPLKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKDEGLLNLFLIVLANQDLDS  475

Query  2017  SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLD  2196
             S S+   KRGWW+P+ FT++IASAKYF RHISR+NTLTQARRNISRHYDLSNELFSLFLD
Sbjct  476   STSKLKQKRGWWSPMFFTASIASAKYFFRHISRKNTLTQARRNISRHYDLSNELFSLFLD  535

Query  2197  ETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGC  2376
             ++M YSCA+FKSE EDL+ AQMRK+SLLI KA++SK H +LEIGCGWG+LAIE V++TGC
Sbjct  536   KSMLYSCAIFKSEHEDLEVAQMRKVSLLIQKARVSKGHEVLEIGCGWGTLAIEIVKQTGC  595

Query  2377  KYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEF  2556
             KYTGITLSE+QLKYAE KV+EAGLQD+IR  LCDYRQLP + +YDRIISCEM+EAVGH++
Sbjct  596   KYTGITLSEEQLKYAEMKVKEAGLQDHIRLYLCDYRQLPKSNKYDRIISCEMIEAVGHDY  655

Query  2557  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2736
             M EFFG CES+LAE+G+L+LQFIS+PD+ YDE+R S  FIKEYIFPGGCLPSL+R+TSAM
Sbjct  656   MEEFFGCCESLLAEHGLLLLQFISVPDQCYDEHRLSPGFIKEYIFPGGCLPSLNRITSAM  715

Query  2737  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQ  2835
              +SSRLCVE LE+IGIHYYQTLRCWR NFLE+Q
Sbjct  716   TSSSRLCVEDLENIGIHYYQTLRCWRKNFLEKQ  748



>gb|EMT03310.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=829

 Score =  1134 bits (2933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/826 (67%), Positives = 664/826 (80%), Gaps = 19/826 (2%)
 Frame = +1

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  747
             +VTYPNM+E FE LGV+MEISDMS SVS  L  G   EWGSRNG SGL AQK N L P F
Sbjct  9     QVTYPNMLEWFEELGVEMEISDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALRPAF  68

Query  748   WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWS  927
             W MIREILKFK D L YLE+ ++NPD++R++TLG+FI++ GYS+LFQ+AY+IP+CASIWS
Sbjct  69    WHMIREILKFKEDALKYLEDHESNPDLNRHETLGQFIQTHGYSQLFQEAYLIPICASIWS  128

Query  928   CSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCG  1107
             C S+GV+ FSA+ +LSFCRNHHLLQ+FGRPQWLTVK RSH+YVNKVREELE  GC+I+  
Sbjct  129   CPSQGVLGFSAFFVLSFCRNHHLLQIFGRPQWLTVKGRSHTYVNKVREELESMGCQIKTS  188

Query  1108  CEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGA  1287
             C+V SVS+ E G    V+ + G    +E YD  I  AHAPD L+MLG +AT +ELRILGA
Sbjct  189   CQVKSVSSVEGGYK--VLEVGGS---EEVYDKIIFGAHAPDVLRMLGDEATHEELRILGA  243

Query  1288  FQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTL  1467
             FQYV+SDIYLHR+ + MP+N +AWSAWNFLGT ++ V +TYWLN LQN+  T +P+LVTL
Sbjct  244   FQYVHSDIYLHRDDTLMPQNPSAWSAWNFLGTTSSGVSVTYWLNLLQNIESTGKPFLVTL  303

Query  1468  NPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGM  1647
             NPP  P+  +LKW TGHPVPSVAA++AS EL++IQG R IWFCGAYQGYGFHEDGLKAG 
Sbjct  304   NPPHVPDHVVLKWNTGHPVPSVAAAKASLELQQIQGNRGIWFCGAYQGYGFHEDGLKAGK  363

Query  1648  IAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEG  1827
              AA  LL ++ S L NP  MVPSW ETGARLLVTRFL  ++  G++ +LEEGGT+F+F  
Sbjct  364   SAAQSLLGQKSSLLLNPKQMVPSWTETGARLLVTRFLNQYVTIGNMTILEEGGTMFSFGE  423

Query  1828  TDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD  2007
              DKK L+K ++RVH P FYWKVAT+ADLG+ADAYI+G  SFVDK+EGLLNLF I +ANRD
Sbjct  424   VDKKCLVKTVLRVHDPLFYWKVATEADLGMADAYINGYFSFVDKREGLLNLFLILIANRD  483

Query  2008  LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSL  2187
                S S + SKRGWWTP+L T+ IASAKYF+RHISR+NT+TQ RRNIS+HYDLSN+ FS+
Sbjct  484   AQKSSSSAASKRGWWTPMLLTAGIASAKYFLRHISRKNTVTQTRRNISQHYDLSNDFFSI  543

Query  2188  FLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVER  2367
             FLD +MTYSCAVFK EDE L+ AQ RK++LLI KAK+ + HH+LEIG GWGSLA+E V++
Sbjct  544   FLDPSMTYSCAVFKVEDESLEVAQQRKVNLLIKKAKVERNHHVLEIGSGWGSLAMEVVKQ  603

Query  2368  TGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIIS--------  2523
             TGCKYTGITLSE+QLKYA+ KV+EAGL+D I FLLCDYRQ+P  C+YDRIIS        
Sbjct  604   TGCKYTGITLSEEQLKYAQMKVKEAGLEDRITFLLCDYRQIPSRCKYDRIISWKYLPLVD  663

Query  2524  --CEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPG  2697
                EM+E VGHEFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPG
Sbjct  664   THSEMIEGVGHEFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPG  723

Query  2698  GCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIR  2877
             GCLPSL+R+TSAM+ +SRLC+E +E+IG HYY TL  WR NF+  +  IL LGFD KFIR
Sbjct  724   GCLPSLARITSAMSTASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAILALGFDDKFIR  783

Query  2878  TWEYYFDYCAAGFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  3009
              WEYYF YCAAGF + TLG YQIVFSRPGN   A+ D PY  L +A
Sbjct  784   VWEYYFIYCAAGFKSRTLGTYQIVFSRPGNDKLAYADNPYASLPAA  829



>ref|XP_011091266.1| PREDICTED: uncharacterized protein LOC105171752 isoform X2 [Sesamum 
indicum]
Length=813

 Score =  1125 bits (2911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/811 (66%), Positives = 660/811 (81%), Gaps = 8/811 (1%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             V YP+ MELFE+LGVD E+SD+SFSVSLD G G EWG+RNG S LFAQKKN+LNPYFW M
Sbjct  8     VIYPDTMELFENLGVDRELSDLSFSVSLDEGQGCEWGTRNGLSSLFAQKKNVLNPYFWNM  67

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IREI+KFK D  +Y+EE +NNPD+DRN+TL ++I+SRGYSELFQKA++IP CASIWSCSS
Sbjct  68    IREIIKFKGDASAYVEELENNPDIDRNETLEDYIRSRGYSELFQKAFLIPTCASIWSCSS  127

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
              G+M+FSAYS+LS   N   LQL GRP  LT +  S SYV++V++ELE RGC IR   EV
Sbjct  128   -GMMSFSAYSVLSLLHNDPALQLIGRPHRLTPRWCSQSYVDRVKKELESRGCHIRTNSEV  186

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
             +S+ T+++G A     I  K+ ++E YDGCI+A +APD LK+LGKQAT+DE RILGAFQY
Sbjct  187   YSILTNDEGCA-----IISKDGLEEVYDGCIIAVNAPDALKVLGKQATYDESRILGAFQY  241

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
              YSD++LH + + MP+N A WS+ NF GT+ N+  +TYWLN LQN+G+T  P+ +TLNPP
Sbjct  242   AYSDLFLHHDNNLMPKNPAVWSSRNFRGTIKNKAYITYWLNNLQNVGET-VPFFLTLNPP  300

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
             +TP+  L KW+T  P+PSVAAS+A  +L  IQGKRR+WFCGAYQGYGF EDG+KAG++AA
Sbjct  301   KTPKLTLFKWSTSQPIPSVAASKALHQLNVIQGKRRMWFCGAYQGYGFPEDGVKAGIVAA  360

Query  1657  HGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1836
             +GLL+K  +   +  H+VPS  E+GARLLVTRFL  FI TG +ILLEEGGT+FTFEGT K
Sbjct  361   NGLLRKSYTVQKHSKHLVPSSLESGARLLVTRFLERFITTGCLILLEEGGTIFTFEGTRK  420

Query  1837  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2016
             K+ LKV +RVH+P FYWKVAT+ADLG ADAYI GD SF+DK EGLLN F+IF+AN + + 
Sbjct  421   KSTLKVTLRVHNPAFYWKVATKADLGFADAYIDGDFSFIDKNEGLLNFFQIFIANAEFNT  480

Query  2017  SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLD  2196
              +S+   KRGWWTPLL+TS IASAK F++H+ RQNT+ QARRNIS HYDLSNELFSLF+D
Sbjct  481   YISKLGKKRGWWTPLLYTSMIASAKSFLKHVLRQNTIDQARRNISDHYDLSNELFSLFMD  540

Query  2197  ETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGC  2376
             ETM+YSCA+F++ +EDLK AQ+RKI  LI+KA+ISKEHH+LEIGCGWG LAIE V+RTGC
Sbjct  541   ETMSYSCAIFRTPNEDLKNAQLRKIHTLIEKARISKEHHVLEIGCGWGGLAIEVVKRTGC  600

Query  2377  KYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEF  2556
             +YTGITLS++QL+Y E KV+EAGLQD +  LLCDYRQLP NC+YDRIISCEM+EAVGHE+
Sbjct  601   RYTGITLSQEQLQYTESKVKEAGLQDQVELLLCDYRQLPKNCKYDRIISCEMIEAVGHEY  660

Query  2557  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2736
             + EFF  CES L ENGILVLQFI+I DE+YDE+  S+ FIKEYIFPG  L SLSR+TSAM
Sbjct  661   IEEFFRCCESALTENGILVLQFIAIADEKYDEFTHSAGFIKEYIFPGSWLASLSRLTSAM  720

Query  2737  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2916
             AA+SRL V HLE+ G+HY+QTL CWR N L  QS+IL+LGFD+KF+RTW YYFDYCAAG 
Sbjct  721   AAASRLSVVHLEERGLHYFQTLECWRENLLRNQSKILELGFDEKFMRTWIYYFDYCAAGL  780

Query  2917  HTCTLGDYQIVFSRPGNVTAFGD-PYKGLAS  3006
                 +G YQ+VF+RPG++ AFG+ PY  + +
Sbjct  781   KYGVVGSYQVVFTRPGDIAAFGNKPYNPVPA  811



>ref|XP_006606355.1| PREDICTED: uncharacterized protein LOC100815937 isoform X2 [Glycine 
max]
Length=741

 Score =  1120 bits (2896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/744 (73%), Positives = 631/744 (85%), Gaps = 4/744 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG+GISGL SAY+LAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNRVT
Sbjct  1     MRVAVVGSGISGLASAYLLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDVDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM++ FE+LGVDME SDMSFSVSLD G G EWGSRNG S LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMLDFFENLGVDMESSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV+SYL+  +NNPD+DRN+ LGEFIKSRGYSELFQKAY+IP+C SIWSCSSEG
Sbjct  121   EIVKFKDDVISYLDMLENNPDIDRNEPLGEFIKSRGYSELFQKAYLIPICGSIWSCSSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RS +YVNKV++ELE+ G +I    EVH 
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSQTYVNKVKQELEREGSQIITNREVHL  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST  +       ++   +  QE YDGCIMA HAPD L++LG +AT+DE RILGAFQY Y
Sbjct  241   VSTTSEKGC----VVYCNDGSQEMYDGCIMAVHAPDALRLLGDEATYDERRILGAFQYAY  296

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MP+N AAWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   
Sbjct  297   SDIFLHRDKNLMPQNPAAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHI  356

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAYQGYGFHEDG KAGMIAAHG
Sbjct  357   PENTLLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYQGYGFHEDGFKAGMIAAHG  416

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L   C+   NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K  
Sbjct  417   ILGSCCALQTNPKHMVPSWKELGARIFVTRFLSCYITTGCLMLLEEGGTMFTFEGTGKNC  476

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK ++RVH PQFYWKV TQADLGLADAYI+GD SFVDK EGLLNL  I +ANRD +AS 
Sbjct  477   GLKSVLRVHDPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNLILILIANRDSNASN  536

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+    RGWWTP+ FTSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSN+LF+ FLDET
Sbjct  537   SKLKKNRGWWTPVFFTSALTSAKFFMDHVSRRNTLTQARRNISRHYDLSNDLFATFLDET  596

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKY
Sbjct  597   MTYSCAVFKNKDEDLKDAQKRKISLLIEKARIDKTHEILEIGCGWGSLAIEVVKQTGCKY  656

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK AE +V++AGLQD I F+LCDYRQLP   +YDRIISCEM+EAVGHE+M 
Sbjct  657   TGITLSEEQLKLAEQRVKDAGLQDRINFVLCDYRQLPKTYKYDRIISCEMIEAVGHEYME  716

Query  2563  EFFGRCESVLAENGILVLQFISIP  2634
             EFFG CESVLA+NG+LVLQ ++ P
Sbjct  717   EFFGCCESVLADNGLLVLQEVAYP  740



>gb|AAM33848.1|AF470622_1 cyclopropane synthase [Sterculia foetida]
Length=864

 Score =  1119 bits (2894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/871 (63%), Positives = 670/871 (77%), Gaps = 13/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M VAV+G GI GLVSAYVLAK G  VVVYEKE+ +GGHAKTV+ D VDLDLG +  N   
Sbjct  1     MGVAVIGGGIQGLVSAYVLAKAGVNVVVYEKEEQVGGHAKTVSFDAVDLDLGLLFLNPAR  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YP M+ELF+SL VD+E +D+SFSVS D G+GYEW S+ GFS   A KK +LNPY WQ +R
Sbjct  61    YPTMLELFDSLEVDVEATDVSFSVSHDKGNGYEWCSQYGFSNFLAHKKKMLNPYNWQDLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E +KF NDV SYLE  + NPD+DRN+TLG F+ S+GYSE F   Y+ P+C S+WSCS E 
Sbjct  121   ETIKFGNDVNSYLESLEKNPDIDRNETLGHFVGSKGYSENFLNTYLAPICGSMWSCSKEE  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSY-VNKVREELEKRGCEIRCGCEVH  1119
             VM+FSAYSILSFCR +HL QLFG PQWLT+KR  HSY V KVR+ LE RGC+ + GCEV 
Sbjct  181   VMSFSAYSILSFCRTYHLYQLFGNPQWLTIKR--HSYLVKKVRDILESRGCQFKLGCEVL  238

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV   + GS+    I+ G    QE Y+GCIMA +AP  LK+LG QATF+E+R+LGAFQY 
Sbjct  239   SVLPADDGSS----IVFGDGF-QETYNGCIMAVNAPTALKILGNQATFEEMRVLGAFQYA  293

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
              SDIYLHR+ + MP N + WSA NFL +  N+  LTYWLN LQN+G T QP+ VTLNP R
Sbjct  294   SSDIYLHRDSNLMPTNRSGWSALNFLRSRENKASLTYWLNVLQNVGKTSQPFFVTLNPDR  353

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
              P++ LLKW+TG P+PSVAAS+AS EL++IQGKR IWFCG    Y FHED LKAGM AAH
Sbjct  354   IPDKILLKWSTGRPIPSVAASKASLELDQIQGKRGIWFCG----YDFHEDELKAGMDAAH  409

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
              +L K  S L++P  M PS+ ET ARLLVT+F   +I  G +I++EEGG V+TF+G+ + 
Sbjct  410   RILGKHFSVLHSPRQMSPSFMETTARLLVTKFFHQYIQVGCVIIIEEGGRVYTFKGSMEN  469

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK  ++VH+PQFYW++  +AD+GLADAYI GD SFVDK +GLLNLF+I +AN++L+ S
Sbjct  470   CSLKTALKVHNPQFYWRIMKEADIGLADAYIQGDFSFVDKDDGLLNLFRILIANKELN-S  528

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S  N +R W +P LFT+ I+SAKYF++H  RQNT+TQARRNISRHYDLSNELF+L+L E
Sbjct  529   ASGQNKRRTWLSPALFTAGISSAKYFLKHYMRQNTVTQARRNISRHYDLSNELFTLYLGE  588

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
              M YS  +FK+ +E L  AQ RKIS LIDK++I K H +L+IGCGWGSLA+E V+RTGCK
Sbjct  589   MMQYSSGIFKTGEEHLDVAQRRKISSLIDKSRIEKWHEVLDIGCGWGSLAMEVVKRTGCK  648

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSEQQLKYAE+KV+EAGLQ NI+FLLCDYRQLP   +YDRIIS EM+E VG E++
Sbjct  649   YTGITLSEQQLKYAEEKVKEAGLQGNIKFLLCDYRQLPKTFKYDRIISVEMVEHVGEEYI  708

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EFF  C+S+LAENG+ VLQFISIP+    E +Q++ F+KEYIFPGG L SL R  SAMA
Sbjct  709   EEFFRCCDSLLAENGLFVLQFISIPEILSKEIQQTAGFLKEYIFPGGTLLSLDRTLSAMA  768

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             A+SR  VEH+E+IGI YY TLR WR NFL  +S++L LGFD+KF+RTWEYYFDYCAAGF 
Sbjct  769   AASRFSVEHVENIGISYYHTLRWWRKNFLANESKVLALGFDEKFMRTWEYYFDYCAAGFK  828

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TL DYQ+VFSR GN  A GDPY G  SAY
Sbjct  829   TGTLIDYQVVFSRAGNFAALGDPYIGFPSAY  859



>gb|KHN30725.1| Putative fatty acid methyltransferase [Glycine soja]
Length=787

 Score =  1117 bits (2888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 535/733 (73%), Positives = 624/733 (85%), Gaps = 5/733 (1%)
 Frame = +1

Query  796   YLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILS  975
             YL+  +NNPD+DRN+ LGEFIKSRGYSELFQKAY+IP+C SIWSCSSEGVM+FSA+S+LS
Sbjct  59    YLDMLENNPDIDRNEPLGEFIKSRGYSELFQKAYLIPICGSIWSCSSEGVMSFSAFSVLS  118

Query  976   FCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGG  1155
             FC NHHLLQLFGRPQWLTV+ RS +YVNKV+EELE+ G +I    EV  VST E+     
Sbjct  119   FCHNHHLLQLFGRPQWLTVRWRSQTYVNKVKEELEREGSQIITNREVQLVSTSEKE----  174

Query  1156  VVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSF  1335
               ++  K+  +E YDGCIMA HAPD L++LG +ATFDE RILGAFQY YSDI+LHR+++ 
Sbjct  175   -CVVHCKDGSEEMYDGCIMAVHAPDALRLLGDEATFDERRILGAFQYAYSDIFLHRDKNL  233

Query  1336  MPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTG  1515
             MP+N AAWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   PE  LLKW+TG
Sbjct  234   MPQNPAAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHIPENTLLKWSTG  293

Query  1516  HpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNN  1695
             HPVPSVAA +AS EL+ IQGKR+IWF GAY GYGFHEDG KAGMIAAHGLL   C    N
Sbjct  294   HPVPSVAAFKASLELDHIQGKRKIWFSGAYLGYGFHEDGFKAGMIAAHGLLGSCCVLQTN  353

Query  1696  PNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSP  1875
             P HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K   LK ++RVH+P
Sbjct  354   PKHMVPSWKELGARIFVTRFLSYYINTGCLMLLEEGGTMFTFEGTGKNCGLKSVLRVHNP  413

Query  1876  QFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWT  2055
             QFYWKV TQADLGLADAYI+GD SFVDK EGLL L  I +ANRD +AS  +    RGWWT
Sbjct  414   QFYWKVMTQADLGLADAYINGDFSFVDKDEGLLILILILIANRDSNASNLKLKKNRGWWT  473

Query  2056  PLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSE  2235
             P+  TSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSNELF++FLDETMTYSCA+FK++
Sbjct  474   PVFLTSALTSAKFFMEHVSRRNTLTQARRNISRHYDLSNELFAIFLDETMTYSCALFKNK  533

Query  2236  DEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLK  2415
             DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKYTGITLS++QLK
Sbjct  534   DEDLKDAQKRKISLLIEKARIDKTHEILEIGCGWGSLAIEVVKQTGCKYTGITLSKEQLK  593

Query  2416  YAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLA  2595
              AE +V++AGLQD I+FLLCDYRQLP   +YDRIISCEM+EAVGHE+M EFFG CESVLA
Sbjct  594   LAEQRVKDAGLQDRIKFLLCDYRQLPKAYKYDRIISCEMIEAVGHEYMEEFFGCCESVLA  653

Query  2596  ENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLED  2775
             +NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRLC EH+E+
Sbjct  654   DNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSRLCGEHVEN  713

Query  2776  IGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFS  2955
             IGIHYYQTLRCWR NFLERQ++I+ LGF++KFIRTWEYYFDYC AGF + TLG+YQ+VFS
Sbjct  714   IGIHYYQTLRCWRKNFLERQNEIMALGFNEKFIRTWEYYFDYCGAGFKSLTLGNYQVVFS  773

Query  2956  RPGNVTAFGDPYK  2994
             RPGNV A GDPYK
Sbjct  774   RPGNVAALGDPYK  786


 Score =   105 bits (263),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 2/66 (3%)
 Frame = +1

Query  403  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
            MRVAVVGAGISGL SAYVLAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNR  
Sbjct  1    MRVAVVGAGISGLASAYVLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDIDLGFMVFNR--  58

Query  583  YPNMME  600
            Y +M+E
Sbjct  59   YLDMLE  64



>gb|AAT74601.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =  1111 bits (2873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/871 (62%), Positives = 669/871 (77%), Gaps = 12/871 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M VAV+G GI GLVSAYVL K G  VVVYEKE+ LGGHAKTV  D VDLDLGF+  N   
Sbjct  1     MEVAVIGGGIKGLVSAYVLVKAGVDVVVYEKEEQLGGHAKTVNFDAVDLDLGFLFLNPAR  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGH-GYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             Y  ++++ +SLGVD+E SD+SFS+S D G+ GYEW S+ GFS  FAQKK LLNP+ WQ +
Sbjct  61    YATLLDIIDSLGVDVETSDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNWQNL  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++F NDV SYL   +NNPD+DR +TLG+FIKS+GYSE FQ  Y+ P+C S+WS S E
Sbjct  121   REIIRFSNDVESYLGSLENNPDIDRTETLGQFIKSKGYSENFQNTYLAPICGSMWSSSKE  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
              VM+FSA+SILSFCR HHL Q FG+PQWLT+K  SH +V +VRE LE +GC+ + GCEV 
Sbjct  181   DVMSFSAFSILSFCRTHHLYQQFGQPQWLTIKGHSH-FVKRVREVLETKGCQFKLGCEVQ  239

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV   + G+     ++ G    QE Y+GCIMA  AP  LK+LG QATF+E R+LGAFQY 
Sbjct  240   SVLPADNGT----TMVCGDGF-QETYNGCIMAVDAPTALKLLGNQATFEETRVLGAFQYA  294

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
              SDI+LHR+ + MP+N +AWSA NFL +  N   LTYWLN LQN+G T +P+ VT+NP  
Sbjct  295   TSDIFLHRDSTLMPQNKSAWSALNFLNSSKNNAFLTYWLNALQNIGKTSEPFFVTVNPDH  354

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP+  LLKW+TGH +PSVAAS+AS EL +IQGKR IWFCG    Y F++D LKAGM AAH
Sbjct  355   TPKNTLLKWSTGHAIPSVAASKASLELGQIQGKRGIWFCG----YDFNQDELKAGMDAAH  410

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             G+L K  S L++P  M PS+ ET ARL VT+F   +I  G +I LEEGG +FTF+G  +K
Sbjct  411   GILGKHSSVLHSPKSMSPSFMETTARLFVTKFFQQYISMGCVIFLEEGGRIFTFKGNMEK  470

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK +++VH+PQFYW++  +AD+GLADAYIHGD SF+D+ EGLLNLF+I VAN++ SA+
Sbjct  471   CPLKTVLKVHNPQFYWRIMKEADIGLADAYIHGDFSFLDETEGLLNLFRILVANKENSAA  530

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S SN +R WW+P L T++I+SAKYF++H+ RQNT+TQARRNISRHYDLSNELF+L+L +
Sbjct  531   -SGSNKRRTWWSPALLTASISSAKYFVKHLLRQNTITQARRNISRHYDLSNELFTLYLGK  589

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
              M YS  VF++ +E L  AQ RKIS LI+KA+I K H +L+IGCGWGSLAIE V+RTGCK
Sbjct  590   MMQYSSGVFRTGEEHLDVAQRRKISSLIEKARIEKRHEVLDIGCGWGSLAIETVKRTGCK  649

Query  2380  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2559
             YTGITLSEQQLKYA++KV+EAGLQDNI+ LLCDYRQLP   ++DRIIS EM+E VG E++
Sbjct  650   YTGITLSEQQLKYAQEKVKEAGLQDNIKILLCDYRQLPKEHQFDRIISVEMVEHVGEEYI  709

Query  2560  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2739
              EF+  C+ +L E+G+ VLQFISIP+E   E +Q++ F+KEYIFPGG L SL R  SAMA
Sbjct  710   EEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQQTAGFLKEYIFPGGTLLSLDRNLSAMA  769

Query  2740  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2919
             A++R  VEH+E+IG+ YY TLR WR  FLE  S++L LGFD+KF+RTWEYYFDYCAAGF 
Sbjct  770   AATRFSVEHVENIGMSYYHTLRWWRKLFLENTSKVLALGFDEKFMRTWEYYFDYCAAGFK  829

Query  2920  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  830   TGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  860



>ref|XP_009586646.1| PREDICTED: uncharacterized protein LOC104084479 isoform X6 [Nicotiana 
tomentosiformis]
Length=744

 Score =  1110 bits (2871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/739 (73%), Positives = 625/739 (85%), Gaps = 6/739 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGL+SAY LAK G  VVVYE EDYLGGHAKTVT+D VDLDLGFM+FNRVT
Sbjct  1     MKVAVVGAGISGLISAYELAKSGVKVVVYENEDYLGGHAKTVTVDCVDLDLGFMIFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE LGV+MEIS MSFSV+LD G G EWG+RNG S LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFEFLGVNMEISHMSFSVTLDQGRGCEWGTRNGISSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV+SYLE  DNNPD+D ++TL +FIKS G SELF KAY+IP+C+SIWSC  EG
Sbjct  121   EIIKFKQDVISYLEALDNNPDIDCDETLWQFIKSNGCSELFLKAYLIPICSSIWSCPLEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSAYSILS  R+HHLLQLFG  Q LTV+  SH+ VNKV+EELEKRGC+IR  CEV+S
Sbjct  181   VMGFSAYSILSVFRDHHLLQLFGLSQLLTVRWGSHTSVNKVKEELEKRGCQIRTDCEVNS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VSTD +G       I+  +  +E YDGCIMAAHAPDTL+MLGK+AT DE RILGAFQY Y
Sbjct  241   VSTDGEGCT-----IACNDGAKEVYDGCIMAAHAPDTLRMLGKEATCDETRILGAFQYSY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++F+PR+ AAWSA NFLGT  NR  +TYWLN +QNLGD+K PYLVT++PP T
Sbjct  296   SDIFLHRDKTFLPRDPAAWSALNFLGTTKNRGRMTYWLNVIQNLGDSKLPYLVTVDPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKWTTGH VPSVAAS+AS EL++IQGKR IWFCGAYQGYGFHEDGLK G+ AA G
Sbjct  356   PEHILLKWTTGHLVPSVAASKASRELDQIQGKRGIWFCGAYQGYGFHEDGLKVGVAAADG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L++ CS L+N  HMVP+WPETGARL+VTRF  SFI TG IIL E GGTVFTF+GT++K 
Sbjct  416   VLRRNCSILDNSKHMVPTWPETGARLVVTRFFRSFIKTGCIILFE-GGTVFTFQGTERKC  474

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKV +R+H PQFYWK AT+A++GLADA+IHGD SFVDK EGLLNL  IFVAN DL ASV
Sbjct  475   SLKVSLRIHGPQFYWKTATEAEIGLADAFIHGDFSFVDKNEGLLNLIMIFVANSDLKASV  534

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             + S+ KRGWWTP LFT+A+ SAKYFI+H+  QNTLTQARRNISRHYDLSNELFSLFLD T
Sbjct  535   TSSSKKRGWWTPFLFTAALPSAKYFIQHVLNQNTLTQARRNISRHYDLSNELFSLFLDGT  594

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FKSEDEDLK AQ+RKIS+LI KAKISKEHHILEIG GWGS A+E V++TGCKY
Sbjct  595   MTYSCAIFKSEDEDLKDAQLRKISVLIRKAKISKEHHILEIGFGWGSFAVEVVKQTGCKY  654

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQL+YA+  V +AGLQD I FLLCDYRQ+P+  +Y RIIS EM+E VGHEFM+
Sbjct  655   TGITLSEQQLEYAQLIVEQAGLQDRITFLLCDYRQMPNKDKYHRIISIEMIEHVGHEFMD  714

Query  2563  EFFGRCESVLAENGILVLQ  2619
             EFF  CES LAE+G+LV+Q
Sbjct  715   EFFTCCESALAEDGLLVVQ  733



>ref|XP_010650129.1| PREDICTED: uncharacterized protein LOC100249441 isoform X2 [Vitis 
vinifera]
Length=684

 Score =  1104 bits (2855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/689 (76%), Positives = 603/689 (88%), Gaps = 5/689 (1%)
 Frame = +1

Query  946   MAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSV  1125
             M FSA+S+LSFCRNHHLLQLFGRPQWLTVK RSH YVNKVREELE +GC+IR GCEV SV
Sbjct  1     MTFSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHYYVNKVREELESKGCQIRTGCEVVSV  60

Query  1126  STDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYS  1305
             ST + G      +  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV S
Sbjct  61    STTDDG----CTVFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVSS  115

Query  1306  DIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTP  1485
             DI+LH +++FMP+N AAWSAWNFLGT++N+VCLTYWLN LQN+  T +P+LVTLNPP TP
Sbjct  116   DIFLHCDKNFMPQNPAAWSAWNFLGTIDNKVCLTYWLNVLQNIDQTSRPFLVTLNPPHTP  175

Query  1486  EQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGL  1665
             +  LLKW+T HP PSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAHG+
Sbjct  176   DHTLLKWSTSHPFPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHGM  235

Query  1666  LKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNL  1845
             L K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK L
Sbjct  236   LGKGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSRKKCL  295

Query  1846  LKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVS  2025
             LKV +++H+PQFYWK+ATQADLGLADAYI+GD S VDK EGL NLF IF+ANRDL +S+S
Sbjct  296   LKVSLKIHNPQFYWKIATQADLGLADAYINGDFSLVDKDEGLQNLFMIFIANRDLDSSLS  355

Query  2026  RSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETM  2205
             R N+KRGWWTPL FT+ IASA+YF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETM
Sbjct  356   RLNNKRGWWTPLFFTAGIASARYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDETM  415

Query  2206  TYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYT  2385
             TYSCAVFK+E EDLK AQ+RKISLLI+K +I K+H +LEIGCGWGSLAIE V+RTGCKYT
Sbjct  416   TYSCAVFKTEGEDLKVAQLRKISLLIEKVRIDKKHEVLEIGCGWGSLAIEVVKRTGCKYT  475

Query  2386  GITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNE  2565
             GITLSE+QLK+AE KV+EAGLQDNIRFLLCDYRQL D+ +YDRIISCEMLEAVGHE+M E
Sbjct  476   GITLSEEQLKFAEMKVKEAGLQDNIRFLLCDYRQLSDSYKYDRIISCEMLEAVGHEYMEE  535

Query  2566  FFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAAS  2745
             FFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAAS
Sbjct  536   FFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAAS  595

Query  2746  SRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTC  2925
             SRLC+EHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T 
Sbjct  596   SRLCMEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTH  655

Query  2926  TLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  656   TLGNYQIVFSRPGNAAAFSNPYESVVSTY  684



>ref|XP_010670960.1| PREDICTED: uncharacterized protein LOC104887889 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=725

 Score =  1102 bits (2849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/725 (73%), Positives = 615/725 (85%), Gaps = 6/725 (1%)
 Frame = +1

Query  826   MDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQL  1005
             MDR +TL  FI++R +S+LFQK Y++PMCASIWSC S+ VM FSA+SILSF RNHHLLQL
Sbjct  1     MDRTETLSHFIETRNFSDLFQKGYLVPMCASIWSCPSDTVMNFSAFSILSFSRNHHLLQL  60

Query  1006  FGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMV  1185
             FGRPQWLTVK RSH YV+KVREELE RG +++  CEV SVST ++G       +S  +  
Sbjct  61    FGRPQWLTVKGRSHCYVSKVREELEVRGVQVKTSCEVQSVSTSDEGCT-----LSCSDGS  115

Query  1186  QEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSA  1365
              E YD CI+A HAPD +++LGK+AT+DE  ILGAFQYVYSDI+LHR+++FMP+N AAWSA
Sbjct  116   NEVYDKCIIAVHAPDAIRILGKEATYDETTILGAFQYVYSDIFLHRDKTFMPQNPAAWSA  175

Query  1366  WNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasr  1545
             WNFLGT+++++CLTYWLN LQN+ +T  PYLVTLNPP  PE  LLKW TGHPVPSVAA++
Sbjct  176   WNFLGTMDSKLCLTYWLNVLQNIEETDLPYLVTLNPPHQPENVLLKWRTGHPVPSVAATK  235

Query  1546  assELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSP-LNNPNHMVPSWP  1722
             AS +L  IQG R IWFCGAYQGYGFHEDGLKAGMIAA GLL K  +  L NP  MV S  
Sbjct  236   ASLDLGNIQGTRGIWFCGAYQGYGFHEDGLKAGMIAARGLLGKSFNNILTNPKQMVASLT  295

Query  1723  ETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQ  1902
             E  A + VTRFL++FI  G + LLEEGGT+ TFEG+ K   LKV +R+HSPQFYWKVA +
Sbjct  296   EAAACIFVTRFLSNFISAGCLTLLEEGGTILTFEGSSKICPLKVALRIHSPQFYWKVAKE  355

Query  1903  ADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIA  2082
             ADLGLADAYI+GD SFVDK EGLLNLF IF+A+RDL+++ +  N KRGWWTP+LFT+ IA
Sbjct  356   ADLGLADAYINGDFSFVDKNEGLLNLFMIFIASRDLNSTATLVNKKRGWWTPMLFTAGIA  415

Query  2083  SAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQM  2262
             SAKYF  H+SRQNTLTQARRNISRHYDLSN++FSLFLDETMTYSCAVF+SE+EDLK AQM
Sbjct  416   SAKYFYHHVSRQNTLTQARRNISRHYDLSNDMFSLFLDETMTYSCAVFESENEDLKVAQM  475

Query  2263  RKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREA  2442
             RKISLL++KA++ K H +LEIGCGWGSLAIE V+RTGC+YTGITLSE+QL+YAE++V+EA
Sbjct  476   RKISLLLEKARVEKHHEVLEIGCGWGSLAIEVVKRTGCRYTGITLSEEQLRYAEERVKEA  535

Query  2443  GLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQF  2622
             GLQD IRFLLCDYRQLPD  +Y+RIISCEMLEAVGHE+M EFF  CES+LA NG+LVLQF
Sbjct  536   GLQDRIRFLLCDYRQLPDVHKYNRIISCEMLEAVGHEYMEEFFQCCESLLAANGLLVLQF  595

Query  2623  ISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTL  2802
             ISIPDERYDEYR+SSDFIKEYIFPGGCLP LSRVTSAMAA+SRLCVEH+E+IGIHYY+TL
Sbjct  596   ISIPDERYDEYRRSSDFIKEYIFPGGCLPCLSRVTSAMAAASRLCVEHIENIGIHYYKTL  655

Query  2803  RCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG  2982
             RCWR NFLE QS+I  LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN+ +FG
Sbjct  656   RCWRKNFLEHQSKIHSLGFDEKFIRTWEYYFDYCAAGFKTRTLGNYQIVFSRPGNLASFG  715

Query  2983  DPYKG  2997
               Y G
Sbjct  716   GAYAG  720



>gb|AAT74600.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=873

 Score =  1092 bits (2825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/879 (61%), Positives = 664/879 (76%), Gaps = 20/879 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M VAV+G GI GL+SAYVL K G  VVVYEKE+ LGGHAKTV  D VDLDLGF+  N   
Sbjct  1     MEVAVIGGGIKGLLSAYVLVKAGVDVVVYEKEEQLGGHAKTVNFDAVDLDLGFLFLNPAR  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGH-GYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             Y  ++ +F+SLGVD+E SD+SFS+S D G+ GYEW S+ GFS  FAQKK LLNP+ WQ +
Sbjct  61    YATLLHMFDSLGVDVETSDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNWQSL  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KF NDV SYL   +NNPD+DR +TLG+FI S+GYSE FQ  Y+ P+C S+WS S E
Sbjct  121   REIIKFGNDVESYLGSLENNPDIDRTETLGQFINSKGYSENFQNTYLAPICGSMWSSSKE  180

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
              V +FSA+SILSFCR HHL QLFG+ QWLT+K  SH +V +VRE LE +GC+ + GCEV 
Sbjct  181   DVTSFSAFSILSFCRTHHLYQLFGQSQWLTIKGHSH-FVKRVREVLETKGCQFKLGCEVQ  239

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV   + G+A    ++ G    QE Y+GCIMA  AP  LK+LG QATF+E R+LGAFQY 
Sbjct  240   SVLPVDNGTA----MVCGDGF-QETYNGCIMAVDAPTALKLLGNQATFEETRVLGAFQYA  294

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
              SDI+LH++ + MP+N +AWSA NFL +  N   LTYWLN LQN+G T +P+ VT+NP  
Sbjct  295   TSDIFLHQDSTLMPQNKSAWSALNFLNSSKNNAFLTYWLNALQNIGKTSEPFFVTVNPDH  354

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TP+  LLKW+TGH + SVAAS+AS EL +IQGKR IWFCG    Y F++D LKAGM AAH
Sbjct  355   TPKNTLLKWSTGHAIXSVAASKASLELGQIQGKRGIWFCG----YDFNQDELKAGMDAAH  410

Query  1660  GLLKKRCSPLNNPNHMVPSWP--------ETGARLLVTRFLASFIVTGSIILLEEGGTVF  1815
             G+L K  S   +P +M PS P        ET ARL VT+F   +I  G +I LEEGG +F
Sbjct  411   GILGKHSSVPPSPKNMSPSLPKNMSPSFMETTARLFVTKFFQQYISMGCVIFLEEGGRIF  470

Query  1816  TFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFV  1995
             TF+G  +K  LK +++VH+PQFYW++  +AD+GLADAYIHGD SF+D+ EGLLNLF+I V
Sbjct  471   TFKGNMEKCPLKTVLKVHNPQFYWRIMKEADIGLADAYIHGDFSFLDENEGLLNLFRILV  530

Query  1996  ANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNE  2175
             AN++ SA+ S S  +R WW+P L T++I+SAKYF++H+ RQNT+TQARRNISRHYDLSNE
Sbjct  531   ANKENSAA-SGSTKRRTWWSPALLTASISSAKYFVKHLLRQNTITQARRNISRHYDLSNE  589

Query  2176  LFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIE  2355
             LFSL+L + M YS  VF++ +E L  AQ RKIS LI+K +I K H +L+IGCGWGSLAIE
Sbjct  590   LFSLYLGKMMQYSSGVFRTGEEHLDVAQRRKISSLIEKTRIEKWHEVLDIGCGWGSLAIE  649

Query  2356  AVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEML  2535
              V+RTGCKYTGITLSEQQLKYA++KV+EAGL+DNI+ LLCDYRQLP   ++DRIIS EM+
Sbjct  650   TVKRTGCKYTGITLSEQQLKYAQEKVKEAGLEDNIKILLCDYRQLPKEHQFDRIISVEMV  709

Query  2536  EAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSL  2715
             E VG E++ EF+  C+ +L E+G+ VLQFISIP+E   E +Q++ F+KEYIFPGG L SL
Sbjct  710   EHVGEEYIEEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQQTAGFLKEYIFPGGTLLSL  769

Query  2716  SRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYF  2895
              R  SAMAA++R  VEH+E+IG+ YY TLR WR  FL+  S++L LGFD+KF+RTWEYYF
Sbjct  770   DRNLSAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLKNTSKVLALGFDEKFMRTWEYYF  829

Query  2896  DYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             DYCAAGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  830   DYCAAGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  868



>emb|CDX77514.1| BnaA07g06520D [Brassica napus]
Length=803

 Score =  1090 bits (2818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/820 (64%), Positives = 627/820 (76%), Gaps = 31/820 (4%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME F++LGV ME+SDMSFSVSLDNG G EWGSRNG S LFAQK+N+ NPYFWQMI E  
Sbjct  1     MMEFFKNLGVKMEVSDMSFSVSLDNGRGCEWGSRNGLSSLFAQKRNIFNPYFWQMITEFY  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KF  D L Y+EE + NPD DRN+TLGEF+KS GYS LFQKAY++P C SIW C  + ++ 
Sbjct  61    KFNKDALKYIEEMERNPDTDRNETLGEFLKSHGYSALFQKAYLVPACRSIWPCPPDSILN  120

Query  952   FSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1131
             FSAYS+LSFCRNHHLLQ+F RPQWLTV  RS +Y  KVR ELEKRGC+IR  C V SVS 
Sbjct  121   FSAYSVLSFCRNHHLLQIFERPQWLTVAGRSETYAAKVRAELEKRGCKIRMNCNVQSVSI  180

Query  1132  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1311
              E G     ++++ ++  QE +D CI+A +APD L++LG+ AT DE R+LGAF Y YSDI
Sbjct  181   SEDG----CILVTTEDGSQEVFDRCILAVNAPDALRLLGEDATSDEARVLGAFHYAYSDI  236

Query  1312  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1491
             YLHR+   MPRN  AWSAWNFL +  N+  LTYWLN +QNLG+   P+ +T NP  TP+ 
Sbjct  237   YLHRDTDLMPRNRVAWSAWNFLTSSGNKASLTYWLNIIQNLGEEHDPFFLTFNPEVTPKM  296

Query  1492  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHED------------GL  1635
              L KWT+GHP+PSV+A +AS EL  IQGKR +WF   +    F E+             L
Sbjct  297   TLFKWTSGHPLPSVSAWKASQELNNIQGKRGLWFYCLW--LPFKENFTRSTFFLECLMDL  354

Query  1636  KAGMIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTV  1812
              AGM AA  LL K+  SP +NP HM PS  E GAR L TR            + EEGGT+
Sbjct  355   HAGMAAAQSLLGKEMVSPPSNPKHMAPSIIEKGARFLFTR------------VYEEGGTM  402

Query  1813  FTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIF  1992
             FTF+G   +  L+ ++++HSP FYWKV TQADLGLADAYI+GD SF DK  GLLNL  I 
Sbjct  403   FTFKGNHLRCNLESVIKIHSPHFYWKVMTQADLGLADAYINGDFSFADKDSGLLNLIMIL  462

Query  1993  VANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSN  2172
             +AN++L++   + + KRGWWTP+  T+ + SA  F++H SRQNTLT+ARRNISRHYDLSN
Sbjct  463   IANKELNSKNLKLSKKRGWWTPMFMTAGLTSATQFLKHFSRQNTLTKARRNISRHYDLSN  522

Query  2173  ELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAI  2352
             ELF+LFLD+TM+YS AVFKS+DEDLKTAQMRKI+LLIDKA+I K H +LEIGCGWG+LAI
Sbjct  523   ELFALFLDDTMSYSTAVFKSDDEDLKTAQMRKINLLIDKARIEKNHEVLEIGCGWGTLAI  582

Query  2353  EAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEM  2532
             E V++TGCKYTGITLS +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRIISCEM
Sbjct  583   EVVKKTGCKYTGITLSIEQLKYAEEKVKEAGLQDRITFELCDYRQLSDAKKYDRIISCEM  642

Query  2533  LEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPS  2712
             +E VGHEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPS
Sbjct  643   IEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPS  702

Query  2713  LSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYY  2892
             L+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYY
Sbjct  703   LARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYY  762

Query  2893  FDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             FDYCAAGF T TL DYQ+VFSRPGNV AFGDP+     A+
Sbjct  763   FDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFHSFPYAH  802



>ref|XP_010650130.1| PREDICTED: uncharacterized protein LOC100249441 isoform X3 [Vitis 
vinifera]
Length=678

 Score =  1087 bits (2812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 518/683 (76%), Positives = 595/683 (87%), Gaps = 5/683 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV LDLGFMVFNRVT
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVPLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGVDME+SDMSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61    YPNMMEFFETLGVDMELSDMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             +++KFK+DVL YLEE +NNPDMDRN TLG+FIK RGYSELFQKAY++P+CASIWSC +EG
Sbjct  121   DVIKFKDDVLKYLEELENNPDMDRNQTLGDFIKCRGYSELFQKAYLVPICASIWSCPAEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSA+S+LSFCRNHHLLQLFGRPQWLTVK RSH YVNKVREELE +GC+IR GCEV S
Sbjct  181   VMTFSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHYYVNKVREELESKGCQIRTGCEVVS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             VST + G      +  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV 
Sbjct  241   VSTTDDG----CTVFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVS  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LH +++FMP+N AAWSAWNFLGT++N+VCLTYWLN LQN+  T +P+LVTLNPP T
Sbjct  296   SDIFLHCDKNFMPQNPAAWSAWNFLGTIDNKVCLTYWLNVLQNIDQTSRPFLVTLNPPHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+T HP PSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAHG
Sbjct  356   PDHTLLKWSTSHPFPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK 
Sbjct  416   MLGKGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSRKKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
             LLKV +++H+PQFYWK+ATQADLGLADAYI+GD S VDK EGL NLF IF+ANRDL +S+
Sbjct  476   LLKVSLKIHNPQFYWKIATQADLGLADAYINGDFSLVDKDEGLQNLFMIFIANRDLDSSL  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             SR N+KRGWWTPL FT+ IASA+YF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDET
Sbjct  536   SRLNNKRGWWTPLFFTAGIASARYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK+E EDLK AQ+RKISLLI+K +I K+H +LEIGCGWGSLAIE V+RTGCKY
Sbjct  596   MTYSCAVFKTEGEDLKVAQLRKISLLIEKVRIDKKHEVLEIGCGWGSLAIEVVKRTGCKY  655

Query  2383  TGITLSEQQLKYAEDKVREAGLQ  2451
             TGITLSE+QLK+AE KV+EAGLQ
Sbjct  656   TGITLSEEQLKFAEMKVKEAGLQ  678



>ref|XP_010532686.1| PREDICTED: uncharacterized protein LOC104808653 isoform X2 [Tarenaya 
hassleriana]
Length=887

 Score =  1083 bits (2802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/817 (64%), Positives = 641/817 (78%), Gaps = 6/817 (1%)
 Frame = +1

Query  400   KMRVAVVGAGIS-GLVSAYVLAKGGAGVVVYEKEDYLGGHAK-TVTLDGVDLDLGFMVFN  573
             +MRVAV+G G S GL SAYVLA+ G GVV+YE+E  LGG+A  T+ +DG D+DLG ++FN
Sbjct  4     EMRVAVIGGGTSTGLASAYVLAREGLGVVLYEEEHCLGGNANDTIRVDGADVDLGLILFN  63

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  753
                 PNMME FE LG+DME+SDMS SVSLD+G G EWG+ NGFS LFAQK N+LNP+FW+
Sbjct  64    PAICPNMMEFFEDLGLDMEVSDMSLSVSLDSGGGTEWGTLNGFSSLFAQKSNVLNPFFWK  123

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MIREI KFK+D   Y++E + + D+DR +TLG+F++S GYSELFQKAY++P+C SIWS  
Sbjct  124   MIREIAKFKDDASIYVDERERDRDLDRTETLGQFLRSYGYSELFQKAYLVPICGSIWSRP  183

Query  934   SEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCE  1113
             S+ V +FSA S+LSF RN+HLLQ+FGRPQWLTV  RS +YV K+R ELE+RGC+IR   E
Sbjct  184   SDDVSSFSALSVLSFFRNNHLLQIFGRPQWLTVAGRSRTYVAKIRTELEQRGCKIRTRRE  243

Query  1114  VHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQ  1293
             V  V+T    S    V I   +  +E +D C++A +A D L++LG QATFDE R+LGAFQ
Sbjct  244   VQWVTT----SVNNGVTIRNGDGSEEIFDRCLLAMNAQDALRLLGDQATFDERRVLGAFQ  299

Query  1294  YVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNP  1473
             YV+SDIYLHR+  FMP   AAWSA NFL +  ++  +TYWLN LQNLG+ ++P+ VTLNP
Sbjct  300   YVHSDIYLHRDTDFMPHKTAAWSACNFLESTEHKGSITYWLNILQNLGEKQEPFFVTLNP  359

Query  1474  PRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIA  1653
              R P++ LLKWTT   VPSVAA  AS +L++IQG+  +WFC + QGYGFHEDGLKAG+ A
Sbjct  360   DRVPKKTLLKWTTARTVPSVAALTASQDLDKIQGQHGLWFCESCQGYGFHEDGLKAGIAA  419

Query  1654  AHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTD  1833
             A  LL+K    L NP  MV S  ETGARL VTRF+  FI TGSI LLEEGGT+F F G  
Sbjct  420   ARNLLRKDIGNLKNPKCMVLSLSETGARLFVTRFMEQFISTGSITLLEEGGTMFRFGGKH  479

Query  1834  KKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLS  2013
              K  L+ ++ +HSPQFYWKV T+ADLGLADAYI+GD SFVDK  GLLN+  I +ANRD++
Sbjct  480   PKCNLRSVLTIHSPQFYWKVMTRADLGLADAYINGDFSFVDKDNGLLNMLMILIANRDMN  539

Query  2014  ASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2193
             +  S    KRGWWTP+  T+ +AS  YF++H+SRQNTLTQARRNISRHYDLSNELF++FL
Sbjct  540   SLKSNLAKKRGWWTPMFLTAGLASVNYFLKHVSRQNTLTQARRNISRHYDLSNELFAMFL  599

Query  2194  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2373
             DETM YS A+F SEDEDLKTAQMRKISLLI+KA+I K H +LEIGCGWG+LAIE V RTG
Sbjct  600   DETMMYSAALFSSEDEDLKTAQMRKISLLIEKARIEKNHEVLEIGCGWGTLAIEVVRRTG  659

Query  2374  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHE  2553
             C+YTGITLS +QLKYAE K REAGLQD I F LCDYRQL D+  YDRIISCEMLEAVGHE
Sbjct  660   CRYTGITLSVEQLKYAEAKAREAGLQDQITFQLCDYRQLSDSRVYDRIISCEMLEAVGHE  719

Query  2554  FMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSA  2733
             FM  FF  CE+ LAE+G+LV+QF  IPD+RYDEYR SSDFIKEYIF GGCLPSL+R+TSA
Sbjct  720   FMETFFRSCEAALAEDGLLVMQFAWIPDQRYDEYRLSSDFIKEYIFHGGCLPSLARLTSA  779

Query  2734  MAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQI  2844
             MA+SSRL ++ +E+IG+HYYQT+RCWR NF ER+  +
Sbjct  780   MASSSRLYIQQVENIGVHYYQTIRCWRKNFTERRRSL  816



>emb|CDX77513.1| BnaA07g06510D [Brassica napus]
Length=778

 Score =  1080 bits (2792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/813 (64%), Positives = 621/813 (76%), Gaps = 47/813 (6%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT PNMMELF++LGVD+E+SDMSFSVSL+NG GYEWG+RNG S LFAQK+N+LNPYFW M
Sbjct  11    VTCPNMMELFKNLGVDIEVSDMSFSVSLNNGRGYEWGTRNGLSSLFAQKRNILNPYFWHM  70

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             I E  +FK D L+Y+EE + NPD DRN+TL EF+KS GYS LFQKAY++P C+SIW+C  
Sbjct  71    ITEFKRFKEDALNYIEEMERNPDTDRNETLREFVKSHGYSALFQKAYLVPACSSIWTCPI  130

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             +  +  SAYS+LSFCRNHHLLQ+F RPQWLTV  RS +Y  KVR ELE+RG  +R     
Sbjct  131   DSALNLSAYSVLSFCRNHHLLQIFERPQWLTVAGRSETYAAKVRAELEQRGYALR-----  185

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
                                                      +LG+ AT DE R+LGAFQY
Sbjct  186   -----------------------------------------LLGEDATPDETRVLGAFQY  204

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
              YSDIYLHR+   MPRN  AWSAWNFL +  N+  LT+WLN +QNL +    Y +TLNP 
Sbjct  205   AYSDIYLHRDTDLMPRNRVAWSAWNFLTSSENKASLTHWLNIIQNLDEEHDSYFLTLNPE  264

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
              +P++ L KWT+G P+PSV+A +AS EL +IQGKR IWFCGAYQG   H+ G  AGM AA
Sbjct  265   VSPKKTLYKWTSGRPLPSVSAWKASQELNKIQGKRGIWFCGAYQGSPIHKFGKYAGMGAA  324

Query  1657  HGLLKKRCSPL-NNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTD  1833
               LL K   PL +NP HMVPS  E GAR L TRFL  FI TG + + EEGGT+FTF+G D
Sbjct  325   QSLLGKDMVPLLSNPKHMVPSLTEKGARFLFTRFLRHFISTGCVTVYEEGGTMFTFKGKD  384

Query  1834  KKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLS  2013
              +  L+ ++++ SP FYWKV TQADLGLADAYI+GD SFV+K+ GLLNL  I +ANR+L+
Sbjct  385   LRCNLESVIKIRSPHFYWKVMTQADLGLADAYINGDFSFVNKETGLLNLIMILIANRELN  444

Query  2014  ASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2193
             +       KRGWWTP+  T+ + SA  F++H SRQNTLT+ARRNISRHYDLSNELFSLFL
Sbjct  445   SKNLNLAKKRGWWTPMFMTAGLTSATQFLKHFSRQNTLTKARRNISRHYDLSNELFSLFL  504

Query  2194  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2373
             D+TM+YS AVFKS+DEDLKTAQMRKI+LLIDKA+I K+H +LEIGCGWG+LAIE V++TG
Sbjct  505   DDTMSYSTAVFKSDDEDLKTAQMRKINLLIDKARIEKDHEVLEIGCGWGTLAIEVVKKTG  564

Query  2374  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHE  2553
             CKYTGITLS +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRIISCEM+E VGHE
Sbjct  565   CKYTGITLSIEQLKYAEEKVKEAGLQDRITFELCDYRQLSDARKYDRIISCEMIEHVGHE  624

Query  2554  FMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSA  2733
             FM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV SA
Sbjct  625   FMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVISA  684

Query  2734  MAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAG  2913
             MA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDYCAAG
Sbjct  685   MASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAAG  744

Query  2914  FHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             F T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  745   FKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  777



>gb|EPS70161.1| hypothetical protein M569_04599, partial [Genlisea aurea]
Length=850

 Score =  1069 bits (2765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/851 (61%), Positives = 647/851 (76%), Gaps = 12/851 (1%)
 Frame = +1

Query  439   LVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLG  618
             L +A VL   G  VV+YE+E++    A T T+DG  +D+GF+  N VTY NM+ELFESLG
Sbjct  12    LTAARVLKDAGVDVVIYEREEW----APTFTVDGTRIDIGFL--NPVTYSNMVELFESLG  65

Query  619   VDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSY  798
             ++ E+SD+SFSVSLDNG GYEWG RNG S LFAQKKN+ NPY+W M+REI KF  DV+SY
Sbjct  66    LEAELSDVSFSVSLDNGRGYEWGIRNGLSSLFAQKKNVFNPYYWTMLREIRKFSGDVISY  125

Query  799   LEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSF  978
             L+    N D+DRN+TLG FI+SRGYSE+FQKAY+IP+C SIW CSSE VM F+A S+LSF
Sbjct  126   LQVIGENADVDRNETLGHFIQSRGYSEMFQKAYLIPICVSIWGCSSEDVMIFAASSVLSF  185

Query  979   CRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGV  1158
              R+ HLLQ+F   Q LT+   S  +V+++ E LE RGCEIR   EV  VS++E+G     
Sbjct  186   FRDQHLLQIFDYHQQLTINWSSDHFVSRIVESLESRGCEIRTNSEVCCVSSNEEGCT---  242

Query  1159  VIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFM  1338
               +  +N  ++ YD CI+ AHAPD +KMLG Q TFDE+RILGAFQY  SDIYLHR+++ M
Sbjct  243   --VICENGSEDKYDHCIITAHAPDAIKMLGNQLTFDEMRILGAFQYACSDIYLHRDKTLM  300

Query  1339  PRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGH  1518
             P++ AAWSA+NFLG++N+  C+T WLN LQNL     P+LVTLNPP  PE  LLKWT+ H
Sbjct  301   PKSEAAWSAYNFLGSLNDGACVTIWLNVLQNLDQGGLPFLVTLNPPYGPEHKLLKWTSKH  360

Query  1519  pvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNP  1698
             P+PSVAAS A S+   IQGKRRIWF  AYQGYGF +DGLKAG +AA+ LL++  + L N 
Sbjct  361   PIPSVAASIAYSQSNLIQGKRRIWFGAAYQGYGFDDDGLKAGFLAANDLLRRSSTDLINS  420

Query  1699  NHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQ  1878
              H+VPS  + GARLLVT+FL+ FI TG++ILLE+GGTV +F+G   K  LKV VR+HS Q
Sbjct  421   RHLVPSMMDMGARLLVTQFLSRFIATGTLILLEDGGTVLSFKGALDKCPLKVTVRIHSLQ  480

Query  1879  FYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTP  2058
             FYWKVAT+AD+GL  AY+ GD S VDK EGLLN   I + NRDL +S+  + S RGWWTP
Sbjct  481   FYWKVATEADIGLGQAYMDGDFSLVDKNEGLLNFLTILIINRDLDSSI-LAYSHRGWWTP  539

Query  2059  LLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSED  2238
             L+ T+ +++AKY+ RH  R+NT+  AR+NIS HYDLSNELFSLFLDE M YSC VFK E 
Sbjct  540   LISTALVSTAKYYFRHALRRNTIAHARQNISAHYDLSNELFSLFLDERMQYSCPVFKVEG  599

Query  2239  EDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKY  2418
             EDL +AQ+RKI LLI+K+++   HH+LE+GCGWG L IE V+RTGC+YTG+TLS+QQ KY
Sbjct  600   EDLNSAQLRKIHLLIEKSRVCASHHVLELGCGWGGLGIELVKRTGCRYTGVTLSKQQQKY  659

Query  2419  AEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAE  2598
             AE K  EAGLQD   F+L DYR++P   +YDRIISCEMLE++G E+  EFF  CES+L E
Sbjct  660   AEAKANEAGLQDRATFILGDYREVPKTRKYDRIISCEMLESIGVEYTKEFFSICESLLVE  719

Query  2599  NGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDI  2778
             +G+LV+QF ++PD R++  R++S FI EYIF G C+PSLS VTSAM A+SR  VEHLEDI
Sbjct  720   DGLLVVQFTTVPDSRFENNRRTSGFISEYIFQGSCIPSLSYVTSAMGAASRFWVEHLEDI  779

Query  2779  GIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSR  2958
             G+HYY  LRCWR NFL  ++QI  LGFD KF+R +EYYFDYCA+ F TC +G+YQ+V SR
Sbjct  780   GVHYYPALRCWRDNFLRNRNQIEALGFDDKFVRMFEYYFDYCASAFKTCAIGNYQLVLSR  839

Query  2959  PGNVTAFGDPY  2991
             PGNV  FGDPY
Sbjct  840   PGNVAIFGDPY  850



>dbj|BAJ95828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=749

 Score =  1068 bits (2761),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/754 (67%), Positives = 619/754 (82%), Gaps = 7/754 (1%)
 Frame = +1

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MIREILKFK D L YLE+ ++NPD+DR++TLG+FIK+ GYS+LFQ+AY+IP+CASIWSC 
Sbjct  1     MIREILKFKEDALKYLEDHESNPDLDRHETLGQFIKTHGYSQLFQEAYLIPICASIWSCP  60

Query  934   SEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCE  1113
             S+GV+ FSA+ +LSFCRNHHLLQ+FGRPQWLTVK RSH+YVNKVREELE  GC+I+  C+
Sbjct  61    SQGVLGFSAFFVLSFCRNHHLLQIFGRPQWLTVKGRSHTYVNKVREELESMGCQIKTSCQ  120

Query  1114  VHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQ  1293
             V SVS+ + G    V+ + G    +E YD  I  AHAP+ L+MLG +AT +ELRILGAFQ
Sbjct  121   VKSVSSFDGGYK--VLEVGGS---EEVYDKIIFGAHAPEVLRMLGGEATHEELRILGAFQ  175

Query  1294  YVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNP  1473
             YV+SDIYLHR+ + MP+N +AWSAWNFLGT ++ V +TYWLN LQN+  T +P+LVTLNP
Sbjct  176   YVHSDIYLHRDDTLMPQNPSAWSAWNFLGTTSSGVSVTYWLNLLQNIESTGRPFLVTLNP  235

Query  1474  PRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIA  1653
             P  P+  LLKW TGHPVPSVAA++AS EL++IQG R IWFCGAYQGYGFHEDG KAG  A
Sbjct  236   PHVPDHVLLKWNTGHPVPSVAAAKASLELQQIQGNRGIWFCGAYQGYGFHEDGHKAGKSA  295

Query  1654  AHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTD  1833
             A GLL ++ S L NP  MVPSW ETGARLLVTRFL  ++  G++ +LEEGGT+++F   D
Sbjct  296   AQGLLGQKSSLLLNPKQMVPSWTETGARLLVTRFLNQYVTIGNMTILEEGGTMYSFGEVD  355

Query  1834  KKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLS  2013
             KK L+K ++RVH P FYWKVAT+ADLG+ADAYI+G  SFVDK+EGLLNLF I +ANRD  
Sbjct  356   KKCLVKTVLRVHDPLFYWKVATEADLGMADAYINGYFSFVDKREGLLNLFLILIANRDAQ  415

Query  2014  ASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2193
              S + + SKRGWWTP+L T+ IASAKYF+RHISR+NT+TQ RRNIS+HYDLSN+ FSLFL
Sbjct  416   KSNNSAASKRGWWTPMLLTAGIASAKYFLRHISRKNTVTQTRRNISQHYDLSNDFFSLFL  475

Query  2194  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2373
             D +MTYSCAVFK EDE L+ AQ RK++LLI KAK+ + HH+LEIG GWGSLA++ V++TG
Sbjct  476   DPSMTYSCAVFKVEDESLEVAQRRKVNLLIKKAKVERNHHVLEIGSGWGSLAMQVVKQTG  535

Query  2374  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHE  2553
             CKYTGITLSE+QLKYAE KV+EAGL+D I FLLCDYRQ+P   +YDRIISCEM+E VGHE
Sbjct  536   CKYTGITLSEEQLKYAEMKVKEAGLEDRITFLLCDYRQIPSRSKYDRIISCEMIEGVGHE  595

Query  2554  FMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSA  2733
             FM++FFG CES+LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TSA
Sbjct  596   FMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITSA  655

Query  2734  MAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAG  2913
             M+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL LGFD KFIR WEYYF YCAAG
Sbjct  656   MSAASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAILALGFDDKFIRVWEYYFIYCAAG  715

Query  2914  FHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  3009
             F + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  716   FKSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  749



>gb|AES60365.2| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=825

 Score =  1067 bits (2759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/875 (61%), Positives = 660/875 (75%), Gaps = 57/875 (7%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGG---HAKTVTLDGVDLD-LGFMVF  570
             MRVAVVGAGISGLVSAYVLAK G  VV+YEKED+LG    H  T      D D +GFM+ 
Sbjct  1     MRVAVVGAGISGLVSAYVLAKAGVNVVLYEKEDHLGEEGIHGNTQQY-AFDFDHMGFMLL  59

Query  571   NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  750
             N V YPN+MELF+SL VD ++S +S SVSLDNG GYEWG++NG S LFAQKKN++NPYFW
Sbjct  60    NPVNYPNIMELFDSLEVDKKLSYLSTSVSLDNGKGYEWGTQNGLSSLFAQKKNVINPYFW  119

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWS-  927
             +MI+E+ KFK DVLSYL+  + N D++ N+T+  FIKSRGYSELFQKAY+IP+C SIW  
Sbjct  120   KMIKEVSKFKEDVLSYLDIVETNQDIEHNETMEHFIKSRGYSELFQKAYLIPLCCSIWPW  179

Query  928   -CSS-EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIR  1101
              CSS EGVM+FS++S+L+F  NHHLLQL   PQ   V+  S +++ KV+E+L    C+I+
Sbjct  180   PCSSPEGVMSFSSFSVLTFLSNHHLLQLIYSPQCKIVRWNSQNFIKKVKEKLASENCQIK  239

Query  1102  CGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRIL  1281
               CEVH VST ++G      ++  K+  +E YD CI+A HAPD LK+LG +AT DE RIL
Sbjct  240   VNCEVHLVSTSDKG-----CVVLCKDGSEEMYDSCIIAVHAPDVLKILGDEATSDECRIL  294

Query  1282  GAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLV  1461
             GAFQYVY D +L                      +N+ VC+TYW++ LQN+ +T  P  +
Sbjct  295   GAFQYVYCDTFL----------------------LNDSVCVTYWIDILQNVEETSGPSFI  332

Query  1462  TLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKA  1641
             T+NP +TP+  L KW+TGH VP+VAAS+AS EL  IQGKR+IWF G YQGY +H D LKA
Sbjct  333   TVNPNQTPQNTLFKWSTGHLVPTVAASKASHELNHIQGKRKIWFSGVYQGYAYHGDELKA  392

Query  1642  GMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1821
             GM AA+ +L + CS   N  ++VPSW E GARL VTRFL+++I TG ++LLE+GGT+FTF
Sbjct  393   GMDAAYDILGRICSLQRNLKYIVPSWTEVGARLFVTRFLSAYITTGCLMLLEDGGTIFTF  452

Query  1822  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2001
             EG+ KK  LK ++R+H+PQFYWKV T +DLGLA                      I +AN
Sbjct  453   EGSKKKCSLKSVLRIHNPQFYWKVMTNSDLGLAS---------------------ILIAN  491

Query  2002  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2181
             RD + S S +   RGWWTP+ FT+ +ASAK+FI+H+SR+NT+TQARRNIS HYDLSN+LF
Sbjct  492   RDFNLSNS-TLKNRGWWTPVFFTAGLASAKFFIKHVSRKNTVTQARRNISMHYDLSNDLF  550

Query  2182  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2361
             + FLDE M YSC VFK E EDLK AQ RKIS+LI+KA+I ++H IL+IGCGWG  AIE V
Sbjct  551   ACFLDEKMQYSCGVFKDEYEDLKDAQKRKISILIEKAQIDRKHEILDIGCGWGGFAIEVV  610

Query  2362  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2541
             ++ GCKYTGITLSE+QLKYAE+KV++AGLQ++I FLLC+YRQL    +YDRI+SCEM+EA
Sbjct  611   KKVGCKYTGITLSEEQLKYAENKVKDAGLQEHITFLLCEYRQLSKTKKYDRIVSCEMIEA  670

Query  2542  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2721
             VGHE+M EFFG C+SVLA++G+LVLQF SIPDERYD YR+SS+FIKEYIFPG C+PSLSR
Sbjct  671   VGHEYMEEFFGCCDSVLADDGLLVLQFTSIPDERYDAYRRSSEFIKEYIFPGCCIPSLSR  730

Query  2722  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2901
             VT AMAA+SRLCVEH E+IGIHYY TLR WR NF+E  S+IL LGFD+KFIR WEYYFDY
Sbjct  731   VTLAMAAASRLCVEHAENIGIHYYPTLRWWRKNFMENHSKILALGFDEKFIRIWEYYFDY  790

Query  2902  CAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLAS  3006
             CAAGF + TLG+YQ+VFSRPGN TAF +  K +AS
Sbjct  791   CAAGFKSRTLGNYQMVFSRPGNKTAFSNLDKKMAS  825



>ref|XP_008224159.1| PREDICTED: uncharacterized protein LOC103323914 isoform X3 [Prunus 
mume]
Length=689

 Score =  1065 bits (2755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/684 (75%), Positives = 590/684 (86%), Gaps = 5/684 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KMRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRV
Sbjct  5     KMRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRV  64

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFWQM+
Sbjct  65    TYPNMMELFERLGVDMETSDMSFSASLDKGRGCEWGSRNGLSSLFAQKRNLFNPYFWQML  124

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI KFK+D ++YLEE +NNPD+DRN+TLG+FIKSRGYSELFQKAY++P+C SIWSC SE
Sbjct  125   REITKFKHDAINYLEELENNPDIDRNETLGQFIKSRGYSELFQKAYLVPVCGSIWSCPSE  184

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
             GVM+FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RSH YV KVRE LE +GC+IR   EVH
Sbjct  185   GVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCQIRTSSEVH  244

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
              VST ++G +    I+SG  + +E YDGCIMA HAPD +++LG QAT DELR+LGAFQYV
Sbjct  245   RVSTTDEGCS----ILSGDGL-EEIYDGCIMAVHAPDAVRILGDQATSDELRVLGAFQYV  299

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDI+LHR+++ MP+N AAWSAWNFLG+  N+VCLTYWLN LQN+ +   P+LVTLNP  
Sbjct  300   YSDIFLHRDKTLMPQNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDEKGLPFLVTLNPDH  359

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TPE  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAYQGYGFHEDGLKAGM AA 
Sbjct  360   TPEHTLLKWSTSHPVPSVAASKASVELHRIQGKRGIWFCGAYQGYGFHEDGLKAGMAAAR  419

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             G+L K CS L+NP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT+F FEGT K 
Sbjct  420   GILGKGCSLLSNPKHMVPSLTETGARLFVTRFLRHYISTGCLILLEEGGTIFNFEGTRKG  479

Query  1840  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2019
               LK ++RVH+PQFYWKV TQADLGLADAYI+GD SF+DK +GLLNLF I +ANRD ++S
Sbjct  480   CSLKCVLRVHTPQFYWKVMTQADLGLADAYINGDFSFIDKDKGLLNLFMILIANRDSNSS  539

Query  2020  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2199
              S  N KRGWWTPLLFT++IASAKYF +H+SR+NTLTQARRNISRHYDLSN+LFS FLDE
Sbjct  540   DSTLNKKRGWWTPLLFTASIASAKYFFQHVSRKNTLTQARRNISRHYDLSNDLFSQFLDE  599

Query  2200  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2379
             TMTYS AVFK+EDEDLKTAQ+RKISLLI+K++I K H +LEIGCGWGSLAIE V++TGCK
Sbjct  600   TMTYSSAVFKTEDEDLKTAQLRKISLLIEKSRIEKNHEVLEIGCGWGSLAIEVVKQTGCK  659

Query  2380  YTGITLSEQQLKYAEDKVREAGLQ  2451
             YTGITLSE+QLKYA+ KV++AGLQ
Sbjct  660   YTGITLSEEQLKYAQQKVKDAGLQ  683



>ref|XP_002964119.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
 ref|XP_002992048.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ06897.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ34452.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
Length=864

 Score =  1060 bits (2741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/873 (60%), Positives = 658/873 (75%), Gaps = 16/873 (2%)
 Frame = +1

Query  406   RVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             R+AV+GAG+SGLV+AY L K G   VV+YEKE+Y GGHA+T   +G+ +DLGFMVFN+VT
Sbjct  3     RIAVIGAGVSGLVAAYTLCKAGCHEVVLYEKENYFGGHARTEDANGIAVDLGFMVFNQVT  62

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM+ LF+ LGVDME SDMSFSVSLD G G EWGS  G + +FAQK NL+NPYF +MIR
Sbjct  63    YPNMVSLFDELGVDMETSDMSFSVSLDGGKGCEWGS-TGLAAVFAQKSNLVNPYFLRMIR  121

Query  763   EILKFKNDVLSYLEEFDNNPD-MDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             EI+KF++DVL+YL + +   D +D N TLG F++  GYSE F+  Y+IP+CASIWSCSSE
Sbjct  122   EIVKFQDDVLNYLNKLEQGDDAVDPNQTLGSFLQLHGYSEKFRDCYLIPVCASIWSCSSE  181

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
              V+ FSA SIL+FCRNHHLLQ+FGRPQWLTVK RS  YV K+  EL K GCE+R GC V 
Sbjct  182   QVLGFSAASILTFCRNHHLLQIFGRPQWLTVKDRSIKYVEKIVAELTKMGCELRLGCAVS  241

Query  1120  SVSTDEQGSAGGVVII--SGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQ  1293
              +S+ E    GGV +I  SG+ +V   YD C++AAHAPD L +LG+ ATFDE R+LGAFQ
Sbjct  242   RISSTE----GGVKLILESGEKVV---YDTCLVAAHAPDALTLLGETATFDERRLLGAFQ  294

Query  1294  YVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTK-QPYLVTLN  1470
             Y YSDIYLHR+++ MP++ AAWSAWNFLG+V  RVC+TYWLN LQNLGDT+ +PYLVTLN
Sbjct  295   YSYSDIYLHRDRALMPKSTAAWSAWNFLGSVQGRVCVTYWLNLLQNLGDTEGKPYLVTLN  354

Query  1471  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1650
             PPR P+  + KW TGHPVPS  A+ A  EL+ IQG R+IWF GAYQGYGFHEDGLKAGM 
Sbjct  355   PPRPPKNLISKWRTGHPVPSPGAATALKELDTIQGARKIWFAGAYQGYGFHEDGLKAGMA  414

Query  1651  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1830
             AA+ LL  +   L+N   +  +W ++ AR  VT+FL  +IV G +  +E GGT+  F G 
Sbjct  415   AANSLLGAKYQALSNVKQLNFTWCQSQARREVTKFLQKYIVFGKLQFIEAGGTILDFVGK  474

Query  1831  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2010
             D    L   +R+H P FYWK+AT++DLGLA+AY+ GD + +D + GLLNL  I + NRD 
Sbjct  475   DCD--LTSKLRIHHPDFYWKIATRSDLGLAEAYMDGDFTCIDSQNGLLNLLLIIIKNRDW  532

Query  2011  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2190
                 S  + KRGWWTP + T+A  SA  +++H  R N++  AR+NIS HYDLSNE+FSLF
Sbjct  533   MLK-SLKDEKRGWWTPPILTAAFGSAVAYLKHKLRNNSIVNARKNISEHYDLSNEMFSLF  591

Query  2191  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2370
             LDETMTYSCA+FK  +E LK AQ+RKI  LIDKA+I   H +LEIG GWGS+A+E V RT
Sbjct  592   LDETMTYSCAIFKGPEEPLKDAQLRKIHHLIDKARIDNSHEVLEIGFGWGSMAVEVVRRT  651

Query  2371  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2550
             GCKYTGI+LSE+QL +A+  V +  L+D I   LCDYR L    +Y+RIISCEM+EAVG 
Sbjct  652   GCKYTGISLSEEQLAFAKQLVTQERLEDKITLKLCDYRCLEGCKKYNRIISCEMMEAVGP  711

Query  2551  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2730
             E+ +EFF +C+ +LAE+G+ V+Q I++P+ERYDE R+SS+FIKEYIFPGG LP L+ +T+
Sbjct  712   EYYDEFFAKCDYLLAEDGLAVIQVITVPEERYDELRRSSEFIKEYIFPGGSLPCLAALTA  771

Query  2731  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2910
             AM  +S LCVEHLE+IG+HYYQTL CWR NF  + S+I  LGF + F+R W+YYF YCAA
Sbjct  772   AMFRASSLCVEHLENIGLHYYQTLMCWRRNFNSKTSEIAKLGFSESFMRKWDYYFIYCAA  831

Query  2911  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             GF TCTLG+ QIVFSR GN  A G+PY+   +A
Sbjct  832   GFLTCTLGNLQIVFSRSGNAAALGNPYRSFPTA  864



>ref|XP_007144121.1| hypothetical protein PHAVU_007G1305000g, partial [Phaseolus vulgaris]
 gb|ESW16115.1| hypothetical protein PHAVU_007G1305000g, partial [Phaseolus vulgaris]
Length=694

 Score =  1059 bits (2738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/698 (72%), Positives = 596/698 (85%), Gaps = 5/698 (1%)
 Frame = +1

Query  901   IPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELE  1080
             IP+C SIWSCSSEGV++FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RS +YV KV EEL+
Sbjct  1     IPICGSIWSCSSEGVLSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSQNYVKKVVEELQ  60

Query  1081  KRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQAT  1260
             + G +I    EVH VST E+G      ++  K+  QE YDGC+++ HAPD L++LG +AT
Sbjct  61    REGSQIITNREVHFVSTTEKG-----CVVYCKDGSQEVYDGCVLSVHAPDALRLLGDEAT  115

Query  1261  FDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGD  1440
             +DE RILGAFQY YSDI+LHR+++ MP+N AAWSAWNFLG+ NN+VC+TYWLN LQN+ +
Sbjct  116   YDEHRILGAFQYAYSDIFLHRDKNLMPQNPAAWSAWNFLGSNNNKVCVTYWLNILQNIKE  175

Query  1441  TKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGF  1620
             T  P+LVTLNP   PE  L+KW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAYQG GF
Sbjct  176   TSLPFLVTLNPDHIPENTLVKWSTGHPVPSVAAFKASLELDYIQGKRKIWFSGAYQGNGF  235

Query  1621  HEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEE  1800
             HEDG KAGMIAAHG+L KRC    NP HMVPSW E GAR+ VTRFL+ ++ TG + LLEE
Sbjct  236   HEDGFKAGMIAAHGILGKRCVLQTNPKHMVPSWKELGARIFVTRFLSCYVNTGCLTLLEE  295

Query  1801  GGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNL  1980
             GGT+FTFEGT +  +LK ++R+HSPQFYWKV  QADLGLADAYI+GD SFVDK EGLLNL
Sbjct  296   GGTMFTFEGTGENGILKSVLRIHSPQFYWKVMAQADLGLADAYINGDFSFVDKDEGLLNL  355

Query  1981  FKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHY  2160
               I +ANRD +AS S     RGWWTP+ FTSA+ SAK+F+ H+SR+NTLTQARRNISRHY
Sbjct  356   ILILIANRDSNASNSHLKKNRGWWTPVFFTSALTSAKFFMDHVSRRNTLTQARRNISRHY  415

Query  2161  DLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWG  2340
             DLSNELF++FLDETMTYSCAVFK++DEDLK AQ RKISLLI KAKI K H ILEIGCGWG
Sbjct  416   DLSNELFAIFLDETMTYSCAVFKNKDEDLKDAQRRKISLLIQKAKIDKTHEILEIGCGWG  475

Query  2341  SLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRII  2520
             SLAIE V++TGC+YTGITLS++QLK+AE +V++AGLQD I+FLLCDYRQLP   ++DRII
Sbjct  476   SLAIEVVKQTGCRYTGITLSKEQLKFAEQRVKDAGLQDYIKFLLCDYRQLPKTYKFDRII  535

Query  2521  SCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGG  2700
             SCEM+EAVGHE+M EFFG CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGG
Sbjct  536   SCEMIEAVGHEYMEEFFGCCESVLAQNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGG  595

Query  2701  CLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRT  2880
             CLPSLSR+TSAMA +SRLCVEH+E++GIHYYQTLRCWR NF+ERQ++IL LGF++KFIRT
Sbjct  596   CLPSLSRITSAMATTSRLCVEHVENLGIHYYQTLRCWRKNFMERQNEILALGFNEKFIRT  655

Query  2881  WEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYK  2994
             WEYYFDYC AGF + TLG+YQ+VFSRPGNV AFGDPYK
Sbjct  656   WEYYFDYCGAGFKSLTLGNYQVVFSRPGNVAAFGDPYK  693



>ref|XP_010670925.1| PREDICTED: uncharacterized protein LOC104887860 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=793

 Score =  1053 bits (2724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/795 (64%), Positives = 626/795 (79%), Gaps = 9/795 (1%)
 Frame = +1

Query  640   MSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNN  819
             MS SVSLD G G EWGSRNGF  LFAQ  N L P FW+M++EI KFK+DV+ YL+  + N
Sbjct  1     MSVSVSLDKGQGCEWGSRNGFRSLFAQTTNALKPNFWRMVQEIKKFKDDVIMYLDGLELN  60

Query  820   PDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRNHHLL  999
             P++DR +T G FIKSR YSELFQKAY+IP+ AS W CSSE VM FSA+S+LSFCRNHHLL
Sbjct  61    PEIDRAETFGHFIKSRSYSELFQKAYLIPVFASFWCCSSERVMDFSAFSVLSFCRNHHLL  120

Query  1000  QLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKN  1179
             +L G PQWL+V   S  YVNK+REELE RG +IR  CEV+ VST ++G A    +  G  
Sbjct  121   ELSGGPQWLSVSGGSQQYVNKLREELEVRGSQIRTSCEVNFVSTSDKGCA----LFYGDG  176

Query  1180  MVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAW  1359
               ++ YDGCI+A  AP+ LK+LGK+ T DE RILGA QYV  DI+LHR++ FMP+N AAW
Sbjct  177   -SEDLYDGCIIAVPAPNALKILGKEVTDDETRILGALQYVGRDIFLHRDKKFMPQNPAAW  235

Query  1360  SAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaa  1539
             SA NF G+ +N VCLTYW+N LQN+  T QP L+T+NPP  PE  LLK +TG  VPSVA+
Sbjct  236   SALNFQGSTDNTVCLTYWINVLQNISKTDQPLLLTINPPHPPENFLLKRSTGVLVPSVAS  295

Query  1540  srassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSW  1719
              +AS EL  IQGKR IWFCG   G GFHEDGLKAG+IAA+ +LK+   PL NP  M  SW
Sbjct  296   MKASLELRNIQGKRGIWFCGTRHGNGFHEDGLKAGLIAANDVLKRTFLPLPNPKKMALSW  355

Query  1720  PETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVAT  1899
              E  AR  + R+L SFI  G +ILLE+GGTV  FEG+DK+   K  +RVH+PQFYWKVA 
Sbjct  356   TEATARRYIIRYLKSFISAGCLILLEDGGTVLKFEGSDKRCTWKTAIRVHNPQFYWKVAL  415

Query  1900  QADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSK----RGWWTPLLF  2067
             +ADLGLADA+I+GDIS VDK +GLL+LF+IF+AN  L   VS    K    +GWWTP+ F
Sbjct  416   EADLGLADAFINGDISIVDKDDGLLDLFRIFLANMYLYRCVSMDEKKSFDFKGWWTPMFF  475

Query  2068  TSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDL  2247
             T+ IASAKYF +H+SR+N++T ARRNI+RHYDLSNE+FSLFLD+TMTYSCAVFKS+DEDL
Sbjct  476   TAGIASAKYFYQHLSRKNSVTLARRNIARHYDLSNEMFSLFLDDTMTYSCAVFKSKDEDL  535

Query  2248  KTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAED  2427
             K AQ+RK+ LLI+KA++ K+H +L+IGCGWGSLAIE V++TGC+YTGITL+E+QLK AE 
Sbjct  536   KVAQLRKLHLLIEKARVEKQHEVLDIGCGWGSLAIEIVKKTGCRYTGITLAEEQLKLAEQ  595

Query  2428  KVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGI  2607
             +V+EAGLQD+I+FLLCDYRQLP + ++DRIISC MLE VG E+  +FF  CES+LA+ G+
Sbjct  596   RVKEAGLQDHIKFLLCDYRQLPASHKFDRIISCGMLEHVGDEYYEDFFRHCESLLADTGL  655

Query  2608  LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIH  2787
             LVLQ ISIPDERYD +R+SSDF++EYIFPGGCLPSLSR+T+AMA++SRLCVEH+E+IG+H
Sbjct  656   LVLQTISIPDERYDGHRKSSDFMREYIFPGGCLPSLSRLTTAMASASRLCVEHVENIGVH  715

Query  2788  YYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  2967
             Y Q LRCWR NFLE Q +I  LGFD KF+R WEYYFDY A+ F T TLGDYQIVFSR GN
Sbjct  716   YGQALRCWRKNFLENQGKIRSLGFDDKFMRAWEYYFDYMASMFKTRTLGDYQIVFSRQGN  775

Query  2968  VTAFGDPYKGLASAY  3012
             + AF DPY+ + S++
Sbjct  776   LVAFSDPYECIPSSH  790



>ref|XP_004169247.1| PREDICTED: uncharacterized protein LOC101225338, partial [Cucumis 
sativus]
Length=800

 Score =  1053 bits (2723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/801 (62%), Positives = 629/801 (79%), Gaps = 7/801 (1%)
 Frame = +1

Query  613   LGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVL  792
             L V++E S+MSFS+S+D G GYEWG+RNG S LFAQK N+L+P FWQMIREI KF +DV 
Sbjct  1     LEVEIEESNMSFSISIDKGRGYEWGTRNGVSSLFAQKNNILDPSFWQMIREITKFNHDVT  60

Query  793   SYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSIL  972
              YL   +N   +D+N+TLG+F+ SR YS++FQ AY++PMC SIWS   E V+ FSA S+ 
Sbjct  61    DYLTAMENKQVLDQNETLGQFLNSRDYSDVFQTAYLLPMCGSIWSNPIEKVVNFSAVSVF  120

Query  973   SFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAG  1152
             S+ ++H LLQLFG PQWLTVK  S+SY+ K+++ LE  GC+IR   +V+S+ST ++G   
Sbjct  121   SYLQDHCLLQLFGHPQWLTVKSSSNSYLKKLQKALESAGCQIRTCSKVNSISTTKEG---  177

Query  1153  GVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQS  1332
                I+S     +E +D C++A +A D L +LG +AT +E R+LGAF YV+SD+ LH ++S
Sbjct  178   --CIVSYGVHFEEIFDQCVIATNATDALSILGNEATQEEKRVLGAFHYVFSDMILHHDKS  235

Query  1333  FMPRNLAAWSAWNFLGT-VNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWT  1509
             FMP+NL AWSA NFLG   NN  C+TYW+N +QN    K P+ VT NP + P+  L+K +
Sbjct  236   FMPQNLNAWSALNFLGNNTNNEACMTYWINAIQNNLGEKSPFFVTSNPEQEPKNILVKSS  295

Query  1510  TGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPL  1689
              GHP+PS++A +A +EL+ IQGKR+IWFCG Y G G HEDGLKAG I AH +L K  + L
Sbjct  296   IGHPIPSLSAFKALNELDSIQGKRQIWFCGPYLGSGSHEDGLKAGTIVAHKILGKSITIL  355

Query  1690  -NNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRV  1866
              NNPNHMVPS  E GAR +VT+F A +I  GS+ ++EEGG +FTF+G D K L  V+++V
Sbjct  356   SNNPNHMVPSLVEIGARYVVTKFFARYISIGSLTIMEEGGRLFTFKGMDNKFLPNVVLKV  415

Query  1867  HSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRG  2046
             H+P FYWK+ T+AD+GLADAYI+ D SFVDK EGL NL +I +AN+D ++SV++ N KRG
Sbjct  416   HNPNFYWKIMTRADIGLADAYINADFSFVDKNEGLFNLVQILIANKDANSSVAKLNKKRG  475

Query  2047  WWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVF  2226
             WWTP L+T+ IA AKYF +H  RQNT+TQAR NISRHYDLSNELFSLFLD+TMTYSCA+F
Sbjct  476   WWTPPLYTAGIAYAKYFFQHTLRQNTITQARTNISRHYDLSNELFSLFLDDTMTYSCAIF  535

Query  2227  KSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQ  2406
             K EDEDL+ AQ+RKIS LI KA+I K HH+L+IGCGWGSLAIE V++TGC  T ITLSE+
Sbjct  536   KREDEDLRVAQLRKISHLIKKARIDKNHHVLDIGCGWGSLAIELVKQTGCHCTAITLSEE  595

Query  2407  QLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCES  2586
             QLKYAE KV+  GLQDNI+F LCDYRQLP+  +YDRIISC MLE VGHEFM +FFG CES
Sbjct  596   QLKYAERKVKVLGLQDNIKFHLCDYRQLPNTPKYDRIISCGMLECVGHEFMEDFFGSCES  655

Query  2587  VLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  2766
              L ENG+LVLQFIS+PD++YDE+R SS F++EYIFPGGCLPSL+RVT+AMA +SR CVEH
Sbjct  656   ALVENGLLVLQFISMPDDQYDEHRLSSGFMREYIFPGGCLPSLNRVTTAMAKASRFCVEH  715

Query  2767  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  2946
             LE+IGIHYYQTL+CWR NF+  + +I++LGFD+ FIRTWEYYFDYCAAGF +  +GDYQI
Sbjct  716   LENIGIHYYQTLKCWRKNFVMNKRKIIELGFDESFIRTWEYYFDYCAAGFKSRIIGDYQI  775

Query  2947  VFSRPGNVTAFGDPYKGLASA  3009
             VFSR GNVT F +PY+G+ SA
Sbjct  776   VFSRAGNVTTFNNPYQGIPSA  796



>ref|XP_001769171.1| predicted protein [Physcomitrella patens]
 gb|EDQ66043.1| predicted protein [Physcomitrella patens]
Length=864

 Score =  1034 bits (2674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/858 (59%), Positives = 635/858 (74%), Gaps = 7/858 (1%)
 Frame = +1

Query  439   LVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLG  618
             L +A+ LA  G  V +YEKEDY+GGHA+T+   G+ LD GFMVFNRVTYPNM++ FE  G
Sbjct  13    LTAAHTLASAGIQVTLYEKEDYVGGHARTIHDVGIGLDTGFMVFNRVTYPNMIDFFEQAG  72

Query  619   VDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSY  798
             V+ME SDMSFSVSL+ G G EWGS     GLFAQK+N++NP+F+QMIREI++FK+DVLSY
Sbjct  73    VEMEESDMSFSVSLNGGKGCEWGS-TSLGGLFAQKRNMINPFFFQMIREIVRFKDDVLSY  131

Query  799   LEEFDNNPDMDRND-TLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILS  975
             LE+ ++  +  R D TLGEF+ S  YS  F++ Y++P+C SIWSCSS+ V+ FSA SIL+
Sbjct  132   LEKIESGDESIRQDETLGEFLASHKYSNKFRECYLVPVCGSIWSCSSDVVLGFSAASILT  191

Query  976   FCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGG  1155
             FC+NHHLLQLF RPQWLTVK RS +YV K+   LE  G +IR  CEV  +S+     AGG
Sbjct  192   FCKNHHLLQLFQRPQWLTVKGRSETYVAKMVAGLEAAGADIRTSCEVKRISS----IAGG  247

Query  1156  VVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSF  1335
             V I   +  V E +D C++ +HAPD L+MLG+ AT +E  ILGAFQY  S IYLHR+  +
Sbjct  248   VEIEDARGGV-EVFDRCLVGSHAPDALQMLGEGATHEERTILGAFQYSPSTIYLHRDDKW  306

Query  1336  MPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTG  1515
             MPRN AAWSAWNFLG  + +VC++YWLN LQNLG+T +PYLVTLNP   P   +  W T 
Sbjct  307   MPRNQAAWSAWNFLGDSSGQVCVSYWLNILQNLGNTGKPYLVTLNPTEEPRHIVNVWRTS  366

Query  1516  HpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNN  1695
             HP+PS  A++A+     IQGKR IWFCGAYQGYGFHEDGLK+G+ AA  LL  +  PL  
Sbjct  367   HPIPSPGAAKAAKAFGSIQGKRGIWFCGAYQGYGFHEDGLKSGLEAAFDLLGTQFKPLPL  426

Query  1696  PNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSP  1875
                MVP++ E+  RL+VT FL  FI TG + L E GGTVF F G +K   LK  +RV  P
Sbjct  427   VKQMVPTYLESATRLVVTSFLRKFIRTGHVQLFEAGGTVFNFFGEEKGCTLKTSLRVSDP  486

Query  1876  QFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWT  2055
              FYWK+AT+ DLGLADAYI GD SFVD KEGLLN   I +ANRD+    S  +S   WW+
Sbjct  487   AFYWKIATRQDLGLADAYIDGDFSFVDPKEGLLNFLLIIIANRDIDRLFSSKSSVNPWWS  546

Query  2056  PLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSE  2235
             P+L TS + SA  + RH+ R N+LT  RRNIS+HYDLSN++FSLFLDETMTYSCA+FK  
Sbjct  547   PVLLTSVLGSATSYFRHMMRNNSLTNTRRNISQHYDLSNDMFSLFLDETMTYSCAIFKGP  606

Query  2236  DEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLK  2415
             DE L  AQMRKI+ LIDKA++   H +LEIGCGWG+LAI+ V R+GC+YTGITLS++QL 
Sbjct  607   DEPLVDAQMRKINHLIDKARVESTHEVLEIGCGWGALAIQLVRRSGCRYTGITLSQEQLD  666

Query  2416  YAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLA  2595
             YA+  V+EA L+D I F L DYR +    +++RIISCEMLEAVGHE+  E+F RC+++LA
Sbjct  667   YAQALVKEARLEDKITFQLVDYRNVQGFHKFNRIISCEMLEAVGHEYYAEWFRRCDTLLA  726

Query  2596  ENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLED  2775
             ++G++V+Q ISIP+ERYD YRQSSDFIKEYIFPGGCLPS + +T+AM++ S  CVEH+E+
Sbjct  727   KDGLVVVQVISIPEERYDGYRQSSDFIKEYIFPGGCLPSFAALTTAMSSGSSFCVEHMEN  786

Query  2776  IGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFS  2955
             IGIHY +TL  W+  F   +++I+ LGF +KFIRTW+YYF YCAAGF +CTLG  QIVFS
Sbjct  787   IGIHYCETLLRWQEQFTRNRNKIMKLGFGEKFIRTWDYYFFYCAAGFKSCTLGVLQIVFS  846

Query  2956  RPGNVTAFGDPYKGLASA  3009
             RPGN    G PY    +A
Sbjct  847   RPGNEAFLGCPYVSFPTA  864



>ref|XP_004972625.1| PREDICTED: uncharacterized protein LOC101764920 [Setaria italica]
Length=871

 Score =  1014 bits (2623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/871 (58%), Positives = 650/871 (75%), Gaps = 25/871 (3%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG-----VDLDLGFM  564
             MRVAVVG G+SGL +A+ LA+ GGA V VYEKE++LGG  KT+ +D      V  DLG M
Sbjct  2     MRVAVVGGGLSGLAAAHELARSGGARVTVYEKEEHLGG--KTMAVDDGAGGRVPADLGCM  59

Query  565   VFNRVTYPNMMELFESLGVDMEISDMSFSVSL---DNGHGYEWGSRNGFSGLFAQKKNLL  735
             VFNR+T PNMM  FE LGV++E SDMSFS SL   D G G+EWGS NG SG+ AQK NLL
Sbjct  60    VFNRMTCPNMMRWFEDLGVEVETSDMSFSASLRLDDKGGGFEWGSHNGISGVLAQKSNLL  119

Query  736   NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             +P FW +IREI+KFKN  L YLEE D+  + DRN+TLG+FI+S  YS+LFQ AY+IP+C+
Sbjct  120   SPRFWLVIREIIKFKNHALKYLEE-DHGRNPDRNETLGQFIQSHRYSQLFQDAYLIPLCS  178

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCE  1095
              IWS   +GV+ F A S+LSF R++HLL+LFGRP W TVK  S SYVNKVREELE  GC+
Sbjct  179   CIWSSPPQGVLGFPALSVLSFFRDNHLLELFGRPHWHTVKGGSVSYVNKVREELESMGCQ  238

Query  1096  IRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELR  1275
             I+ GCEV SVS   Q     V  I   +  +E YD  I    APD LK+LG +AT +ELR
Sbjct  239   IKTGCEVSSVSKFNQ-----VYRILEVDGSEEMYDRIIFGLQAPDALKVLGAEATHEELR  293

Query  1276  ILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPY  1455
             ILGAFQY+YSD+Y H ++S MP N  AWSA NFLGT ++ VC+TYWLN +QN+ ++ +P+
Sbjct  294   ILGAFQYIYSDVYFHCDESLMPHNFYAWSARNFLGT-SSGVCVTYWLNIVQNI-ESSRPF  351

Query  1456  LVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGL  1635
             LVT NPPR P    LKW T HP+PS+A+++A+ EL  IQGKR IWFCG YQGYG HED +
Sbjct  352   LVTFNPPRAPNHVFLKWHTSHPIPSLASAKATVELNNIQGKRGIWFCGPYQGYGCHEDSV  411

Query  1636  KAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVF  1815
             KAG +AA  LL+++C+ L NP  MVPSW E GARLLV +    +I  G++ + EEGGT F
Sbjct  412   KAGKVAASELLQRKCNLLVNPKPMVPSWTEAGARLLVLKRFDQYINIGNVSIREEGGTTF  471

Query  1816  TFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFV  1995
             +F    ++  +K +++VH PQFYWK+ T+ADLGLA AYI+G ISF D +EGLLN   I  
Sbjct  472   SFGKACERCHVKSVIQVHDPQFYWKLVTEADLGLAYAYINGYISFSDNREGLLNFILINF  531

Query  1996  ANRDLSASVSRSNS------KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRH  2157
             ANR     + RS++      ++GWW+P L  + IA AKY +RH SR N++++A +NIS+H
Sbjct  532   ANRGERKRLMRSSASKSSSIRKGWWSPWLRITGIACAKYILRHASRNNSVSKAAKNISKH  591

Query  2158  YDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGW  2337
             YDLSN+ F+L+LD +MTYS  +FK+EDE L+ AQ+RKI+ LI+KAK+   HH+L+IG GW
Sbjct  592   YDLSNDFFALYLDPSMTYSSGIFKAEDESLEAAQLRKINSLINKAKVESGHHVLDIGSGW  651

Query  2338  GSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRI  2517
             G+LAIE V++TGCKYTGITLSE+QLKY++ KV+EAGL+D I FLLCDYRQ+P + ++DRI
Sbjct  652   GTLAIELVKKTGCKYTGITLSEEQLKYSKRKVKEAGLEDRISFLLCDYRQIPTDQKFDRI  711

Query  2518  ISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPG  2697
             ISCEM+E VGHE+M++FFG CE  LAE+G+ VLQFI+IP+E YD+ R   +F+KEYIFPG
Sbjct  712   ISCEMIEHVGHEYMDDFFGSCEYHLAEHGLFVLQFIAIPEELYDKMRTRPEFLKEYIFPG  771

Query  2698  GCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIR  2877
             GCLPSL+RV SAM  +SRLC++H+E+IG HYY TL  WR NF+  + ++  LGFD+KF+ 
Sbjct  772   GCLPSLARVVSAMTNASRLCIQHVENIGDHYYPTLMHWRDNFMANRKKVAALGFDEKFML  831

Query  2878  TWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  2970
             TW+YY  YCAA F + TL DYQIVFSR G+ 
Sbjct  832   TWQYYLTYCAAMFRSRTLMDYQIVFSRSGDA  862



>gb|KHG13738.1| Cyclopropane-fatty-acyl-phospholipid synthase [Gossypium arboreum]
Length=799

 Score =  1013 bits (2619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/805 (61%), Positives = 617/805 (77%), Gaps = 12/805 (1%)
 Frame = +1

Query  601   LFESLGVDMEISDMSFSVSLDNGH-GYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKF  777
             +F+SL VD+E SD+SFS+S D G+ GYEW S+ GFS  FAQKK LLNP+ WQ +REI+KF
Sbjct  1     MFDSLDVDVETSDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNWQNLREIIKF  60

Query  778   KNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFS  957
              NDV SYL   +NNPD+DR +TLG+FI S+GYSE FQ  Y+ P+C S+WS S E V +FS
Sbjct  61    SNDVESYLGSLENNPDIDRTETLGQFINSKGYSENFQNTYLAPICGSMWSSSKEDVTSFS  120

Query  958   AYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDE  1137
             A+SILSFCR HHL QLFG+PQWLT+K  SH +V +V E LE +GC+ + GCEV SV   +
Sbjct  121   AFSILSFCRTHHLYQLFGQPQWLTIKGHSH-FVKRVSEVLETKGCQFKLGCEVQSVLPAD  179

Query  1138  QGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYL  1317
              G+     ++ G    QE Y+GCIMA  AP  LK+LG QATF+E R+LGAFQY  SDI+L
Sbjct  180   NGT----TMVCGDGF-QETYNGCIMAVDAPTALKLLGNQATFEETRVLGAFQYATSDIFL  234

Query  1318  HREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCL  1497
             HR+ + MP+N +AWSA NFL +  N   LTYWLN LQ +G T +P+ VT+NP  TP+  L
Sbjct  235   HRDSTLMPQNKSAWSALNFLNSSKNNAFLTYWLNALQYIGKTSEPFFVTVNPDHTPKNTL  294

Query  1498  LKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKR  1677
             LKW+TGH +PSVAAS+AS EL +IQGKR IWFCG    Y F++D LKAGM AAHG+L K 
Sbjct  295   LKWSTGHAIPSVAASKASLELGQIQGKRGIWFCG----YDFNQDELKAGMDAAHGILGKH  350

Query  1678  CSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVL  1857
              S L++P +M PS+ ET ARL VT+F   +I  G +  LEEGG +FTF+G  +K  LK +
Sbjct  351   SSVLHSPKNMSPSFMETTARLFVTKFFQQYISMGCVTFLEEGGRIFTFKGNMEKCPLKTV  410

Query  1858  VRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNS  2037
             ++VH+PQFYW++  +AD+GLADAYIHGD SF+D+ EGLLNLF+I VAN++ SA+ S SN 
Sbjct  411   LKVHNPQFYWRIMKEADIGLADAYIHGDFSFLDETEGLLNLFRILVANKENSAA-SGSNK  469

Query  2038  KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSC  2217
             +R WW+P L T++I+SAKYF++H+ RQNT+TQARRNISRHYDLSNELF+L+L + M YS 
Sbjct  470   RRTWWSPALLTASISSAKYFVKHLLRQNTITQARRNISRHYDLSNELFTLYLGKMMQYSS  529

Query  2218  AVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITL  2397
              VF++ +E L  AQ RKIS LI+K +I K H +L+IGCGWGSLAIE V+RTGCKYTGITL
Sbjct  530   GVFRTGEEHLDVAQRRKISSLIEKTRIEKWHEVLDIGCGWGSLAIETVKRTGCKYTGITL  589

Query  2398  SEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGR  2577
             SEQQLKYA++KV+EAGLQDNI+ LLCDYRQLP   ++DRIIS EM+E VG E++ EF+  
Sbjct  590   SEQQLKYAQEKVKEAGLQDNIKILLCDYRQLPKEHQFDRIISVEMVEHVGEEYIEEFYRC  649

Query  2578  CESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC  2757
             C+ +L E+G+ VLQFISIP+E   E +Q++ F+KEYIFPGG L SL R  SAMAA++R  
Sbjct  650   CDQLLKEDGLFVLQFISIPEELSKEIQQTAGFLKEYIFPGGTLLSLDRNLSAMAAATRFS  709

Query  2758  VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGD  2937
             VEH+E+IG+ YY TLR WR  FLE  S++L LGFDKKF+RTWEYYFDYCAAGF T TL D
Sbjct  710   VEHVENIGMSYYHTLRWWRKLFLENTSKVLALGFDKKFMRTWEYYFDYCAAGFKTGTLID  769

Query  2938  YQIVFSRPGNVTAFGDPYKGLASAY  3012
             YQ+VFSR GN    GDPYKG  SAY
Sbjct  770   YQVVFSRAGNFGTLGDPYKGFPSAY  794



>ref|XP_002451281.1| hypothetical protein SORBIDRAFT_05g026900 [Sorghum bicolor]
 gb|EES10269.1| hypothetical protein SORBIDRAFT_05g026900 [Sorghum bicolor]
Length=872

 Score =  1013 bits (2619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/870 (59%), Positives = 640/870 (74%), Gaps = 24/870 (3%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG-----VDLDLGFM  564
             MRVAVVG G+SGLV+A+ LA+ GGA V VYEKE++LGG AKTV ++G     V +D+ FM
Sbjct  2     MRVAVVGGGLSGLVAAHELARSGGARVTVYEKEEHLGG-AKTVAVNGGSSGPVLVDVDFM  60

Query  565   VFNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLLN  738
             VFNRVTYPNMME FE LGV+ME SDMSFS SL  + G+G+EWGSRNG S +  QK N L+
Sbjct  61    VFNRVTYPNMMEWFERLGVEMETSDMSFSASLRLNKGNGFEWGSRNGISSVLVQKSNFLS  120

Query  739   PYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCAS  918
             P FW MI EI KFKN  L YLE+   NPD  +N+TLG+FI+S  YS+LFQ AY+IPMCA 
Sbjct  121   PRFWLMINEIFKFKNHALKYLEDHARNPD--QNETLGQFIQSHRYSQLFQDAYLIPMCAC  178

Query  919   IWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEI  1098
             IWSC S+ V  F A  +LSF  ++HLL+LF   QWL VK  S SYVNKVREELE  GC+I
Sbjct  179   IWSCPSQNVFGFPAGFVLSFFCDNHLLELFSPLQWLNVKGGSGSYVNKVREELESMGCQI  238

Query  1099  RCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRI  1278
             + GC+V SVS  +    GG  I+      +E Y+  I   H PD LK+LG +AT DE R+
Sbjct  239   KTGCKVRSVSRLK----GGYRILEADGS-EEIYERIIFCVHPPDALKVLGTEATPDEQRV  293

Query  1279  LGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYL  1458
             L AFQY+YSD+Y H ++SFMP N +AWSA NFLGT ++ VC+TYWLN LQN  ++ +P+L
Sbjct  294   LEAFQYIYSDLYFHCDESFMPHNSSAWSARNFLGTTSSGVCVTYWLNILQNT-ESARPFL  352

Query  1459  VTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLK  1638
              TLNPPR P+  LLKW T HP+PS+AA++A+ EL  IQGKR IWFC  YQGYG HED +K
Sbjct  353   ATLNPPRVPDHVLLKWHTSHPIPSMAAAKATLELNNIQGKRGIWFCVPYQGYGNHEDSVK  412

Query  1639  AGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFT  1818
             AG   A GLL K+C  L NP  MVPSW E GAR LV + +  +I  G+  +LEEGGT  +
Sbjct  413   AGKAVASGLLGKKCDFLVNPKPMVPSWTEAGARFLVAKNMGKYITIGNFSILEEGGTTLS  472

Query  1819  FEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVA  1998
             F  T ++  LK ++RVH+PQFYWK+AT+ D G A +YI+G ISFVDKKEGL N+ +I +A
Sbjct  473   FGKTCERCQLKCVIRVHNPQFYWKIATEGDPGFAYSYINGYISFVDKKEGLQNIVEITLA  532

Query  1999  NRDLSASVSRSNS-------KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRH  2157
             NR     +S S++       K+GWWTPLL  + +  AKY +  + R+NT+++AR+NIS H
Sbjct  533   NRGERKRLSSSHANNKSSYIKKGWWTPLLRINGVTLAKYVLHEVLRRNTISKARKNISAH  592

Query  2158  YDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGW  2337
             YDLSNE F+LFLD TMTYSC +FK EDE L+ AQ+RK+  LI+KAK+   HH+L+IGCGW
Sbjct  593   YDLSNEFFALFLDPTMTYSCGIFKVEDESLEAAQLRKLDNLINKAKVEPGHHVLDIGCGW  652

Query  2338  GSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRI  2517
             GSLAI  V+RTGCK TGITLSE+QLKY + KV+E GL+D I  LLCDYRQ+ +  ++DRI
Sbjct  653   GSLAIRLVKRTGCKCTGITLSEEQLKYGKRKVKEFGLEDRITLLLCDYRQIANGQKFDRI  712

Query  2518  ISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPG  2697
             ISC MLE VGHEF  +FF  CE  LAE+G+LVLQ I+ P+E YD+ R   +F+KEYIFPG
Sbjct  713   ISCGMLEHVGHEFYEDFFASCEYHLAEHGLLVLQSIACPEELYDKMRTRPEFLKEYIFPG  772

Query  2698  GCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIR  2877
             GCLPSL+R+TSAM+ +SRLCV H+E+IG HYY TL  WR NF+  + ++L LGFD+KFIR
Sbjct  773   GCLPSLARITSAMSNASRLCVHHVENIGYHYYPTLIHWRDNFVANREKVLALGFDEKFIR  832

Query  2878  TWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  2967
             TWEYY +YCAA F +    DYQIVF+RPG+
Sbjct  833   TWEYYLNYCAAMFKSHMGLDYQIVFARPGD  862



>ref|XP_004956057.1| PREDICTED: uncharacterized protein LOC101762231 isoform X2 [Setaria 
italica]
Length=872

 Score =  1011 bits (2615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/871 (58%), Positives = 648/871 (74%), Gaps = 24/871 (3%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHA-KTVTLDG-----VDLDLGF  561
             MRVAVVG G+SGL +A+ LA+ GGA V VYEKE++LGG   KT+ +D      V +DLG 
Sbjct  2     MRVAVVGGGLSGLAAAHELARSGGARVTVYEKEEHLGGGGNKTMAVDDGTGGRVPVDLGC  61

Query  562   MVFNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLL  735
             MVFNR+T PNMM  FE LG+++E SDMSFS SL  D G G+EWG+RNG SG+  QK NLL
Sbjct  62    MVFNRMTCPNMMRWFEDLGLEVETSDMSFSASLRLDKGAGFEWGTRNGISGVLVQKSNLL  121

Query  736   NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             +P FW +IREI+KFKN  L YLE+   NPD  RN+TLG+FI+S  YS+LFQ AY+IPMC 
Sbjct  122   SPRFWLVIREIIKFKNHALKYLEDHGRNPD--RNETLGQFIQSHRYSQLFQDAYLIPMCL  179

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCE  1095
              IWS   +GV+   A S+LSF R++HLL+LFGRPQW TVK  S SYVNKVREELE  GC+
Sbjct  180   CIWSSPPQGVLGIPAVSVLSFFRDNHLLELFGRPQWHTVKGGSGSYVNKVREELESMGCQ  239

Query  1096  IRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELR  1275
             I+ GCEV SV    +     V+ + G    +E YD  I    APD +K+LG +AT +ELR
Sbjct  240   IKTGCEVKSVLKFNE--VYRVLEVDGS---EEMYDRIIFGLQAPDAIKLLGAEATHEELR  294

Query  1276  ILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPY  1455
             ILGAFQY+YSD+Y H ++S MP N  AWSA NFLGT ++ VC+TYWLN +QN+ ++ +P+
Sbjct  295   ILGAFQYIYSDVYFHCDESLMPHNSYAWSARNFLGT-SSGVCVTYWLNIVQNI-ESSRPF  352

Query  1456  LVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGL  1635
             LVT NPPR P    LKW T  P+PS+A+++A+ EL  IQGKR IWFCG YQGY  HED +
Sbjct  353   LVTFNPPRAPNHVFLKWHTSLPIPSLASAKATVELNNIQGKRGIWFCGPYQGYRCHEDSV  412

Query  1636  KAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVF  1815
             KAG +AA  LL+++C+ L NP  MVPSW E GARLLV +    +I  G++ +LEEGGT F
Sbjct  413   KAGKVAASELLQRKCNLLVNPKPMVPSWTEAGARLLVLKHFDQYINIGNVSILEEGGTTF  472

Query  1816  TFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFV  1995
             +F    ++  +K +++VH PQFYWK+AT+ADLG A AYI+G ISF D +EGLLN   I  
Sbjct  473   SFGRAGERCHVKSVIQVHDPQFYWKLATEADLGFAYAYINGYISFSDNREGLLNFILITF  532

Query  1996  ANRDLSASVSRSNS------KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRH  2157
             ANR     + RS++      ++GWW+P L  + IA AKY +RH SR NT+++A +NIS+H
Sbjct  533   ANRGERKRLMRSSASKSSCIRKGWWSPWLRITGIACAKYILRHASRNNTVSKAAKNISKH  592

Query  2158  YDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGW  2337
             YDLSN+ F+L+LD +MTYS  +FK+EDE L+ AQ+RKI+ LI+KAK+   HH+L+IG GW
Sbjct  593   YDLSNDFFALYLDPSMTYSSGIFKAEDESLEAAQLRKINSLINKAKVESGHHVLDIGSGW  652

Query  2338  GSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRI  2517
             G+LAIE V++TGCKYTGITLSE+QLKY++ KV+EAGL+D I FLLCDYRQ+P + ++DRI
Sbjct  653   GTLAIELVKKTGCKYTGITLSEEQLKYSKRKVKEAGLEDRISFLLCDYRQIPTDQKFDRI  712

Query  2518  ISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPG  2697
             ISCEM+E VGHE+M++FFG CE  LAE+G+ VLQFI+IP+E YD+ R   +F+KEYIFPG
Sbjct  713   ISCEMIEHVGHEYMDDFFGSCEYHLAEHGLFVLQFIAIPEELYDKLRTRPEFLKEYIFPG  772

Query  2698  GCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIR  2877
             GCLPSL+RV SAM  +SRLC++H+E+IG HYY TL  WR NF+  + ++  LGFD+KF+ 
Sbjct  773   GCLPSLARVVSAMTNASRLCIQHVENIGDHYYPTLMHWRDNFMANRKKVAALGFDEKFML  832

Query  2878  TWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  2970
             TW+YY  YCAA F + TL DYQIVFSR G+ 
Sbjct  833   TWQYYLTYCAAMFRSRTLMDYQIVFSRSGDA  863



>ref|XP_006664478.1| PREDICTED: uncharacterized protein LOC102701601 [Oryza brachyantha]
Length=822

 Score =  1004 bits (2595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/802 (61%), Positives = 614/802 (77%), Gaps = 10/802 (1%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSV--SLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  750
             VT PNMM+ FE LG +ME SDMSFSV   LD G   EW S NG SGL AQK N LNP FW
Sbjct  17    VTCPNMMQWFEVLGANMERSDMSFSVRTQLDVGRACEWASGNGISGLLAQKSNALNPRFW  76

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSC  930
              MI +ILKFK+D L YLE+  NNPD++ N+TLG+FI+S GY +LFQ+AY+IP+C  IW C
Sbjct  77    CMISDILKFKSDALRYLEDRKNNPDLNLNETLGQFIQSHGYCQLFQEAYLIPICCCIWPC  136

Query  931   SSEGVMAFSAYSILSFCRNHHLLQL--FGRPQWLTVKRRSHSYVNKVREELEKRGCEIRC  1104
              S+ V+ FSA+ +LSF   HH+LQ   FGR + LTVK  S SY+NKV+EELE RGC I+ 
Sbjct  137   PSQQVLGFSAFFVLSFFHKHHILQFSQFGRGEQLTVKGHSQSYINKVKEELESRGCRIKT  196

Query  1105  GCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILG  1284
              C+V  +S+ ++G    V+ + G   ++E YD  I+  HA D LK+LG +AT +ELRILG
Sbjct  197   NCQVKCISSFDRGYR--VLEVDG---LEEMYDRIIVDTHATDALKLLGTEATHEELRILG  251

Query  1285  AFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVT  1464
             AF+Y YSDIYLH ++SFMP N +AWSA NF+G  +   C+TYWLN LQN+  T+  +LVT
Sbjct  252   AFRYAYSDIYLHCDESFMPFNSSAWSACNFMGNKSRCFCVTYWLNLLQNIQSTR-TFLVT  310

Query  1465  LNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAG  1644
             +NP   P   LLKW T H VP+VAAS+AS +L +IQGKR IWFCG YQG GFHEDGLK G
Sbjct  311   VNPSHVPNHVLLKWNTSHLVPAVAASKASLDLGQIQGKRGIWFCGTYQGCGFHEDGLKVG  370

Query  1645  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1824
               AA  LL K+  P+ NP  MV SW ETGARLLV+RFL  +I  G++IL EEGGT+F+F 
Sbjct  371   RAAAQSLLGKKIDPIVNPKQMVLSWTETGARLLVSRFLNQYISVGNLILFEEGGTMFSFG  430

Query  1825  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2004
                KK  +K +++VH P FYWK+AT+ADLGLADAYI+G  SF +K+EGLLNLF I +ANR
Sbjct  431   EACKKCNVKSILQVHDPLFYWKIATEADLGLADAYINGYFSFTNKREGLLNLFLILIANR  490

Query  2005  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2184
             D   S SR +  RGWWTPLL T+  ASAKYF+RH+SR+NT+ Q R+N+S+HYDLSN+ FS
Sbjct  491   DAQRSSSRISCTRGWWTPLLLTAGFASAKYFLRHLSRKNTVAQTRQNVSQHYDLSNDFFS  550

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2364
             LFLD++MTYS A+F  E+E L+ AQ+RK+ +LIDKAK+  +  +LEIG GWGSLAIE V+
Sbjct  551   LFLDKSMTYSSAIFMDEEESLEEAQLRKVKVLIDKAKVEWDQDVLEIGSGWGSLAIEVVK  610

Query  2365  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2544
             +TGCKYTG+T S +QLKYA+ +V+EAGL D I FLLCDYR++P   +YDRII CEM+E V
Sbjct  611   QTGCKYTGVTQSMEQLKYAQRRVKEAGLADQITFLLCDYREIPACHKYDRIICCEMIEEV  670

Query  2545  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2724
             GHE+M+EFFG CES+LAE+GI V+QF SIP+ERYDEYR+SSDFIKEYIFPGGC+P L+R+
Sbjct  671   GHEYMDEFFGCCESLLAEDGIFVIQFSSIPEERYDEYRRSSDFIKEYIFPGGCIPCLTRI  730

Query  2725  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2904
             TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL LGFD++F RTWEYYF Y 
Sbjct  731   TSAMSAASRLCIEHVENIGHHYYPTLVRWRDNFMANKDKILALGFDERFTRTWEYYFMYS  790

Query  2905  AAGFHTCTLGDYQIVFSRPGNV  2970
             AAGF + TLG YQIVFSRPGN 
Sbjct  791   AAGFKSRTLGVYQIVFSRPGNA  812



>ref|XP_007035212.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 4 [Theobroma 
cacao]
 gb|EOY06138.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 4 [Theobroma 
cacao]
Length=672

 Score =  1004 bits (2595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/647 (74%), Positives = 557/647 (86%), Gaps = 5/647 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+G GISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1     MRTAVIGGGISGLVSAYVLAKSGVNVVLYEKEDYLGGHAKTVNFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME SDMSF+VSLD G G EWGSRNG S LFA+K N+LNPYFW+M+R
Sbjct  61    YPNMMEFFESLGVDMEASDMSFAVSLDEGKGCEWGSRNGLSSLFAKKMNILNPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+DV+SYLE  +NNPD+DRN+TLG+FI+SRGYSELFQKAY++P+C SIWSC +E 
Sbjct  121   EISKFKDDVISYLEVLENNPDIDRNETLGQFIESRGYSELFQKAYLVPICGSIWSCPTER  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSA+SILSFCRNHHLLQLFGRPQW+TV+ RSH YVNKVR+ELE RGC+IR GCEVHS
Sbjct  181   VMGFSAFSILSFCRNHHLLQLFGRPQWMTVRWRSHRYVNKVRKELESRGCQIRTGCEVHS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V T    +A G  ++ G +  QE Y+GC+MA HAPD L++LG QAT+DELR+LGAFQYVY
Sbjct  241   VLT----TAEGCTVLCGDDS-QETYEGCVMAVHAPDALRLLGNQATYDELRVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MP+N AAWSAWNFLG+ + +VCLTYWLN LQNLG+T  P+LVTLNP   
Sbjct  296   SDIFLHRDKNLMPKNPAAWSAWNFLGSTDKKVCLTYWLNVLQNLGETSLPFLVTLNPDYI  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+Q LLKW TGHPVPSVAA++AS EL++IQGKR IWFCGAYQGYGFHEDGLKAG +AA+G
Sbjct  356   PQQTLLKWKTGHPVPSVAATKASLELDQIQGKRGIWFCGAYQGYGFHEDGLKAGTVAANG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K CS L+NP HMVPS  ETGARL VTRFL+ FI+TGS+ILLEEGGT+FTFEGT  K 
Sbjct  416   VLGKSCSILSNPKHMVPSLVETGARLFVTRFLSHFILTGSVILLEEGGTMFTFEGTSTKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VH+P  YWKV T+ADLGLADAYI+G+ SFVDKKEGLLNL  I +ANRDL++S 
Sbjct  476   PLKTVLKVHNPHIYWKVMTEADLGLADAYINGEFSFVDKKEGLLNLIMILIANRDLNSSN  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ + +RGWWTPLLFT+ + SAKYF++H+ R N+LTQARRNISRHYDLSN+LF+LFLDET
Sbjct  536   SKLSKQRGWWTPLLFTAGLTSAKYFLKHVLRHNSLTQARRNISRHYDLSNDLFALFLDET  595

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGS  2343
             MTYSCAVFK+EDEDLK AQ RKISLLI+KA+I  +H ILEIGCGW S
Sbjct  596   MTYSCAVFKTEDEDLKDAQQRKISLLIEKARIDSKHEILEIGCGWSS  642



>dbj|BAC83502.1| putative cyclopropane synthase [Oryza sativa Japonica Group]
 dbj|BAC83939.1| putative cyclopropane synthase [Oryza sativa Japonica Group]
Length=798

 Score =   999 bits (2583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/832 (62%), Positives = 625/832 (75%), Gaps = 64/832 (8%)
 Frame = +1

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVS--LDNG--HGYEWGSRNGFSGLFAQKKNLLNP  741
             +VTYPNMME FE LGV+ME+SDMSFSVS  L +G     EWGSRNG +GL AQK N ++P
Sbjct  11    QVTYPNMMEWFEELGVEMELSDMSFSVSAQLQDGDEQTMEWGSRNGLAGLLAQKTNAVSP  70

Query  742   YFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASI  921
              FW+MIREILKFK+DVL+YLEE D NPD+DRN+TLG F++S GYS LFQ+AY++P+CA I
Sbjct  71    AFWRMIREILKFKDDVLTYLEEHDKNPDLDRNETLGHFVQSHGYSRLFQQAYLVPICACI  130

Query  922   WSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIR  1101
             WSC S+GV+ FSA+ +LSFCRNHHLLQLFGRPQWLTVK RSH+YVN+VREELE  GC+I+
Sbjct  131   WSCPSQGVLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHTYVNRVREELESLGCQIK  190

Query  1102  CGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRIL  1281
              GCEV SVS  E G  G  V+ +G    +EAYD  I A HAPD L +LG +AT DE RIL
Sbjct  191   TGCEVQSVSALEGG--GYRVVEAGG--TEEAYDSIIFAVHAPDALNILGDEATHDERRIL  246

Query  1282  GAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNL----GDTKQ  1449
             GAFQYVYSDIYLH ++S MPRN +AWS+WNFLGT    VC+TYWLN LQN+    G  ++
Sbjct  247   GAFQYVYSDIYLHCDKSLMPRNPSAWSSWNFLGTTTTGVCVTYWLNLLQNIEQSAGRGRR  306

Query  1450  PYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHED  1629
             P+LVTLNPPR P+  LL W T HPVPSVAA+ A+ EL R+QG R +WFCGAYQGYGFHED
Sbjct  307   PFLVTLNPPRVPDHVLLAWKTSHPVPSVAAAAAAGELRRVQGCRGLWFCGAYQGYGFHED  366

Query  1630  GLKAGMIAAH--------GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSI  1785
             GLKAGM AA         G  ++R   L NP  MVPSW E GARLLVTRFLA ++  G++
Sbjct  367   GLKAGMAAARGLLLAANGGAGERRL--LANPRQMVPSWTEAGARLLVTRFLAGYVSVGNL  424

Query  1786  ILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKE  1965
              LLEEGGT+F+F    KK   K ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDKK+
Sbjct  425   TLLEEGGTMFSFGEAGKKCQAKCVMRVHDPLFYWKVATEADLGLADAYINGYCSFVDKKQ  484

Query  1966  GLLNLFKIFVANRDLSASVSRSNSK-RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARR  2142
             GLLNL  I +ANRD +   S S S+ RGWWTP+L T+ +ASAKYF+RH+SR+NT+TQ R+
Sbjct  485   GLLNLLLILIANRDANKQSSTSTSRIRGWWTPMLLTAGVASAKYFLRHVSRKNTVTQTRQ  544

Query  2143  NISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILE  2322
             NIS+HYDLSN+ FSLFLD +MTYSCAVFK EDE L+ AQ RK+SLLI KA++ ++HH+LE
Sbjct  545   NISQHYDLSNDFFSLFLDPSMTYSCAVFKDEDESLEAAQQRKVSLLIHKARVERDHHVLE  604

Query  2323  IGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNC  2502
             IG GWGSLAI+ V++TGCKYTG+TLSE+QLKY + KV+EAGL+D++ FLLCDYRQ+P   
Sbjct  605   IGSGWGSLAIQVVKQTGCKYTGVTLSEEQLKYCQRKVKEAGLEDHMTFLLCDYRQIPTVR  664

Query  2503  RYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  2682
             +YDRIISCEM+E VGHE+M++FFG CES+LA++G+ VLQFISIP+ER             
Sbjct  665   KYDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEER-------------  711

Query  2683  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  2862
                                      +EHLE+IG HYY TL  WR NF+  + +I  LGFD
Sbjct  712   -------------------------IEHLENIGYHYYPTLIRWRDNFMANREEIKSLGFD  746

Query  2863  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  3009
              KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  747   DKFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  798



>ref|XP_008796358.1| PREDICTED: uncharacterized protein LOC103711840 isoform X5 [Phoenix 
dactylifera]
Length=683

 Score =   996 bits (2576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/688 (69%), Positives = 575/688 (84%), Gaps = 6/688 (1%)
 Frame = +1

Query  946   MAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSV  1125
             M+FSA+S+L+FCRNHHLLQLFGRPQWLTVK+RSH YV KVR ELE R C+IR GC V SV
Sbjct  1     MSFSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHCYVRKVRGELESRCCQIRTGCAVKSV  60

Query  1126  STDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYS  1305
                +    GG  ++ G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+QYVYS
Sbjct  61    LNID----GGCHVV-GEDQSEETYDGCIISTHAPDALKILGTQATYEESRLLGAYQYVYS  115

Query  1306  DIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTP  1485
             DIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP   P
Sbjct  116   DIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNLPFLVTLNPRFVP  175

Query  1486  EQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGL  1665
             +  LLKW+T HP+PSVAAS+AS E+ +IQGKRRIWFCGAYQG+GFHEDGLKAG++AA+ +
Sbjct  176   KHTLLKWSTSHPIPSVAASKASLEIGKIQGKRRIWFCGAYQGFGFHEDGLKAGIVAANSV  235

Query  1666  LKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNL  1845
             L   C  L NP  MVPS  ETGARL+VTRFL  +I TG + LLEEGGT+F FEGT+KK+ 
Sbjct  236   LGMDCVLLRNPRQMVPSLVETGARLIVTRFLEKYISTGCLTLLEEGGTIFVFEGTNKKSC  295

Query  1846  LKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVS  2025
             +K ++++H P FYWKVAT+ADLGLADAYI+   SFVD++EGLLNLF I + NRD ++S S
Sbjct  296   IKSILKIHDPLFYWKVATEADLGLADAYINRYFSFVDEQEGLLNLFMILIVNRDQNSS-S  354

Query  2026  RSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETM  2205
             +S + RGWWTP+LFT+ + SA+YF+RHISRQNT+ QA +NIS HYDLSNE FSLFLDETM
Sbjct  355   KSKTTRGWWTPILFTAGLQSARYFLRHISRQNTVAQAPKNISHHYDLSNEFFSLFLDETM  414

Query  2206  TYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYT  2385
             TYS A+FK E+EDLK AQ+ KISLLI+KA+I  +H ILEIGCGWGSLAIE V++TGCKYT
Sbjct  415   TYSGAIFKMENEDLKVAQLHKISLLIEKARIEAKHEILEIGCGWGSLAIEVVKQTGCKYT  474

Query  2386  GITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNE  2565
             GITLSE+QLK+A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGHE+M E
Sbjct  475   GITLSEEQLKFAKRRAKEACLEDRITFLLCDYRQLPCYRKYDRIISCEMIEGVGHEYMEE  534

Query  2566  FFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAAS  2745
             FFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA+
Sbjct  535   FFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAAA  594

Query  2746  SRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTC  2925
             SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF + 
Sbjct  595   SRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSR  654

Query  2926  TLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  655   TLGNYQMVFSRPGNSTAFSNPYDGVPSA  682



>ref|XP_008664677.1| PREDICTED: uncharacterized protein LOC103643302 isoform X2 [Zea 
mays]
 tpg|DAA49063.1| TPA: hypothetical protein ZEAMMB73_143484 [Zea mays]
Length=873

 Score =   996 bits (2576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/872 (58%), Positives = 639/872 (73%), Gaps = 25/872 (3%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG----VDLDLGFMV  567
             MRVAVVG G+SGLV+A+ LA+ GGA V VYEKED+LGG AKTV ++G    V +DL FMV
Sbjct  2     MRVAVVGGGLSGLVAAHELARSGGARVTVYEKEDHLGG-AKTVAVNGGSGPVLVDLDFMV  60

Query  568   FNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLLNP  741
             FNRVT+ NMME FE LGV+ME SDMSFS SL  + G G+EWG+RNG S +  QK NLL+P
Sbjct  61    FNRVTFSNMMEWFERLGVEMEKSDMSFSASLRLNEGKGFEWGTRNGISSVLVQKSNLLSP  120

Query  742   YFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASI  921
              FW MI EI KFKN  L Y E++  NPD  +N+T G+FI+S  YS+LFQ AY+IPMCA I
Sbjct  121   RFWLMINEIFKFKNHALKYQEDYARNPD--KNETFGQFIQSHRYSQLFQDAYLIPMCACI  178

Query  922   WSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIR  1101
             WSC  + +  F A  +LSF  ++HLL+LF   QWL VK  S  YV KVREELE  GC+I+
Sbjct  179   WSCPPQNIFGFPAGFVLSFFCDNHLLELFSPLQWLNVKGGSGCYVKKVREELESMGCQIK  238

Query  1102  CGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRIL  1281
              GCEV SVS       GG  I+      +E YD  I   HAPD LK+LG++AT  E R+L
Sbjct  239   TGCEVRSVSRFN----GGYRILEADGS-EEMYDRIIFCVHAPDALKILGEEATPHERRVL  293

Query  1282  GAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLV  1461
             GAFQY+YSD+Y H ++SFMPRN +AWSA NFLGT ++ VC+TYWLN LQN+ ++  P+L 
Sbjct  294   GAFQYIYSDLYFHCDESFMPRNSSAWSAMNFLGTTSSGVCVTYWLNILQNI-ESAGPFLA  352

Query  1462  TLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQ-GYGFHEDGLK  1638
             TLNPPR P+  LLKW T HP+PS+AA+RA+ EL  IQGKR IWFC  YQ GYG HED +K
Sbjct  353   TLNPPRVPDHVLLKWHTRHPIPSMAAARATLELNSIQGKRGIWFCVPYQQGYGNHEDSVK  412

Query  1639  AGMIAAHGLLKKRCSPLNNPNHM-VPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVF  1815
             AG     GLL K+C  L NP  M VPSW E G R +V + L  FI  G+  +LE+GGT  
Sbjct  413   AGKAVTLGLLGKKCDLLVNPKPMIVPSWTEAGVRYMVAKNLGKFITIGNFSMLEDGGTSL  472

Query  1816  TFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFV  1995
             +F  T ++  LK ++RVH+PQFYWK+AT+ D G A +YI+G ISFVDKKEG+ N+ +I +
Sbjct  473   SFGKTCERCQLKCVIRVHNPQFYWKIATEGDPGFAYSYINGYISFVDKKEGIQNIVEIII  532

Query  1996  ANRD----LSASVSRSNS---KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISR  2154
             ANR     LS++ +R+ S   K+GWWTPL   +  A AKY +  + R+NT+++AR+NIS 
Sbjct  533   ANRGERKRLSSTRARNKSGYVKKGWWTPLFKKNGAAMAKYVLHEVLRRNTISKARKNISA  592

Query  2155  HYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCG  2334
             HYDLSN+ F+LFLD TMTYSC +FK+EDE L+ AQ+RK+  LI+KAK+   HH+L+IGCG
Sbjct  593   HYDLSNDFFALFLDPTMTYSCGIFKAEDESLEAAQLRKLDNLINKAKVDPGHHVLDIGCG  652

Query  2335  WGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDR  2514
             WGSLAI  V+RTGCK TGITLSE+QLKY + KV+E GL+D+I  LLCDYRQ+P+  ++DR
Sbjct  653   WGSLAIRLVKRTGCKCTGITLSEEQLKYGKRKVKEFGLEDHITLLLCDYRQIPNGQKFDR  712

Query  2515  IISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFP  2694
             IISC MLE VGHEF  +FF  CE  LAE+G+LVLQ I++P+E YD+ R   DF+KEYIFP
Sbjct  713   IISCGMLEHVGHEFYEDFFASCEYHLAEHGLLVLQSIAVPEELYDKMRTKPDFLKEYIFP  772

Query  2695  GGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFI  2874
             GGC+PSL+R+ SAM+ +SRLC++H+E+IG HYY TL  WR NF   + ++L LGFD+KFI
Sbjct  773   GGCIPSLARIASAMSNASRLCIQHVENIGYHYYPTLIHWRENFEANEEKVLALGFDEKFI  832

Query  2875  RTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  2970
             RTWEYY +YCAA F +    DYQIVF+R G+ 
Sbjct  833   RTWEYYLNYCAAMFKSHMGLDYQIVFARAGDA  864



>ref|XP_008664676.1| PREDICTED: uncharacterized protein LOC103643302 isoform X1 [Zea 
mays]
Length=875

 Score =   996 bits (2575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/872 (58%), Positives = 639/872 (73%), Gaps = 23/872 (3%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG----VDLDLGFMV  567
             MRVAVVG G+SGLV+A+ LA+ GGA V VYEKED+LGG AKTV ++G    V +DL FMV
Sbjct  2     MRVAVVGGGLSGLVAAHELARSGGARVTVYEKEDHLGG-AKTVAVNGGSGPVLVDLDFMV  60

Query  568   FNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLLNP  741
             FNRVT+ NMME FE LGV+ME SDMSFS SL  + G G+EWG+RNG S +  QK NLL+P
Sbjct  61    FNRVTFSNMMEWFERLGVEMEKSDMSFSASLRLNEGKGFEWGTRNGISSVLVQKSNLLSP  120

Query  742   YFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASI  921
              FW MI EI KFKN  L Y E++  NPD  +N+T G+FI+S  YS+LFQ AY+IPMCA I
Sbjct  121   RFWLMINEIFKFKNHALKYQEDYARNPD--KNETFGQFIQSHRYSQLFQDAYLIPMCACI  178

Query  922   WSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIR  1101
             WSC  + +  F A  +LSF  ++HLL+LF   QWL VK  S  YV KVREELE  GC+I+
Sbjct  179   WSCPPQNIFGFPAGFVLSFFCDNHLLELFSPLQWLNVKGGSGCYVKKVREELESMGCQIK  238

Query  1102  CGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRIL  1281
              GCEV SVS     +   ++   G    +E YD  I   HAPD LK+LG++AT  E R+L
Sbjct  239   TGCEVRSVSRFNGETGYRILEADGS---EEMYDRIIFCVHAPDALKILGEEATPHERRVL  295

Query  1282  GAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLV  1461
             GAFQY+YSD+Y H ++SFMPRN +AWSA NFLGT ++ VC+TYWLN LQN+ ++  P+L 
Sbjct  296   GAFQYIYSDLYFHCDESFMPRNSSAWSAMNFLGTTSSGVCVTYWLNILQNI-ESAGPFLA  354

Query  1462  TLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQ-GYGFHEDGLK  1638
             TLNPPR P+  LLKW T HP+PS+AA+RA+ EL  IQGKR IWFC  YQ GYG HED +K
Sbjct  355   TLNPPRVPDHVLLKWHTRHPIPSMAAARATLELNSIQGKRGIWFCVPYQQGYGNHEDSVK  414

Query  1639  AGMIAAHGLLKKRCSPLNNPNHM-VPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVF  1815
             AG     GLL K+C  L NP  M VPSW E G R +V + L  FI  G+  +LE+GGT  
Sbjct  415   AGKAVTLGLLGKKCDLLVNPKPMIVPSWTEAGVRYMVAKNLGKFITIGNFSMLEDGGTSL  474

Query  1816  TFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFV  1995
             +F  T ++  LK ++RVH+PQFYWK+AT+ D G A +YI+G ISFVDKKEG+ N+ +I +
Sbjct  475   SFGKTCERCQLKCVIRVHNPQFYWKIATEGDPGFAYSYINGYISFVDKKEGIQNIVEIII  534

Query  1996  ANRD----LSASVSRSNS---KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISR  2154
             ANR     LS++ +R+ S   K+GWWTPL   +  A AKY +  + R+NT+++AR+NIS 
Sbjct  535   ANRGERKRLSSTRARNKSGYVKKGWWTPLFKKNGAAMAKYVLHEVLRRNTISKARKNISA  594

Query  2155  HYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCG  2334
             HYDLSN+ F+LFLD TMTYSC +FK+EDE L+ AQ+RK+  LI+KAK+   HH+L+IGCG
Sbjct  595   HYDLSNDFFALFLDPTMTYSCGIFKAEDESLEAAQLRKLDNLINKAKVDPGHHVLDIGCG  654

Query  2335  WGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDR  2514
             WGSLAI  V+RTGCK TGITLSE+QLKY + KV+E GL+D+I  LLCDYRQ+P+  ++DR
Sbjct  655   WGSLAIRLVKRTGCKCTGITLSEEQLKYGKRKVKEFGLEDHITLLLCDYRQIPNGQKFDR  714

Query  2515  IISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFP  2694
             IISC MLE VGHEF  +FF  CE  LAE+G+LVLQ I++P+E YD+ R   DF+KEYIFP
Sbjct  715   IISCGMLEHVGHEFYEDFFASCEYHLAEHGLLVLQSIAVPEELYDKMRTKPDFLKEYIFP  774

Query  2695  GGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFI  2874
             GGC+PSL+R+ SAM+ +SRLC++H+E+IG HYY TL  WR NF   + ++L LGFD+KFI
Sbjct  775   GGCIPSLARIASAMSNASRLCIQHVENIGYHYYPTLIHWRENFEANEEKVLALGFDEKFI  834

Query  2875  RTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  2970
             RTWEYY +YCAA F +    DYQIVF+R G+ 
Sbjct  835   RTWEYYLNYCAAMFKSHMGLDYQIVFARAGDA  866



>ref|XP_004956056.1| PREDICTED: uncharacterized protein LOC101762231 isoform X1 [Setaria 
italica]
Length=912

 Score =   994 bits (2570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/911 (55%), Positives = 648/911 (71%), Gaps = 64/911 (7%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHA-KTVTLDG-----VDLDLGF  561
             MRVAVVG G+SGL +A+ LA+ GGA V VYEKE++LGG   KT+ +D      V +DLG 
Sbjct  2     MRVAVVGGGLSGLAAAHELARSGGARVTVYEKEEHLGGGGNKTMAVDDGTGGRVPVDLGC  61

Query  562   MVFNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLL  735
             MVFNR+T PNMM  FE LG+++E SDMSFS SL  D G G+EWG+RNG SG+  QK NLL
Sbjct  62    MVFNRMTCPNMMRWFEDLGLEVETSDMSFSASLRLDKGAGFEWGTRNGISGVLVQKSNLL  121

Query  736   NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             +P FW +IREI+KFKN  L YLE+   NPD  RN+TLG+FI+S  YS+LFQ AY+IPMC 
Sbjct  122   SPRFWLVIREIIKFKNHALKYLEDHGRNPD--RNETLGQFIQSHRYSQLFQDAYLIPMCL  179

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCE  1095
              IWS   +GV+   A S+LSF R++HLL+LFGRPQW TVK  S SYVNKVREELE  GC+
Sbjct  180   CIWSSPPQGVLGIPAVSVLSFFRDNHLLELFGRPQWHTVKGGSGSYVNKVREELESMGCQ  239

Query  1096  IRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELR  1275
             I+ GCEV SV    +     V+ + G    +E YD  I    APD +K+LG +AT +ELR
Sbjct  240   IKTGCEVKSVLKFNE--VYRVLEVDGS---EEMYDRIIFGLQAPDAIKLLGAEATHEELR  294

Query  1276  ILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPY  1455
             ILGAFQY+YSD+Y H ++S MP N  AWSA NFLGT ++ VC+TYWLN +QN+ ++ +P+
Sbjct  295   ILGAFQYIYSDVYFHCDESLMPHNSYAWSARNFLGT-SSGVCVTYWLNIVQNI-ESSRPF  352

Query  1456  LVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGL  1635
             LVT NPPR P    LKW T  P+PS+A+++A+ EL  IQGKR IWFCG YQGY  HED +
Sbjct  353   LVTFNPPRAPNHVFLKWHTSLPIPSLASAKATVELNNIQGKRGIWFCGPYQGYRCHEDSV  412

Query  1636  KAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVF  1815
             KAG +AA  LL+++C+ L NP  MVPSW E GARLLV +    +I  G++ +LEEGGT F
Sbjct  413   KAGKVAASELLQRKCNLLVNPKPMVPSWTEAGARLLVLKHFDQYINIGNVSILEEGGTTF  472

Query  1816  TFEGTDKKNLLKVLVRVHSPQFYWKV----------------------------------  1893
             +F    ++  +K +++VH PQFYWKV                                  
Sbjct  473   SFGRAGERCHVKSVIQVHDPQFYWKVQLSSSRFFFALFLNNILFSSSHLVRDTSYIFTVP  532

Query  1894  ------ATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNS------  2037
                   AT+ADLG A AYI+G ISF D +EGLLN   I  ANR     + RS++      
Sbjct  533   PLFHQLATEADLGFAYAYINGYISFSDNREGLLNFILITFANRGERKRLMRSSASKSSCI  592

Query  2038  KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSC  2217
             ++GWW+P L  + IA AKY +RH SR NT+++A +NIS+HYDLSN+ F+L+LD +MTYS 
Sbjct  593   RKGWWSPWLRITGIACAKYILRHASRNNTVSKAAKNISKHYDLSNDFFALYLDPSMTYSS  652

Query  2218  AVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITL  2397
              +FK+EDE L+ AQ+RKI+ LI+KAK+   HH+L+IG GWG+LAIE V++TGCKYTGITL
Sbjct  653   GIFKAEDESLEAAQLRKINSLINKAKVESGHHVLDIGSGWGTLAIELVKKTGCKYTGITL  712

Query  2398  SEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGR  2577
             SE+QLKY++ KV+EAGL+D I FLLCDYRQ+P + ++DRIISCEM+E VGHE+M++FFG 
Sbjct  713   SEEQLKYSKRKVKEAGLEDRISFLLCDYRQIPTDQKFDRIISCEMIEHVGHEYMDDFFGS  772

Query  2578  CESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC  2757
             CE  LAE+G+ VLQFI+IP+E YD+ R   +F+KEYIFPGGCLPSL+RV SAM  +SRLC
Sbjct  773   CEYHLAEHGLFVLQFIAIPEELYDKLRTRPEFLKEYIFPGGCLPSLARVVSAMTNASRLC  832

Query  2758  VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGD  2937
             ++H+E+IG HYY TL  WR NF+  + ++  LGFD+KF+ TW+YY  YCAA F + TL D
Sbjct  833   IQHVENIGDHYYPTLMHWRDNFMANRKKVAALGFDEKFMLTWQYYLTYCAAMFRSRTLMD  892

Query  2938  YQIVFSRPGNV  2970
             YQIVFSR G+ 
Sbjct  893   YQIVFSRSGDA  903



>ref|XP_003590114.1| Cyclopropane fatty acid synthase [Medicago truncatula]
Length=793

 Score =   994 bits (2569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/831 (59%), Positives = 620/831 (75%), Gaps = 62/831 (7%)
 Frame = +1

Query  553   LGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNL  732
             +  ++  +V YPN+MELF+SL VD ++S +S SVSLDNG GYEWG++NG S LFAQKKN+
Sbjct  12    IKLLITKQVNYPNIMELFDSLEVDKKLSYLSTSVSLDNGKGYEWGTQNGLSSLFAQKKNV  71

Query  733   LNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMC  912
             +NPYFW+MI+E+ KFK DVLSYL+  + N D++ N+T+  FIKSRGYSELFQKAY+IP+C
Sbjct  72    INPYFWKMIKEVSKFKEDVLSYLDIVETNQDIEHNETMEHFIKSRGYSELFQKAYLIPLC  131

Query  913   ASIWS--CSS-EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEK  1083
              SIW   CSS EGVM+FS++S+L+F  NHHLLQL   PQ   V+  S +++ KV+E+L  
Sbjct  132   CSIWPWPCSSPEGVMSFSSFSVLTFLSNHHLLQLIYSPQCKIVRWNSQNFIKKVKEKLAS  191

Query  1084  RGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATF  1263
               C+I+  CEVH VST ++G      ++  K+  +E YD CI+A HAPD LK+LG +AT 
Sbjct  192   ENCQIKVNCEVHLVSTSDKG-----CVVLCKDGSEEMYDSCIIAVHAPDVLKILGDEATS  246

Query  1264  DELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDT  1443
             DE RILGAFQYVY D +L                      +N+ VC+TYW++ LQN+ +T
Sbjct  247   DECRILGAFQYVYCDTFL----------------------LNDSVCVTYWIDILQNVEET  284

Query  1444  KQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFH  1623
               P  +T+NP +TP+  L KW+TGH VP+VAAS+AS EL  IQGKR+IWF G YQGY +H
Sbjct  285   SGPSFITVNPNQTPQNTLFKWSTGHLVPTVAASKASHELNHIQGKRKIWFSGVYQGYAYH  344

Query  1624  EDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEG  1803
              D LKAGM AA+ +L + CS   N  ++VPSW E GARL VTRFL+++I TG ++LLE+G
Sbjct  345   GDELKAGMDAAYDILGRICSLQRNLKYIVPSWTEVGARLFVTRFLSAYITTGCLMLLEDG  404

Query  1804  GTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLF  1983
             GT+FTFEG+ KK  LK ++R+H+PQFYWKV T +DLGLA                     
Sbjct  405   GTIFTFEGSKKKCSLKSVLRIHNPQFYWKVMTNSDLGLAS--------------------  444

Query  1984  KIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYD  2163
              I +ANRD + S S +   RGWWTP+ FT+ +ASAK+FI+H+SR+NT+TQARRNIS HYD
Sbjct  445   -ILIANRDFNLSNS-TLKNRGWWTPVFFTAGLASAKFFIKHVSRKNTVTQARRNISMHYD  502

Query  2164  LSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGS  2343
             LSN+LF+ FLDE M YSC VFK E EDLK AQ RKIS+LI+KA+I ++H IL+IGCGWG 
Sbjct  503   LSNDLFACFLDEKMQYSCGVFKDEYEDLKDAQKRKISILIEKAQIDRKHEILDIGCGWGG  562

Query  2344  LAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIIS  2523
              AIE V++ GCKYTGITLSE+QLKYAE+KV++AGLQ++I FLLC+YRQL    +YDRI+S
Sbjct  563   FAIEVVKKVGCKYTGITLSEEQLKYAENKVKDAGLQEHITFLLCEYRQLSKTKKYDRIVS  622

Query  2524  CEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGC  2703
             CEM+EAVGHE+M EFFG C+SVLA++G+LVLQF SIPDERYD YR+SS+FIKEYIFPG C
Sbjct  623   CEMIEAVGHEYMEEFFGCCDSVLADDGLLVLQFTSIPDERYDAYRRSSEFIKEYIFPGCC  682

Query  2704  LPSLSRVTSAMAASSRLC----------VEHLEDIGIHYYQTLRCWRANFLERQSQILDL  2853
             +PSLSRVT AMAA+SRL           VEH E+IGIHYY TLR WR NF+E  S+IL L
Sbjct  683   IPSLSRVTLAMAAASRLWYMLYFNTANNVEHAENIGIHYYPTLRWWRKNFMENHSKILAL  742

Query  2854  GFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLAS  3006
             GFD+KFIR WEYYFDYCAAGF + TLG+YQ+VFSRPGN TAF +  K +AS
Sbjct  743   GFDEKFIRIWEYYFDYCAAGFKSRTLGNYQMVFSRPGNKTAFSNLDKKMAS  793



>ref|XP_008796357.1| PREDICTED: uncharacterized protein LOC103711840 isoform X4 [Phoenix 
dactylifera]
Length=684

 Score =   992 bits (2564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 477/689 (69%), Positives = 575/689 (83%), Gaps = 7/689 (1%)
 Frame = +1

Query  946   MAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNK-VREELEKRGCEIRCGCEVHS  1122
             M+FSA+S+L+FCRNHHLLQLFGRPQWLTVK+RSH YV K VR ELE R C+IR GC V S
Sbjct  1     MSFSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHCYVRKQVRGELESRCCQIRTGCAVKS  60

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V   +    GG  ++ G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+QYVY
Sbjct  61    VLNID----GGCHVV-GEDQSEETYDGCIISTHAPDALKILGTQATYEESRLLGAYQYVY  115

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP   
Sbjct  116   SDIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNLPFLVTLNPRFV  175

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+T HP+PSVAAS+AS E+ +IQGKRRIWFCGAYQG+GFHEDGLKAG++AA+ 
Sbjct  176   PKHTLLKWSTSHPIPSVAASKASLEIGKIQGKRRIWFCGAYQGFGFHEDGLKAGIVAANS  235

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L   C  L NP  MVPS  ETGARL+VTRFL  +I TG + LLEEGGT+F FEGT+KK+
Sbjct  236   VLGMDCVLLRNPRQMVPSLVETGARLIVTRFLEKYISTGCLTLLEEGGTIFVFEGTNKKS  295

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              +K ++++H P FYWKVAT+ADLGLADAYI+   SFVD++EGLLNLF I + NRD ++S 
Sbjct  296   CIKSILKIHDPLFYWKVATEADLGLADAYINRYFSFVDEQEGLLNLFMILIVNRDQNSS-  354

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+S + RGWWTP+LFT+ + SA+YF+RHISRQNT+ QA +NIS HYDLSNE FSLFLDET
Sbjct  355   SKSKTTRGWWTPILFTAGLQSARYFLRHISRQNTVAQAPKNISHHYDLSNEFFSLFLDET  414

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYS A+FK E+EDLK AQ+ KISLLI+KA+I  +H ILEIGCGWGSLAIE V++TGCKY
Sbjct  415   MTYSGAIFKMENEDLKVAQLHKISLLIEKARIEAKHEILEIGCGWGSLAIEVVKQTGCKY  474

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLK+A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGHE+M 
Sbjct  475   TGITLSEEQLKFAKRRAKEACLEDRITFLLCDYRQLPCYRKYDRIISCEMIEGVGHEYME  534

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA
Sbjct  535   EFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAA  594

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF +
Sbjct  595   ASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRS  654

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
              TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  655   RTLGNYQMVFSRPGNSTAFSNPYDGVPSA  683



>dbj|BAK05129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/869 (58%), Positives = 641/869 (74%), Gaps = 21/869 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVL--AKGGAGVVV--YEKEDYLGGHAKTVTLDG-------VDL  549
             MRVAVVG G+SGL +A+ L  A GG  V V  YE+E+ LGGHA+TV +D        V+L
Sbjct  1     MRVAVVGGGVSGLAAAHELLGASGGGDVRVTLYEQEESLGGHARTVAVDDDDGAGGCVNL  60

Query  550   DLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDN---GHGYEWGSRNGFSGLFAQ  720
             DLGF  FN+VTY +MME    LGV+ME +DMS SVS  +   G G EWG+ NG S L AQ
Sbjct  61    DLGFTSFNQVTYSHMMEWLVGLGVEMERTDMSLSVSTQSDGAGGGCEWGNSNGISSLLAQ  120

Query  721   KKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYI  900
             K N+L   FW+M+R+I KFKND L+YLE  ++N D+D N+TLG+FI+S GYS LFQ+AY+
Sbjct  121   KANILKISFWRMVRDIFKFKNDALTYLEYQEHNRDLDCNETLGQFIQSHGYSVLFQEAYL  180

Query  901   IPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELE  1080
              P+CA +WS SS+ V++ SA+ +LSF RNH LLQLF  PQ  T+K RS S+V+KV+  LE
Sbjct  181   FPVCAGMWSSSSQDVLSLSAFFVLSFFRNHDLLQLFRYPQLPTIKARSQSFVDKVKGALE  240

Query  1081  KRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQAT  1260
               GC I+  C V SV++   G AG  V+ +  +  +E YD  I+  HAP+ LK+LG +AT
Sbjct  241   SMGCRIKTSCHVKSVAS--FGGAGYKVLENDGS--EETYDNVILGIHAPNALKVLGAEAT  296

Query  1261  FDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGD  1440
               EL+ILGA QYV+ D YLHR+Q+ MPRN +AWSAWNFLGT  +   +TYWLN +Q +  
Sbjct  297   DYELKILGACQYVHRDTYLHRDQNLMPRNSSAWSAWNFLGTTTSGFSITYWLNHIQKIES  356

Query  1441  TKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGF  1620
              K P+LVTLNPP  P+  LLKW+T  PV SVAA++A  +L++IQGKR IWFCGAYQ +GF
Sbjct  357   VK-PFLVTLNPPCVPDHVLLKWSTSLPVLSVAAAKAYLQLDQIQGKRGIWFCGAYQSHGF  415

Query  1621  HEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEE  1800
             HEDGLKAG + A GLL K+C  L NP  M+PSW E GARLLV RF   ++  G++  +EE
Sbjct  416   HEDGLKAGKVVAQGLLGKKCELLLNPKQMIPSWTEAGARLLVARFFNQYVSIGNLTFVEE  475

Query  1801  GGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNL  1980
             GG+VF+F     K  +K ++RVH P FYWKVAT+ +LGLA+AYI+G  SF+DK+EGLLN 
Sbjct  476   GGSVFSFGKACDKCHVKSVMRVHDPLFYWKVATEGNLGLAEAYINGCFSFLDKREGLLNF  535

Query  1981  FKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHY  2160
               I +ANRD   S SR    RG WTPL   +  A AKYF+   SR+NT+ Q+RRNIS+HY
Sbjct  536   LLILIANRDARRS-SRIAGNRGRWTPLHVIARFAHAKYFMGQASRKNTMAQSRRNISQHY  594

Query  2161  DLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWG  2340
             DLSNE FSLF+D++MTYSCA+FK ++E L+ AQ RK+SLLI KAK+ + HH+L+IG GWG
Sbjct  595   DLSNEFFSLFMDKSMTYSCAIFKKDNESLEAAQERKLSLLIKKAKVERGHHVLDIGFGWG  654

Query  2341  SLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRII  2520
             SLAI+ V++TGCKYTG+TLSE+QLKYAE K +EAGL+D+I FLLCDYR++P  C+YD II
Sbjct  655   SLAIQVVKQTGCKYTGVTLSEEQLKYAEGKAKEAGLEDHITFLLCDYRKIPP-CKYDAII  713

Query  2521  SCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGG  2700
             S  M+E VGHE++++FF  CES LAE+GI+ LQFIS+PDERY++YR+  DFIKEYIFPGG
Sbjct  714   SICMIEHVGHEYLDDFFACCESYLAEDGIMALQFISVPDERYEQYRRKPDFIKEYIFPGG  773

Query  2701  CLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRT  2880
             CLPSLSRV SAM  SSR  +EH+E+IG HYY TL CW  N+   + +IL LGFD+KFIR 
Sbjct  774   CLPSLSRVMSAMTRSSRFSIEHVENIGPHYYTTLMCWMDNYTANRDKILALGFDEKFIRI  833

Query  2881  WEYYFDYCAAGFHTCTLGDYQIVFSRPGN  2967
             WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  834   WEYYLIFSAACMKARALGDYQVVFSRPGN  862



>ref|XP_010936016.1| PREDICTED: uncharacterized protein LOC105055750 isoform X3 [Elaeis 
guineensis]
Length=677

 Score =   988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/683 (69%), Positives = 567/683 (83%), Gaps = 6/683 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVA+VGAGISGLVSAYVLAK G  VV+YEKEDYLGGHA+TV  DGV LDLGFMVFNRVT
Sbjct  1     MRVAIVGAGISGLVSAYVLAKAGVDVVLYEKEDYLGGHARTVNFDGVHLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+DV+ YL+E +NNPD+D ++TL  FIKS GYS+LFQKAY++P+CASIWSC SEG
Sbjct  121   EIFKFKHDVIKYLDEHENNPDLDHDETLEHFIKSHGYSQLFQKAYLVPICASIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM+FSA+S+LSFCRNHHLLQLFGRPQWLTVK+RSH YV KV  ELE R C+IR G  V S
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVKQRSHCYVRKVTGELESRYCQIRTGYAVQS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V + +    GG  ++ G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+QYVY
Sbjct  241   VLSID----GGCCVV-GEDQSKETYDGCIISIHAPDALKILGTQATYEESRLLGAYQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP   
Sbjct  296   SDIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNMPFLVTLNPYFV  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKWTT HP+PSVAAS+AS ELE+IQGKR IWFCGAYQG+GFHEDG+K G++AA+ 
Sbjct  356   PEHILLKWTTSHPIPSVAASKASLELEKIQGKRGIWFCGAYQGFGFHEDGVKTGIVAANS  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K C  L NP HMVPS  ETGARL+VTRFL  ++ TG + LLEEGGT+F FEGT+KK+
Sbjct  416   VLGKDCVILRNPRHMVPSLVETGARLIVTRFLEKYVATGCLTLLEEGGTIFVFEGTNKKS  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              +K ++++H P FYWKVAT+ADLGLA AYI+   S VD++EGLL+LF I + NRDL+ S 
Sbjct  476   CVKSILKIHDPLFYWKVATEADLGLAYAYINRYFSVVDEQEGLLDLFMILIVNRDLNYSC  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
              +S ++RGWWTP+LFT+ + SA+YF+RHISR N + Q  +NISRHYDLSNE FSLFLDET
Sbjct  536   -KSKTRRGWWTPILFTAGLQSARYFLRHISRHNAVAQTPKNISRHYDLSNEFFSLFLDET  594

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FK E+EDLK AQ+RKISLLI+KA+I  +H IL+IGCGWGSLAIE   +TGCKY
Sbjct  595   MTYSCAIFKMENEDLKVAQLRKISLLIEKARIKAKHEILDIGCGWGSLAIEVARQTGCKY  654

Query  2383  TGITLSEQQLKYAEDKVREAGLQ  2451
             TGITLSE+QLK+A+ + +EA L+
Sbjct  655   TGITLSEEQLKFAKRRAQEACLE  677



>dbj|BAK05892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   986 bits (2548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/869 (58%), Positives = 640/869 (74%), Gaps = 21/869 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVL--AKGGAGVVV--YEKEDYLGGHAKTVTLDG-------VDL  549
             MRVAVVG G+SGL +A+ L  A GG  V V  YE+E+ LGGHA+TV +D        V+L
Sbjct  1     MRVAVVGGGVSGLAAAHELLGASGGGDVRVTLYEQEESLGGHARTVAVDDDDGAGGCVNL  60

Query  550   DLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDN---GHGYEWGSRNGFSGLFAQ  720
             DLGF  FN+VTY +MME    LGV+ME +DMS SVS  +   G G EW + NG S L AQ
Sbjct  61    DLGFTSFNQVTYSHMMEWLVGLGVEMERTDMSLSVSTQSDGAGGGCEWENSNGISSLLAQ  120

Query  721   KKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYI  900
             K N+L   FW+M+R+I KFKND L+YLE  ++N D+D N+TLG+FI+S GYS LFQ+AY+
Sbjct  121   KANILKISFWRMVRDIFKFKNDALTYLEYQEHNRDLDCNETLGQFIQSHGYSVLFQEAYL  180

Query  901   IPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELE  1080
              P+CA +WS SS+ V++ SA+ +LSF RNH LLQLF  PQ  T+K RS S+V+KV+  LE
Sbjct  181   FPVCAGMWSSSSQDVLSLSAFFVLSFFRNHDLLQLFRYPQLPTIKARSQSFVDKVKGALE  240

Query  1081  KRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQAT  1260
               GC I+  C V SV++   G AG  V+ +  +  +E YD  I+  HAP+ LK+LG +AT
Sbjct  241   SMGCRIKTSCHVKSVAS--FGGAGYKVLENDGS--EETYDNVILGIHAPNALKVLGAEAT  296

Query  1261  FDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGD  1440
               EL+ILGA QYV+ D YLHR+Q+ MPRN +AWSAWNFLGT  +   +TYWLN +Q +  
Sbjct  297   DYELKILGACQYVHRDTYLHRDQNLMPRNSSAWSAWNFLGTTTSGFSITYWLNHIQKIES  356

Query  1441  TKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGF  1620
              K P+LVTLNPP  P+  LLKW+T  PV SVAA++A  +L++IQGKR IWFCGAYQ +GF
Sbjct  357   VK-PFLVTLNPPCVPDHVLLKWSTSLPVLSVAAAKAYLQLDQIQGKRGIWFCGAYQSHGF  415

Query  1621  HEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEE  1800
             HEDGLKAG + A GLL K+C  L NP  M+PSW E GARLLV RF   ++  G++  +EE
Sbjct  416   HEDGLKAGKVVAQGLLGKKCELLLNPKQMIPSWTEAGARLLVQRFFNQYVSIGNLTFVEE  475

Query  1801  GGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNL  1980
             GG+VF+F     K  +K ++RVH P FYWKVAT+ +LGLA+AYI+G  SF+DK+EGLLN 
Sbjct  476   GGSVFSFGKACDKCHVKSVMRVHDPLFYWKVATEGNLGLAEAYINGCFSFLDKREGLLNF  535

Query  1981  FKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHY  2160
               I +ANRD   S SR    RG WTPL   +  A AKYF+   SR+NT+ Q+RRNIS+HY
Sbjct  536   LLILIANRDARRS-SRIAGNRGRWTPLHVIARFAHAKYFMGQASRKNTMAQSRRNISQHY  594

Query  2161  DLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWG  2340
             DLSNE FSLF+D++MTYSCA+FK ++E L+ AQ RK+SLLI KAK+ + HH+L+IG GWG
Sbjct  595   DLSNEFFSLFMDKSMTYSCAIFKKDNESLEAAQERKLSLLIKKAKVERGHHVLDIGFGWG  654

Query  2341  SLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRII  2520
             SLAI+ V++TGCKYTG+TLSE+QLKYAE K +EAGL+D+I FLLCDYR++P  C+YD II
Sbjct  655   SLAIQVVKQTGCKYTGVTLSEEQLKYAEGKAKEAGLEDHITFLLCDYRKIPP-CKYDAII  713

Query  2521  SCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGG  2700
             S  M+E VGHE++++FF  CES LAE+GI+ LQFIS+PDERY++YR+  DFIKEYIFPGG
Sbjct  714   SICMIEHVGHEYLDDFFACCESYLAEDGIMALQFISVPDERYEQYRRKPDFIKEYIFPGG  773

Query  2701  CLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRT  2880
             CLPSLSRV SAM  SSR  +EH+E+IG HYY TL CW  N+   + +IL LGFD+KFIR 
Sbjct  774   CLPSLSRVMSAMTRSSRFSIEHVENIGPHYYTTLMCWMDNYTANRDKILALGFDEKFIRI  833

Query  2881  WEYYFDYCAAGFHTCTLGDYQIVFSRPGN  2967
             WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  834   WEYYLIFSAACMKARALGDYQVVFSRPGN  862



>ref|NP_001066537.1| Os12g0267200 [Oryza sativa Japonica Group]
 gb|ABA97030.2| cyclopropane fatty acid synthase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29556.1| Os12g0267200 [Oryza sativa Japonica Group]
 dbj|BAG91262.1| unnamed protein product [Oryza sativa Japonica Group]
Length=837

 Score =   985 bits (2546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/800 (61%), Positives = 616/800 (77%), Gaps = 9/800 (1%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSV--SLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  750
             VT PNMM+ F  LG +ME SDMSFSV   LD     EW S NG SGL A++ N L+P FW
Sbjct  39    VTSPNMMQWFADLGANMERSDMSFSVRTQLDACGECEWASSNGISGLLAKRSNALSPSFW  98

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSC  930
             +MI E LKFK D L YLE+ +NN D+++++TLG+F++S GY + FQ+AY+ P+C  +WSC
Sbjct  99    RMISETLKFKRDALRYLEDCENNLDLEQSETLGQFVQSHGYCQFFQEAYLFPICGWMWSC  158

Query  931   SSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1110
              S+ V+ FSA S+LSF R H+LLQLF R Q L V  RS SY NKVRE+LE R C I+  C
Sbjct  159   PSQRVLGFSASSVLSFFRKHNLLQLFSRTQPLIVNGRSQSYFNKVREDLESRSCRIKTNC  218

Query  1111  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1290
              V S+S+ ++G    V+ + G    +E YD  I+  HA D LK+LG +AT +E RILGAF
Sbjct  219   HVKSISSFDRGYR--VLEVDGS---EEMYDRIIVGIHALDALKLLGAEATHEESRILGAF  273

Query  1291  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1470
             QYV S++YLH ++SFM  N + WSA N   T +  VC+TYWLN LQN+  T   +LVTLN
Sbjct  274   QYVSSNLYLHCDESFMLCNSSTWSACNITRTRSGSVCVTYWLNLLQNIESTNH-FLVTLN  332

Query  1471  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1650
             P   P+  LLKW T H VP+VAAS+AS EL++IQGKR IWFCGAYQG GFHEDG +AG  
Sbjct  333   PSYVPDHVLLKWNTNHFVPTVAASKASLELDQIQGKRGIWFCGAYQGSGFHEDGFQAGKA  392

Query  1651  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1830
             AA  LL  +  PL NP  MV SW ETGARLLV RFL  +I  G++IL EEGGT+F+F   
Sbjct  393   AAQSLLGNKIDPLTNPKQMVLSWTETGARLLVLRFLKQYISVGNLILFEEGGTMFSFGEA  452

Query  1831  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2010
              +K   K +++V  P FYW+VAT+ADLGLADAYI+G  SFV+K+EGLLNLF I +A+RD 
Sbjct  453   CEKCNKKSVLQVQDPLFYWQVATEADLGLADAYINGCFSFVNKREGLLNLFLILIASRDA  512

Query  2011  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2190
               S  R++S+RGWWTPLLFT+ +ASAKYF+RHISR+N++TQ R+N+S+HYDLSN+ FSLF
Sbjct  513   HRSSCRNSSRRGWWTPLLFTAGVASAKYFLRHISRKNSVTQTRQNVSQHYDLSNDFFSLF  572

Query  2191  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2370
             LD++MTYS A+FK E+E L+ AQ+RKI+LLI KAK+ ++  +LEIG GWGSLA+E V++T
Sbjct  573   LDKSMTYSSAIFKDEEESLEEAQLRKINLLIHKAKVGQDDEVLEIGSGWGSLAMEVVKQT  632

Query  2371  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2550
             GCKYTG+T S +QLKYA+ +V+EAGL+D I FLLCDYR++P + +YDRII CEM+E VGH
Sbjct  633   GCKYTGVTQSVEQLKYAQRRVKEAGLEDRITFLLCDYREIPCH-KYDRIICCEMIEEVGH  691

Query  2551  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2730
             E+M+EFFG CES+LAENGI V QFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TS
Sbjct  692   EYMDEFFGCCESLLAENGIFVTQFISIPEERYDEYRRSSDFIKEYIFPGGCLPSLTRITS  751

Query  2731  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2910
             AM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL LGFD+KFIRTWEYYF YCAA
Sbjct  752   AMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKDKILALGFDEKFIRTWEYYFIYCAA  811

Query  2911  GFHTCTLGDYQIVFSRPGNV  2970
             GF + TLGDYQIVFSRPGN 
Sbjct  812   GFKSRTLGDYQIVFSRPGNT  831



>gb|EYU18296.1| hypothetical protein MIMGU_mgv1a024671mg [Erythranthe guttata]
Length=809

 Score =   984 bits (2543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/866 (58%), Positives = 623/866 (72%), Gaps = 65/866 (8%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGG-HAKTVT-LDGVDLDLGFMVFNR  576
             MRVAVVG G SGL+S Y+LAK G  VV+YEKE  LGG HA TVT  DG +LD+G + F  
Sbjct  1     MRVAVVGGGTSGLISGYILAKEGVKVVLYEKETRLGGGHANTVTATDGTELDIGLIGFCN  60

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT PN  EL ESLG++M  +D SFSVSL  G G EWG+RNGFS LFAQKKNLLNPYFW+M
Sbjct  61    VTNPNTTELLESLGIEMGPTDTSFSVSLSGGQGCEWGNRNGFSSLFAQKKNLLNPYFWKM  120

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             +REI KF +D + Y+ E +NN D+DRN+TL  F++SRGYSELFQKA++IP CASIWSCSS
Sbjct  121   VREITKFNDDAIKYIAELENNQDVDRNETLDHFVQSRGYSELFQKAFLIPTCASIWSCSS  180

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
                   +  ++L  C NHH LQLFG  Q +T K RS +Y + V++ELE RGC I+   EV
Sbjct  181   SLKSLSAYSALLFLC-NHHALQLFGPTQRVTPKLRSQNYADIVKKELELRGCLIKTNSEV  239

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
             +SV T+++G     V+I+ K+  +E YDGCI+A +  + LK+LG +AT DE RILGAFQY
Sbjct  240   YSVLTNDEG----CVVITCKDGSEEVYDGCIIATNTRNALKILGNKATHDESRILGAFQY  295

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
               SD++LHR+++ MP+N  AWS+ NFLGT+ N+V +TYWLN +QN+ +T  PYL+T+NPP
Sbjct  296   ADSDVFLHRDENLMPKNPTAWSSSNFLGTIENKVYITYWLNAVQNISETGLPYLLTVNPP  355

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
               PE  L KW+T  P+PS+AAS+A +EL  IQGKRRIWFCGAYQ Y FHEDGL+AG++AA
Sbjct  356   HKPENTLRKWSTSQPIPSLAASKALAELNLIQGKRRIWFCGAYQDYFFHEDGLQAGLLAA  415

Query  1657  HGLLKKRCSPL-NNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTD  1833
             + LL K+   L  NP  M+PSW E GAR+ V RFL  FIV G +IL E+GGTVFTFEG+ 
Sbjct  416   NSLLGKKVFTLRKNPKQMIPSWTEAGARIFVIRFLRRFIVAGCLILAEDGGTVFTFEGSR  475

Query  1834  KKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLS  2013
             K + LK+ +RVH+PQFYWK+A + DLGLADAYI GD SFVDK +GL+NL  +F+ N +L+
Sbjct  476   KTSDLKISLRVHNPQFYWKLAIEGDLGLADAYIDGDFSFVDKDKGLVNLIMLFIGNIELN  535

Query  2014  ASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2193
              S S+ N KRGWWTPL+FTS IAS + F + +S +NTLTQARRNIS+HYDLSNELFSLFL
Sbjct  536   DSASKLNKKRGWWTPLVFTSIIASGRNFCKLLSEKNTLTQARRNISKHYDLSNELFSLFL  595

Query  2194  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2373
             D+TMTYSCA+F+   E+L + Q+RK+  LI KAK+ K+HHILEIGCGWGS AIE V+RTG
Sbjct  596   DDTMTYSCALFQDSGEELLSGQIRKLDSLIKKAKVDKKHHILEIGCGWGSFAIEVVKRTG  655

Query  2374  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHE  2553
             CKYTGITLS +QL+YAE KV+EAGLQ +          + D  +YD          + H 
Sbjct  656   CKYTGITLSIEQLQYAEIKVKEAGLQTS---------SIVDQ-KYDEF-------RLSHG  698

Query  2554  FMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSA  2733
             F+ E                                       YIFPGG LPSLSR+TS 
Sbjct  699   FIKE---------------------------------------YIFPGGFLPSLSRITST  719

Query  2734  MAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAG  2913
             MA++SRLCV H EDIG HYYQTLRCWR NFL  Q +I+ LGFD+KFIRTWEYYF Y AAG
Sbjct  720   MASASRLCVVHAEDIGSHYYQTLRCWRENFLRNQRKIMALGFDEKFIRTWEYYFSYTAAG  779

Query  2914  FHTCTLGDYQIVFSRPGNVTAFG-DP  2988
             F    +G+YQIVF+RPG+V AFG DP
Sbjct  780   FKMSIMGNYQIVFTRPGDVAAFGNDP  805



>ref|XP_010936015.1| PREDICTED: uncharacterized protein LOC105055750 isoform X2 [Elaeis 
guineensis]
Length=683

 Score =   981 bits (2537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/682 (68%), Positives = 566/682 (83%), Gaps = 6/682 (1%)
 Frame = +1

Query  946   MAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSV  1125
             M+FSA+S+LSFCRNHHLLQLFGRPQWLTVK+RSH YV KV  ELE R C+IR G  V SV
Sbjct  1     MSFSAFSVLSFCRNHHLLQLFGRPQWLTVKQRSHCYVRKVTGELESRYCQIRTGYAVQSV  60

Query  1126  STDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYS  1305
              + +    GG  ++ G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+QYVYS
Sbjct  61    LSID----GGCCVV-GEDQSKETYDGCIISIHAPDALKILGTQATYEESRLLGAYQYVYS  115

Query  1306  DIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTP  1485
             DIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP   P
Sbjct  116   DIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNMPFLVTLNPYFVP  175

Query  1486  EQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGL  1665
             E  LLKWTT HP+PSVAAS+AS ELE+IQGKR IWFCGAYQG+GFHEDG+K G++AA+ +
Sbjct  176   EHILLKWTTSHPIPSVAASKASLELEKIQGKRGIWFCGAYQGFGFHEDGVKTGIVAANSV  235

Query  1666  LKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNL  1845
             L K C  L NP HMVPS  ETGARL+VTRFL  ++ TG + LLEEGGT+F FEGT+KK+ 
Sbjct  236   LGKDCVILRNPRHMVPSLVETGARLIVTRFLEKYVATGCLTLLEEGGTIFVFEGTNKKSC  295

Query  1846  LKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVS  2025
             +K ++++H P FYWKVAT+ADLGLA AYI+   S VD++EGLL+LF I + NRDL+ S  
Sbjct  296   VKSILKIHDPLFYWKVATEADLGLAYAYINRYFSVVDEQEGLLDLFMILIVNRDLNYSC-  354

Query  2026  RSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETM  2205
             +S ++RGWWTP+LFT+ + SA+YF+RHISR N + Q  +NISRHYDLSNE FSLFLDETM
Sbjct  355   KSKTRRGWWTPILFTAGLQSARYFLRHISRHNAVAQTPKNISRHYDLSNEFFSLFLDETM  414

Query  2206  TYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYT  2385
             TYSCA+FK E+EDLK AQ+RKISLLI+KA+I  +H IL+IGCGWGSLAIE   +TGCKYT
Sbjct  415   TYSCAIFKMENEDLKVAQLRKISLLIEKARIKAKHEILDIGCGWGSLAIEVARQTGCKYT  474

Query  2386  GITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNE  2565
             GITLSE+QLK+A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGHE+M E
Sbjct  475   GITLSEEQLKFAKRRAQEACLEDRITFLLCDYRQLPCYQKYDRIISCEMIEGVGHEYMEE  534

Query  2566  FFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAAS  2745
             FFG CE +LAE+G+ VLQFISIPDERYDEYR+SSDFIKEY+FPGGC+PSLSR+TSAMAA+
Sbjct  535   FFGCCELLLAEDGLFVLQFISIPDERYDEYRRSSDFIKEYVFPGGCIPSLSRITSAMAAT  594

Query  2746  SRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTC  2925
             SR CVEH+E+IGIHYY+TLRCWR N ++ + +IL LGFD+KFIRTWEYYF YCAAGF + 
Sbjct  595   SRFCVEHVENIGIHYYETLRCWRNNLMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSR  654

Query  2926  TLGDYQIVFSRPGNVTAFGDPY  2991
             TLG+YQ+VFSRPGN+TA G  Y
Sbjct  655   TLGNYQMVFSRPGNLTALGSLY  676



>gb|EEC78767.1| hypothetical protein OsI_18995 [Oryza sativa Indica Group]
Length=1429

 Score =   972 bits (2512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/805 (60%), Positives = 612/805 (76%), Gaps = 18/805 (2%)
 Frame = +1

Query  562   MVFNRVTYPNMMELFESLGVDMEISDMSFSV--SLDNGHGYEWGSRNGFSGLFAQKKNLL  735
             M   +VT PNMM+ F  LG +ME SDMSFSV   LD     EW S NG SGL A++ N L
Sbjct  635   MPSTQVTSPNMMQWFADLGANMERSDMSFSVRTQLDACGECEWASGNGISGLLAKRSNAL  694

Query  736   NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             +P FW+MI E LKFK D L YLE+ +NN D+++++TLG+F++S GY + FQ+AY+ P+C 
Sbjct  695   SPSFWRMISETLKFKRDALRYLEDCENNLDLEQSETLGQFVQSHGYCQFFQEAYLFPICG  754

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCE  1095
              +WSC S+ V+ FSA S+LSF R H+LLQLF R Q L V  RS SY NKVRE+LE R C 
Sbjct  755   WMWSCPSQRVLGFSASSVLSFFRKHNLLQLFSRTQPLIVNGRSQSYFNKVREDLESRSCR  814

Query  1096  IRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELR  1275
             I+  C V S+S+ ++G    V+ + G    +E YD  I+  HAPD LK+LG +AT +E R
Sbjct  815   IKTNCHVKSISSFDRGYR--VLEVDGS---EEMYDRIIVGIHAPDALKLLGAEATHEESR  869

Query  1276  ILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPY  1455
             ILGAFQYV S++YLH ++SFMP N + WSA N   T +  VC+TYWLN LQN+  T+  +
Sbjct  870   ILGAFQYVSSNLYLHCDESFMPCNSSTWSACNITRTRSGSVCVTYWLNLLQNIESTRT-F  928

Query  1456  LVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGL  1635
             LVTLNP   P+  LLKW T H VP+VAAS+AS EL++IQGKR         G GFHEDG 
Sbjct  929   LVTLNPSYVPDHVLLKWNTNHFVPTVAASKASLELDQIQGKR---------GSGFHEDGF  979

Query  1636  KAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVF  1815
             +AG  AA  LL  +  PL NP  MV SW ETGARLLV RFL  +I  G++IL EEGGT+F
Sbjct  980   QAGKAAAQSLLGNKIDPLTNPKQMVLSWTETGARLLVLRFLKQYISVGNLILFEEGGTMF  1039

Query  1816  TFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFV  1995
             +F    +K   K ++RV  P FYW+VAT+ADLGLADAYI+G  SFV+K+EGLLNLF I +
Sbjct  1040  SFGEACEKCNKKSVLRVQDPLFYWQVATEADLGLADAYINGCFSFVNKREGLLNLFLILI  1099

Query  1996  ANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNE  2175
             A+RD   S  R++S+RGWWTPLLFT+ +ASAKYF+RHISR+N++TQ R+N+S+HYDLSN+
Sbjct  1100  ASRDAHRSSCRNSSRRGWWTPLLFTAGVASAKYFLRHISRKNSVTQTRQNVSQHYDLSND  1159

Query  2176  LFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIE  2355
              FSLFLD++MTYS A+FK E+E L+ AQ+RKI+LLI KAK+ ++  +LEIG GWGSLA+E
Sbjct  1160  FFSLFLDKSMTYSSAIFKDEEESLEEAQLRKINLLIHKAKVGQDDEVLEIGSGWGSLAME  1219

Query  2356  AVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEML  2535
              V++TGCKYTG+T S +QLKYA+ +V+EAGL+D I FLLCDYR++P + +YDRII CEM+
Sbjct  1220  VVKQTGCKYTGVTQSVEQLKYAQRRVKEAGLEDRITFLLCDYREIPCH-KYDRIICCEMI  1278

Query  2536  EAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSL  2715
             E VGHE+M+EFFG CES+LAENGI V QF SIP+ERYDEYR+SSDFIKEYIFPGGCLPSL
Sbjct  1279  EEVGHEYMDEFFGCCESLLAENGIFVTQFTSIPEERYDEYRRSSDFIKEYIFPGGCLPSL  1338

Query  2716  SRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYF  2895
             +R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL LGFD+KFIRTWEYYF
Sbjct  1339  TRITSAMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKDKILALGFDEKFIRTWEYYF  1398

Query  2896  DYCAAGFHTCTLGDYQIVFSRPGNV  2970
              YCAAGF + TLGDYQIVFSRPGN 
Sbjct  1399  IYCAAGFKSRTLGDYQIVFSRPGNT  1423


 Score =   222 bits (566),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 151/226 (67%), Gaps = 56/226 (25%)
 Frame = +1

Query  2116  QNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAK  2295
             +N++TQ R+N+S+HYDLSN+ FSLFLD++MTYS A+FK E+E L+ AQ+RKI+LLI KAK
Sbjct  447   KNSVTQTRQNVSQHYDLSNDFFSLFLDKSMTYSSAIFKDEEESLEEAQLRKINLLIHKAK  506

Query  2296  ISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLC  2475
             + ++  +LEIG GWGSLA+E V++TGCKYTG+T S +QLKYA+ +V+EAGL+        
Sbjct  507   VGQDDEVLEIGSGWGSLAMEVVKQTGCKYTGVTQSVEQLKYAQRRVKEAGLE--------  558

Query  2476  DYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEY  2655
              +  +P+  RYD                                              EY
Sbjct  559   -FISIPEE-RYD----------------------------------------------EY  570

Query  2656  RQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  2793
             R+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY
Sbjct  571   RRSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYY  616


 Score =   108 bits (269),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 77/117 (66%), Gaps = 9/117 (8%)
 Frame = +1

Query  1438  DTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYG  1617
             ++ + +LVTLNP   P+  LLKW T H VP+VAAS+AS EL++IQGKR         G G
Sbjct  339   ESTRTFLVTLNPSYVPDHVLLKWNTNHFVPTVAASKASLELDQIQGKR---------GSG  389

Query  1618  FHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSII  1788
             FHEDG +AG  AA  LL  +  PL NP  MV SW ETGARLLV RFL  +I  G+++
Sbjct  390   FHEDGFQAGKAAAQSLLGNKIDPLTNPKQMVLSWTETGARLLVLRFLKQYISVGNLM  446


 Score = 66.6 bits (161),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 46/69 (67%), Gaps = 10/69 (14%)
 Frame = +1

Query  403  MRVAVVGAGISGLVSAYVLA---KGGAGVVVYEKEDYLGGH-AKTVTLDG------VDLD  552
            MRVAVVGAG+SGL +A+ LA    GG  V VYEKED LGG  A+TV +DG      V L 
Sbjct  1    MRVAVVGAGVSGLAAAHELATSCAGGVDVTVYEKEDSLGGSFARTVGVDGGAGGEVVHLH  60

Query  553  LGFMVFNRV  579
            LGFM FN V
Sbjct  61   LGFMPFNSV  69



>ref|XP_008677860.1| PREDICTED: uncharacterized protein LOC103652693 isoform X1 [Zea 
mays]
Length=887

 Score =   970 bits (2508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/870 (56%), Positives = 637/870 (73%), Gaps = 24/870 (3%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG------VDLDLG  558
             +MRVA+VG+G+SGLV+A+ LA+ GG  V VYEKED+LGG AKTV +DG      V +DLG
Sbjct  18    EMRVAMVGSGLSGLVAAHELARSGGVRVTVYEKEDHLGG-AKTVAVDGGAEEGRVLVDLG  76

Query  559   FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSL---DNGHGYEWGSRNGFSGLFAQKKN  729
              +VFN VT PN+ME FE LGV+M  SDMSFS S+    +   +EWGSR+G SG+ AQK N
Sbjct  77    PVVFNPVTSPNLMEWFERLGVEMCTSDMSFSASMRLNKSSESFEWGSRSGMSGVLAQKSN  136

Query  730   LLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPM  909
             LL+P FW ++ EI KFKN  L YLE+  + P+  RN+TLG+FI S  YS+LFQ AY+IPM
Sbjct  137   LLSPRFWLVVHEIFKFKNHALKYLEDHRSGPN--RNETLGQFILSHRYSQLFQDAYLIPM  194

Query  910   CASIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRG  1089
             CA IW   S  ++ F A  +LSF R++ LL++    +WLTVK  S SYVNK+REELE  G
Sbjct  195   CACIWPSPSHEILGFPALFVLSFFRDNQLLEILSGSKWLTVKGGSGSYVNKIREELESNG  254

Query  1090  CEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDE  1269
             C+I+ GCEV+S+S    G    ++ + G     E YD  I+  +A D LK+LG +AT +E
Sbjct  255   CQIKIGCEVNSISKSNDGYQ--ILEVDGS---VETYDRIIIGINAHDALKVLGAEATNEE  309

Query  1270  LRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQ  1449
             L+ LGAF ++ S  YLH ++S MPRN +AWSA NFLGT ++ VC+T WLN L+N+ ++  
Sbjct  310   LKNLGAFHFIRSIAYLHSDESLMPRNSSAWSARNFLGTTSSGVCVTSWLNILENI-ESAG  368

Query  1450  PYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHED  1629
             P LVTLNPPR P   LLK    HP+PS+AA++A+ +L  IQGKR IWFCG+YQGYG+HED
Sbjct  369   PLLVTLNPPRVPNHVLLKCHISHPIPSIAAAKANLQLNSIQGKRGIWFCGSYQGYGYHED  428

Query  1630  GLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGT  1809
              +KAG  AA GLL ++C  L+NP  MV SW E GARLLV R L  +I  G+  +LEEGGT
Sbjct  429   SVKAGKAAALGLLGRKCDLLSNPKPMVSSWTEAGARLLVARSLDQYITIGNFCILEEGGT  488

Query  1810  VFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKI  1989
              F+F    +K  +K  +RVH PQFYWK AT+ DLG A AYI+G ISFVD ++GL+NL +I
Sbjct  489   TFSFGKACEKCHVKSAIRVHDPQFYWKAATEGDLGFASAYINGQISFVDHRKGLVNLVRI  548

Query  1990  FVANRD----LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRH  2157
              +ANR     LS++ S  N+++ WW+PLL  + ++ AKYF+RH  R+N++++AR+NIS H
Sbjct  549   ILANRGEFKRLSSTAS-GNTRKAWWSPLLGITGVSFAKYFLRHALRKNSVSKARKNISEH  607

Query  2158  YDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGW  2337
             YDLSN+ F+L+LD +MTYS  +FK  +E L+TAQ+RK+  LI+KAK+   HH+L+IGCGW
Sbjct  608   YDLSNDFFALYLDPSMTYSSGIFKVAEESLETAQLRKLDSLINKAKVEPGHHVLDIGCGW  667

Query  2338  GSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRI  2517
             G+LAI  V++TGCKYTGITLSE+QLKYA+ KV+E+GL+D I  LLCDYRQLP   ++DRI
Sbjct  668   GTLAIRLVKQTGCKYTGITLSEEQLKYAKRKVKESGLEDRITLLLCDYRQLPAGDKFDRI  727

Query  2518  ISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPG  2697
             ISCEM+E VGHE+M++FFG CE  LAE+G+LVLQ I++P+E YD+ R   +F+K YIFPG
Sbjct  728   ISCEMIEHVGHEYMDDFFGCCEYHLAEHGLLVLQSIALPEELYDKMRMRPEFLKTYIFPG  787

Query  2698  GCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIR  2877
             GCLPSL R+ SAM+ +SRL ++HLE+IG HYY TL  WR NF+  + +   LGFD KFIR
Sbjct  788   GCLPSLGRIVSAMSNASRLNIQHLENIGDHYYTTLMNWRDNFVANREKASALGFDDKFIR  847

Query  2878  TWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  2967
             TWEYY  Y AA F + T  DYQIVF+RPG+
Sbjct  848   TWEYYLSYAAALFKSRTAIDYQIVFARPGD  877



>ref|XP_009763752.1| PREDICTED: uncharacterized protein LOC104215602 isoform X2 [Nicotiana 
sylvestris]
Length=566

 Score =   960 bits (2482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/566 (82%), Positives = 508/566 (90%), Gaps = 0/566 (0%)
 Frame = +1

Query  1315  LHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQC  1494
             + +E   +     AWSAWNFLGT+NN+VC+TYWLN LQNLG+T++PY VTLNPP TPE  
Sbjct  1     MKQEYLVLSNMFIAWSAWNFLGTMNNKVCVTYWLNILQNLGETERPYCVTLNPPHTPEHT  60

Query  1495  LLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKK  1674
             LLKWTTGHPVPSVAAS ASSEL++IQGKR IWFCGAYQGYGFHEDGLKAG+IAA GLLK+
Sbjct  61    LLKWTTGHPVPSVAASIASSELDQIQGKRGIWFCGAYQGYGFHEDGLKAGVIAAQGLLKR  120

Query  1675  RCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKV  1854
               S L NP HMVP+WPETGARLLVTRFL SFI TG IILLE+GGT+FTFEGT+ K+ LKV
Sbjct  121   NYSVLKNPKHMVPTWPETGARLLVTRFLKSFITTGCIILLEDGGTMFTFEGTENKSSLKV  180

Query  1855  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2034
              +RVHSPQFYWKVATQ DLGLADA+I GD SFVDK EGLLNLF IFV NRDL ASV+RS+
Sbjct  181   SLRVHSPQFYWKVATQGDLGLADAFIQGDFSFVDKNEGLLNLFMIFVNNRDLKASVTRSS  240

Query  2035  SKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  2214
              KRGWWTPLLFT+A++SAKYFIRH+S QNTLT+ARRNISRHYDLSNELFSLFLD+TMTYS
Sbjct  241   KKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTRARRNISRHYDLSNELFSLFLDQTMTYS  300

Query  2215  CAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGIT  2394
             CA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RTGCKYTGIT
Sbjct  301   CAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRTGCKYTGIT  360

Query  2395  LSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFG  2574
             LSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGHEFM EFF 
Sbjct  361   LSEQQLKYAQKRVQQAGLQDHIIFLLCDYRQLPNMSRYDRIISCEMLEAVGHEFMEEFFT  420

Query  2575  RCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL  2754
               ES LAE+G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA+SRL
Sbjct  421   CSESALAEDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAAASRL  480

Query  2755  CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLG  2934
             CVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLG
Sbjct  481   CVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLG  540

Query  2935  DYQIVFSRPGNVTAFGDPYKGLASAY  3012
             DYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  541   DYQIVFSRPGNVAAFGDPYHGVPSTY  566



>ref|XP_009625539.1| PREDICTED: uncharacterized protein LOC104116392 isoform X5 [Nicotiana 
tomentosiformis]
Length=556

 Score =   959 bits (2479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/553 (83%), Positives = 505/553 (91%), Gaps = 0/553 (0%)
 Frame = +1

Query  1354  AWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsv  1533
             AWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPPRTPE  LLKWTTGHPVPSV
Sbjct  4     AWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPRTPEHTLLKWTTGHPVPSV  63

Query  1534  aasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVP  1713
             AAS ASSEL++IQG+R IWFCGAYQGYGFHEDG+KAG IAA GLLK+  S LNNP HMVP
Sbjct  64    AASIASSELDQIQGERGIWFCGAYQGYGFHEDGVKAGAIAAQGLLKRNYSVLNNPKHMVP  123

Query  1714  SWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKV  1893
             +WPETGARLLVTRFL SFI T  IILLEEGGT+FTFEGT+ K+ LKV +RVHSPQFYWKV
Sbjct  124   TWPETGARLLVTRFLKSFISTECIILLEEGGTMFTFEGTENKSSLKVSLRVHSPQFYWKV  183

Query  1894  ATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTS  2073
             ATQ DLGLADA+I GD SFVDK +GLLNLF IFV NRDL ASV+RS+ KRGWWTPLLFT+
Sbjct  184   ATQGDLGLADAFIQGDFSFVDKNDGLLNLFMIFVNNRDLKASVTRSSKKRGWWTPLLFTA  243

Query  2074  AIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKT  2253
             A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLFLDETMTYSCA+FKSE+EDLK 
Sbjct  244   AVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAIFKSEEEDLKV  303

Query  2254  AQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKV  2433
             AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RTGCKYTGITLSEQQLKYA+ +V
Sbjct  304   AQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRTGCKYTGITLSEQQLKYAQIRV  363

Query  2434  REAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILV  2613
             ++AGLQD+I F+LCDYRQLP+  RYDRIISCEMLEAVGHEFM+EFF  CES LAE G+LV
Sbjct  364   QQAGLQDHITFILCDYRQLPNMSRYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLV  423

Query  2614  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  2793
             LQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYY
Sbjct  424   LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYY  483

Query  2794  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  2973
             QTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV 
Sbjct  484   QTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVA  543

Query  2974  AFGDPYKGLASAY  3012
             AFGDPY G+ S Y
Sbjct  544   AFGDPYNGVPSTY  556



>ref|XP_006421139.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
 gb|ESR34379.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
Length=650

 Score =   959 bits (2478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/620 (74%), Positives = 530/620 (85%), Gaps = 5/620 (1%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFWQM+REI+
Sbjct  1     MMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFWQMLREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK+DVLSYLEE ++NPD+DR++TLG+F+ SRGYSELFQKAY+IP+C SIWSC SEGV +
Sbjct  61    KFKDDVLSYLEELESNPDIDRSETLGQFVNSRGYSELFQKAYLIPICGSIWSCPSEGVTS  120

Query  952   FSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1131
             FSA+S+LSFCRNHHLLQLFGRPQWLTV+ RSHSYVNKVR++LE  GC+IR   EV SV  
Sbjct  121   FSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHSYVNKVRKQLESWGCQIRTSSEVCSVLP  180

Query  1132  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1311
              ++G      I+ G    +E Y+ C+MA HAPD LK+LG QATFDE RILGAFQYVYSD+
Sbjct  181   ADKG----CTIVCGDG-SREFYNSCVMALHAPDALKILGNQATFDETRILGAFQYVYSDV  235

Query  1312  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1491
             +LHR++ FMP+N AAWSAWNFL + +++VCLTYWLN LQNLG+T  P+LVTLNP   PE 
Sbjct  236   FLHRDKRFMPQNPAAWSAWNFLESFDSKVCLTYWLNVLQNLGETSLPFLVTLNPDHVPEH  295

Query  1492  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1671
              LLKW+TGHPVPSVAAS+A  EL  IQGKR IWFCGAYQGYGFHEDGLKAGM AAH +L 
Sbjct  296   TLLKWSTGHPVPSVAASKALLELNHIQGKRGIWFCGAYQGYGFHEDGLKAGMTAAHAVLG  355

Query  1672  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1851
             K C+ L+NP HMVPS  ETGARL V RFL  +I TGS+ILLEEGGT+FTFEGT K   LK
Sbjct  356   KSCTLLSNPRHMVPSLMETGARLFVARFLGQYISTGSMILLEEGGTIFTFEGTRKNCHLK  415

Query  1852  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2031
              ++R+HSPQFYWKV TQADLG+ADAYI+GD SFVDK EGLLNLF I +ANRDL +SVS+ 
Sbjct  416   TVLRIHSPQFYWKVMTQADLGVADAYINGDFSFVDKDEGLLNLFMILIANRDLDSSVSKL  475

Query  2032  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2211
               KRGWW+P+LFT+ IASAKYF RHISRQNTLTQARRNISRHYDLSNELFSLFLDE+MTY
Sbjct  476   KQKRGWWSPMLFTAGIASAKYFFRHISRQNTLTQARRNISRHYDLSNELFSLFLDESMTY  535

Query  2212  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2391
             SCAVFKSEDEDLK AQMRK+SLLI+K ++SK   +LEIGCGWG+LAIE V+RTGCKYTGI
Sbjct  536   SCAVFKSEDEDLKAAQMRKVSLLIEKVRVSKGQEVLEIGCGWGTLAIEIVKRTGCKYTGI  595

Query  2392  TLSEQQLKYAEDKVREAGLQ  2451
             TLSE+QLKYAE KV+EAGLQ
Sbjct  596   TLSEEQLKYAEMKVKEAGLQ  615



>ref|XP_009625540.1| PREDICTED: uncharacterized protein LOC104116392 isoform X6 [Nicotiana 
tomentosiformis]
Length=556

 Score =   957 bits (2475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/553 (83%), Positives = 504/553 (91%), Gaps = 0/553 (0%)
 Frame = +1

Query  1354  AWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsv  1533
             AWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPP TPE  +LKWTTGHP+PSV
Sbjct  4     AWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPHTPEHTMLKWTTGHPIPSV  63

Query  1534  aasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVP  1713
             AAS ASSEL++IQGKR IWFCGAYQGYGFHEDG+KAG IAA GLLK+  S LNNP HMVP
Sbjct  64    AASIASSELDQIQGKRGIWFCGAYQGYGFHEDGVKAGAIAAQGLLKRNYSVLNNPKHMVP  123

Query  1714  SWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKV  1893
             +WPETGARLLVTRFL SFI T  IILLEEGGT+FTFEGT+ K+ LKV +RVHSPQFYWKV
Sbjct  124   TWPETGARLLVTRFLKSFISTECIILLEEGGTMFTFEGTENKSSLKVSLRVHSPQFYWKV  183

Query  1894  ATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTS  2073
             ATQ DLGLADA+I GD SFVDK +GLLNLF IFV NRDL ASV+RS+ KRGWWTPLLFT+
Sbjct  184   ATQGDLGLADAFIQGDFSFVDKNDGLLNLFMIFVNNRDLKASVTRSSKKRGWWTPLLFTA  243

Query  2074  AIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKT  2253
             A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLFLDETMTYSCA+FKSE+EDLK 
Sbjct  244   AVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAIFKSEEEDLKV  303

Query  2254  AQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKV  2433
             AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RTGCKYTGITLSEQQLKYA+ +V
Sbjct  304   AQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRTGCKYTGITLSEQQLKYAQIRV  363

Query  2434  REAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILV  2613
             ++AGLQD+I F+LCDYRQLP+  RYDRIISCEMLEAVGHEFM+EFF  CES LAE G+LV
Sbjct  364   QQAGLQDHITFILCDYRQLPNMSRYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLV  423

Query  2614  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  2793
             LQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYY
Sbjct  424   LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYY  483

Query  2794  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  2973
             QTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV 
Sbjct  484   QTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVA  543

Query  2974  AFGDPYKGLASAY  3012
             AFGDPY G+ S Y
Sbjct  544   AFGDPYNGVPSTY  556



>ref|XP_009617895.1| PREDICTED: uncharacterized protein LOC104110155 isoform X5 [Nicotiana 
tomentosiformis]
Length=566

 Score =   949 bits (2454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/566 (81%), Positives = 503/566 (89%), Gaps = 0/566 (0%)
 Frame = +1

Query  1315  LHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQC  1494
             + +E   +     AWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPP TPE  
Sbjct  1     MKQEYLVLSNMFIAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPHTPEHT  60

Query  1495  LLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKK  1674
             +LKWTTGHPVPSVAAS ASSEL +IQGKR IWFCGAYQGYGFHEDGLKAG IAA GLLK+
Sbjct  61    MLKWTTGHPVPSVAASIASSELHQIQGKRGIWFCGAYQGYGFHEDGLKAGAIAAQGLLKR  120

Query  1675  RCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKV  1854
               S LNNP HMVP+W ETGARLLVTRFL SFI TG IILLEEGGT+FTFEGT+ K+ LKV
Sbjct  121   NYSVLNNPKHMVPTWKETGARLLVTRFLKSFISTGCIILLEEGGTMFTFEGTENKSSLKV  180

Query  1855  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2034
              +RVHSP+FYWKVATQ DLGLADA+I GD SFVDK EGLLNLF IFV NRDL ASV+RS+
Sbjct  181   SLRVHSPRFYWKVATQGDLGLADAFIQGDFSFVDKNEGLLNLFMIFVNNRDLKASVTRSS  240

Query  2035  SKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  2214
              KRGWWTPLLFT+A++SAKYF+RH+S QNTLTQARRNISRHYDLSNELFSLFLDETMTYS
Sbjct  241   KKRGWWTPLLFTAAVSSAKYFVRHVSNQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  300

Query  2215  CAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGIT  2394
             CA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E  +RTGCKYTGIT
Sbjct  301   CAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVAKRTGCKYTGIT  360

Query  2395  LSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFG  2574
             LSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGHEFM EFF 
Sbjct  361   LSEQQLKYAQLRVQQAGLQDHITFLLCDYRQLPNMSRYDRIISCEMLEAVGHEFMEEFFT  420

Query  2575  RCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL  2754
              CES LA +G+LVLQFISIPDERYDEYRQSSDFIKEYIFPG CLP+LSRVTSAMAA+SRL
Sbjct  421   CCESALAGDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGACLPALSRVTSAMAAASRL  480

Query  2755  CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLG  2934
              VEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLG
Sbjct  481   SVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDNKFIRTWEYYFDYCAAGFKTCTLG  540

Query  2935  DYQIVFSRPGNVTAFGDPYKGLASAY  3012
             DYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  541   DYQIVFSRPGNIAAFGDPYSAVPSAY  566



>ref|XP_007035213.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 5, partial 
[Theobroma cacao]
 gb|EOY06139.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 5, partial 
[Theobroma cacao]
Length=604

 Score =   946 bits (2444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/609 (74%), Positives = 525/609 (86%), Gaps = 5/609 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+G GISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1     MRTAVIGGGISGLVSAYVLAKSGVNVVLYEKEDYLGGHAKTVNFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME SDMSF+VSLD G G EWGSRNG S LFA+K N+LNPYFW+M+R
Sbjct  61    YPNMMEFFESLGVDMEASDMSFAVSLDEGKGCEWGSRNGLSSLFAKKMNILNPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+DV+SYLE  +NNPD+DRN+TLG+FI+SRGYSELFQKAY++P+C SIWSC +E 
Sbjct  121   EISKFKDDVISYLEVLENNPDIDRNETLGQFIESRGYSELFQKAYLVPICGSIWSCPTER  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
             VM FSA+SILSFCRNHHLLQLFGRPQW+TV+ RSH YVNKVR+ELE RGC+IR GCEVHS
Sbjct  181   VMGFSAFSILSFCRNHHLLQLFGRPQWMTVRWRSHRYVNKVRKELESRGCQIRTGCEVHS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V T    +A G  ++ G +  QE Y+GC+MA HAPD L++LG QAT+DELR+LGAFQYVY
Sbjct  241   VLT----TAEGCTVLCGDDS-QETYEGCVMAVHAPDALRLLGNQATYDELRVLGAFQYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++ MP+N AAWSAWNFLG+ + +VCLTYWLN LQNLG+T  P+LVTLNP   
Sbjct  296   SDIFLHRDKNLMPKNPAAWSAWNFLGSTDKKVCLTYWLNVLQNLGETSLPFLVTLNPDYI  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+Q LLKW TGHPVPSVAA++AS EL++IQGKR IWFCGAYQGYGFHEDGLKAG +AA+G
Sbjct  356   PQQTLLKWKTGHPVPSVAATKASLELDQIQGKRGIWFCGAYQGYGFHEDGLKAGTVAANG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K CS L+NP HMVPS  ETGARL VTRFL+ FI+TGS+ILLEEGGT+FTFEGT  K 
Sbjct  416   VLGKSCSILSNPKHMVPSLVETGARLFVTRFLSHFILTGSVILLEEGGTMFTFEGTSTKC  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VH+P  YWKV T+ADLGLADAYI+G+ SFVDKKEGLLNL  I +ANRDL++S 
Sbjct  476   PLKTVLKVHNPHIYWKVMTEADLGLADAYINGEFSFVDKKEGLLNLIMILIANRDLNSSN  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ + +RGWWTPLLFT+ + SAKYF++H+ R N+LTQARRNISRHYDLSN+LF+LFLDET
Sbjct  536   SKLSKQRGWWTPLLFTAGLTSAKYFLKHVLRHNSLTQARRNISRHYDLSNDLFALFLDET  595

Query  2203  MTYSCAVFK  2229
             MTYSCAVFK
Sbjct  596   MTYSCAVFK  604



>ref|XP_006489664.1| PREDICTED: uncharacterized protein LOC102612222 isoform X3 [Citrus 
sinensis]
Length=674

 Score =   934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/650 (68%), Positives = 533/650 (82%), Gaps = 5/650 (1%)
 Frame = +1

Query  1063  VREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKM  1242
             V  +L+  GC+IR  CEV+SV   ++G       +   +  QE Y  C+MA HAPD L++
Sbjct  28    VTGQLQSWGCQIRTSCEVYSVYPADEGCT-----VVSSDGSQENYSCCVMAVHAPDALRI  82

Query  1243  LGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNT  1422
             LG QAT DE RILGAF+YVYSDI+LHR+ +FMP+N AAWSAWNFLG+ + ++CLTYWLN 
Sbjct  83    LGNQATLDETRILGAFRYVYSDIFLHRDTNFMPQNTAAWSAWNFLGSTDGKICLTYWLNV  142

Query  1423  LQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGA  1602
             LQN+G+T  P+L TLNP  TPE   LKW+T + VPSVAAS+AS  ++ IQGKR IWFCGA
Sbjct  143   LQNIGETGVPFLATLNPDHTPENTSLKWSTSYQVPSVAASKASLAVDLIQGKRGIWFCGA  202

Query  1603  YQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGS  1782
             YQGYGF EDGLKAGMI AHG+L K C+ L+NP HMVPS  E GARL V RFL  +I TG 
Sbjct  203   YQGYGFQEDGLKAGMITAHGVLGKNCAVLSNPKHMVPSLLEKGARLFVARFLRRYISTGC  262

Query  1783  IILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKK  1962
             +ILLEEGGT+FTFEGT + + LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK 
Sbjct  263   LILLEEGGTIFTFEGTLRNSPLKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKD  322

Query  1963  EGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARR  2142
             EGLLNLF I +AN+D  +S S+   KRGWW+P+ FT++IASAKYF R+ISR+N+LTQARR
Sbjct  323   EGLLNLFLIVIANQDFDSSTSKLKKKRGWWSPMFFTASIASAKYFFRNISRKNSLTQARR  382

Query  2143  NISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILE  2322
             N+SRHYDL+NELFSLFLD++MTYSCA+FKSE EDL+  QMRK+S+LI+KA++SK   +L+
Sbjct  383   NVSRHYDLNNELFSLFLDKSMTYSCAIFKSEHEDLEVGQMRKVSVLIEKARVSKGQEVLD  442

Query  2323  IGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNC  2502
             IGCGWG+LAIE V++TGCKYTGITLSE+QLKYAE KVREAGLQD+IRF LCDYRQLP   
Sbjct  443   IGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYAEIKVREAGLQDHIRFYLCDYRQLPKAN  502

Query  2503  RYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  2682
             +YDRIISC M+E VGH++M EFFG CES+LA +G+LVLQFIS PD+ YDEYR S  FIKE
Sbjct  503   KYDRIISCGMIEHVGHDYMEEFFGCCESLLATHGLLVLQFISAPDQCYDEYRLSPGFIKE  562

Query  2683  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  2862
             YIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL LGF+
Sbjct  563   YIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEILALGFN  622

Query  2863  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             +KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  623   EKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  672



>ref|XP_006489666.1| PREDICTED: uncharacterized protein LOC102613225 isoform X1 [Citrus 
sinensis]
Length=674

 Score =   930 bits (2404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/650 (68%), Positives = 535/650 (82%), Gaps = 5/650 (1%)
 Frame = +1

Query  1063  VREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKM  1242
             V  +L+  GC+IR  CEV+SV   ++G    VV   G    QE Y  C+MA HAPD L++
Sbjct  28    VTGQLQSWGCQIRTSCEVYSVYPADEGCT--VVSSDGS---QENYSCCVMAVHAPDALRI  82

Query  1243  LGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNT  1422
             LG QAT DE RILGAF+YVYSDI+LHR+++FMP+N AAWSAWNFLG+ + ++CLTYWLN 
Sbjct  83    LGNQATLDETRILGAFRYVYSDIFLHRDKNFMPQNTAAWSAWNFLGSTDGKICLTYWLNV  142

Query  1423  LQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGA  1602
             LQN G+T  P+L TLNP  TPE  LLKW+T +  PSVAAS+AS  ++ IQGKR IWFCGA
Sbjct  143   LQNNGETGVPFLATLNPDHTPENTLLKWSTSNQAPSVAASKASLAVDLIQGKRGIWFCGA  202

Query  1603  YQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGS  1782
             YQGYGF EDGLKAGMI AHG+L K C+ L+ P HMVPS  E GARL V  F   +I TG 
Sbjct  203   YQGYGFQEDGLKAGMITAHGVLGKNCAVLSKPKHMVPSLLEKGARLFVAGFFRRYISTGC  262

Query  1783  IILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKK  1962
             +ILLEEGGT+FTFEG  + + LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK 
Sbjct  263   LILLEEGGTIFTFEGALRNSPLKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKD  322

Query  1963  EGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARR  2142
             EGLLNLF I +AN+DL++S S+   KRGWW+P+ FT++IASAK F RHISR+NTLTQARR
Sbjct  323   EGLLNLFLILIANQDLNSSASKLKQKRGWWSPMFFTASIASAKCFFRHISRKNTLTQARR  382

Query  2143  NISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILE  2322
             N+SRHYDLSNELFSLFLD++MTYSCA+FKSE EDL+  QMRKIS+LI+KA++SK   +L+
Sbjct  383   NVSRHYDLSNELFSLFLDKSMTYSCAIFKSEHEDLEVGQMRKISVLIEKARVSKGQEVLD  442

Query  2323  IGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNC  2502
             IGCGWG+LAIE V++TGCKYTGITLS++QLKYA+ KVREAGLQD+IRF LCDYRQLP   
Sbjct  443   IGCGWGTLAIEIVKQTGCKYTGITLSKEQLKYAQIKVREAGLQDHIRFYLCDYRQLPKAN  502

Query  2503  RYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  2682
             +YDRIISCEM+E VGH++M EFF  CES+LA++G+LVLQF S PD+ YDEYR S  F+ E
Sbjct  503   KYDRIISCEMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYDEYRLSPGFLNE  562

Query  2683  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  2862
             YIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS+IL LGF+
Sbjct  563   YIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQSEILALGFN  622

Query  2863  KKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             +KFIRTWEYYFDYCAA F +  +G+YQIVFSRPGNV AF +PY+GL SAY
Sbjct  623   EKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGNVAAFSNPYEGLPSAY  672



>ref|XP_010532687.1| PREDICTED: uncharacterized protein LOC104808653 isoform X3 [Tarenaya 
hassleriana]
Length=717

 Score =   921 bits (2380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/716 (63%), Positives = 553/716 (77%), Gaps = 6/716 (1%)
 Frame = +1

Query  400   KMRVAVVGAGIS-GLVSAYVLAKGGAGVVVYEKEDYLGGHAK-TVTLDGVDLDLGFMVFN  573
             +MRVAV+G G S GL SAYVLA+ G GVV+YE+E  LGG+A  T+ +DG D+DLG ++FN
Sbjct  4     EMRVAVIGGGTSTGLASAYVLAREGLGVVLYEEEHCLGGNANDTIRVDGADVDLGLILFN  63

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  753
                 PNMME FE LG+DME+SDMS SVSLD+G G EWG+ NGFS LFAQK N+LNP+FW+
Sbjct  64    PAICPNMMEFFEDLGLDMEVSDMSLSVSLDSGGGTEWGTLNGFSSLFAQKSNVLNPFFWK  123

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MIREI KFK+D   Y++E + + D+DR +TLG+F++S GYSELFQKAY++P+C SIWS  
Sbjct  124   MIREIAKFKDDASIYVDERERDRDLDRTETLGQFLRSYGYSELFQKAYLVPICGSIWSRP  183

Query  934   SEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCE  1113
             S+ V +FSA S+LSF RN+HLLQ+FGRPQWLTV  RS +YV K+R ELE+RGC+IR   E
Sbjct  184   SDDVSSFSALSVLSFFRNNHLLQIFGRPQWLTVAGRSRTYVAKIRTELEQRGCKIRTRRE  243

Query  1114  VHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQ  1293
             V  V+T    S    V I   +  +E +D C++A +A D L++LG QATFDE R+LGAFQ
Sbjct  244   VQWVTT----SVNNGVTIRNGDGSEEIFDRCLLAMNAQDALRLLGDQATFDERRVLGAFQ  299

Query  1294  YVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNP  1473
             YV+SDIYLHR+  FMP   AAWSA NFL +  ++  +TYWLN LQNLG+ ++P+ VTLNP
Sbjct  300   YVHSDIYLHRDTDFMPHKTAAWSACNFLESTEHKGSITYWLNILQNLGEKQEPFFVTLNP  359

Query  1474  PRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIA  1653
              R P++ LLKWTT   VPSVAA  AS +L++IQG+  +WFC + QGYGFHEDGLKAG+ A
Sbjct  360   DRVPKKTLLKWTTARTVPSVAALTASQDLDKIQGQHGLWFCESCQGYGFHEDGLKAGIAA  419

Query  1654  AHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTD  1833
             A  LL+K    L NP  MV S  ETGARL VTRF+  FI TGSI LLEEGGT+F F G  
Sbjct  420   ARNLLRKDIGNLKNPKCMVLSLSETGARLFVTRFMEQFISTGSITLLEEGGTMFRFGGKH  479

Query  1834  KKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLS  2013
              K  L+ ++ +HSPQFYWKV T+ADLGLADAYI+GD SFVDK  GLLN+  I +ANRD++
Sbjct  480   PKCNLRSVLTIHSPQFYWKVMTRADLGLADAYINGDFSFVDKDNGLLNMLMILIANRDMN  539

Query  2014  ASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2193
             +  S    KRGWWTP+  T+ +AS  YF++H+SRQNTLTQARRNISRHYDLSNELF++FL
Sbjct  540   SLKSNLAKKRGWWTPMFLTAGLASVNYFLKHVSRQNTLTQARRNISRHYDLSNELFAMFL  599

Query  2194  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2373
             DETM YS A+F SEDEDLKTAQMRKISLLI+KA+I K H +LEIGCGWG+LAIE V RTG
Sbjct  600   DETMMYSAALFSSEDEDLKTAQMRKISLLIEKARIEKNHEVLEIGCGWGTLAIEVVRRTG  659

Query  2374  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2541
             C+YTGITLS +QLKYAE K REAGLQD I F LCDYRQL D+  YDRIISC ++ A
Sbjct  660   CRYTGITLSVEQLKYAEAKAREAGLQDQITFQLCDYRQLSDSRVYDRIISCFVVSA  715



>ref|XP_010650131.1| PREDICTED: (S)-coclaurine N-methyltransferase isoform X4 [Vitis 
vinifera]
Length=556

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/553 (79%), Positives = 495/553 (90%), Gaps = 0/553 (0%)
 Frame = +1

Query  1354  AWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsv  1533
             AWSAWNFLGT++N+VCLTYWLN LQN+  T +P+LVTLNPP TP+  LLKW+T HP PSV
Sbjct  4     AWSAWNFLGTIDNKVCLTYWLNVLQNIDQTSRPFLVTLNPPHTPDHTLLKWSTSHPFPSV  63

Query  1534  aasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVP  1713
             AAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAHG+L K C+ LNNP HMVP
Sbjct  64    AASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHGMLGKGCAVLNNPKHMVP  123

Query  1714  SWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKV  1893
             S  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK LLKV +++H+PQFYWK+
Sbjct  124   SLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSRKKCLLKVSLKIHNPQFYWKI  183

Query  1894  ATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTS  2073
             ATQADLGLADAYI+GD S VDK EGL NLF IF+ANRDL +S+SR N+KRGWWTPL FT+
Sbjct  184   ATQADLGLADAYINGDFSLVDKDEGLQNLFMIFIANRDLDSSLSRLNNKRGWWTPLFFTA  243

Query  2074  AIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKT  2253
              IASA+YF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK+E EDLK 
Sbjct  244   GIASARYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKTEGEDLKV  303

Query  2254  AQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKV  2433
             AQ+RKISLLI+K +I K+H +LEIGCGWGSLAIE V+RTGCKYTGITLSE+QLK+AE KV
Sbjct  304   AQLRKISLLIEKVRIDKKHEVLEIGCGWGSLAIEVVKRTGCKYTGITLSEEQLKFAEMKV  363

Query  2434  REAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILV  2613
             +EAGLQDNIRFLLCDYRQL D+ +YDRIISCEMLEAVGHE+M EFFG CESVLAE+G+LV
Sbjct  364   KEAGLQDNIRFLLCDYRQLSDSYKYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLV  423

Query  2614  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  2793
             LQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYY
Sbjct  424   LQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYY  483

Query  2794  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  2973
             QTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  
Sbjct  484   QTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAA  543

Query  2974  AFGDPYKGLASAY  3012
             AF +PY+ + S Y
Sbjct  544   AFSNPYESVVSTY  556



>ref|XP_008677861.1| PREDICTED: uncharacterized protein LOC103652693 isoform X2 [Zea 
mays]
Length=834

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/823 (56%), Positives = 605/823 (74%), Gaps = 24/823 (3%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG------VDLDLG  558
             +MRVA+VG+G+SGLV+A+ LA+ GG  V VYEKED+LGG AKTV +DG      V +DLG
Sbjct  18    EMRVAMVGSGLSGLVAAHELARSGGVRVTVYEKEDHLGG-AKTVAVDGGAEEGRVLVDLG  76

Query  559   FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSL---DNGHGYEWGSRNGFSGLFAQKKN  729
              +VFN VT PN+ME FE LGV+M  SDMSFS S+    +   +EWGSR+G SG+ AQK N
Sbjct  77    PVVFNPVTSPNLMEWFERLGVEMCTSDMSFSASMRLNKSSESFEWGSRSGMSGVLAQKSN  136

Query  730   LLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPM  909
             LL+P FW ++ EI KFKN  L YLE+  + P+  RN+TLG+FI S  YS+LFQ AY+IPM
Sbjct  137   LLSPRFWLVVHEIFKFKNHALKYLEDHRSGPN--RNETLGQFILSHRYSQLFQDAYLIPM  194

Query  910   CASIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRG  1089
             CA IW   S  ++ F A  +LSF R++ LL++    +WLTVK  S SYVNK+REELE  G
Sbjct  195   CACIWPSPSHEILGFPALFVLSFFRDNQLLEILSGSKWLTVKGGSGSYVNKIREELESNG  254

Query  1090  CEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDE  1269
             C+I+ GCEV+S+S    G    ++ + G     E YD  I+  +A D LK+LG +AT +E
Sbjct  255   CQIKIGCEVNSISKSNDGYQ--ILEVDGS---VETYDRIIIGINAHDALKVLGAEATNEE  309

Query  1270  LRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQ  1449
             L+ LGAF ++ S  YLH ++S MPRN +AWSA NFLGT ++ VC+T WLN L+N+ ++  
Sbjct  310   LKNLGAFHFIRSIAYLHSDESLMPRNSSAWSARNFLGTTSSGVCVTSWLNILENI-ESAG  368

Query  1450  PYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHED  1629
             P LVTLNPPR P   LLK    HP+PS+AA++A+ +L  IQGKR IWFCG+YQGYG+HED
Sbjct  369   PLLVTLNPPRVPNHVLLKCHISHPIPSIAAAKANLQLNSIQGKRGIWFCGSYQGYGYHED  428

Query  1630  GLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGT  1809
              +KAG  AA GLL ++C  L+NP  MV SW E GARLLV R L  +I  G+  +LEEGGT
Sbjct  429   SVKAGKAAALGLLGRKCDLLSNPKPMVSSWTEAGARLLVARSLDQYITIGNFCILEEGGT  488

Query  1810  VFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKI  1989
              F+F    +K  +K  +RVH PQFYWK AT+ DLG A AYI+G ISFVD ++GL+NL +I
Sbjct  489   TFSFGKACEKCHVKSAIRVHDPQFYWKAATEGDLGFASAYINGQISFVDHRKGLVNLVRI  548

Query  1990  FVANRD----LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRH  2157
              +ANR     LS++ S  N+++ WW+PLL  + ++ AKYF+RH  R+N++++AR+NIS H
Sbjct  549   ILANRGEFKRLSSTAS-GNTRKAWWSPLLGITGVSFAKYFLRHALRKNSVSKARKNISEH  607

Query  2158  YDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGW  2337
             YDLSN+ F+L+LD +MTYS  +FK  +E L+TAQ+RK+  LI+KAK+   HH+L+IGCGW
Sbjct  608   YDLSNDFFALYLDPSMTYSSGIFKVAEESLETAQLRKLDSLINKAKVEPGHHVLDIGCGW  667

Query  2338  GSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRI  2517
             G+LAI  V++TGCKYTGITLSE+QLKYA+ KV+E+GL+D I  LLCDYRQLP   ++DRI
Sbjct  668   GTLAIRLVKQTGCKYTGITLSEEQLKYAKRKVKESGLEDRITLLLCDYRQLPAGDKFDRI  727

Query  2518  ISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPG  2697
             ISCEM+E VGHE+M++FFG CE  LAE+G+LVLQ I++P+E YD+ R   +F+K YIFPG
Sbjct  728   ISCEMIEHVGHEYMDDFFGCCEYHLAEHGLLVLQSIALPEELYDKMRMRPEFLKTYIFPG  787

Query  2698  GCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFL  2826
             GCLPSL R+ SAM+ +SRL ++HLE+IG HYY TL  WR NF+
Sbjct  788   GCLPSLGRIVSAMSNASRLNIQHLENIGDHYYTTLMNWRDNFV  830



>gb|EMT06798.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=783

 Score =   911 bits (2355),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/787 (59%), Positives = 590/787 (75%), Gaps = 12/787 (2%)
 Frame = +1

Query  595   MELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNG---FSGLFAQKKNLLNPYFWQMIRE  765
             ME  E LGV+ME SDMSFSVS  +  G            S L AQK N+L P FW+M+ E
Sbjct  1     MEWLEGLGVEMERSDMSFSVSTQSKGGGGGCEWGNGNGISSLLAQKTNILKPSFWRMVCE  60

Query  766   ILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGV  945
             ILKFKND L+YLE+ ++NPD+DR +TLG+FI+S GYS  FQ+AY+IP+C  +WSCSS+ V
Sbjct  61    ILKFKNDALTYLEDHEHNPDLDRKETLGQFIQSHGYSLSFQEAYLIPVCTGMWSCSSQDV  120

Query  946   MAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSV  1125
             ++ SA+ +LSFCRNH L+QLF   Q  TVK RS SYVNKV+ ELE  GC I+  C+V S+
Sbjct  121   LSLSAFLVLSFCRNHGLVQLFRHSQLPTVKPRSQSYVNKVKGELESIGCRIKTSCQVKSI  180

Query  1126  STDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYS  1305
             S+ + G+AG  V+   K+  +E YD  I+  HAP+ LK+LG +AT  E RILGA QYV+ 
Sbjct  181   SSID-GAAGYRVL--EKDGSEETYDSVILGVHAPNALKVLGIEATHHERRILGACQYVHR  237

Query  1306  DIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTP  1485
             DIYLH +Q+ MPRN +AWSAWNFLGT +    +TYWLN +Q + ++ +P+LVTLNPP  P
Sbjct  238   DIYLHCDQNLMPRNTSAWSAWNFLGTTSRGFSVTYWLNQIQKV-ESVRPFLVTLNPPCVP  296

Query  1486  EQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGL  1665
             +  LLKW    PVPSVAA++A  +L++IQGKR IWFCG Y G+GFHEDGLK+G  AA GL
Sbjct  297   DHVLLKWNASLPVPSVAAAKAYLQLDQIQGKRGIWFCGVYNGHGFHEDGLKSGKAAAQGL  356

Query  1666  LKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNL  1845
             L K+C  L NP  M PSW E GARLLVTRF   +I  G++IL+EEGG+VF+F     K  
Sbjct  357   LGKKCDVLLNPKKMSPSWTEAGARLLVTRFFNQYISIGNLILVEEGGSVFSFGKACDKCC  416

Query  1846  LKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVS  2025
             +K +++VH P FYWKVA +  +GLA+AYI G  S +DK+EGLLNL  I +ANRD     +
Sbjct  417   VKSVIQVHDPLFYWKVAIEGGMGLAEAYIDGCYSVLDKREGLLNLILILIANRD--ERRN  474

Query  2026  RSNSKRGWW-TPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             R  +++G+W +P    + +A AK+F+R  SR+NT TQ RRNIS+HYDLSN+ FSLFLD+T
Sbjct  475   RRIARKGFWLSPFHVIAQLAYAKHFLRQTSRKNTATQTRRNISQHYDLSNDFFSLFLDKT  534

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCAVFK ++E L+ AQ RK+SLLI+KAK+ +EHH+L+IG GWGSLAIE V++TGCKY
Sbjct  535   MTYSCAVFK-DNESLEAAQQRKLSLLINKAKVKREHHVLDIGSGWGSLAIETVKQTGCKY  593

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TG+TLS +Q KYAE KVREAGL+D I FLLCDYR++P   +YD IISC M+E VGHE+M+
Sbjct  594   TGVTLSAEQHKYAERKVREAGLEDRINFLLCDYRKIPP-FKYDTIISCGMIEHVGHEYMD  652

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CES LAE+GILVLQFIS+P+ERY++YR+  DFIKEYIFPGGCLPSL+R+ SAM  
Sbjct  653   EFFACCESYLAEDGILVLQFISVPEERYEQYRKRPDFIKEYIFPGGCLPSLARIMSAMTT  712

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSR C+EH+E+IG +YY TL  WR NF+  + ++L LGFD++F+R WEYY  + AAGF +
Sbjct  713   SSRFCIEHVENIGPNYYTTLMHWRDNFMANKDEVLALGFDERFLRIWEYYLIFSAAGFKS  772

Query  2923  CTLGDYQ  2943
               LGDYQ
Sbjct  773   RALGDYQ  779



>ref|XP_006489667.1| PREDICTED: uncharacterized protein LOC102613225 isoform X2 [Citrus 
sinensis]
Length=603

 Score =   903 bits (2333),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/601 (70%), Positives = 509/601 (85%), Gaps = 0/601 (0%)
 Frame = +1

Query  1210  MAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVN  1389
             MA HAPD L++LG QAT DE RILGAF+YVYSDI+LHR+++FMP+N AAWSAWNFLG+ +
Sbjct  1     MAVHAPDALRILGNQATLDETRILGAFRYVYSDIFLHRDKNFMPQNTAAWSAWNFLGSTD  60

Query  1390  NRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERI  1569
              ++CLTYWLN LQN G+T  P+L TLNP  TPE  LLKW+T +  PSVAAS+AS  ++ I
Sbjct  61    GKICLTYWLNVLQNNGETGVPFLATLNPDHTPENTLLKWSTSNQAPSVAASKASLAVDLI  120

Query  1570  QGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVT  1749
             QGKR IWFCGAYQGYGF EDGLKAGMI AHG+L K C+ L+ P HMVPS  E GARL V 
Sbjct  121   QGKRGIWFCGAYQGYGFQEDGLKAGMITAHGVLGKNCAVLSKPKHMVPSLLEKGARLFVA  180

Query  1750  RFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAY  1929
              F   +I TG +ILLEEGGT+FTFEG  + + LK ++R+H+PQFYWKV T+ADLGLAD+Y
Sbjct  181   GFFRRYISTGCLILLEEGGTIFTFEGALRNSPLKTVLRIHNPQFYWKVMTEADLGLADSY  240

Query  1930  IHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHI  2109
             I+GD SFVDK EGLLNLF I +AN+DL++S S+   KRGWW+P+ FT++IASAK F RHI
Sbjct  241   INGDFSFVDKDEGLLNLFLILIANQDLNSSASKLKQKRGWWSPMFFTASIASAKCFFRHI  300

Query  2110  SRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDK  2289
             SR+NTLTQARRN+SRHYDLSNELFSLFLD++MTYSCA+FKSE EDL+  QMRKIS+LI+K
Sbjct  301   SRKNTLTQARRNVSRHYDLSNELFSLFLDKSMTYSCAIFKSEHEDLEVGQMRKISVLIEK  360

Query  2290  AKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFL  2469
             A++SK   +L+IGCGWG+LAIE V++TGCKYTGITLS++QLKYA+ KVREAGLQD+IRF 
Sbjct  361   ARVSKGQEVLDIGCGWGTLAIEIVKQTGCKYTGITLSKEQLKYAQIKVREAGLQDHIRFY  420

Query  2470  LCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYD  2649
             LCDYRQLP   +YDRIISCEM+E VGH++M EFF  CES+LA++G+LVLQF S PD+ YD
Sbjct  421   LCDYRQLPKANKYDRIISCEMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYD  480

Query  2650  EYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLE  2829
             EYR S  F+ EYIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E
Sbjct  481   EYRLSPGFLNEYIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFME  540

Query  2830  RQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             +QS+IL LGF++KFIRTWEYYFDYCAA F +  +G+YQIVFSRPGNV AF +PY+GL SA
Sbjct  541   KQSEILALGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGNVAAFSNPYEGLPSA  600

Query  3010  Y  3012
             Y
Sbjct  601   Y  601



>ref|XP_011029775.1| PREDICTED: uncharacterized protein LOC105129420 isoform X4 [Populus 
euphratica]
Length=566

 Score =   898 bits (2320),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/566 (76%), Positives = 490/566 (87%), Gaps = 0/566 (0%)
 Frame = +1

Query  1315  LHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQC  1494
             + RE   +     AWSAWNFLG+ +N+VCLTYWLN LQN+ +T  P+LVTLNP   P+  
Sbjct  1     MRREYLVLSNICIAWSAWNFLGSTDNKVCLTYWLNVLQNIDETGLPFLVTLNPDHVPDHT  60

Query  1495  LLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKK  1674
             L+KW+TGHPVPSVAA++AS EL+ IQGKRRIWFCGAYQGYGFHEDGLK+GM+AAHGLL  
Sbjct  61    LVKWSTGHPVPSVAATKASLELDHIQGKRRIWFCGAYQGYGFHEDGLKSGMVAAHGLLGN  120

Query  1675  RCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKV  1854
             RC+ L+NP HM PS  ETGARL VTRFL  +I TG +ILLEEGGTVF+FEGT KK  LK 
Sbjct  121   RCAILSNPKHMAPSMLETGARLFVTRFLGHYISTGCLILLEEGGTVFSFEGTSKKCSLKT  180

Query  1855  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2034
             +++VH+PQFYWK+ TQADLGLADAYI+GD SFV+K EGLLNL  I + NRD++ S S+ N
Sbjct  181   VLKVHNPQFYWKIMTQADLGLADAYINGDFSFVNKDEGLLNLLMILIVNRDVNKSASKLN  240

Query  2035  SKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  2214
              KRGWWTPLLFT+ IASAK+FI+H+SRQNTLTQARRNISRHYDLSNELF+LFLDETMTYS
Sbjct  241   KKRGWWTPLLFTAGIASAKFFIQHVSRQNTLTQARRNISRHYDLSNELFALFLDETMTYS  300

Query  2215  CAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGIT  2394
             C VFK+EDEDLK AQMRKISLLI+KA ISK+H ILEIGCGWG+LAIEAV+RTGCKYTGIT
Sbjct  301   CGVFKTEDEDLKDAQMRKISLLIEKAGISKDHEILEIGCGWGTLAIEAVQRTGCKYTGIT  360

Query  2395  LSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFG  2574
             LSE+QLK+AE KV+EAGLQD I F LCDYRQLP   +YDRIISCEM+EAVGHE+M EFFG
Sbjct  361   LSEEQLKHAEMKVKEAGLQDRIAFHLCDYRQLPKTHKYDRIISCEMIEAVGHEYMEEFFG  420

Query  2575  RCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL  2754
              CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TSAMA SSRL
Sbjct  421   CCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITSAMATSSRL  480

Query  2755  CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLG  2934
             CVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDY AAGF T TLG
Sbjct  481   CVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYSAAGFKTHTLG  540

Query  2935  DYQIVFSRPGNVTAFGDPYKGLASAY  3012
             +YQ+VFSRPGNV A  +PYK   SAY
Sbjct  541   NYQVVFSRPGNVVALSNPYKSFPSAY  566



>ref|XP_009780643.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 [Nicotiana sylvestris]
Length=543

 Score =   895 bits (2313),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/543 (79%), Positives = 482/543 (89%), Gaps = 0/543 (0%)
 Frame = +1

Query  1384  VNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELE  1563
             +NNR C+TYWLN +QNL DTK PYLVT++PP TP+  LLKWTT H VPSVAAS+AS EL+
Sbjct  1     MNNRGCMTYWLNIIQNLVDTKLPYLVTIDPPHTPDHTLLKWTTCHLVPSVAASKASRELD  60

Query  1564  RIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLL  1743
             +IQGKR IWFCGAYQGYGFHED LKAG+ AA  +L+++C+ L+NP HMVP+WPETGARLL
Sbjct  61    QIQGKRGIWFCGAYQGYGFHEDELKAGVAAADDILRRKCTILDNPKHMVPTWPETGARLL  120

Query  1744  VTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLAD  1923
             VTRFL SFI TG IILLE+GGT+FTF+ TD+K  LKV +RVHS QFYWKVATQ DLGLAD
Sbjct  121   VTRFLKSFIATGCIILLEDGGTIFTFQVTDRKCTLKVSLRVHSTQFYWKVATQGDLGLAD  180

Query  1924  AYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIR  2103
             A+IHGD SFVDK EGLLNLF IFVANRDL ASV+RS++KRGWWTPLL T+A++SAKYFI+
Sbjct  181   AFIHGDFSFVDKNEGLLNLFMIFVANRDLKASVTRSSNKRGWWTPLLSTAALSSAKYFIQ  240

Query  2104  HISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLI  2283
             H+S QNTLT+ARRNISRHYDLSNELFSLFLDETMTYSCA+FKSEDEDLKTAQ+RKISLLI
Sbjct  241   HVSNQNTLTKARRNISRHYDLSNELFSLFLDETMTYSCAIFKSEDEDLKTAQLRKISLLI  300

Query  2284  DKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIR  2463
              KAKISKEHHILEIG GWGSLA+E V++TGCKYTG+TLSEQQL YA+  V +AGLQD I 
Sbjct  301   KKAKISKEHHILEIGFGWGSLAVEVVKQTGCKYTGVTLSEQQLTYAQLIVEQAGLQDQIT  360

Query  2464  FLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDER  2643
             FLLCDYRQ+P+  +YDRIISC MLE VGH+FM EFF  CES LAE+G+LV+QFISIPDER
Sbjct  361   FLLCDYRQMPNKDKYDRIISCGMLEHVGHDFMGEFFSCCESALAEDGLLVVQFISIPDER  420

Query  2644  YDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANF  2823
             YDEYRQSSDFIKEYIFPGGCLP+L+RVTSAMAA+SRLCV HLE+IGIHYYQTLRCWR  F
Sbjct  421   YDEYRQSSDFIKEYIFPGGCLPALNRVTSAMAAASRLCVVHLEEIGIHYYQTLRCWREKF  480

Query  2824  LERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLA  3003
             L+ QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV  FGDPY G+ 
Sbjct  481   LKNQSQIRALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAVFGDPYNGVP  540

Query  3004  SAY  3012
             SAY
Sbjct  541   SAY  543



>ref|XP_008460676.1| PREDICTED: pavine N-methyltransferase-like isoform X3 [Cucumis 
melo]
Length=557

 Score =   882 bits (2278),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/555 (75%), Positives = 482/555 (87%), Gaps = 0/555 (0%)
 Frame = +1

Query  1348  LAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvp  1527
             +AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLNP + P+  LLKW+TGHP+P
Sbjct  3     IAAWSAWNFLGNTDKKVCLTYWLNILQNLGETGPPFLVTLNPDKEPKNILLKWSTGHPIP  62

Query  1528  svaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHM  1707
             SVAAS+AS+E   IQG RRIWFCGAYQGYGFHEDGLKAG++AA  LL    + L+NP HM
Sbjct  63    SVAASKASNEFHSIQGNRRIWFCGAYQGYGFHEDGLKAGIVAAQNLLGNSFTLLSNPKHM  122

Query  1708  VPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYW  1887
              PS  +TGARL VTRFL  +I +GS+ L+E+GGT+FTFEGTDKK L KV V+VHSPQFYW
Sbjct  123   APSLVDTGARLFVTRFLGQYITSGSLTLIEDGGTIFTFEGTDKKCLPKVAVKVHSPQFYW  182

Query  1888  KVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLF  2067
             K+ T+ADLGLADAYI+GD SFVDK EGLLN F I +A+RD ++S+++   KRGWWTP LF
Sbjct  183   KIMTRADLGLADAYINGDFSFVDKDEGLLNFFLIIIASRDTNSSIAKQKKKRGWWTPPLF  242

Query  2068  TSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDL  2247
             T+ IASAKYF +H SRQNTLTQARRNISRHYDLSNELFSLFLD+TMTYSCA+FK E+EDL
Sbjct  243   TACIASAKYFFQHASRQNTLTQARRNISRHYDLSNELFSLFLDDTMTYSCAIFKGENEDL  302

Query  2248  KTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAED  2427
             K AQMRKISLLI+KA+I+K HH+LEIGCGWGSLAIE V++TGC YTGITLSE+QLKYAE 
Sbjct  303   KVAQMRKISLLIEKARINKNHHVLEIGCGWGSLAIEIVKKTGCHYTGITLSEEQLKYAEK  362

Query  2428  KVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGI  2607
             +V++A LQD IRFLLCDYR+LP   RYDRIISCEM+EAVGHEFM +FFG CESVLAENG+
Sbjct  363   RVKDANLQDRIRFLLCDYRKLPSTERYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGL  422

Query  2608  LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIH  2787
              VLQFISIPDERYDEYR SSDFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIH
Sbjct  423   FVLQFISIPDERYDEYRLSSDFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIH  482

Query  2788  YYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  2967
             Y+QTLRCWR NFLE QS+IL LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGN
Sbjct  483   YHQTLRCWRKNFLENQSKILQLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGN  542

Query  2968  VTAFGDPYKGLASAY  3012
             V AF +PY+G+ SAY
Sbjct  543   VAAFTNPYQGIPSAY  557



>ref|XP_009102618.1| PREDICTED: uncharacterized protein LOC103828740 isoform X2 [Brassica 
rapa]
Length=619

 Score =   877 bits (2267),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/608 (69%), Positives = 495/608 (81%), Gaps = 1/608 (0%)
 Frame = +1

Query  1192  AYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWN  1371
              +D CI+A +APD L++LG+ AT DE R+LGAFQY YSDIYLHR+   MPRN  AWSAWN
Sbjct  11    VFDRCILAVNAPDALRLLGEDATPDETRVLGAFQYAYSDIYLHRDTDLMPRNRVAWSAWN  70

Query  1372  FLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasras  1551
             FL +  N+  LT+WLN +QNL +    Y +TLNP  +P++ L KWT+G P+PSV+A +AS
Sbjct  71    FLTSSENKASLTHWLNIIQNLDEEHDSYFLTLNPEVSPKKTLYKWTSGRPLPSVSAWKAS  130

Query  1552  sELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPL-NNPNHMVPSWPET  1728
              EL +IQGKR IWFCGAYQG GFHEDGLKAGM AA  LL K   PL +NP HMVPS  E 
Sbjct  131   QELNKIQGKRGIWFCGAYQGSGFHEDGLKAGMGAAQSLLGKDMVPLLSNPKHMVPSLTEK  190

Query  1729  GARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQAD  1908
             GAR L TRFL  FI TG + + EEGGT+FTF+G D +  L+ ++++ SP FYWKV TQAD
Sbjct  191   GARFLFTRFLRHFISTGCVTVYEEGGTMFTFKGKDLRCNLESVIKIRSPHFYWKVMTQAD  250

Query  1909  LGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASA  2088
             LGLADAYI+GD SFV+K+ GLLNL  I +ANR+L++       KRGWWTP+  T+ + SA
Sbjct  251   LGLADAYINGDFSFVNKETGLLNLIMILIANRELNSKNLNLAKKRGWWTPMFMTAGLTSA  310

Query  2089  KYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRK  2268
               F+RH SRQNTLT+ARRNISRHYDLSNELF+LFLD+TM+YS AVFKS+DEDLKTAQMRK
Sbjct  311   TQFLRHFSRQNTLTKARRNISRHYDLSNELFALFLDDTMSYSTAVFKSDDEDLKTAQMRK  370

Query  2269  ISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGL  2448
             I+LLIDKA+I K+H +LEIGCGWG+LAIE V++TGCKYTGITLS +QLKYAE+KV+EAGL
Sbjct  371   INLLIDKARIEKDHEVLEIGCGWGTLAIEVVKKTGCKYTGITLSIEQLKYAEEKVKEAGL  430

Query  2449  QDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFIS  2628
             QD I F LCDYRQL D  +YDRIISCEM+E VGHEFM+ FF  CE+ LAE+GI VLQFIS
Sbjct  431   QDRITFELCDYRQLSDARKYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFIS  490

Query  2629  IPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRC  2808
             IP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRC
Sbjct  491   IPEERYNEYRLNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRC  550

Query  2809  WRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDP  2988
             WR NFLE Q QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP
Sbjct  551   WRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDP  610

Query  2989  YKGLASAY  3012
             ++   SA+
Sbjct  611   FRNFPSAH  618



>ref|XP_008340641.1| PREDICTED: uncharacterized protein LOC103403572 isoform X2 [Malus 
domestica]
Length=554

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/549 (78%), Positives = 481/549 (88%), Gaps = 1/549 (0%)
 Frame = +1

Query  1351  AAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvps  1530
              AWSAWNFLG+  N+VCLTYWLN LQN+ +T  P+LVTLNP  TP+  LLKW+T HPVPS
Sbjct  3     TAWSAWNFLGSNGNKVCLTYWLNVLQNIDETGLPFLVTLNPEHTPKHTLLKWSTSHPVPS  62

Query  1531  vaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMV  1710
             VAAS+AS EL RIQGKR IWFCGAY GYGFHEDGLKAGM AAHGLL K  + L+NP HMV
Sbjct  63    VAASKASLELPRIQGKRGIWFCGAYXGYGFHEDGLKAGMDAAHGLLGKGXALLDNPKHMV  122

Query  1711  PSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWK  1890
             PS  ETGARL VTRFL  FI TG +I LEEGGT+FTFEGT K   LK +++VH+PQFYWK
Sbjct  123   PSLTETGARLFVTRFLTHFISTGCLIFLEEGGTIFTFEGTRKGCSLKCVIKVHNPQFYWK  182

Query  1891  VATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFT  2070
             V TQADLGLADAYI+GD SFVDK +GLLNL  I +ANRD ++S S+   KRGWWTPLLFT
Sbjct  183   VMTQADLGLADAYINGDFSFVDKDKGLLNLIMILIANRDANSSDSKLTKKRGWWTPLLFT  242

Query  2071  SAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLK  2250
             ++IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFS FLDETMTYS AVFK+EDEDLK
Sbjct  243   ASIASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSQFLDETMTYSSAVFKTEDEDLK  302

Query  2251  TAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDK  2430
              AQ+RKIS+LI+KA+I K H +LEIGCGWGSLAI+ V++TGCKYTGITLSE+QLKYA++K
Sbjct  303   VAQLRKISILIEKARIEKNHEVLEIGCGWGSLAIKVVKQTGCKYTGITLSEEQLKYAQEK  362

Query  2431  VREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGIL  2610
             V+EAGLQD I+FLLCDYRQL  + +YDRIISCEMLE+VGHEFM+EFF  CESVLAENG+L
Sbjct  363   VKEAGLQDRIKFLLCDYRQLA-SYKYDRIISCEMLESVGHEFMDEFFSCCESVLAENGLL  421

Query  2611  VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHY  2790
             VLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY
Sbjct  422   VLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHY  481

Query  2791  YQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  2970
             +QTLR WR NFL+RQ +IL LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGNV
Sbjct  482   FQTLRYWRKNFLDRQGEILALGFDEKFIRTWEYYFDYCAAGFRTYTLGNYQIVFSRPGNV  541

Query  2971  TAFGDPYKG  2997
              AF +PYKG
Sbjct  542   PAFSNPYKG  550



>ref|XP_006606356.1| PREDICTED: uncharacterized protein LOC100815937 isoform X3 [Glycine 
max]
Length=566

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/560 (75%), Positives = 481/560 (86%), Gaps = 0/560 (0%)
 Frame = +1

Query  1315  LHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQC  1494
             +  E S +   L AWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   PE  
Sbjct  6     MSEEYSELFNMLTAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHIPENT  65

Query  1495  LLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKK  1674
             LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAYQGYGFHEDG KAGMIAAHG+L  
Sbjct  66    LLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYQGYGFHEDGFKAGMIAAHGILGS  125

Query  1675  RCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKV  1854
              C+   NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K   LK 
Sbjct  126   CCALQTNPKHMVPSWKELGARIFVTRFLSCYITTGCLMLLEEGGTMFTFEGTGKNCGLKS  185

Query  1855  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2034
             ++RVH PQFYWKV TQADLGLADAYI+GD SFVDK EGLLNL  I +ANRD +AS S+  
Sbjct  186   VLRVHDPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNLILILIANRDSNASNSKLK  245

Query  2035  SKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  2214
               RGWWTP+ FTSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSN+LF+ FLDETMTYS
Sbjct  246   KNRGWWTPVFFTSALTSAKFFMDHVSRRNTLTQARRNISRHYDLSNDLFATFLDETMTYS  305

Query  2215  CAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGIT  2394
             CAVFK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKYTGIT
Sbjct  306   CAVFKNKDEDLKDAQKRKISLLIEKARIDKTHEILEIGCGWGSLAIEVVKQTGCKYTGIT  365

Query  2395  LSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFG  2574
             LSE+QLK AE +V++AGLQD I F+LCDYRQLP   +YDRIISCEM+EAVGHE+M EFFG
Sbjct  366   LSEEQLKLAEQRVKDAGLQDRINFVLCDYRQLPKTYKYDRIISCEMIEAVGHEYMEEFFG  425

Query  2575  RCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL  2754
              CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRL
Sbjct  426   CCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSRL  485

Query  2755  CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLG  2934
             CVEH+E+IGIHYYQTLRCWR NFL+RQ++IL LGF++KFIRTWEYYFDYC AGF + TLG
Sbjct  486   CVEHVENIGIHYYQTLRCWRKNFLKRQNEILALGFNEKFIRTWEYYFDYCGAGFKSLTLG  545

Query  2935  DYQIVFSRPGNVTAFGDPYK  2994
             +YQ+VFSRPGNV A GDPYK
Sbjct  546   NYQVVFSRPGNVPALGDPYK  565



>gb|EPS65744.1| cyclopropane fatty acid synthase, partial [Genlisea aurea]
Length=567

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/569 (73%), Positives = 479/569 (84%), Gaps = 3/569 (1%)
 Frame = +1

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR++  MP N AAWSAWNFLG+ +++VC+TYWLN LQN+     P+LVTLNPP T
Sbjct  2     SDIFLHRDKRLMPNNEAAWSAWNFLGSTDDKVCVTYWLNVLQNIYQEDLPFLVTLNPPYT  61

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P   LLKWTT HP+PSVAAS+ASS+ + IQGKRRIWFCGAY GYGFHEDGLKAG++AA+ 
Sbjct  62    PHHSLLKWTTSHPIPSVAASKASSQFDLIQGKRRIWFCGAYHGYGFHEDGLKAGILAANS  121

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LLK+ C+   NP  MVPS  E GARLLVT+FLA FI  GSI LLE GGT+F+FEG   K+
Sbjct  122   LLKRSCTLHVNPRQMVPSLVEIGARLLVTQFLARFIAIGSITLLENGGTMFSFEGDKGKS  181

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LKV +R+HSP FY KVA +ADLGLADAYI+GD SFVD+ EGLLNLF IF+ANRD  +S 
Sbjct  182   HLKVTLRIHSPHFYRKVAVEADLGLADAYINGDFSFVDEDEGLLNLFMIFIANRDFCSS-  240

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
               +  K GWWTPLL TS ++SAKYF+RH+SRQNTL+QARRNISRHYDLSN+LFSLFLDET
Sbjct  241   --TMPKGGWWTPLLLTSFLSSAKYFLRHVSRQNTLSQARRNISRHYDLSNDLFSLFLDET  298

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
             MTYSCA+FK+E EDLK AQ RKISLLI+K++I+K HHILEIGCGWG+L +E V+RTGCKY
Sbjct  299   MTYSCAIFKTEGEDLKVAQRRKISLLIEKSRITKSHHILEIGCGWGTLGVEVVKRTGCKY  358

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSEQQL+YA+ K +EAG+QD   FLLCDYRQLP   RYDRIISCEMLEAVGHEFM 
Sbjct  359   TGITLSEQQLRYAQAKAKEAGVQDRTSFLLCDYRQLPKTDRYDRIISCEMLEAVGHEFME  418

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CES+L ++G+LVLQFISIPD RYD YR+SSDFIKEYIFPGGCLPSLSRVT+AMA 
Sbjct  419   EFFSCCESLLVKDGLLVLQFISIPDVRYDTYRRSSDFIKEYIFPGGCLPSLSRVTAAMAT  478

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             +SR CVEHLEDIGIHYY TLRCWR  FL  + +I DLGFD+KFIRTW YYFDYCAAGF +
Sbjct  479   ASRFCVEHLEDIGIHYYPTLRCWREKFLGSRKEIEDLGFDEKFIRTWVYYFDYCAAGFKS  538

Query  2923  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             CTLG+YQIV SRPGNVTAFG+PY  L SA
Sbjct  539   CTLGNYQIVMSRPGNVTAFGNPYSSLPSA  567



>gb|KDO40331.1| hypothetical protein CISIN_1g036521mg, partial [Citrus sinensis]
Length=602

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/627 (68%), Positives = 496/627 (79%), Gaps = 30/627 (5%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT PNMME  ESLG DMEIS+MSFS                       KKN+L PYFWQ+
Sbjct  1     VTCPNMMEFLESLGADMEISNMSFS-----------------------KKNVLGPYFWQI  37

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IREI+KFK+DVL YLEE +NNPD+DR++TLG+FIKSRGYSELFQKAY++P+C SIWSC S
Sbjct  38    IREIMKFKDDVLCYLEELENNPDIDRDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPS  97

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             EG+M+FSA+SILSF RNHHLLQLFGRPQWLTV+ RSHSYVNKV   LE  GC+I+ GCEV
Sbjct  98    EGIMSFSAFSILSFYRNHHLLQLFGRPQWLTVRSRSHSYVNKVIALLESLGCQIKTGCEV  157

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
              SV   ++G       + G    Q  YDGCIMA HAPD L++LG Q+TF+E R+LGAFQY
Sbjct  158   CSVLQYDEGRTE----VRGDGF-QGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQY  212

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGD--TKQPYLVTLN  1470
             VYSDI+LHR+++FMPRN AAWSAWNFLG ++ + CLTYWLN LQN+GD  T  P+LVTLN
Sbjct  213   VYSDIFLHRDKNFMPRNPAAWSAWNFLGGLDGKACLTYWLNVLQNIGDGETGLPFLVTLN  272

Query  1471  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1650
             P  TP   LLKW+TGHPVPSVAAS+AS EL+ IQGKR IWFC AYQGYGFHEDGLKAGMI
Sbjct  273   PDHTPNNTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMI  332

Query  1651  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1830
             AAHG+L KRC+ L NP +MVPS  E GARL V RFL  F+  G +ILLEE GT FTFEGT
Sbjct  333   AAHGVLGKRCASLCNPRNMVPSLMERGARLFVARFLKQFVCAGCLILLEEVGTTFTFEGT  392

Query  1831  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2010
              +   L+ ++R+H+PQFYWKV T ADLGLAD+YI GD SF DK+EGLLNL  I +A RDL
Sbjct  393   RRYCNLRTVLRIHNPQFYWKVMTHADLGLADSYIDGDFSFADKEEGLLNLIMILIAIRDL  452

Query  2011  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2190
              ASVS+ N KRGWWTPLLFTS IASA YF+RHISR+N+L QARRNIS HYDLSNELF+LF
Sbjct  453   DASVSKVNQKRGWWTPLLFTSGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALF  512

Query  2191  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2370
             +DE+MTYSC +FK EDEDLK AQMRK SL I+KA++SK H +LEIGCGWG+ AIE V +T
Sbjct  513   MDESMTYSCPIFKDEDEDLKVAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQT  572

Query  2371  GCKYTGITLSEQQLKYAEDKVREAGLQ  2451
             GC YTGITLS +QLKYAE KV EAGLQ
Sbjct  573   GCNYTGITLSAEQLKYAEMKVNEAGLQ  599



>ref|XP_006589308.1| PREDICTED: uncharacterized protein LOC100801659 isoform X2 [Glycine 
max]
Length=566

 Score =   856 bits (2211),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/560 (74%), Positives = 478/560 (85%), Gaps = 0/560 (0%)
 Frame = +1

Query  1315  LHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQC  1494
             +  E S +   L AWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   PE  
Sbjct  6     MSEEYSELFNMLTAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHIPENT  65

Query  1495  LLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKK  1674
             LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAY GYGFHEDG KAGMIAAHGLL  
Sbjct  66    LLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYLGYGFHEDGFKAGMIAAHGLLGS  125

Query  1675  RCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKV  1854
              C    NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K   LK 
Sbjct  126   CCVLQTNPKHMVPSWKELGARIFVTRFLSYYINTGCLMLLEEGGTMFTFEGTGKNCGLKS  185

Query  1855  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2034
             ++RVH+PQFYWKV TQADLGLADAYI+GD SFVDK EGLL L  I +ANRD +AS  +  
Sbjct  186   VLRVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLILILILIANRDSNASNLKLK  245

Query  2035  SKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  2214
               RGWWTP+  TSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSNELF++FLDETMTYS
Sbjct  246   KNRGWWTPVFLTSALTSAKFFMEHVSRRNTLTQARRNISRHYDLSNELFAIFLDETMTYS  305

Query  2215  CAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGIT  2394
             CA+FK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKYTGIT
Sbjct  306   CALFKNKDEDLKDAQKRKISLLIEKARIDKTHEILEIGCGWGSLAIEVVKQTGCKYTGIT  365

Query  2395  LSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFG  2574
             LS++QLK AE +V++AGLQD I+FLLCDYRQLP   +YDRIISCEM+EAVGHE+M EFFG
Sbjct  366   LSKEQLKLAEQRVKDAGLQDRIKFLLCDYRQLPKAYKYDRIISCEMIEAVGHEYMEEFFG  425

Query  2575  RCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL  2754
              CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRL
Sbjct  426   CCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSRL  485

Query  2755  CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLG  2934
             C EH+E+IGIHYYQTLRCWR NFLERQ++I+ LGF++KFIRTWEYYFDYC AGF + TLG
Sbjct  486   CGEHVENIGIHYYQTLRCWRKNFLERQNEIMALGFNEKFIRTWEYYFDYCGAGFKSLTLG  545

Query  2935  DYQIVFSRPGNVTAFGDPYK  2994
             +YQ+VFSRPGNV A GDPYK
Sbjct  546   NYQVVFSRPGNVAALGDPYK  565



>ref|XP_006431328.1| hypothetical protein CICLE_v10030464mg [Citrus clementina]
 gb|ESR44568.1| hypothetical protein CICLE_v10030464mg [Citrus clementina]
Length=585

 Score =   852 bits (2200),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/590 (68%), Positives = 484/590 (82%), Gaps = 5/590 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  T
Sbjct  1     MQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHAT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
              PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKN LNPYFWQM+R
Sbjct  61    SPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNFLNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D L Y++E +NNPD++RN+TLG+F+KSRGYSELFQK+Y+IP+C S+WSC SE 
Sbjct  121   EINKFKDDALRYIDELENNPDINRNETLGQFLKSRGYSELFQKSYLIPLCDSVWSCPSER  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
              M+FSA+S+LSFCRNHHLL+LFG PQWLT + RSHSYVNKV  +L+  GC+IR  CEV+S
Sbjct  181   AMSFSAFSVLSFCRNHHLLELFGHPQWLTFRIRSHSYVNKVTGQLQSWGCQIRTSCEVYS  240

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V   ++G    VV   G    QE Y  C+MA HAPD L++LG QAT DE RILGAF+YVY
Sbjct  241   VYPADEGCT--VVSSDGS---QENYSCCVMAVHAPDALRILGNQATLDETRILGAFRYVY  295

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             SDI+LHR+++FMP+N AAWSAWNFLG+ + ++CLTYWLN LQN G+T  P+L TLNP  T
Sbjct  296   SDIFLHRDKNFMPQNTAAWSAWNFLGSTDGKICLTYWLNVLQNNGETGVPFLATLNPDHT  355

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             PE  LLKW+T + VPSVAAS+AS EL+ IQGKR IWFCGAYQGYGF EDGLKAGMI AHG
Sbjct  356   PENTLLKWSTSNRVPSVAASKASLELDLIQGKRGIWFCGAYQGYGFQEDGLKAGMITAHG  415

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             +L K C+ L+NP HMVPS  E GARL V RF   +I TG +ILLEEGGT+FTFEGT + +
Sbjct  416   VLGKNCAVLSNPKHMVPSLLEKGARLFVARFFRRYISTGCLILLEEGGTIFTFEGTLRNS  475

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK EGLLNLF I +AN+DL++S 
Sbjct  476   PLKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKDEGLLNLFLIVIANKDLNSST  535

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSN  2172
             S+   KRGWW+P+ FT++IASAK F RHISR+NTLTQARRN+SRHYDL N
Sbjct  536   SKLKQKRGWWSPMFFTASIASAKCFFRHISRKNTLTQARRNVSRHYDLVN  585



>ref|XP_008796359.1| PREDICTED: uncharacterized protein LOC103711840 isoform X6 [Phoenix 
dactylifera]
Length=558

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/558 (71%), Positives = 472/558 (85%), Gaps = 1/558 (0%)
 Frame = +1

Query  1336  MPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTG  1515
             MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP   P+  LLKW+T 
Sbjct  1     MPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNLPFLVTLNPRFVPKHTLLKWSTS  60

Query  1516  HpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNN  1695
             HP+PSVAAS+AS E+ +IQGKRRIWFCGAYQG+GFHEDGLKAG++AA+ +L   C  L N
Sbjct  61    HPIPSVAASKASLEIGKIQGKRRIWFCGAYQGFGFHEDGLKAGIVAANSVLGMDCVLLRN  120

Query  1696  PNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSP  1875
             P  MVPS  ETGARL+VTRFL  +I TG + LLEEGGT+F FEGT+KK+ +K ++++H P
Sbjct  121   PRQMVPSLVETGARLIVTRFLEKYISTGCLTLLEEGGTIFVFEGTNKKSCIKSILKIHDP  180

Query  1876  QFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWT  2055
              FYWKVAT+ADLGLADAYI+   SFVD++EGLLNLF I + NRD ++S S+S + RGWWT
Sbjct  181   LFYWKVATEADLGLADAYINRYFSFVDEQEGLLNLFMILIVNRDQNSS-SKSKTTRGWWT  239

Query  2056  PLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSE  2235
             P+LFT+ + SA+YF+RHISRQNT+ QA +NIS HYDLSNE FSLFLDETMTYS A+FK E
Sbjct  240   PILFTAGLQSARYFLRHISRQNTVAQAPKNISHHYDLSNEFFSLFLDETMTYSGAIFKME  299

Query  2236  DEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLK  2415
             +EDLK AQ+ KISLLI+KA+I  +H ILEIGCGWGSLAIE V++TGCKYTGITLSE+QLK
Sbjct  300   NEDLKVAQLHKISLLIEKARIEAKHEILEIGCGWGSLAIEVVKQTGCKYTGITLSEEQLK  359

Query  2416  YAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLA  2595
             +A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGHE+M EFFG CES+LA
Sbjct  360   FAKRRAKEACLEDRITFLLCDYRQLPCYRKYDRIISCEMIEGVGHEYMEEFFGCCESLLA  419

Query  2596  ENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLED  2775
             E+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+
Sbjct  420   EDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLEN  479

Query  2776  IGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFS  2955
             IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFS
Sbjct  480   IGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFS  539

Query  2956  RPGNVTAFGDPYKGLASA  3009
             RPGN TAF +PY G+ SA
Sbjct  540   RPGNSTAFSNPYDGVPSA  557



>gb|EEE62857.1| hypothetical protein OsJ_17660 [Oryza sativa Japonica Group]
Length=796

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/839 (53%), Positives = 566/839 (67%), Gaps = 95/839 (11%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSV--SLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIRE  765
             MM+ F  LG +ME SDMSFSV   LD     EW S NG SGL A++ N L+P FW+MI E
Sbjct  1     MMQWFADLGANMERSDMSFSVRTQLDACGECEWASSNGISGLLAKRSNALSPSFWRMISE  60

Query  766   ILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGV  945
              LKFK D L YLE+ +NN D+++++TLG+F++S GY + FQ+AY+               
Sbjct  61    TLKFKRDALRYLEDCENNLDLEQSETLGQFVQSHGYCQFFQEAYL---------------  105

Query  946   MAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSV  1125
                                LF R Q L V  RS SY NKVRE+LE R C I+  C V S+
Sbjct  106   -------------------LFSRTQPLIVNGRSQSYFNKVREDLESRSCRIKTNCHVKSI  146

Query  1126  STDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYS  1305
             S+ ++G    V+ + G    +E YD  I+  HA D LK+LG +AT +E RILGAFQ++  
Sbjct  147   SSFDRGYR--VLEVDGS---EEMYDRIIVGIHALDALKLLGAEATHEESRILGAFQHLSV  201

Query  1306  DIYL------HREQSFM-------------------PRNLAA-------WSAWNFLGTVN  1389
              +Y        R+   +                   P  L         W      G   
Sbjct  202   IVYQGAIPISTRKHVHLCIGEDSGSGGSGKFKVVLPPLALVVDGCGGDDWIGETREGREG  261

Query  1390  NRVCLTYWLNTLQNLG-----DTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrass  1554
             +   LT   +  +N+G     ++   +LVTLNP   P+  LLKW T H VP+VAAS+AS 
Sbjct  262   SFPALTLVDDVDRNMGKPLNIESTNHFLVTLNPSYVPDHVLLKWNTNHFVPTVAASKASL  321

Query  1555  ELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGA  1734
             EL++IQGKR         G GFHEDG +AG  AA  LL  +  PL NP  MV SW ETGA
Sbjct  322   ELDQIQGKR---------GSGFHEDGFQAGKAAAQSLLGNKIDPLTNPKQMVLSWTETGA  372

Query  1735  RLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLG  1914
             RLLV RFL  +I  G++IL EEGGT+F+F    +K   K +++V  P FYW+VAT+ADLG
Sbjct  373   RLLVLRFLKQYISVGNLILFEEGGTMFSFGEACEKCNKKSVLQVQDPLFYWQVATEADLG  432

Query  1915  LADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKY  2094
             LADAYI+G  SFV+K+EGLLNLF I +A+RD   S  R++S+RGWWTPLLFT+ +ASAKY
Sbjct  433   LADAYINGCFSFVNKREGLLNLFLILIASRDAHRSSCRNSSRRGWWTPLLFTAGVASAKY  492

Query  2095  FIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKIS  2274
             F+RHISR+N++TQ R+N+S+HYDLSN+ FSLFLD++MTYS A+FK E+E L+ AQ+RKI+
Sbjct  493   FLRHISRKNSVTQTRQNVSQHYDLSNDFFSLFLDKSMTYSSAIFKDEEESLEEAQLRKIN  552

Query  2275  LLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQD  2454
             LLI KAK+ ++  +LEIG GWGSLA+E V++TGCKYTG+T S +QLKYA+ +V+EAGL+D
Sbjct  553   LLIHKAKVGQDDEVLEIGSGWGSLAMEVVKQTGCKYTGVTQSVEQLKYAQRRVKEAGLED  612

Query  2455  NIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIP  2634
              I FLLCDYR++P + +YDRII CEM+E VGHE+M+EFFG CES+LAENGI V QFISIP
Sbjct  613   RITFLLCDYREIPCH-KYDRIICCEMIEEVGHEYMDEFFGCCESLLAENGIFVTQFISIP  671

Query  2635  DERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWR  2814
             +ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR
Sbjct  672   EERYDEYRRSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYYTTLIRWR  731

Query  2815  ANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ-------IVFSRPGNV  2970
              NF+  + +IL LGFD+KFIRTWEYYF YCAAGF + TLGDYQ       IVFSRPGN 
Sbjct  732   DNFMANKDKILALGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQASTVLLYIVFSRPGNT  790



>ref|XP_004169418.1| PREDICTED: cyclopropane-fatty-acyl-phospholipid synthase-like, 
partial [Cucumis sativus]
Length=577

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/571 (67%), Positives = 469/571 (82%), Gaps = 2/571 (0%)
 Frame = +1

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFL-GTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             SD++LH ++ FMP+NL AWSA NFL    NN +CLTYW+N +QN    K P+ VT+NP +
Sbjct  3     SDMFLHHDKDFMPQNLNAWSARNFLENNTNNELCLTYWINVIQNNLGEKSPFFVTINPEQ  62

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
              P+  L   + GHP+PS++A +AS+EL+ IQGKR+IWFCG+Y G G HEDGLKAG + A 
Sbjct  63    KPKDILFNSSIGHPIPSLSAFKASNELDSIQGKRQIWFCGSYLGSGSHEDGLKAGTMVAQ  122

Query  1660  GLLKKRCSPL-NNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1836
              LL K  + L NNPNHMVPS  ETGAR LVT+F A +I  GS+ ++EEGG +FTF+GTD 
Sbjct  123   KLLGKSFTLLSNNPNHMVPSLIETGARYLVTKFFARYISIGSLTIMEEGGRLFTFKGTDN  182

Query  1837  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2016
             K L  V+++VH+P FYWK+ T+AD+GLA+AYI+ D SFVDK EGLLNL +I +ANRD ++
Sbjct  183   KFLPNVVLKVHNPNFYWKIMTRADIGLANAYINADFSFVDKNEGLLNLVQILIANRDANS  242

Query  2017  SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLD  2196
              V++ N KRGWWTP L+T++IA AKYF +H  RQNT+TQAR NISRHYDLSNELFSLFLD
Sbjct  243   LVAKLNKKRGWWTPPLYTASIAYAKYFFQHTLRQNTITQARTNISRHYDLSNELFSLFLD  302

Query  2197  ETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGC  2376
             +TMTYSCA+FK EDEDL+ AQ+RKIS LI KA+I K HH+LEIGCGWGSLAIE V++TGC
Sbjct  303   DTMTYSCAIFKREDEDLRVAQLRKISHLIKKARIDKNHHVLEIGCGWGSLAIELVKQTGC  362

Query  2377  KYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEF  2556
               T ITLSE+Q KYAEDKV+  GLQDNI+F LCDYRQLP+  +YDRIISC +LE+VGHEF
Sbjct  363   HCTAITLSEEQFKYAEDKVKVLGLQDNIKFHLCDYRQLPNTHKYDRIISCGLLESVGHEF  422

Query  2557  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2736
             M +FFG CESVL ENG+LV+QFIS+PD+RYDE+R SSDF++EYIFPGGCLPSL+RVT+AM
Sbjct  423   MEDFFGLCESVLVENGLLVVQFISMPDDRYDEHRLSSDFMREYIFPGGCLPSLNRVTTAM  482

Query  2737  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2916
             A +SR CVEHLE+IGIHYYQTL+CWR NF+  + +I++LGFD+ FIRTWEYYFDYCAAGF
Sbjct  483   AKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKRKIIELGFDESFIRTWEYYFDYCAAGF  542

Query  2917  HTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
              + T+GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  543   KSRTIGDYQIVFSRAGNVTTFNNPYQGIPSA  573



>ref|XP_006350427.1| PREDICTED: uncharacterized protein LOC102587606 [Solanum tuberosum]
Length=513

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/507 (74%), Positives = 434/507 (86%), Gaps = 0/507 (0%)
 Frame = +1

Query  1423  LQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGA  1602
             LQNLGD++ PYLVT +PP TPE  L+KW T H VPSVAAS+AS EL +IQGKR IWFCGA
Sbjct  6     LQNLGDSELPYLVTFDPPHTPEHTLVKWRTSHSVPSVAASKASRELHQIQGKRGIWFCGA  65

Query  1603  YQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGS  1782
             YQGYGFH +GLKAG++AA  +L++ CS  +NP HMVP+WPETGARL+V RF  SFI TG 
Sbjct  66    YQGYGFHANGLKAGVVAADSMLRRSCSIRDNPKHMVPTWPETGARLVVARFFKSFIQTGC  125

Query  1783  IILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKK  1962
             IILLEEGGT+FTF+GT++K  LKV +RVHS QFYWKV+TQAD+GLADA+I GD SFVDK 
Sbjct  126   IILLEEGGTIFTFQGTERKCSLKVSLRVHSTQFYWKVSTQADIGLADAFIQGDFSFVDKN  185

Query  1963  EGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARR  2142
             EGLLNL  IF+ANRDL ASV  S  +R WWTPLL T+A++SAKYFIRH+S +NTLTQARR
Sbjct  186   EGLLNLIMIFIANRDLKASVRTSRKERAWWTPLLLTAALSSAKYFIRHVSNRNTLTQARR  245

Query  2143  NISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILE  2322
             NIS HYDLSNELFSLFLDETMTYSCA+FKSEDEDLK AQ+RKI LLI KAKISKEHHILE
Sbjct  246   NISCHYDLSNELFSLFLDETMTYSCAIFKSEDEDLKDAQLRKIFLLIRKAKISKEHHILE  305

Query  2323  IGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNC  2502
             IG GWGS A+E V++TGCKYTGITLSEQQL+YA+ KV +AGLQD I  LLCDYRQ+P+  
Sbjct  306   IGFGWGSFAVEVVKQTGCKYTGITLSEQQLEYAQLKVEQAGLQDQITLLLCDYRQIPNKD  365

Query  2503  RYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  2682
             +YDRIISCEMLE +GH+F+ +FF  CES LAE+G+LVLQFISIPDERYD +R S+DF++E
Sbjct  366   KYDRIISCEMLEHIGHDFIGKFFTCCESSLAEDGLLVLQFISIPDERYDSHRHSTDFMRE  425

Query  2683  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  2862
             YIFPGG L + S+VTS MAA+SRLCVEHLE+IGIHYYQTL+CWR NF + QSQI  LGFD
Sbjct  426   YIFPGGGLNAPSQVTSVMAAASRLCVEHLENIGIHYYQTLKCWRRNFFKNQSQIRALGFD  485

Query  2863  KKFIRTWEYYFDYCAAGFHTCTLGDYQ  2943
              KFIRTWEYYFDYCAAG  TCT+GDYQ
Sbjct  486   DKFIRTWEYYFDYCAAGLKTCTIGDYQ  512



>gb|ABG37642.1| cyclopropane fatty acid synthase [Populus trichocarpa]
Length=1664

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/568 (70%), Positives = 467/568 (82%), Gaps = 24/568 (4%)
 Frame = +1

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
             S+I+LHR++++MP+N AAWSAWNFLG+  N+VCLTYWLN LQN+ +T  P+LVTLNP   
Sbjct  234   SEIFLHRDKTYMPQNSAAWSAWNFLGSTENKVCLTYWLNVLQNIDETGLPFLVTLNPDNA  293

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
             P+  LLKW+TG PVPSVAA++AS EL+ IQGKRRIWF GAYQGYGF+EDGLK+GM+AAHG
Sbjct  294   PDHTLLKWSTGRPVPSVAATKASLELDHIQGKRRIWFGGAYQGYGFYEDGLKSGMVAAHG  353

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL K C  L NP HMVPS  ETGARL VTRFL   I TG + LLE+GGTVF+FEGT KK 
Sbjct  354   LLGKSCDILRNPKHMVPSMLETGARLFVTRFLGHHISTGCLTLLEDGGTVFSFEGTSKKC  413

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFVDK EGL+NLF I + NRD   S 
Sbjct  414   SLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLINLFMILIVNRDADNST  473

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
             S+ N KRGWWTPLLFT+ IASAK+FI+H+SRQNTLTQARRNISRHYDL            
Sbjct  474   SKLNKKRGWWTPLLFTAGIASAKFFIQHVSRQNTLTQARRNISRHYDL------------  521

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
                       EDEDLK AQ+RKISLLI+KA+++K+H +LEIGCGWG+LAIE V+RTGCKY
Sbjct  522   ---------KEDEDLKAAQIRKISLLIEKARVNKDHEVLEIGCGWGTLAIEVVQRTGCKY  572

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TGITLSE+QLKYAE KV+EAGLQD+I+F LCDYRQLP   +YD IISCEM+EAVGHE+M 
Sbjct  573   TGITLSEEQLKYAELKVKEAGLQDSIKFHLCDYRQLPKTHKYDTIISCEMIEAVGHEYME  632

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFFG CESVLAENG+ VLQFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAMA+
Sbjct  633   EFFGCCESVLAENGLFVLQFISIPEERYDEYRKSSDFIKEYIFPGGCLPSLTRITSAMAS  692

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL LGF++KFIRTWEYYFDYCAAGF T
Sbjct  693   SSRLCVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAAGFKT  752

Query  2923  CTLGDYQIVF-SRPGNVTAFGDPYKGLA  3003
              TLG+YQ++   RPG  T   DP   +A
Sbjct  753   HTLGNYQLLNPDRPGGSTR--DPVDPVA  778


 Score =   492 bits (1267),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 264/494 (53%), Positives = 319/494 (65%), Gaps = 83/494 (17%)
 Frame = +1

Query  1633  LKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTV  1812
             L A M AA+    + C+ L +   M PS  E  ARL VT+FL   I T  +IL EEGG  
Sbjct  872   LVASMAAANCSSGETCAALIHGKQMAPSRLEAWARLFVTKFLGRHISTHRLILEEEGGAT  931

Query  1813  FTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLF---  1983
             FTFEGT KK  L+V+++VH+PQFYWKV T+AD+GLADAYI GD SF DK +GLL+L    
Sbjct  932   FTFEGTSKKCSLEVVLKVHNPQFYWKVTTRADIGLADAYIDGDFSFADKDQGLLHLIMRC  991

Query  1984  -KIFVANR-----DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRN  2145
              +I++        D ++  S            L        +Y  +H+ RQNTLTQARRN
Sbjct  992   KQIYLPGEEEKVCDFASFYSFDPIGPSNIHLWLSIGVGGHHRYLQQHVLRQNTLTQARRN  1051

Query  2146  ISRHYDL-----------------------------------------------SNELFS  2184
             ISRHYDL                                               SNE+FS
Sbjct  1052  ISRHYDLVWDHSLLILLFNNVHAVGQIDCVEIVWKCMYIASAMFRILMLVKDLSSNEVFS  1111

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2364
             LFL ETM YS A+FK+EDEDL TAQ+RKIS+LI+KA+I K+H IL+IGCGWG+ AIE V+
Sbjct  1112  LFLGETMAYSSAIFKTEDEDLNTAQLRKISVLIEKARIDKKHEILDIGCGWGTFAIEVVK  1171

Query  2365  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2544
             +TGCKYTG+TLS +QLKYAE KV+EAGLQDNIR LLCDYR+LP   +YDRI+SCEM+E V
Sbjct  1172  QTGCKYTGLTLSVEQLKYAEMKVKEAGLQDNIRLLLCDYRELPKGYKYDRIVSCEMIEHV  1231

Query  2545  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2724
             GHE+M +FF  CES LAE+G+LVLQFISI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+
Sbjct  1232  GHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYRRSSDFIKEYIFPGGCLPSLSRI  1291

Query  2725  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2904
             TSAM  +SRLC                           +IL +GFD+KFIRTWEYYFDY 
Sbjct  1292  TSAMGVASRLC---------------------------KILAMGFDEKFIRTWEYYFDYS  1324

Query  2905  AAGFHTCTLGDYQI  2946
             +AGF + TLGDYQ+
Sbjct  1325  SAGFKSYTLGDYQL  1338


 Score =   345 bits (884),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 186/225 (83%), Gaps = 23/225 (10%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV-  579
             MRVAVVGAGISGLVSAYVLAK GA VV+YEKED LGGHAKTV  DGVDLDLGFMVFNRV 
Sbjct  1     MRVAVVGAGISGLVSAYVLAKAGAEVVLYEKEDSLGGHAKTVCFDGVDLDLGFMVFNRVV  60

Query  580   ----------------------TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  693
                                   TYPNMME FE+LG+DME+SDMSFSVSLD G G EWGSR
Sbjct  61    GFVTNLRVGLIDLEGYWDHEQVTYPNMMEFFENLGIDMELSDMSFSVSLDQGKGCEWGSR  120

Query  694   NGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGY  873
             NGFSGLFAQKKN LNPYFW+M+REI+KFK+DVLSYLE  +NNP +DRN+TLG+F+KSRGY
Sbjct  121   NGFSGLFAQKKNALNPYFWKMLREIVKFKDDVLSYLEVLENNPVVDRNETLGQFVKSRGY  180

Query  874   SELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQLF  1008
             SELFQKAY++P+C SIWSC SEGVM FSA+S+LSFCRNHHLLQ+F
Sbjct  181   SELFQKAYLVPVCGSIWSCPSEGVMNFSAFSVLSFCRNHHLLQIF  225


 Score =   297 bits (761),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 176/239 (74%), Gaps = 28/239 (12%)
 Frame = +1

Query  2230  SEDEDLKTAQMRKISLLI-DKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQ  2406
             +E+  L   + R ++  I   A+I K+H ILEIGCGWG+ AIE V++TGCKYTG+TLS +
Sbjct  1413  AEEGKLGDERYRLVAFTIFGLARIDKKHEILEIGCGWGTFAIEVVKQTGCKYTGLTLSVE  1472

Query  2407  QLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCES  2586
             QLKYAE KV+EAGLQDNIR LLCDYR+LP+  +YDRI+SCEM+E VGHE+M +FF  CES
Sbjct  1473  QLKYAEMKVKEAGLQDNIRLLLCDYRELPEGYKYDRIVSCEMIEHVGHEYMEDFFSSCES  1532

Query  2587  VLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  2766
              LAE+G+LVLQ  SI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLC   
Sbjct  1533  ALAEDGLLVLQSTSIADERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMGVASRLC---  1589

Query  2767  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  2943
                                     +IL +GFD+KFIRTWEYYFDY AAGF +  LG+YQ
Sbjct  1590  ------------------------KILAMGFDEKFIRTWEYYFDYSAAGFKSYALGNYQ  1624



>ref|XP_006489668.1| PREDICTED: uncharacterized protein LOC102613225 isoform X3 [Citrus 
sinensis]
Length=524

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/526 (67%), Positives = 429/526 (82%), Gaps = 5/526 (1%)
 Frame = +1

Query  946   MAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSV  1125
             M+FSA+S+LSFCRNHHLL+LFG PQWLT + RSHSYVNKV  +L+  GC+IR  CEV+SV
Sbjct  1     MSFSAFSVLSFCRNHHLLELFGHPQWLTFRNRSHSYVNKVTGQLQSWGCQIRTSCEVYSV  60

Query  1126  STDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYS  1305
                ++G    VV   G    QE Y  C+MA HAPD L++LG QAT DE RILGAF+YVYS
Sbjct  61    YPADEGCT--VVSSDGS---QENYSCCVMAVHAPDALRILGNQATLDETRILGAFRYVYS  115

Query  1306  DIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTP  1485
             DI+LHR+++FMP+N AAWSAWNFLG+ + ++CLTYWLN LQN G+T  P+L TLNP  TP
Sbjct  116   DIFLHRDKNFMPQNTAAWSAWNFLGSTDGKICLTYWLNVLQNNGETGVPFLATLNPDHTP  175

Query  1486  EQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGL  1665
             E  LLKW+T +  PSVAAS+AS  ++ IQGKR IWFCGAYQGYGF EDGLKAGMI AHG+
Sbjct  176   ENTLLKWSTSNQAPSVAASKASLAVDLIQGKRGIWFCGAYQGYGFQEDGLKAGMITAHGV  235

Query  1666  LKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNL  1845
             L K C+ L+ P HMVPS  E GARL V  F   +I TG +ILLEEGGT+FTFEG  + + 
Sbjct  236   LGKNCAVLSKPKHMVPSLLEKGARLFVAGFFRRYISTGCLILLEEGGTIFTFEGALRNSP  295

Query  1846  LKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVS  2025
             LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK EGLLNLF I +AN+DL++S S
Sbjct  296   LKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKDEGLLNLFLILIANQDLNSSAS  355

Query  2026  RSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETM  2205
             +   KRGWW+P+ FT++IASAK F RHISR+NTLTQARRN+SRHYDLSNELFSLFLD++M
Sbjct  356   KLKQKRGWWSPMFFTASIASAKCFFRHISRKNTLTQARRNVSRHYDLSNELFSLFLDKSM  415

Query  2206  TYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYT  2385
             TYSCA+FKSE EDL+  QMRKIS+LI+KA++SK   +L+IGCGWG+LAIE V++TGCKYT
Sbjct  416   TYSCAIFKSEHEDLEVGQMRKISVLIEKARVSKGQEVLDIGCGWGTLAIEIVKQTGCKYT  475

Query  2386  GITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIIS  2523
             GITLS++QLKYA+ KVREAGLQD+IRF LCDYRQLP   +YDRIIS
Sbjct  476   GITLSKEQLKYAQIKVREAGLQDHIRFYLCDYRQLPKANKYDRIIS  521



>gb|EMS47376.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=676

 Score =   734 bits (1895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/785 (49%), Positives = 497/785 (63%), Gaps = 119/785 (15%)
 Frame = +1

Query  625   MEISDMSFSVS--LDNG-HGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLS  795
             ME SDMSFSVS  L  G  G EWG+ NG SGL AQK N+L P FW+M+REI+KFKND L+
Sbjct  1     MERSDMSFSVSTQLKGGSRGCEWGNGNGISGLLAQKTNILKPSFWRMVREIIKFKNDALT  60

Query  796   YLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAY-IIPMCASIWSCSSEGVMAFSAYSIL  972
             YLE+ ++NPD+D N+TLG+FI+S GYS  FQ+AY +IP+C  +WSCS + V++ SA+ +L
Sbjct  61    YLEDHEHNPDLDHNETLGQFIQSHGYSPSFQEAYLVIPVCTGMWSCSPQDVLSLSAFFVL  120

Query  973   SFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAG  1152
             SFCRN+ LLQLF   Q  TVK RS SYVNKV+ ELE  GC I+  C V SVS+ + G+  
Sbjct  121   SFCRNNDLLQLFRHTQLPTVKPRSQSYVNKVKGELESMGCLIKTSCRVKSVSSLD-GAGY  179

Query  1153  GVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQS  1332
              V+   G    +E +D  I+  HAP+ LK+LG +AT  ELRILGA QYV  DIYLH +Q+
Sbjct  180   RVLENDGS---EETFDSVILGVHAPNALKVLGAEATHQELRILGACQYVQRDIYLHCDQN  236

Query  1333  FMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTT  1512
              MP+N +AWSAWNFLGT +    +TYWLN +Q +G  + P+LVTLNPP  P+        
Sbjct  237   LMPQNPSAWSAWNFLGTTSRGFSVTYWLNQIQKIGSVR-PFLVTLNPPGVPDH-------  288

Query  1513  GHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLN  1692
                                                       AG  AA GLL K+C  L 
Sbjct  289   ------------------------------------------AGKAAAQGLLGKKCELLL  306

Query  1693  NPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHS  1872
              P  ++PSW   GARL  TRF   ++  G++I +E GG+VF+F     K  +K +VRVH 
Sbjct  307   YPKQIIPSWTVAGARLAFTRFFMQYVSIGNLIFVEAGGSVFSFGKACNKCPVKSVVRVHD  366

Query  1873  PQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWW  2052
             P FYWK  T+ ++GL +AYI+G  S +DK+EGLLNL                        
Sbjct  367   PLFYWKATTEGEIGLGEAYINGYFSCLDKREGLLNL------------------------  402

Query  2053  TPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKS  2232
                     I S  +F   + +  T + A       + + NE                   
Sbjct  403   --------ILSNDFFSLFLDKSMTYSCAV------FKMENE-------------------  429

Query  2233  EDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQL  2412
                 L+ AQ RK+SLLIDKAK+ +EHH+L+IG GWGSLAI+ V++TGCKYTG+TLSE+QL
Sbjct  430   ---SLEAAQQRKLSLLIDKAKVEREHHVLDIGSGWGSLAIQMVKQTGCKYTGVTLSEEQL  486

Query  2413  KYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVL  2592
             KYAE KVREAGL+D+I FLLCDYR +P   +YD IISC M+E VGHE+M+EFF  CES L
Sbjct  487   KYAESKVREAGLEDHITFLLCDYRLIPPY-KYDAIISCGMIEHVGHEYMDEFFACCESYL  545

Query  2593  AENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE  2772
             AE+GILVLQFISI +ERY++YR+   F+KEYIFPGGC+PSL+RV SAM  SSR  +EH+E
Sbjct  546   AEDGILVLQFISIAEERYEQYRRRPHFVKEYIFPGGCIPSLARVMSAMTTSSRFSIEHVE  605

Query  2773  DIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVF  2952
             +IG +YY TL  WR NF+  + Q+L+LGFD+KFI  WE+Y  Y AAGF +  +GDYQ+VF
Sbjct  606   NIGPNYYTTLMHWRDNFMANKDQVLELGFDEKFILIWEFYLIYSAAGFKSRAVGDYQVVF  665

Query  2953  SRPGN  2967
             SRPGN
Sbjct  666   SRPGN  670



>ref|XP_010670963.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase isoform 
X4 [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/452 (75%), Positives = 392/452 (87%), Gaps = 1/452 (0%)
 Frame = +1

Query  1645  MIAAHGLLKKRCSP-LNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1821
             MIAA GLL K  +  L NP  MV S  E  A + VTRFL++FI  G + LLEEGGT+ TF
Sbjct  1     MIAARGLLGKSFNNILTNPKQMVASLTEAAACIFVTRFLSNFISAGCLTLLEEGGTILTF  60

Query  1822  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2001
             EG+ K   LKV +R+HSPQFYWKVA +ADLGLADAYI+GD SFVDK EGLLNLF IF+A+
Sbjct  61    EGSSKICPLKVALRIHSPQFYWKVAKEADLGLADAYINGDFSFVDKNEGLLNLFMIFIAS  120

Query  2002  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2181
             RDL+++ +  N KRGWWTP+LFT+ IASAKYF  H+SRQNTLTQARRNISRHYDLSN++F
Sbjct  121   RDLNSTATLVNKKRGWWTPMLFTAGIASAKYFYHHVSRQNTLTQARRNISRHYDLSNDMF  180

Query  2182  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2361
             SLFLDETMTYSCAVF+SE+EDLK AQMRKISLL++KA++ K H +LEIGCGWGSLAIE V
Sbjct  181   SLFLDETMTYSCAVFESENEDLKVAQMRKISLLLEKARVEKHHEVLEIGCGWGSLAIEVV  240

Query  2362  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2541
             +RTGC+YTGITLSE+QL+YAE++V+EAGLQD IRFLLCDYRQLPD  +Y+RIISCEMLEA
Sbjct  241   KRTGCRYTGITLSEEQLRYAEERVKEAGLQDRIRFLLCDYRQLPDVHKYNRIISCEMLEA  300

Query  2542  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2721
             VGHE+M EFF  CES+LA NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLP LSR
Sbjct  301   VGHEYMEEFFQCCESLLAANGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPCLSR  360

Query  2722  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2901
             VTSAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS+I  LGFD+KFIRTWEYYFDY
Sbjct  361   VTSAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQSKIHSLGFDEKFIRTWEYYFDY  420

Query  2902  CAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  2997
             CAAGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  421   CAAGFKTRTLGNYQIVFSRPGNLASFGGAYAG  452



>ref|XP_002528809.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF33543.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=563

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/514 (67%), Positives = 416/514 (81%), Gaps = 23/514 (4%)
 Frame = +1

Query  1078  EKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQA  1257
             +K+GC + CG           GS             +E Y  CI+A HAPD LK+LG Q 
Sbjct  5     QKKGCTVLCG----------DGS-------------EEQYSRCIIAVHAPDALKLLGNQT  41

Query  1258  TFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLG  1437
             TFDE+R+LGAFQYVYS+I+LHR++ FMP+   AWSAWNFLG  +N+ CLTYWLN LQNLG
Sbjct  42    TFDEIRVLGAFQYVYSEIFLHRDKKFMPQVPTAWSAWNFLGNTDNKGCLTYWLNVLQNLG  101

Query  1438  DTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYG  1617
             +T  P+L+TLNP  TP+  LLKWT GHPVP +AAS+AS E E IQG+R +WFCGAYQGYG
Sbjct  102   ETNLPFLITLNPDHTPDHTLLKWTAGHPVPCLAASKASLEFEHIQGRRGLWFCGAYQGYG  161

Query  1618  FHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLE  1797
             FHEDGLK GM+AAH LL+K C+ L+NPN +VPS  ETGARL VTRFL  +I TG +ILLE
Sbjct  162   FHEDGLKFGMVAAHSLLEKMCAILSNPNQIVPSLIETGARLFVTRFLGKYISTGCLILLE  221

Query  1798  EGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLN  1977
             EGGT+FTF+GT KK   K +++VH+PQFYWK+ TQADLGLADAYI+GDISF DK EGLLN
Sbjct  222   EGGTIFTFQGTVKKYFPKSILKVHNPQFYWKIMTQADLGLADAYINGDISFPDKDEGLLN  281

Query  1978  LFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRH  2157
             L  + +ANRD + SV   N K+GWWTP+  T++IASAK+F RH+SR+N+LT ARRNISRH
Sbjct  282   LVMVLIANRDANISVPERNKKKGWWTPMFLTASIASAKFFFRHVSRKNSLTLARRNISRH  341

Query  2158  YDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGW  2337
             YDLSNE+FS+FLDETM+YSCAVFK+EDEDLK+AQMRKISLLI+KA+I+KE   LEIGCGW
Sbjct  342   YDLSNEMFSMFLDETMSYSCAVFKTEDEDLKSAQMRKISLLIEKARINKEREFLEIGCGW  401

Query  2338  GSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRI  2517
             G+LAIE V+RTGCKYTGITLS++QLK+AE++V EAGLQ+NIRF LCD+RQLPD  + D I
Sbjct  402   GTLAIEVVKRTGCKYTGITLSKEQLKFAEERVNEAGLQENIRFQLCDHRQLPDTYKCDGI  461

Query  2518  ISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQ  2619
             ISCEMLEAVGHE+M E+FG CESVLA++GI+VLQ
Sbjct  462   ISCEMLEAVGHEYMEEYFGCCESVLAKDGIIVLQ  495



>ref|XP_004172280.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101213850, 
partial [Cucumis sativus]
Length=483

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/488 (69%), Positives = 405/488 (83%), Gaps = 5/488 (1%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNMME FE+LGV+ME SDMSFSVSLDNG G EWGSRNG S LFAQKKNLLNPYFWQM
Sbjct  1     VTYPNMMEFFENLGVEMETSDMSFSVSLDNGRGCEWGSRNGLSSLFAQKKNLLNPYFWQM  60

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IREI+KFK+DV++YLE  +NN D+DRN+TLG+FI S GYSELFQ AY++PMC SIWSCSS
Sbjct  61    IREIVKFKDDVINYLEVLENNSDVDRNETLGQFINSNGYSELFQNAYLVPMCGSIWSCSS  120

Query  937   EGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEV  1116
             E V++FSA+S+LSFCRNHHLLQL GRPQWLTVK RSHSYV KV+E LE +GC+IR  CEV
Sbjct  121   EKVLSFSAFSVLSFCRNHHLLQLVGRPQWLTVKGRSHSYVKKVQEVLESQGCQIRTSCEV  180

Query  1117  HSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQY  1296
             +S+ST ++G       +S  + +QE +D CI+A HAPDTL++LG +AT DELR+LGAFQY
Sbjct  181   NSISTLDKGCK-----VSYGDGLQEMFDACIIATHAPDTLRILGNEATSDELRVLGAFQY  235

Query  1297  VYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPP  1476
              YSDI+LHR++S MP+N AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVT NP 
Sbjct  236   AYSDIFLHRDKSLMPQNPAAWSAWNFLGNTDKKVCLTYWLNVLQNLGETGPPFLVTXNPD  295

Query  1477  RTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAA  1656
             + P   LLKW+TGHP+PSVAAS+AS+EL  IQGKRRIWFCGAYQGYGFHEDGLK G+IAA
Sbjct  296   KEPTNILLKWSTGHPIPSVAASKASNELHSIQGKRRIWFCGAYQGYGFHEDGLKGGIIAA  355

Query  1657  HGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1836
               +L  R + L+NP HMVPS  +TGARL VTRFL  FI +GS+ L+EEGGT+FTFEGTDK
Sbjct  356   QNMLGNRFTLLSNPKHMVPSLADTGARLFVTRFLRQFITSGSLTLMEEGGTIFTFEGTDK  415

Query  1837  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2016
             K LLKV ++VH+PQFYWK+ T+AD+GLADAYI+GD SFVDK EGLLN F I VA R+ + 
Sbjct  416   KCLLKVALKVHNPQFYWKITTRADIGLADAYINGDFSFVDKDEGLLNFFMIIVACRETNF  475

Query  2017  SVSRSNSK  2040
             S+++   K
Sbjct  476   SIAKLKKK  483



>ref|XP_006354535.1| PREDICTED: pavine N-methyltransferase-like [Solanum tuberosum]
Length=439

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/437 (76%), Positives = 378/437 (86%), Gaps = 1/437 (0%)
 Frame = +1

Query  1705  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1884
             ++P+W ETGARLLVTRF  SFI TG IILLEEGGT FTF+GT++K  LKV +RVHS QFY
Sbjct  3     LLPTWTETGARLLVTRFFKSFIQTGCIILLEEGGTTFTFQGTERKCSLKVSLRVHSMQFY  62

Query  1885  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2064
             WKVAT+AD+GLADA+IHGD SFVDK EGLLNL  IF+ANRDL ASV  S+ KRGWWTP++
Sbjct  63    WKVATRADVGLADAFIHGDFSFVDKNEGLLNLVMIFIANRDLKASVGTSSKKRGWWTPVI  122

Query  2065  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2244
             FT+A++SA YFIRH+S +NTLTQARRNISRHYDLSNELFSLF+DETM YSCA+FKS+DED
Sbjct  123   FTAALSSATYFIRHVSNRNTLTQARRNISRHYDLSNELFSLFMDETMLYSCAIFKSKDED  182

Query  2245  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2424
             LK AQ+RK+S+LI+KAKISKEHHILEIG GWG  A+E V++TGCKYTGITLSEQQL+YA+
Sbjct  183   LKVAQLRKMSILIEKAKISKEHHILEIGFGWGGFAVEVVKQTGCKYTGITLSEQQLEYAQ  242

Query  2425  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2604
              +V +AGLQD I  LLCDYRQ+P+  +YDRII CE+LE VGHEF+ EFF  CES L E+G
Sbjct  243   LRVEQAGLQDQITLLLCDYRQMPNQDKYDRIIVCEVLEHVGHEFIGEFFSCCESALTEDG  302

Query  2605  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGI  2784
             +LVLQFIS+PD  YDEYR S+ FI EYIFPGGCLP+LSRVTSAMAA+SRLCV HLEDIG+
Sbjct  303   LLVLQFISMPDPMYDEYRHSAGFINEYIFPGGCLPALSRVTSAMAAASRLCVVHLEDIGV  362

Query  2785  HYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2964
             HYYQTLRCWR NFL+ +SQI  LGFD KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPG
Sbjct  363   HYYQTLRCWRKNFLKNKSQIHALGFDDKFIRTWEYYFDYCAAGFKTHTLGDYQIVFSRPG  422

Query  2965  NVTAFGDPYK-GLASAY  3012
             NV  FGDPY   + SAY
Sbjct  423   NVATFGDPYNVTMPSAY  439



>gb|KCW60259.1| hypothetical protein EUGRSUZ_H029682, partial [Eucalyptus grandis]
Length=458

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/451 (73%), Positives = 384/451 (85%), Gaps = 0/451 (0%)
 Frame = +1

Query  1639  AGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFT  1818
              GM AAHG++ +    L+NP HMVPS  E GAR  VT FL  +I TG I LLEEGGT+FT
Sbjct  1     GGMAAAHGVIGQSHFLLDNPQHMVPSLKEIGARFFVTGFLRRYISTGLITLLEEGGTMFT  60

Query  1819  FEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVA  1998
             FEGT K+  L V +R+HSP+FYWKV TQADLGLADAYI+GD S VDK +GLLNLF+I +A
Sbjct  61    FEGTTKRCPLTVTLRIHSPEFYWKVMTQADLGLADAYINGDFSCVDKNKGLLNLFQILIA  120

Query  1999  NRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNEL  2178
             NRD   ++S+ + +RGWWTP+L T+ IASAKYF +HI RQNTLTQARRNIS+HYDLSNEL
Sbjct  121   NRDSDITMSKLSKRRGWWTPMLSTAGIASAKYFFKHILRQNTLTQARRNISQHYDLSNEL  180

Query  2179  FSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEA  2358
             FSLFLDETMTYSCAVF+   EDLK AQMRKISLLI KA+I K H +LEIGCGWGSLAIE 
Sbjct  181   FSLFLDETMTYSCAVFEMAGEDLKAAQMRKISLLIKKARIEKTHEVLEIGCGWGSLAIEV  240

Query  2359  VERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLE  2538
             V +TGCKYTGITLS++QLKYA+ +V+EAGLQD+I+F+LCDYRQLP   +YDRIISCEM+E
Sbjct  241   VRQTGCKYTGITLSKEQLKYAKSRVKEAGLQDSIKFILCDYRQLPSAYKYDRIISCEMIE  300

Query  2539  AVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLS  2718
             AVGHE+M EFF  CESVLA++G+LVLQF SIPDERY+EYRQSSDFIKEYIFPG C+PSLS
Sbjct  301   AVGHEYMEEFFSCCESVLAKDGLLVLQFTSIPDERYEEYRQSSDFIKEYIFPGCCVPSLS  360

Query  2719  RVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFD  2898
             R+TSAMA++SRL VEH+++IGIH+YQTLRCWR NF+E+Q +IL LGF++KFIRTWEYYFD
Sbjct  361   RITSAMASASRLSVEHVDNIGIHFYQTLRCWRKNFMEKQRKILALGFNEKFIRTWEYYFD  420

Query  2899  YCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  2991
             YCAAGF + TLG+YQIVFSRPGN  AF D Y
Sbjct  421   YCAAGFKSHTLGNYQIVFSRPGNEAAFTDLY  451



>ref|XP_006489663.1| PREDICTED: uncharacterized protein LOC102612222 isoform X2 [Citrus 
sinensis]
Length=779

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/497 (67%), Positives = 402/497 (81%), Gaps = 5/497 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KM+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  
Sbjct  4     KMQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHA  63

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             T PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKNLLNPYFWQM+
Sbjct  64    TSPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNLLNPYFWQML  123

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
              EI +FK+D L Y+EE +NNPD++RN+TLG+F+K RGYSELFQK+Y+IP+C S+WSC SE
Sbjct  124   WEINQFKDDALRYIEELENNPDINRNETLGQFLKLRGYSELFQKSYLIPLCDSVWSCPSE  183

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
               M+FSA+S+LSFCRNHHLL+LFG PQWLT + RSHSYVNKV  +L+  GC+IR  CEV+
Sbjct  184   RAMSFSAFSVLSFCRNHHLLELFGHPQWLTFRNRSHSYVNKVTGQLQSWGCQIRTSCEVY  243

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
             SV   ++G    VV   G    QE Y  C+MA HAPD L++LG QAT DE RILGAF+YV
Sbjct  244   SVYPADEGCT--VVSSDGS---QENYSCCVMAVHAPDALRILGNQATLDETRILGAFRYV  298

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1479
             YSDI+LHR+ +FMP+N AAWSAWNFLG+ + ++CLTYWLN LQN+G+T  P+L TLNP  
Sbjct  299   YSDIFLHRDTNFMPQNTAAWSAWNFLGSTDGKICLTYWLNVLQNIGETGVPFLATLNPDH  358

Query  1480  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1659
             TPE   LKW+T + VPSVAAS+AS  ++ IQGKR IWFCGAYQGYGF EDGLKAGMI AH
Sbjct  359   TPENTSLKWSTSYQVPSVAASKASLAVDLIQGKRGIWFCGAYQGYGFQEDGLKAGMITAH  418

Query  1660  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1839
             G+L K C+ L+NP HMVPS  E GARL V RFL  +I TG +ILLEEGGT+FTFEGT + 
Sbjct  419   GVLGKNCAVLSNPKHMVPSLLEKGARLFVARFLRRYISTGCLILLEEGGTIFTFEGTLRN  478

Query  1840  NLLKVLVRVHSPQFYWK  1890
             + LK ++R+H+PQFYWK
Sbjct  479   SPLKTVLRIHNPQFYWK  495


 Score =   453 bits (1165),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 213/295 (72%), Positives = 250/295 (85%), Gaps = 0/295 (0%)
 Frame = +1

Query  2128  TQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKE  2307
             T  R +  + Y  +NELFSLFLD++MTYSCA+FKSE EDL+  QMRK+S+LI+KA++SK 
Sbjct  483   TVLRIHNPQFYWKNNELFSLFLDKSMTYSCAIFKSEHEDLEVGQMRKVSVLIEKARVSKG  542

Query  2308  HHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQ  2487
               +L+IGCGWG+LAIE V++TGCKYTGITLSE+QLKYAE KVREAGLQD+IRF LCDYRQ
Sbjct  543   QEVLDIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYAEIKVREAGLQDHIRFYLCDYRQ  602

Query  2488  LPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSS  2667
             LP   +YDRIISC M+E VGH++M EFFG CES+LA +G+LVLQFIS PD+ YDEYR S 
Sbjct  603   LPKANKYDRIISCGMIEHVGHDYMEEFFGCCESLLATHGLLVLQFISAPDQCYDEYRLSP  662

Query  2668  DFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQIL  2847
              FIKEYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL
Sbjct  663   GFIKEYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEIL  722

Query  2848  DLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
              LGF++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  723   ALGFNEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  777



>ref|XP_004247760.1| PREDICTED: uncharacterized protein LOC101261068 [Solanum lycopersicum]
Length=436

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/430 (75%), Positives = 366/430 (85%), Gaps = 1/430 (0%)
 Frame = +1

Query  1705  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1884
             + P+W ETGAR LVTRF  +FI TG IILLEEGG+ FTF+GT+ K  LKV + V S QFY
Sbjct  3     LSPTWTETGARHLVTRFFKNFIQTGCIILLEEGGSTFTFQGTEGKCSLKVSLTVRSMQFY  62

Query  1885  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2064
             WKVAT+AD+GLADA+IHGD SFVDK +GLLNL  IF+ANRDL ASV  SN KRGWWTPL 
Sbjct  63    WKVATRADIGLADAFIHGDFSFVDKNKGLLNLIMIFIANRDLKASVKTSNKKRGWWTPLF  122

Query  2065  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2244
             +T+A++SA YFIRH+S +NTLTQARRNISRHYDLSNELFSLF+DETM YSCA+FKSEDED
Sbjct  123   YTAALSSATYFIRHVSNRNTLTQARRNISRHYDLSNELFSLFMDETMLYSCAIFKSEDED  182

Query  2245  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2424
             LK AQ RK+S+LI+KAKISKEHHILEIG GWG  A+E V +TGCKYTGI+LSEQQL+YA+
Sbjct  183   LKVAQRRKMSVLIEKAKISKEHHILEIGFGWGGFAVEVVHQTGCKYTGISLSEQQLEYAQ  242

Query  2425  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2604
              +V +AGLQD I  LLCDYRQ+P+  +YDRII CE+LE VGHEF+ EFF  CES LAE+G
Sbjct  243   LRVEQAGLQDQITLLLCDYRQMPNKDKYDRIIVCEVLEHVGHEFIGEFFSCCESALAEDG  302

Query  2605  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGI  2784
             +LVLQFIS+PD  YDE R SS FIKEYIFPGG LP+LSRVTSAMA++SRLCV HLEDIG+
Sbjct  303   LLVLQFISLPDTMYDENRLSSGFIKEYIFPGGYLPALSRVTSAMASASRLCVVHLEDIGV  362

Query  2785  HYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2964
             HYYQTLRCWR NFL  +SQI  LGFD+KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPG
Sbjct  363   HYYQTLRCWRKNFLNNKSQIRALGFDEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPG  422

Query  2965  NVTAFGD-PY  2991
             NV  FGD PY
Sbjct  423   NVATFGDHPY  432



>ref|XP_011013987.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
 ref|XP_011013989.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
 ref|XP_011013990.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
Length=460

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/462 (69%), Positives = 381/462 (82%), Gaps = 2/462 (0%)
 Frame = +1

Query  1645  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1824
             M AAH    +  + L +   M PS  E  ARL V +FL S I +  +I+ EEGG  FTFE
Sbjct  1     MAAAHCSSGETGAALIHGKQMAPSRLEAWARLFVNKFLGSHISSDRLIVEEEGGATFTFE  60

Query  1825  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2004
             GT KK  L+V+++VH+PQFYWKV T+AD+GLADAYI GD SF DK + LL+LF + +ANR
Sbjct  61    GTSKKCSLEVVLKVHNPQFYWKVTTRADIGLADAYIDGDFSFADKDQCLLDLFMVLIANR  120

Query  2005  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2184
             D + S+S++N KRGWWTP LFT+ IASAK+F++H+ RQNTLTQARRNISRHYDLSNE+FS
Sbjct  121   DANKSISKANKKRGWWTPSLFTAGIASAKFFLQHVLRQNTLTQARRNISRHYDLSNEVFS  180

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2364
             LFL ETM YS A+FK+EDEDL TAQ+RKIS+LI+KA+I K+H IL+IGCGWG+ AIE V+
Sbjct  181   LFLGETMAYSSAIFKTEDEDLNTAQLRKISVLIEKARIDKKHEILDIGCGWGTFAIEVVK  240

Query  2365  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2544
             +TGCKYTG+TLS +QLKYAE KV+EAGLQDNI+ LLCDYR+LP   +YDRI+SCEM+E V
Sbjct  241   QTGCKYTGLTLSVEQLKYAEMKVKEAGLQDNIKLLLCDYRELPKGYKYDRIVSCEMIEHV  300

Query  2545  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2724
             GHE+M +FF  CES LAE+G+LVLQFISI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+
Sbjct  301   GHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYRRSSDFIKEYIFPGGCLPSLSRI  360

Query  2725  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2904
             TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL +GFD+KFIRTWEYYFDYC
Sbjct  361   TSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKILAMGFDEKFIRTWEYYFDYC  420

Query  2905  AAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY*AHSLL  3030
             AAGF + TLGDYQ+VFSRPGNV A G+PYKG  SAY  H LL
Sbjct  421   AAGFKSYTLGDYQVVFSRPGNVVALGNPYKGFPSAY--HHLL  460



>emb|CDY67345.1| BnaCnng54600D [Brassica napus]
Length=454

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/457 (70%), Positives = 375/457 (82%), Gaps = 5/457 (1%)
 Frame = +1

Query  1645  MIAAHGLLKKRCSPL-NNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1821
             M AA  LL K   PL +NP HMVPS  E GAR L TRFL  FI TG + + EEGGT+FTF
Sbjct  1     MGAAQSLLGKDMVPLLSNPKHMVPSLTEKGARFLFTRFLRHFISTGCVTVYEEGGTMFTF  60

Query  1822  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2001
             +G D +  L+ ++++H+P FYWKV TQADLGLADAYI+GD SFV+K+ GLLNL  I +AN
Sbjct  61    KGKDLRCNLESVMKIHNPHFYWKVMTQADLGLADAYINGDFSFVNKETGLLNLIMILIAN  120

Query  2002  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2181
             R+L++       KRGWWTP+  T+ + SA  F++H SRQNTLT+ARRNISRHYDLSNELF
Sbjct  121   RELNSKNLNLAKKRGWWTPMFMTAGLTSATQFLKHFSRQNTLTKARRNISRHYDLSNELF  180

Query  2182  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2361
             SLFLD+TM+YS     S+DEDLKTAQMRKI+LLIDKA+I K H +LEIGCGWG+LAIE V
Sbjct  181   SLFLDDTMSYST----SDDEDLKTAQMRKINLLIDKARIEKNHEVLEIGCGWGTLAIEVV  236

Query  2362  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2541
             ++TGCKYTGITLS +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRIISCEM+E 
Sbjct  237   KKTGCKYTGITLSIEQLKYAEEKVKEAGLQDRITFELCDYRQLSDAKKYDRIISCEMIEH  296

Query  2542  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2721
             VGHEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+R
Sbjct  297   VGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLAR  356

Query  2722  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2901
             V SAMA+SSRL VE++E+IG+HYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDY
Sbjct  357   VISAMASSSRLSVENVENIGLHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDY  416

Query  2902  CAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             CAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  417   CAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  453



>ref|XP_002314497.2| hypothetical protein POPTR_0010s07830g, partial [Populus trichocarpa]
 gb|EEF00668.2| hypothetical protein POPTR_0010s07830g, partial [Populus trichocarpa]
Length=464

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/460 (68%), Positives = 380/460 (83%), Gaps = 0/460 (0%)
 Frame = +1

Query  1633  LKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTV  1812
             L A M AA+    + C+ L +   M PS  +  ARL VT+FL S I T  +IL E+GG  
Sbjct  1     LVASMAAANCSSGETCAALIHGKQMAPSRLQAWARLFVTKFLGSHISTDHLILEEDGGAT  60

Query  1813  FTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIF  1992
             FTFEGT K+  L+V+++VH+P+FYWKV T+AD+GLADAYI GD SF DK +GLL+L  + 
Sbjct  61    FTFEGTSKRFSLEVVLKVHNPRFYWKVTTRADIGLADAYIDGDYSFADKDQGLLHLIMVL  120

Query  1993  VANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSN  2172
             +ANRD + S+S++N+KRGWWTP LFT+ IASAK+F++H+ RQNTLTQARRNISRHYDLSN
Sbjct  121   IANRDANKSISKANNKRGWWTPSLFTAGIASAKFFLQHVLRQNTLTQARRNISRHYDLSN  180

Query  2173  ELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAI  2352
             E+FSLFL ETM YSCA+FK+EDEDL TAQ+RKIS+LI+KA+I K+H ILEIGCGWG+ AI
Sbjct  181   EVFSLFLGETMAYSCAIFKTEDEDLNTAQLRKISVLIEKARIDKKHEILEIGCGWGTFAI  240

Query  2353  EAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEM  2532
             E V++TGCKYTG+TLS +QLKYAE KV+EAGLQDNIR LLCDYR+LP+  +YDRI+SCEM
Sbjct  241   EVVKQTGCKYTGLTLSVEQLKYAEMKVKEAGLQDNIRLLLCDYRELPEGYKYDRIVSCEM  300

Query  2533  LEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPS  2712
             +E VGHE+M +FF  CES LAE+G+LVLQ  SI DERYDEYR+SSDFIKEYIFPGGCLPS
Sbjct  301   IEHVGHEYMEDFFSSCESALAEDGLLVLQSTSIADERYDEYRRSSDFIKEYIFPGGCLPS  360

Query  2713  LSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYY  2892
             LSR+TSAM  +SRLCVEH+E+IG HYY TLRCW+  FLE +S+IL +GFD+KFIRTWEYY
Sbjct  361   LSRITSAMGVASRLCVEHVENIGSHYYLTLRCWKKYFLENKSKILAMGFDEKFIRTWEYY  420

Query  2893  FDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             FDY AAGF +  LG+YQIVFSRPGNV   G+PYKG  SAY
Sbjct  421   FDYSAAGFKSYALGNYQIVFSRPGNVGVLGNPYKGFPSAY  460



>ref|XP_002314494.2| hypothetical protein POPTR_0010s07840g [Populus trichocarpa]
 gb|EEF00665.2| hypothetical protein POPTR_0010s07840g [Populus trichocarpa]
Length=460

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/456 (68%), Positives = 375/456 (82%), Gaps = 0/456 (0%)
 Frame = +1

Query  1645  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1824
             M AA+    + C+ L +   M PS  E  ARL VT+FL   I T  +IL EEGG  FTFE
Sbjct  1     MAAANCSSGETCAALIHGKQMAPSRLEAWARLFVTKFLGRHISTHRLILEEEGGATFTFE  60

Query  1825  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2004
             GT KK  L+V+++VH+PQFYWKV T+AD+GLADAYI GD SF DK +GLL+L  + +ANR
Sbjct  61    GTSKKCSLEVVLKVHNPQFYWKVTTRADIGLADAYIDGDFSFADKDQGLLHLIMVLIANR  120

Query  2005  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2184
             D + S+S++  KRGWWTP LFT+ IASAK+F++H+ RQNTLTQARRNISRHYDLSNE+FS
Sbjct  121   DANRSISQAKRKRGWWTPSLFTAGIASAKFFLQHVLRQNTLTQARRNISRHYDLSNEVFS  180

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2364
             LFL ETM YS A+FK+E EDL TAQ+RKIS+LI+KA+I K+H IL+IGCGWG+ AIE V+
Sbjct  181   LFLGETMAYSSAIFKTEGEDLNTAQLRKISVLIEKARIDKKHEILDIGCGWGTFAIEVVK  240

Query  2365  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2544
             +TGCKYTG++LS +QLKYAE KV+EAGLQDNIR LLCDYR+LP   +YDRI+SCEM+E V
Sbjct  241   QTGCKYTGLSLSVEQLKYAEMKVKEAGLQDNIRLLLCDYRELPKGYKYDRIVSCEMIEHV  300

Query  2545  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2724
             GHE+M +FF  CES LAE+G+LVLQFISI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+
Sbjct  301   GHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYRRSSDFIKEYIFPGGCLPSLSRI  360

Query  2725  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2904
             TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL +GFD+KFIRTWEYYFDY 
Sbjct  361   TSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKILAMGFDEKFIRTWEYYFDYS  420

Query  2905  AAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             +AGF + TL DYQ+VFSRPGNV A G+PYKG  SAY
Sbjct  421   SAGFKSYTLRDYQVVFSRPGNVEALGNPYKGFPSAY  456



>ref|XP_002314496.2| hypothetical protein POPTR_0010s07820g [Populus trichocarpa]
 gb|EEF00667.2| hypothetical protein POPTR_0010s07820g [Populus trichocarpa]
Length=460

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/456 (67%), Positives = 374/456 (82%), Gaps = 0/456 (0%)
 Frame = +1

Query  1645  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1824
             M AA+    + C+ L +   M PS  +  ARL VT+FL   I T  +IL E+GG  FTFE
Sbjct  1     MAAANCSSGETCAALIHGKQMAPSRLQAWARLFVTKFLGRHISTDHLILEEDGGATFTFE  60

Query  1825  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2004
             GT K+  L+V+++VH+P+FYWKV T+AD+GLADAYI GD SF DK +GLL+L  + +ANR
Sbjct  61    GTSKRFSLEVVLKVHNPRFYWKVTTRADIGLADAYIDGDFSFADKDQGLLHLIMVLIANR  120

Query  2005  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2184
             D + S+S++N KRGWWTP LFT+ IASAK+F++H+ RQNTLTQARRNISRHYDLSNE+FS
Sbjct  121   DANKSISKANKKRGWWTPSLFTAGIASAKFFLQHVLRQNTLTQARRNISRHYDLSNEVFS  180

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2364
             LFL ETM YSCA+FK+EDEDL TAQ+RKIS+LI+KA+I K+H IL+IGCGWG+ AIE V+
Sbjct  181   LFLGETMAYSCAIFKTEDEDLNTAQLRKISVLIEKARIDKKHEILDIGCGWGTFAIEVVK  240

Query  2365  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2544
             +TGCKYTG+TLS +QLKYAE KV+EAGLQDNIR LLCDYR+LP   +YDRI+SCEM+E V
Sbjct  241   QTGCKYTGLTLSVEQLKYAEMKVKEAGLQDNIRLLLCDYRELPQGYKYDRIVSCEMIEHV  300

Query  2545  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2724
             GHE+M +FF  CES LAE+G+LVLQ  SI DERYDEYR+SSDFIKEYIFPG C+PSLSR+
Sbjct  301   GHEYMEDFFSSCESALAEDGLLVLQSTSIADERYDEYRRSSDFIKEYIFPGACVPSLSRI  360

Query  2725  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2904
             TSAM  +SRLCVEH+E+IG HYY TLRCW+  FLE +S+IL +GFD+KFIRTWEYYFDY 
Sbjct  361   TSAMGVASRLCVEHVENIGSHYYLTLRCWKKYFLENKSKILAMGFDEKFIRTWEYYFDYS  420

Query  2905  AAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             AAGF +  LG+YQIVFSRPGNV   G+PYKG  SAY
Sbjct  421   AAGFKSYALGNYQIVFSRPGNVGVLGNPYKGFPSAY  456



>ref|XP_006378321.1| hypothetical protein POPTR_0010s07800g, partial [Populus trichocarpa]
 gb|ERP56118.1| hypothetical protein POPTR_0010s07800g, partial [Populus trichocarpa]
Length=466

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/462 (67%), Positives = 378/462 (82%), Gaps = 2/462 (0%)
 Frame = +1

Query  1633  LKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTV  1812
             L A M AA+    + C+ L +   M PS  +  ARL VT+FL S I T  +IL EEGG+ 
Sbjct  1     LVASMAAANCSSGETCAALIHGKQMAPSRLQAWARLFVTKFLGSHISTDHLILEEEGGST  60

Query  1813  FTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISF--VDKKEGLLNLFK  1986
             FTFEGT KK  L+V+++VH+PQFYWKV T+AD+GLADAYI  +  F  + K +GLL+LF 
Sbjct  61    FTFEGTSKKCSLEVVLKVHNPQFYWKVMTRADIGLADAYIKMEDLFCLLTKDQGLLDLFM  120

Query  1987  IFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDL  2166
             + +ANRD + S+S++N KRGWWTP LFT+ IASAK+F++H+ RQNTLTQARRNISRHYDL
Sbjct  121   VLIANRDANKSISKANKKRGWWTPSLFTAGIASAKFFLQHVLRQNTLTQARRNISRHYDL  180

Query  2167  SNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSL  2346
             SNE+FSLFL ETM YSCA+FK+EDEDL TAQ+RKIS+LI+KA+I K+H IL+IGCGWG+ 
Sbjct  181   SNEVFSLFLGETMAYSCAIFKTEDEDLNTAQLRKISVLIEKARIDKKHEILDIGCGWGTF  240

Query  2347  AIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISC  2526
             AIE V++TGCKYTG+TLS +QLKYAE KV+EAGLQDNIR LLCDYR+LP   +YDRI+SC
Sbjct  241   AIEVVKQTGCKYTGLTLSVEQLKYAEMKVKEAGLQDNIRLLLCDYRELPKGYKYDRIVSC  300

Query  2527  EMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCL  2706
             EM+E VGHE+M +FF  CES LAE+G+LVLQ ISI DE YDE+R+SS F++EYIFPGGCL
Sbjct  301   EMIEHVGHEYMEDFFSSCESALAEDGLLVLQSISIADECYDEHRRSSCFMREYIFPGGCL  360

Query  2707  PSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWE  2886
             PSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR  FLE +S+IL +GFD+KFIRTWE
Sbjct  361   PSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKTFLENKSKILAMGFDEKFIRTWE  420

Query  2887  YYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             YYFDYCAAGF + TLGDYQIVFSRPGNV   G+PYKG  SAY
Sbjct  421   YYFDYCAAGFKSYTLGDYQIVFSRPGNVGVLGNPYKGFPSAY  462



>emb|CDY18120.1| BnaA01g23810D [Brassica napus]
Length=460

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/455 (68%), Positives = 361/455 (79%), Gaps = 0/455 (0%)
 Frame = +1

Query  1645  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1824
             M AA  LL K  + L N  HM  S  E+GARL VTRFL  FI  G + +LE+GGT+FTF 
Sbjct  1     MEAARSLLGKGITLLKNLQHMALSVTESGARLFVTRFLRQFISIGCLTILEDGGTMFTFG  60

Query  1825  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2004
             G     LLK ++++HSPQFYWKV TQADLGLADAYI GD SFVDK+ G+LNL  I +ANR
Sbjct  61    GNYSNCLLKSILKIHSPQFYWKVMTQADLGLADAYISGDFSFVDKELGMLNLIMILIANR  120

Query  2005  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2184
             DLS+       KRGWWTP+  T+ +ASAKYF +H+SRQNTLTQARRNISRHYDLSNELFS
Sbjct  121   DLSSRKPNFAKKRGWWTPMFLTAGLASAKYFFKHVSRQNTLTQARRNISRHYDLSNELFS  180

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2364
             LF+D+TM YS AVFKS +EDL+TAQMRKI+LLI+KA+I K H +LE+GCGWG+LAIE V 
Sbjct  181   LFMDDTMAYSSAVFKSVNEDLRTAQMRKITLLIEKARIEKNHEVLELGCGWGTLAIEVVR  240

Query  2365  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2544
             RTGCKYTGITLS +QLKYAE KV+EA L+D I F LCDYRQL D  +Y+RII+CEM+EAV
Sbjct  241   RTGCKYTGITLSIEQLKYAEAKVKEARLEDRITFQLCDYRQLSDAQKYNRIIACEMIEAV  300

Query  2545  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2724
             GHEF   FF  CE  LA++GI V+QF ++P+E YDE R SS FI EYIFPGGCLPSL+RV
Sbjct  301   GHEFYEAFFSCCEVALAKDGIFVMQFTAVPEELYDETRLSSGFITEYIFPGGCLPSLARV  360

Query  2725  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2904
             TSAM++SSRLC+E +E+IGIHYY TLRCWR  FLE Q QI++LGFD KFIRTWEYYFDY 
Sbjct  361   TSAMSSSSRLCIEDVENIGIHYYYTLRCWRKRFLENQKQIMELGFDDKFIRTWEYYFDYV  420

Query  2905  AAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             AAGF T TL  YQIVFSRPGN+ AFGDP+    SA
Sbjct  421   AAGFKTLTLRSYQIVFSRPGNIAAFGDPFHSFPSA  455



>ref|XP_009107970.1| PREDICTED: uncharacterized protein LOC103833648 [Brassica rapa]
Length=460

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/455 (68%), Positives = 361/455 (79%), Gaps = 0/455 (0%)
 Frame = +1

Query  1645  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1824
             M AA  LL K  + L N  HM  S  E+GARL VTRFL  FI  G + +LE+GGT+FTF 
Sbjct  1     MEAARSLLGKGITLLKNLQHMALSVTESGARLFVTRFLRQFISIGCLTILEDGGTMFTFG  60

Query  1825  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2004
             G     LLK ++++HSPQFYWKV TQADLGLADAYI GD SFVDK+ G+LNL  I +ANR
Sbjct  61    GNYSNCLLKSILKIHSPQFYWKVMTQADLGLADAYISGDFSFVDKELGMLNLIMILIANR  120

Query  2005  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2184
             DLS+       KRGWWTP+  T+ +ASAKYF +H+SRQNTLTQARRNISRHYDLSNELFS
Sbjct  121   DLSSRKPNFAKKRGWWTPMFLTAGLASAKYFFKHVSRQNTLTQARRNISRHYDLSNELFS  180

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2364
             LF+D+TM YS AVFKS +EDL+TAQMRKI+LLI+KA+I K H +LE+GCGWG+LAIE V 
Sbjct  181   LFMDDTMAYSSAVFKSVNEDLRTAQMRKITLLIEKARIEKNHEVLELGCGWGTLAIEVVR  240

Query  2365  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2544
             RTGCKYTGITLS +QLKYAE KV+EA L+D I F LCDYRQL D  ++DRII+CEM+EAV
Sbjct  241   RTGCKYTGITLSIEQLKYAEAKVKEARLEDRITFQLCDYRQLSDAQKHDRIIACEMIEAV  300

Query  2545  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2724
             GHEF   FFG CE  LA++GI V+QF ++P+E YDE R SS FI EYIFPGGCLPSL+RV
Sbjct  301   GHEFYEAFFGCCEVALAKDGIFVMQFTAVPEELYDETRLSSGFITEYIFPGGCLPSLARV  360

Query  2725  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2904
             TSAM++SSRLC+E +E+IGIHYY TLRCWR  FLE Q QI++LGFD KFIRTWEYYFDY 
Sbjct  361   TSAMSSSSRLCIEDVENIGIHYYYTLRCWRKRFLENQKQIMELGFDDKFIRTWEYYFDYV  420

Query  2905  AAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3009
             AAGF T TL  YQIVFSRPGN+ AFG P+    SA
Sbjct  421   AAGFKTLTLRSYQIVFSRPGNIAAFGHPFHSFPSA  455



>ref|NP_188989.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAV84488.1| At3g23470 [Arabidopsis thaliana]
 gb|AAW30030.1| At3g23470 [Arabidopsis thaliana]
 gb|AEE76768.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=461

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/452 (68%), Positives = 359/452 (79%), Gaps = 2/452 (0%)
 Frame = +1

Query  1645  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1824
             M+ A  LL K  + L    HMV S  E+GARL VTRFL  FI  G + +LEEGGT+F F 
Sbjct  1     MVIAQSLLWKEITLLKKIQHMVLSLTESGARLFVTRFLEQFISIGCVTILEEGGTMFIFG  60

Query  1825  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2004
               D    LK ++++HSPQFYWKV TQADLGLADAYI GD SFVDK  GLLNL  I +ANR
Sbjct  61    EKDSTCPLKSILKIHSPQFYWKVMTQADLGLADAYISGDFSFVDKDSGLLNLIMILIANR  120

Query  2005  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2184
             D  +  S    KRGWWTP+  T+ +AS KY+++H+ +QNTLTQAR+NIS HYDLSNE F 
Sbjct  121   DQRSPKSNLVKKRGWWTPVFLTAGLASVKYYLKHVLKQNTLTQARKNISSHYDLSNEFFG  180

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2364
             LF+D+TM YS A+FKSE+ED +TAQMRKISLLI+KA+I K H +LE+GCGWG+ AIE V+
Sbjct  181   LFMDDTMMYSSAIFKSENEDPRTAQMRKISLLIEKARIEKNHEVLEMGCGWGTFAIEVVK  240

Query  2365  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2544
             RTGCKYTGITLS +QLKYA+ KV+EAGLQ  I F+LCDYRQL D  +YDRII+CEM+EAV
Sbjct  241   RTGCKYTGITLSIEQLKYAKAKVKEAGLQGRITFMLCDYRQLSDARKYDRIIACEMIEAV  300

Query  2545  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2724
             GHEFM++FF  CE  LAENGI VLQF +IP+  YDE R +S FI EYIFPGGCLPSL+RV
Sbjct  301   GHEFMDKFFSCCEDALAENGIFVLQFTAIPEALYDESRLTSGFITEYIFPGGCLPSLARV  360

Query  2725  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2904
             TSAMA+SSRLC+E++E+IGIHYY TLRCWR NFLERQ QI+DLGFD KFIRTWEYYFDYC
Sbjct  361   TSAMASSSRLCIENVENIGIHYYHTLRCWRKNFLERQKQIIDLGFDDKFIRTWEYYFDYC  420

Query  2905  AAGFHTCTLGDYQIVFSRPGNVTAFG--DPYK  2994
             AAGF T TL  YQIVFSRPGNV AFG  DP++
Sbjct  421   AAGFKTLTLRSYQIVFSRPGNVAAFGDDDPFR  452



>ref|XP_011041421.1| PREDICTED: (S)-coclaurine N-methyltransferase-like, partial [Populus 
euphratica]
Length=419

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/408 (73%), Positives = 354/408 (87%), Gaps = 0/408 (0%)
 Frame = +1

Query  1789  LLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEG  1968
             L EEGG  FTFEGT KK  L+V+++VH+PQFYWKV T+AD+GLADAYI GD SF DK + 
Sbjct  8     LEEEGGATFTFEGTSKKCSLEVVLKVHNPQFYWKVTTRADIGLADAYIDGDFSFADKDQC  67

Query  1969  LLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNI  2148
             LL+LF + +ANRD + S+S++N KRGWWTP LFT+ IASAK+F++H+ RQNTLTQARRNI
Sbjct  68    LLDLFMVLIANRDANKSISKANKKRGWWTPSLFTAGIASAKFFLQHVLRQNTLTQARRNI  127

Query  2149  SRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIG  2328
             SRHYDLSNE+FSLFL ETM YS A+FK+EDEDL TAQ+RKIS+LI+KA+I K+H IL+IG
Sbjct  128   SRHYDLSNEVFSLFLGETMAYSSAIFKTEDEDLNTAQLRKISVLIEKARIDKKHEILDIG  187

Query  2329  CGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRY  2508
             CGWG+ AIE V++TGCKYTG+TLS +QLKYAE KV+EAGLQD+IR LLCDYR+LP   +Y
Sbjct  188   CGWGTFAIEVVKQTGCKYTGLTLSVEQLKYAEMKVKEAGLQDHIRLLLCDYRELPKGYKY  247

Query  2509  DRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYI  2688
             DRI+SCEM+E VGHE+M +FF  CES LAE+G+LVLQFISI DERYDEYR+SSDFIKEYI
Sbjct  248   DRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYRRSSDFIKEYI  307

Query  2689  FPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKK  2868
             FPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL +GFD+K
Sbjct  308   FPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKILAMGFDEK  367

Query  2869  FIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             FIRTWEYYFDYCAAGF + TLGDYQ+VFSRPGNV A G+PYKG  SAY
Sbjct  368   FIRTWEYYFDYCAAGFKSYTLGDYQVVFSRPGNVVALGNPYKGFPSAY  415



>ref|XP_010532682.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/435 (69%), Positives = 352/435 (81%), Gaps = 0/435 (0%)
 Frame = +1

Query  1705  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1884
             M PS+ ET AR  VTRF+  +I TG + L+E+GGT F F G   K  LK ++++HSPQFY
Sbjct  1     MAPSFVETAARAFVTRFMGQYISTGYVTLVEDGGTTFEFGGKHPKCTLKSVMKIHSPQFY  60

Query  1885  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2064
             WKV T+AD+GLADAYI GDISF DK EGLLNL  I +ANRDL++S S    KR WW P+ 
Sbjct  61    WKVMTEADIGLADAYISGDISFADKDEGLLNLIVILIANRDLNSSKSNLAEKRRWWKPMF  120

Query  2065  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2244
             FT+ +ASAKYF++H+ R+NTLTQARRNIS HYDLSNELF+LF+DETM YSCAVFKS+DED
Sbjct  121   FTAGLASAKYFLKHVFRKNTLTQARRNISDHYDLSNELFALFMDETMAYSCAVFKSDDED  180

Query  2245  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2424
             L+TAQ RKISLLIDKA+I K H +LEIGCGWG+LAIE V RTGCKYTGITLS +QLKYAE
Sbjct  181   LRTAQTRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTGCKYTGITLSIEQLKYAE  240

Query  2425  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2604
              KV+E GL+D I F L DYRQL D+ +YDRIISCEM+EAVGH+FM  FF RCES LAE G
Sbjct  241   AKVKEEGLEDRITFELRDYRQLSDSRKYDRIISCEMIEAVGHKFMETFFNRCESALAEEG  300

Query  2605  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGI  2784
             +LVLQF ++PD RYDE R S  FI EYIFPG C PSL+RVTSAMA+SSRLC+EH+E+IGI
Sbjct  301   LLVLQFSAVPDSRYDESRLSPGFITEYIFPGACHPSLARVTSAMASSSRLCIEHVENIGI  360

Query  2785  HYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2964
             HY++TLRCWR NFL+RQ ++  +GFD+KFIR WEYYFDYCAAGF T  L  YQ+VFSRPG
Sbjct  361   HYHKTLRCWRQNFLKRQEEVKAIGFDEKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPG  420

Query  2965  NVTAFGDPYKGLASA  3009
             N T FGDPY    SA
Sbjct  421   NTTMFGDPYMSYPSA  435



>ref|XP_010488415.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase-like 
[Camelina sativa]
Length=455

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/453 (68%), Positives = 362/453 (80%), Gaps = 11/453 (2%)
 Frame = +1

Query  1645  MIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1821
             M+AA GLL K   +   N N MV S  E   R   TRFL  FI TG + ++E G T+ TF
Sbjct  1     MVAAQGLLGKDMVTSSRNQNRMVLSLTEKVVRFFFTRFLTKFISTGCVTIIE-GETMVTF  59

Query  1822  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2001
             +G D    LK  + +HSPQFYWKV T++DLGLADAYI+GD SF +K+ GLLNL  I +AN
Sbjct  60    QGEDLSCHLKSELEIHSPQFYWKVMTRSDLGLADAYINGDFSFCNKETGLLNLIMILIAN  119

Query  2002  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2181
             RDL+ S++++   RGWW P+  T+ +A+AK+F R    QNTLTQARRNISRHYDLSNELF
Sbjct  120   RDLNFSLAKN---RGWWNPMFLTTGLAAAKHFYR----QNTLTQARRNISRHYDLSNELF  172

Query  2182  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2361
             +LFLD+TM+YS AVFKS DEDL+ AQMRKI LLIDKA+I K H +L+IGCGWG+LAIEAV
Sbjct  173   ALFLDDTMSYSSAVFKSGDEDLRIAQMRKIYLLIDKARIKKNHEVLDIGCGWGTLAIEAV  232

Query  2362  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2541
              RTGCKYTGITLS +QLKYAE K +EAGL+D I F LCDYRQL D  +YDRIISCEMLE 
Sbjct  233   RRTGCKYTGITLSVEQLKYAEAKAKEAGLEDRITFKLCDYRQLSDAQKYDRIISCEMLEH  292

Query  2542  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2721
              GHEFM  FF  CE+ L E+GI ++QFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+R
Sbjct  293   AGHEFMETFFSHCEAALTEDGITIIQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLAR  352

Query  2722  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2901
             VTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+R +QI+DLGFD KFIRTWEYYFDY
Sbjct  353   VTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRHNQIMDLGFDDKFIRTWEYYFDY  412

Query  2902  CAAGFHTCTLGDYQIVFSRPGNVTAFG--DPYK  2994
             CAAGF T TLGDYQIVFSRPGNV AFG  DP++
Sbjct  413   CAAGFKTRTLGDYQIVFSRPGNVAAFGDDDPFR  445



>ref|XP_010532683.1| PREDICTED: (S)-coclaurine N-methyltransferase-like isoform X2 
[Tarenaya hassleriana]
Length=438

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/435 (68%), Positives = 349/435 (80%), Gaps = 2/435 (0%)
 Frame = +1

Query  1705  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1884
             M PS+ ET AR  VTRF+  +I TG + L+E+GGT F F G   K  LK ++++HSPQFY
Sbjct  1     MAPSFVETAARAFVTRFMGQYISTGYVTLVEDGGTTFEFGGKHPKCTLKSVMKIHSPQFY  60

Query  1885  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2064
             WKV T+AD+GLADAYI GDISF DK EGLLNL  I +ANRDL++S S    KR WW P+ 
Sbjct  61    WKVMTEADIGLADAYISGDISFADKDEGLLNLIVILIANRDLNSSKSNLAEKRRWWKPMF  120

Query  2065  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2244
             FT+ +ASAKYF++H+ R+NTLTQARRNIS HYDLSNELF+LF+DETM YSCAVFKS+DED
Sbjct  121   FTAGLASAKYFLKHVFRKNTLTQARRNISDHYDLSNELFALFMDETMAYSCAVFKSDDED  180

Query  2245  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2424
             L+TAQ RKISLLIDKA+I K H +LEIGCGWG+LAIE V RTGCKYTGITLS +QLKYAE
Sbjct  181   LRTAQTRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTGCKYTGITLSIEQLKYAE  240

Query  2425  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2604
              KV+E GL+D I F L DYRQL D+ +YDRIISCEM+EAVGH+FM  FF RCES LAE G
Sbjct  241   AKVKEEGLEDRITFELRDYRQLSDSRKYDRIISCEMIEAVGHKFMETFFNRCESALAEEG  300

Query  2605  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGI  2784
             +LVLQF ++PD RYDE R S  FI EYIFPG C PSL+RVTSAMA+SS   +EH+E+IGI
Sbjct  301   LLVLQFSAVPDSRYDESRLSPGFITEYIFPGACHPSLARVTSAMASSS--SIEHVENIGI  358

Query  2785  HYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2964
             HY++TLRCWR NFL+RQ ++  +GFD+KFIR WEYYFDYCAAGF T  L  YQ+VFSRPG
Sbjct  359   HYHKTLRCWRQNFLKRQEEVKAIGFDEKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPG  418

Query  2965  NVTAFGDPYKGLASA  3009
             N T FGDPY    SA
Sbjct  419   NTTMFGDPYMSYPSA  433



>ref|XP_007035217.1| Cyclopropane fatty acid synthase isoform 1 [Theobroma cacao]
 gb|EOY06143.1| Cyclopropane fatty acid synthase isoform 1 [Theobroma cacao]
Length=433

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/430 (68%), Positives = 358/430 (83%), Gaps = 0/430 (0%)
 Frame = +1

Query  1723  ETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQ  1902
             ET AR +V +F   +I TG +ILLEE GTV TF G+ +K  LKV+++VH+PQFYWK+ T+
Sbjct  2     ETMARHIVIKFFEQYISTGCVILLEEEGTVLTFTGSMEKCSLKVVLKVHNPQFYWKIMTE  61

Query  1903  ADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIA  2082
             ADLGLADAYI GD SF DK+EGLLNLF IF+ANR   +S S  N KRGWW P LFT++I+
Sbjct  62    ADLGLADAYIQGDFSFEDKEEGLLNLFLIFIANRVSDSSASGLNKKRGWWAPALFTASIS  121

Query  2083  SAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQM  2262
             SAKYF++H+ RQNTL QARRNISRHY+LSNELF LFLDE M YS A+FK+E+EDLK AQ+
Sbjct  122   SAKYFLKHVLRQNTLIQARRNISRHYNLSNELFELFLDEKMQYSSAIFKAENEDLKVAQL  181

Query  2263  RKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREA  2442
             RKIS LIDKA+I K H +++IGCGWG  AIE V+RTGCKYTG+TLSE+QLKYAE KV+EA
Sbjct  182   RKISSLIDKARIEKGHEVIDIGCGWGYFAIEVVKRTGCKYTGVTLSEEQLKYAEAKVKEA  241

Query  2443  GLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQF  2622
             GLQDNIRFLLCDYRQLP+  +YDRIISCEM+E VG+E++ EFF  CES+LA++G+ VLQF
Sbjct  242   GLQDNIRFLLCDYRQLPETGKYDRIISCEMIEHVGNEYIEEFFRCCESILAKDGLFVLQF  301

Query  2623  ISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTL  2802
             IS+ +E++ E+ +S  F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTL
Sbjct  302   ISMTEEQFPEHLRSPGFVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTL  361

Query  2803  RCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG  2982
             RCWR NFLE +S+IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A G
Sbjct  362   RCWRKNFLENKSKILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALG  421

Query  2983  DPYKGLASAY  3012
             DPY+G   AY
Sbjct  422   DPYQGFPLAY  431



>ref|XP_004296401.1| PREDICTED: cyclopropane-fatty-acyl-phospholipid synthase-like 
[Fragaria vesca subsp. vesca]
Length=455

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/457 (66%), Positives = 365/457 (80%), Gaps = 4/457 (1%)
 Frame = +1

Query  1645  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1824
             M AA G+L   C+ L N  HM  S  ET AR  VTRF   FI  G +ILLEEGGT+FTFE
Sbjct  1     MAAADGMLGNGCALLGNTKHMALSLTETAARQFVTRFFRHFISVGCLILLEEGGTMFTFE  60

Query  1825  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2004
             G+ K   L+ +++VHSPQFYWKV TQADLG+ADAYI+GD SF DK   L NLF + +AN 
Sbjct  61    GSRKDCSLRSILKVHSPQFYWKVMTQADLGIADAYINGDFSFDDKDRDLFNLFMLLIAN-  119

Query  2005  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2184
              + ++ S+SN KR WW PLLFT+ IA+AKY  +H  RQN+LTQARRNISRHYDLSNELFS
Sbjct  120   -VESNASKSNKKRRWWQPLLFTATIATAKYCFQHFLRQNSLTQARRNISRHYDLSNELFS  178

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2364
             LFL ETM YS A+FK+EDE+LKTAQ+RKIS+LI+KA+I ++H +L+IGCGWG+ AIE V+
Sbjct  179   LFLGETMMYSTAIFKTEDEELKTAQLRKISILIEKARIDEKHEVLDIGCGWGTFAIEVVK  238

Query  2365  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2544
             +TGC+YTGITLS++QLK+AE KV++AGLQ+ I FLLCDYRQLP + +YDRIISCEM+E V
Sbjct  239   QTGCRYTGITLSDEQLKFAEKKVKDAGLQERINFLLCDYRQLPSDHKYDRIISCEMIEHV  298

Query  2545  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2724
             GHEF++EFF  CESVL ENG+ +LQFIS+PD+RYD+YR+ + FIKEYIFPGGCLPSL RV
Sbjct  299   GHEFVDEFFSCCESVLEENGLFILQFISMPDDRYDDYRRGTGFIKEYIFPGGCLPSLGRV  358

Query  2725  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLE-RQSQILDLGFDKKFIRTWEYYFDY  2901
              SAMAASSRLCVEHLE+IGI    T+  ++  FL    S+IL LGF++ FIRTWEYYFDY
Sbjct  359   ISAMAASSRLCVEHLENIGIFMTATV-LYKMQFLFCIYSEILALGFNENFIRTWEYYFDY  417

Query  2902  CAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             CAAGF +  +GDYQIVFSRPGN   + +PYKG  SAY
Sbjct  418   CAAGFKSHIVGDYQIVFSRPGNALTYNNPYKGFPSAY  454



>ref|XP_011041574.1| PREDICTED: uncharacterized protein LOC105137508 [Populus euphratica]
Length=668

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/436 (69%), Positives = 354/436 (81%), Gaps = 14/436 (3%)
 Frame = +1

Query  1705  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1884
             M PS  E  ARL VT+FL S I T  +IL EEGG  FTF+G  KK+ L+V+++VH+PQFY
Sbjct  1     MSPSRFEAWARLFVTKFLGSHISTDRLILTEEGGATFTFKGASKKSSLEVVLKVHNPQFY  60

Query  1885  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2064
             WKV T+AD+GLADAYI GD+SF DK +GLL+L                +N KRGWWTP L
Sbjct  61    WKVTTRADIGLADAYIDGDLSFADKDQGLLHLIM--------------ANMKRGWWTPSL  106

Query  2065  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2244
             FT+ IASAK+F++H+ RQNTLTQARRNIS HYDLSNE+FSLFL ETM YSCA+FK+EDED
Sbjct  107   FTAGIASAKFFLQHVLRQNTLTQARRNISHHYDLSNEVFSLFLGETMAYSCAIFKTEDED  166

Query  2245  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2424
             L TAQ+RKIS LI+KA+I K+H IL+IGCGWG+ AIE V++TGCK TG+TLS +QLKYAE
Sbjct  167   LDTAQLRKISALIEKARIDKKHEILDIGCGWGTFAIEVVKQTGCKCTGLTLSVEQLKYAE  226

Query  2425  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2604
              KV+EAGLQD+IR LLCDYR+LP   +YD I+SCEM+E VGHE+M +FF  CES LAE+G
Sbjct  227   MKVKEAGLQDHIRLLLCDYRELPKGYKYDIIVSCEMIEHVGHEYMEDFFSSCESALAEDG  286

Query  2605  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGI  2784
             +LVLQ  SI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG 
Sbjct  287   LLVLQSTSIADERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGS  346

Query  2785  HYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2964
             HYY TLR WR NFLE +S+IL +GFD+KFIRTWEYYFDYCAAGF + TL +YQIVFSRPG
Sbjct  347   HYYHTLRRWRKNFLENKSKILAMGFDEKFIRTWEYYFDYCAAGFKSYTLWNYQIVFSRPG  406

Query  2965  NVTAFGDPYKGLASAY  3012
             NV   G+PYKG  SAY
Sbjct  407   NVGVLGNPYKGFPSAY  422



>gb|KFK39641.1| hypothetical protein AALP_AA3G270000 [Arabis alpina]
Length=438

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/438 (66%), Positives = 347/438 (79%), Gaps = 4/438 (1%)
 Frame = +1

Query  1678  CSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVL  1857
              +PL+N   MVPS  E  AR   TRFL  FI TGS+ +LEEG   F+FEG D +  LK +
Sbjct  2     VNPLSNQKQMVPSMTEKWARNFFTRFLRQFISTGSVTILEEGSE-FSFEGNDPRCPLKSV  60

Query  1858  VRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNS  2037
             + +HSPQFYWKV T+AD+GLADAYI GD SFVDK+ GLLNL  I +AN++L +  S    
Sbjct  61    LEIHSPQFYWKVMTRADVGLADAYIDGDFSFVDKETGLLNLIMILIANKELHSRNSNLAK  120

Query  2038  KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSC  2217
             KRGWWTP+  ++ +ASA  F++H+SRQNTLTQARRNISRHYDLSNELF+L+L +TMTYS 
Sbjct  121   KRGWWTPMFLSAGLASAMNFLKHVSRQNTLTQARRNISRHYDLSNELFALYLGDTMTYSS  180

Query  2218  AVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITL  2397
             A+FKS DEDL+TAQMRKISLLI            E+  GWG+L IE V +TGCKYTGITL
Sbjct  181   AIFKSHDEDLETAQMRKISLLIXXXXXXXX---FELASGWGTLGIEVVRKTGCKYTGITL  237

Query  2398  SEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGR  2577
             S +QL YAE+K +EAGLQD I F LCDYRQL D  +YDRIISCEM+E VG +F   FF  
Sbjct  238   SIEQLNYAEEKAKEAGLQDRITFQLCDYRQLSDAKKYDRIISCEMIEHVGDKFFETFFSH  297

Query  2578  CESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC  2757
             CE+ LAE+GI VLQFISIP+ERY+EYR +SDFI+EYIFPGGCLPSL+RVTSAM++SSRLC
Sbjct  298   CEAALAEDGIFVLQFISIPEERYNEYRLNSDFIREYIFPGGCLPSLARVTSAMSSSSRLC  357

Query  2758  VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGD  2937
             +E +E+IGIHYY TL+ WR NFLE+Q +I+DLGF+ KFIRTWEYYFDYCAAGF T TLGD
Sbjct  358   IESVENIGIHYYHTLKYWRKNFLEKQKEIMDLGFNDKFIRTWEYYFDYCAAGFKTLTLGD  417

Query  2938  YQIVFSRPGNVTAFGDPY  2991
             YQ+VFSRPGNV AFGDP+
Sbjct  418   YQVVFSRPGNVAAFGDPF  435



>ref|XP_002528379.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF34051.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=372

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/371 (75%), Positives = 332/371 (89%), Gaps = 0/371 (0%)
 Frame = +1

Query  1897  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2076
             TQADLGLA+AYI GDISF DK EGLLNLF + +ANRD + SVS  N K+GWWTP+  T++
Sbjct  2     TQADLGLANAYISGDISFPDKDEGLLNLFMVLIANRDANISVSERNKKKGWWTPMFLTAS  61

Query  2077  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2256
             IASAK+F RH+SR+N+LTQARRNISRHYDLSNE+FS+FLDETMTYSCAVFK+EDEDLK+A
Sbjct  62    IASAKFFFRHVSRKNSLTQARRNISRHYDLSNEMFSMFLDETMTYSCAVFKTEDEDLKSA  121

Query  2257  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2436
             QMRKISLLI+KA+I+KEH +LEIGCGWG+LAIE V+RTGCKYTGITLSE+QLK+AE++V+
Sbjct  122   QMRKISLLIEKARINKEHEVLEIGCGWGTLAIEVVKRTGCKYTGITLSEEQLKFAEERVK  181

Query  2437  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2616
             +AGLQ+NIRF LCDYRQLPD  + DRIISCEMLEAVGHE+M E+FG CESVLA++G++VL
Sbjct  182   QAGLQENIRFQLCDYRQLPDTYKCDRIISCEMLEAVGHEYMEEYFGCCESVLADDGLIVL  241

Query  2617  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2796
             QF SIP+ERY+EYR+SSD IKEYIFPG C+PSL+R+T AMAAS+RLCVEH+E+IG+HYYQ
Sbjct  242   QFTSIPEERYEEYRRSSDVIKEYIFPGTCVPSLTRITIAMAASTRLCVEHVENIGMHYYQ  301

Query  2797  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  2976
             TLR WR NFLE +S+I  LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V SRPGNV A
Sbjct  302   TLRLWRKNFLESKSKITALGFNEKFIRTWEYYFDYCAAGFKTLTLGNYQVVLSRPGNVAA  361

Query  2977  FGDPYKGLASA  3009
              G+PY    +A
Sbjct  362   LGNPYNEFPAA  372



>ref|XP_010466684.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X2 [Camelina sativa]
Length=434

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/436 (67%), Positives = 349/436 (80%), Gaps = 7/436 (2%)
 Frame = +1

Query  1645  MIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1821
             M+AA GLL     + L N N M  S  E  AR    RFL  FI TG + ++E G T+ TF
Sbjct  1     MVAAQGLLGNDMVTSLRNQNRMDLSLTEKAARFFFIRFLTHFISTGCVTIIE-GETMITF  59

Query  1822  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2001
             +G D +  LK  + +HSPQFYWK  T++DLGLADAYI+GD SF +K+ GLLNL  I +AN
Sbjct  60    KGEDSRCHLKSELEIHSPQFYWKAMTRSDLGLADAYINGDFSFCNKETGLLNLIMILIAN  119

Query  2002  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2181
             RDL+  ++++   RGWW P+  T+ +ASAK+F++H  RQNTLTQARRNISRHYDLSNELF
Sbjct  120   RDLNLRLAKN---RGWWKPMFLTTGLASAKHFLKHFYRQNTLTQARRNISRHYDLSNELF  176

Query  2182  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2361
             +LFLD+TM+YS AVFKS DEDL+TAQ+RKI LLIDKA+I K H +L+IGCGWG+LAIE V
Sbjct  177   ALFLDDTMSYSSAVFKSGDEDLRTAQLRKIYLLIDKARIKKNHEVLDIGCGWGTLAIETV  236

Query  2362  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2541
              RTGCKYTGIT+S +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRI+SCEMLE 
Sbjct  237   RRTGCKYTGITISIEQLKYAEEKVKEAGLQDRITFKLCDYRQLSDVQKYDRIVSCEMLEH  296

Query  2542  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2721
             VGHEFM  FF  C++   E+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+R
Sbjct  297   VGHEFMETFFSHCDA--XEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLAR  354

Query  2722  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2901
             VTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ QI DLGFD KFIRTWEYY+DY
Sbjct  355   VTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQKQITDLGFDNKFIRTWEYYYDY  414

Query  2902  CAAGFHTCTLGDYQIV  2949
             CAAGF T TLGDYQ+ 
Sbjct  415   CAAGFKTRTLGDYQVT  430



>ref|XP_010466685.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X3 [Camelina sativa]
Length=428

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/434 (68%), Positives = 348/434 (80%), Gaps = 7/434 (2%)
 Frame = +1

Query  1645  MIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1821
             M+AA GLL     + L N N M  S  E  AR    RFL  FI TG + ++E G T+ TF
Sbjct  1     MVAAQGLLGNDMVTSLRNQNRMDLSLTEKAARFFFIRFLTHFISTGCVTIIE-GETMITF  59

Query  1822  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2001
             +G D +  LK  + +HSPQFYWK  T++DLGLADAYI+GD SF +K+ GLLNL  I +AN
Sbjct  60    KGEDSRCHLKSELEIHSPQFYWKAMTRSDLGLADAYINGDFSFCNKETGLLNLIMILIAN  119

Query  2002  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2181
             RDL+  ++++   RGWW P+  T+ +ASAK+F++H  RQNTLTQARRNISRHYDLSNELF
Sbjct  120   RDLNLRLAKN---RGWWKPMFLTTGLASAKHFLKHFYRQNTLTQARRNISRHYDLSNELF  176

Query  2182  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2361
             +LFLD+TM+YS AVFKS DEDL+TAQ+RKI LLIDKA+I K H +L+IGCGWG+LAIE V
Sbjct  177   ALFLDDTMSYSSAVFKSGDEDLRTAQLRKIYLLIDKARIKKNHEVLDIGCGWGTLAIETV  236

Query  2362  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2541
              RTGCKYTGIT+S +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRI+SCEMLE 
Sbjct  237   RRTGCKYTGITISIEQLKYAEEKVKEAGLQDRITFKLCDYRQLSDVQKYDRIVSCEMLEH  296

Query  2542  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2721
             VGHEFM  FF  C++   E+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+R
Sbjct  297   VGHEFMETFFSHCDA--XEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLAR  354

Query  2722  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2901
             VTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ QI DLGFD KFIRTWEYY+DY
Sbjct  355   VTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQKQITDLGFDNKFIRTWEYYYDY  414

Query  2902  CAAGFHTCTLGDYQ  2943
             CAAGF T TLGDYQ
Sbjct  415   CAAGFKTRTLGDYQ  428



>ref|XP_010466683.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X1 [Camelina sativa]
Length=440

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/434 (68%), Positives = 348/434 (80%), Gaps = 7/434 (2%)
 Frame = +1

Query  1645  MIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1821
             M+AA GLL     + L N N M  S  E  AR    RFL  FI TG + ++E G T+ TF
Sbjct  1     MVAAQGLLGNDMVTSLRNQNRMDLSLTEKAARFFFIRFLTHFISTGCVTIIE-GETMITF  59

Query  1822  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2001
             +G D +  LK  + +HSPQFYWK  T++DLGLADAYI+GD SF +K+ GLLNL  I +AN
Sbjct  60    KGEDSRCHLKSELEIHSPQFYWKAMTRSDLGLADAYINGDFSFCNKETGLLNLIMILIAN  119

Query  2002  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2181
             RDL+  ++++   RGWW P+  T+ +ASAK+F++H  RQNTLTQARRNISRHYDLSNELF
Sbjct  120   RDLNLRLAKN---RGWWKPMFLTTGLASAKHFLKHFYRQNTLTQARRNISRHYDLSNELF  176

Query  2182  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2361
             +LFLD+TM+YS AVFKS DEDL+TAQ+RKI LLIDKA+I K H +L+IGCGWG+LAIE V
Sbjct  177   ALFLDDTMSYSSAVFKSGDEDLRTAQLRKIYLLIDKARIKKNHEVLDIGCGWGTLAIETV  236

Query  2362  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2541
              RTGCKYTGIT+S +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRI+SCEMLE 
Sbjct  237   RRTGCKYTGITISIEQLKYAEEKVKEAGLQDRITFKLCDYRQLSDVQKYDRIVSCEMLEH  296

Query  2542  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2721
             VGHEFM  FF  C++   E+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+R
Sbjct  297   VGHEFMETFFSHCDA--XEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLAR  354

Query  2722  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2901
             VTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ QI DLGFD KFIRTWEYY+DY
Sbjct  355   VTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQKQITDLGFDNKFIRTWEYYYDY  414

Query  2902  CAAGFHTCTLGDYQ  2943
             CAAGF T TLGDYQ
Sbjct  415   CAAGFKTRTLGDYQ  428



>gb|EMS56688.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=624

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/795 (44%), Positives = 447/795 (56%), Gaps = 180/795 (23%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLD---NGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             M+E  E LGV+ME SDMSFSVS     +  G EW + NG S L AQK N+L   FW+M+R
Sbjct  1     MVEWLEGLGVEMERSDMSFSVSTQPDGSNRGCEWCNGNGISSLLAQKANILKTSFWRMLR  60

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFKND L+                   F+  +    L  K     +  S+ S     
Sbjct  61    EIFKFKNDALA-------------------FLSVQACGHLHHK-----LIKSLQS-----  91

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
                                QLF  PQ  TVK R  S+V+K                    
Sbjct  92    -------------------QLFCYPQLPTVKARLQSFVDK-------------------G  113

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             ++     +AG  V+ +  +  +E YD  I+  HAP+ LK+LG +AT  ELRILGA QY+ 
Sbjct  114   LNNATIAAAGYRVLENDGS--EETYDSVILGVHAPNALKVLGAEATHHELRILGACQYIQ  171

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1482
              DIYLH +Q+ MP+N + WSAWNFLGT +    +TYWLN +QN+                
Sbjct  172   RDIYLHCDQNLMPQNSSTWSAWNFLGTTSRGFSVTYWLNRIQNI---------------R  216

Query  1483  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1662
              +  L+ W  GH                                GFHEDGLKAG  AA G
Sbjct  217   SQMSLVPWIAGH--------------------------------GFHEDGLKAGKAAAQG  244

Query  1663  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1842
             LL K+C  L NP  M+PSW E G RLLV RF   FI  G++IL+EEGG+V  F     K 
Sbjct  245   LLGKKCQLLQNPKQMIPSWTEAGTRLLVARFFNQFISIGNLILVEEGGSVLNFGKACDKC  304

Query  1843  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2022
              +K ++RVH P FYWKVAT+ +LGLA+AYI+G  SF+DK+EGLLNL   F++N   S  +
Sbjct  305   RIKSVMRVHDPLFYWKVATEGNLGLAEAYINGCFSFLDKREGLLNL---FLSNDFFSLFL  361

Query  2023  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2202
              +S         + ++ A+   +     +++Q  L                  SL +D+ 
Sbjct  362   DKS---------MTYSCAVFKMENESLEVAQQRKL------------------SLLIDKA  394

Query  2203  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2382
                                           K+ + HH+L+IG GWGSLAI+AV++TGCKY
Sbjct  395   ------------------------------KVKRGHHVLDIGSGWGSLAIQAVKQTGCKY  424

Query  2383  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2562
             TG+TLS +Q KYAE KVREAGL+DNI F+LCDYRQ+P  C+YD IISC M+E VGHE+M+
Sbjct  425   TGVTLSAEQHKYAERKVREAGLEDNISFMLCDYRQIPP-CKYDAIISCGMIEHVGHEYMD  483

Query  2563  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2742
             EFF  CES LAE+GILVLQFIS PDERY++YR+ +DFIKEYIFPGGCLPSL RV SAM  
Sbjct  484   EFFACCESYLAEDGILVLQFISAPDERYEQYRRRTDFIKEYIFPGGCLPSLGRVVSAMTT  543

Query  2743  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2922
             SSR C+EH+E+IG HYY TL  WR NF+  + Q+L LGFD+KF+R WE+Y  Y AAGF +
Sbjct  544   SSRFCIEHVENIGPHYYTTLMHWRDNFMTNKDQVLALGFDEKFMRIWEFYLIYSAAGFKS  603

Query  2923  CTLGDYQIVFSRPGN  2967
               +GDYQ+VFSRPGN
Sbjct  604   RAVGDYQVVFSRPGN  618



>ref|XP_005824669.1| hypothetical protein GUITHDRAFT_165417 [Guillardia theta CCMP2712]
 gb|EKX37689.1| hypothetical protein GUITHDRAFT_165417 [Guillardia theta CCMP2712]
Length=1146

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/889 (40%), Positives = 512/889 (58%), Gaps = 80/889 (9%)
 Frame = +1

Query  406   RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT-VTLDGVDLDLGFMVFNRVT  582
             RVA++G+GISGL +A+++ K G  V +YE EDY GGH  T  T+ GV +DLGF VFNR T
Sbjct  8     RVAIIGSGISGLAAAWLMQKSGWKVTLYEAEDYFGGHTLTDETIPGVPVDLGFQVFNRTT  67

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             Y +  +  E+LGVD E SDMSF++S+D+G   EWGS N  S +FAQ++NL++P F  MIR
Sbjct  68    YGHFEQFLEALGVDSEESDMSFALSVDDGK-VEWGSHN-LSTIFAQRRNLVSPKFLLMIR  125

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             ++L+F  +    L E +   DM    TLGE++K  GYSE F   Y++PMCA++WS S++ 
Sbjct  126   DVLRFGKEAPKVLVE-EQYADM----TLGEYLKKEGYSEGFTYWYLLPMCAAVWSVSNKQ  180

Query  943   VMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHS  1122
              M FS   ++ F  NHHLL+L  RP+W  VK RS SYV KV E L+    + R  C V S
Sbjct  181   CMEFSIRVMIRFWVNHHLLELIERPKWRVVKDRSRSYVRKVVEILQ----DARSSCAVRS  236

Query  1123  VSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVY  1302
             V        G  V +  +    E +D  I A H+  T+K+LG   + +E  IL    Y  
Sbjct  237   VV-----RKGDKVEVRDEQGKCEEFDHVIFATHSDVTMKILGGDISKEEEAILKGIPYAE  291

Query  1303  SDIYLHREQSFMPRNLAAWSAWNFLGTV--------NNRVCLTYWLNTLQNLGDTKQPYL  1458
             +D+YLHR+ S MPR    W++WN L           +  VC++YW+N+LQ L +      
Sbjct  292   NDVYLHRDPSLMPRERKVWASWNCLDMTELNKDAPSDRAVCVSYWVNSLQRLPEGTGDLF  351

Query  1459  VTLNPPRTP--EQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDG  1632
             VTLNPP  P  E+ +      HPV S A+ ++   L++IQG +R WFCGA+ GYGFHEDG
Sbjct  352   VTLNPPHAPAEEKTVKHLKLSHPVFSGASKKSQETLDKIQGVKRTWFCGAWCGYGFHEDG  411

Query  1633  LKAGMIAAHGLLKKRCSPLNNPNHMVPSW---PETGARLLVTRFLAS--------FIVTG  1779
             +K+ +     +             M+P W   P +    L+TRF+ S         I  G
Sbjct  412   MKSAVNVVEKM-----------GGMIP-WVPRPTSPYMPLLTRFVCSSVHRFAGRAIKRG  459

Query  1780  SIILLEEGGTVFTF----------EGTDKKN----LLKVLVRVHSPQFYWKVATQADLGL  1917
             S+ L+   GT   +          EG D+K     +    VRV   +F+ ++A   D+GL
Sbjct  460   SLRLIMPNGTEVVYGNPEQKYVEEEGGDEKKGRREVYHSRVRVFDCKFFHRIAKDTDIGL  519

Query  1918  ADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYF  2097
              ++Y++G+     + + L N   +   N +   S+ +S     W         I +    
Sbjct  520   GESYMNGEF----EPDDLTNFLNVLTQNVEEFNSLQKSLGVLNW---------IGTQVQT  566

Query  2098  IRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISL  2277
             + H++R NT+  + +NI+ HYDL N+++ LFLDET  YS  VF S  + L  +Q+ K+ L
Sbjct  567   MAHMARANTVEGSLKNINEHYDLGNDMYRLFLDETWMYSSGVFNSPQDTLYQSQLNKLDL  626

Query  2278  LIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDN  2457
             ++DK +++  HHI EIGCGWG  AI AVER GC+ TGIT+SE+Q  YA  KV E G+ D 
Sbjct  627   ILDKLELNSGHHIFEIGCGWGGFAIRAVERFGCRVTGITISEEQFSYATAKVEERGMSDR  686

Query  2458  IRFLLCDYRQLPDNC--RYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISI  2631
             I  L CDYR+LP     ++DR++S EM+EAVGHE + E+FG  E +L   G  V+Q I+ 
Sbjct  687   ITILFCDYRKLPAELLGKFDRLVSIEMIEAVGHENLGEYFGVIEQLLVPGGKAVIQAITY  746

Query  2632  PDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCW  2811
              DE Y EY + SDFI+ +IFPGG LPS+  +  A   SS  C +H+EDIG+HY +TL+ W
Sbjct  747   KDEHYMEYCRCSDFIRRHIFPGGHLPSMGAMLGATRNSSLFC-QHVEDIGLHYARTLKMW  805

Query  2812  RANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSR  2958
               N+   + +I  LG+  +F R W +YF YC AGF    + +YQIV+ +
Sbjct  806   HENWTGAEDKIKKLGYSDEFYRKWRFYFSYCEAGFQLQFIHNYQIVWCK  854



>ref|XP_006299255.1| hypothetical protein CARUB_v10015414mg [Capsella rubella]
 gb|EOA32153.1| hypothetical protein CARUB_v10015414mg [Capsella rubella]
Length=424

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/429 (67%), Positives = 336/429 (78%), Gaps = 20/429 (5%)
 Frame = +1

Query  1699  NHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQ  1878
              HM  S  +T ARL VTRFL  FI  G +++LE G  +F F   D    LK ++++H PQ
Sbjct  2     QHMFLSLTQTVARLFVTRFLGQFISIGCVMILE-GERMFVFGEKDSTCSLKSILKIHCPQ  60

Query  1879  FYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTP  2058
             FYWKV TQADLGLADAYI GD SFVDK  GLLNL                     GWWTP
Sbjct  61    FYWKVMTQADLGLADAYISGDFSFVDKDSGLLNLI-------------------MGWWTP  101

Query  2059  LLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSED  2238
             +  T+ +ASAKY+++H+SRQNTLTQAR+NIS HYDLSNE FSLF+D+TM YS AVFKSE+
Sbjct  102   MFLTAGLASAKYYLKHVSRQNTLTQARKNISCHYDLSNEFFSLFMDDTMMYSSAVFKSEN  161

Query  2239  EDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKY  2418
             ED +TAQMRKISLLI+KA+I + H +LE+GCGWG+LAIE V+RTGCKY GITLS +QLKY
Sbjct  162   EDPRTAQMRKISLLIEKARIERNHEVLEMGCGWGTLAIEVVKRTGCKYNGITLSIEQLKY  221

Query  2419  AEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAE  2598
             AE K +EAGLQD I F LCDYRQL D  +YDRII+CEM+EAVGHEFM +FF  CE+ LA+
Sbjct  222   AETKAKEAGLQDQITFELCDYRQLSDARKYDRIIACEMIEAVGHEFMEKFFSCCEAALAQ  281

Query  2599  NGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDI  2778
             NGI VLQF +IP++ YDE R SS FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+ 
Sbjct  282   NGIFVLQFTAIPEKLYDESRLSSGFITEYIFPGGCLPSLARVTSAMASSSRLCIENVENF  341

Query  2779  GIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSR  2958
             GIHYY TLRCWR NFLERQ QI+DLGFD KFIRTWEYYFDYCAAGF T TL +YQIVFSR
Sbjct  342   GIHYYHTLRCWRKNFLERQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLKNYQIVFSR  401

Query  2959  PGNVTAFGD  2985
             PGN+ AFGD
Sbjct  402   PGNLAAFGD  410



>ref|XP_004307321.1| PREDICTED: probable fatty acid methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=433

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/437 (66%), Positives = 347/437 (79%), Gaps = 5/437 (1%)
 Frame = +1

Query  1705  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSP-QF  1881
             M  +  E  +RL VT+FL  ++ TG +IL E+GGTV TFEGT K   LK +++VH P QF
Sbjct  1     MASAILERVSRLYVTKFLRQYVSTGCLILSEDGGTVETFEGTKKGCSLKCVLQVHDPAQF  60

Query  1882  YWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPL  2061
             YWKV T+ADLGLADAYI+GD S  DK +GL NLF I  ANRD ++ +S+ N  R      
Sbjct  61    YWKVMTRADLGLADAYINGDFSLADKDKGLENLFTILNANRDSTSPLSKLNKIR----RR  116

Query  2062  LFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDE  2241
             L  + ++ A+Y   H S QNTLT ARRN+SRHYDLSN LFSLFLDETM+YS  VFK +DE
Sbjct  117   LLEACLSPARYLFHHGSGQNTLTVARRNVSRHYDLSNALFSLFLDETMSYSTVVFKKDDE  176

Query  2242  DLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYA  2421
             DLKT Q+RKI  LIDKA+I+K H +LE+GCGWG LAIE V++TGC+YTGITLS++QL++A
Sbjct  177   DLKTGQLRKIKTLIDKARITKNHEVLEVGCGWGGLAIEVVKQTGCRYTGITLSKEQLQFA  236

Query  2422  EDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAEN  2601
             E +V++AGL++NI+FLLCDYR LP N +YDRI+SCEM+E VGHE+M EFF  C+S LAEN
Sbjct  237   EQRVKDAGLEENIKFLLCDYRTLPKNYKYDRIVSCEMVEHVGHEYMEEFFACCDSALAEN  296

Query  2602  GILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIG  2781
             G+LVLQF S+PDE YDEYR+   FI+EYI PGGCLPSLSR+T+AMAASSRL VEHLE+IG
Sbjct  297   GLLVLQFTSLPDELYDEYRRCPSFIREYILPGGCLPSLSRLTAAMAASSRLSVEHLENIG  356

Query  2782  IHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRP  2961
              HYY+TL+ WR NFLE+QS+I  LGFD KFIRTWEYYFDYCAAGF+ CTLG+YQIVFSRP
Sbjct  357   SHYYRTLKYWRKNFLEKQSEIQALGFDDKFIRTWEYYFDYCAAGFNACTLGNYQIVFSRP  416

Query  2962  GNVTAFGDPYKGLASAY  3012
             GNV    DPYKG  SAY
Sbjct  417   GNVVLLNDPYKGFPSAY  433



>ref|NP_188990.4| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AEE76769.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=447

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/443 (64%), Positives = 345/443 (78%), Gaps = 2/443 (0%)
 Frame = +1

Query  1645  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1824
             M+ A GLL  + + + N  HMV S  E GARL VTRF   FI  G + +LE G T+F F 
Sbjct  1     MVIARGLLGIQTTLVKNMQHMVFSLTEAGARLFVTRFFRQFISIGCVTILE-GDTIFIFG  59

Query  1825  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2004
               +    LK ++++HSPQFYWKV T ADLGLADAYI+GD SFVDK  GLLNL  I +ANR
Sbjct  60    ENESTCPLKSILKIHSPQFYWKVMTLADLGLADAYINGDFSFVDKDSGLLNLIMILIANR  119

Query  2005  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2184
             DL++  S    KRGWWTP+  T+++ASA Y+++H+ RQNTLTQARRN+S HYDLSNE F 
Sbjct  120   DLNSRKSNLAKKRGWWTPVFLTASLASATYYLKHVCRQNTLTQARRNVSSHYDLSNEFFG  179

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2364
             LF+D+TM YS AVFKSE+E+L+TAQMRKI LLI+K K  + + +LEIGCGWG+LAIE V+
Sbjct  180   LFMDDTMMYSSAVFKSENENLRTAQMRKIHLLIEKDK-EEPYEVLEIGCGWGTLAIEVVK  238

Query  2365  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2544
             RTGCKYTG TLS +QLKY E+KV+EAGLQ+ I F LCDYRQL D  +YDRIISCEM+E V
Sbjct  239   RTGCKYTGFTLSIEQLKYVEEKVKEAGLQERITFKLCDYRQLCDTQKYDRIISCEMIEHV  298

Query  2545  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2724
             GH+FM  FF  CE+ LAE+GI VLQF +IP+E YDE R +S FI EYIFPGGCLPSL+RV
Sbjct  299   GHKFMETFFSHCEAALAEDGIFVLQFTAIPEELYDESRLTSGFITEYIFPGGCLPSLARV  358

Query  2725  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2904
             TSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ QI+DLGFD+KF+RTWEYYFDYC
Sbjct  359   TSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQKQIIDLGFDEKFLRTWEYYFDYC  418

Query  2905  AAGFHTCTLGDYQIVFSRPGNVT  2973
             AAGF T TL +YQ+  +    +T
Sbjct  419   AAGFKTLTLRNYQVTHTHSSTLT  441



>ref|XP_006658552.1| PREDICTED: uncharacterized protein LOC102715408 [Oryza brachyantha]
Length=764

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/443 (67%), Positives = 364/443 (82%), Gaps = 4/443 (1%)
 Frame = +1

Query  1693  NPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHS  1872
             NP  M PSW E GARLLVTRFL  ++  G+  LLEEGGT+++F    K+   K ++RVH 
Sbjct  322   NPKQMAPSWTEAGARLLVTRFLDGYVSAGNFTLLEEGGTMYSFGEAGKRCQAKCVMRVHD  381

Query  1873  PQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSK-RGW  2049
             P FYWKVAT+ADLGLADAYI+G  SFVDKK+GLLNL  I +ANRD +   S S+SK RGW
Sbjct  382   PLFYWKVATEADLGLADAYINGYCSFVDKKQGLLNLLLILIANRDSNKQSSISSSKIRGW  441

Query  2050  WTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK  2229
             WTP+L T+ +ASAKYF+RH+SR+NT+TQ RRNIS+HYDLSN+ FSLFLD +MTYSCAVFK
Sbjct  442   WTPMLLTAGVASAKYFLRHVSRKNTVTQTRRNISQHYDLSNDFFSLFLDPSMTYSCAVFK  501

Query  2230  SEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQ  2409
              E+E L+ AQ RK+SLLI KA++ ++HH+LEIG GWG LAI+ V++TGCKYTG+TLSE+Q
Sbjct  502   DEEESLEAAQQRKVSLLIHKARVERDHHVLEIGSGWGRLAIQVVKQTGCKYTGVTLSEEQ  561

Query  2410  LKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESV  2589
             LKY + KV+EAGL+D++ F+LCDYRQ+P + +YDRIISCEM+E VGHE+M+EFFG CES+
Sbjct  562   LKYCQRKVKEAGLEDHMTFMLCDYRQIPTSRKYDRIISCEMIEGVGHEYMDEFFGCCESL  621

Query  2590  LAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  2769
             LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSLSR+TSAM+ASSRLC+EHL
Sbjct  622   LAQDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLSRITSAMSASSRLCIEHL  681

Query  2770  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  2949
             E+IG HYY TL  WR NF+  + +I  LGFD KFIR WEYYF YCAAGF + TLG+YQIV
Sbjct  682   ENIGYHYYPTLIRWRDNFMVNREEISALGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIV  741

Query  2950  FSRPGN--VTAFGD-PYKGLASA  3009
             FSRPGN  +  F D PY    +A
Sbjct  742   FSRPGNDKLMPFADNPYTTFPAA  764


 Score =   409 bits (1052),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 236/306 (77%), Gaps = 9/306 (3%)
 Frame = +1

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGH-GYEWGSRNGFSGLFAQKKNLLNPYFW  750
             +VTYPNMME FE LGV+ME SDMSFSVS        EWGSRNG +GL AQK N ++P FW
Sbjct  2     QVTYPNMMEWFEELGVEMERSDMSFSVSTRGEEINVEWGSRNGLAGLLAQKSNAVSPAFW  61

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSC  930
             +MIREI+ FK+DVL Y+EE + NPD+DRN+TLG+FI+S GYS LFQ AY+IP+CA IWSC
Sbjct  62    RMIREIVYFKDDVLKYVEEHERNPDLDRNETLGQFIQSHGYSRLFQHAYLIPICACIWSC  121

Query  931   SSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1110
              S GV+ FSA+ +LSFCRNHHLLQLFGRPQWLTVK RSH+YVN+VREELE  GC+I+  C
Sbjct  122   PSHGVLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHTYVNRVREELESLGCQIKTSC  181

Query  1111  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1290
             EV SVS  + G  G  V+ +G +  +E YD  I A HAPD LK+LG  AT DE RILGAF
Sbjct  182   EVQSVSALDGG--GYRVVEAGGS--EEVYDRIIFAVHAPDALKILGDDATHDERRILGAF  237

Query  1291  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNL----GDTKQPYL  1458
             QYVYSDIYLH ++  MPRN +AWSAWNFLGT    VC+TYWLN LQN+    G  ++P+L
Sbjct  238   QYVYSDIYLHCDKRLMPRNPSAWSAWNFLGTTAAGVCVTYWLNLLQNIEESAGRGRRPFL  297

Query  1459  VTLNPP  1476
             VTLNPP
Sbjct  298   VTLNPP  303



>ref|XP_010532684.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X3 [Tarenaya hassleriana]
Length=389

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/384 (72%), Positives = 320/384 (83%), Gaps = 0/384 (0%)
 Frame = +1

Query  1858  VRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNS  2037
             +++HSPQFYWKV T+AD+GLADAYI GDISF DK EGLLNL  I +ANRDL++S S    
Sbjct  1     MKIHSPQFYWKVMTEADIGLADAYISGDISFADKDEGLLNLIVILIANRDLNSSKSNLAE  60

Query  2038  KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSC  2217
             KR WW P+ FT+ +ASAKYF++H+ R+NTLTQARRNIS HYDLSNELF+LF+DETM YSC
Sbjct  61    KRRWWKPMFFTAGLASAKYFLKHVFRKNTLTQARRNISDHYDLSNELFALFMDETMAYSC  120

Query  2218  AVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITL  2397
             AVFKS+DEDL+TAQ RKISLLIDKA+I K H +LEIGCGWG+LAIE V RTGCKYTGITL
Sbjct  121   AVFKSDDEDLRTAQTRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTGCKYTGITL  180

Query  2398  SEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGR  2577
             S +QLKYAE KV+E GL+D I F L DYRQL D+ +YDRIISCEM+EAVGH+FM  FF R
Sbjct  181   SIEQLKYAEAKVKEEGLEDRITFELRDYRQLSDSRKYDRIISCEMIEAVGHKFMETFFNR  240

Query  2578  CESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC  2757
             CES LAE G+LVLQF ++PD RYDE R S  FI EYIFPG C PSL+RVTSAMA+SSRLC
Sbjct  241   CESALAEEGLLVLQFSAVPDSRYDESRLSPGFITEYIFPGACHPSLARVTSAMASSSRLC  300

Query  2758  VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGD  2937
             +EH+E+IGIHY++TLRCWR NFL+RQ ++  +GFD+KFIR WEYYFDYCAAGF T  L  
Sbjct  301   IEHVENIGIHYHKTLRCWRQNFLKRQEEVKAIGFDEKFIRKWEYYFDYCAAGFKTLALEV  360

Query  2938  YQIVFSRPGNVTAFGDPYKGLASA  3009
             YQ+VFSRPGN T FGDPY    SA
Sbjct  361   YQVVFSRPGNTTMFGDPYMSYPSA  384



>gb|KDO54091.1| hypothetical protein CISIN_1g0146251mg, partial [Citrus sinensis]
Length=389

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/408 (67%), Positives = 337/408 (83%), Gaps = 21/408 (5%)
 Frame = +1

Query  1789  LLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEG  1968
             LLEEGGT+FTFEGT + + LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK EG
Sbjct  1     LLEEGGTIFTFEGTLRNSPLKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKDEG  60

Query  1969  LLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNI  2148
             LLNLF I +AN+D  +S S+   KRGWW+P+ FT++IASAKYF R+ISR+N+LTQARRN+
Sbjct  61    LLNLFLIVIANQDFDSSTSKLKKKRGWWSPMFFTASIASAKYFFRNISRKNSLTQARRNV  120

Query  2149  SRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIG  2328
             SRHYDLS                     E EDL+  QMRKIS+LI+KA++SK   +L+IG
Sbjct  121   SRHYDLS---------------------EHEDLEVGQMRKISVLIEKARVSKGQEVLDIG  159

Query  2329  CGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRY  2508
             CGWG+LAIE V++TGCKYTGITLS++QLKYA+ KVREAGLQD+IRF LCDYRQLP   +Y
Sbjct  160   CGWGTLAIEIVKQTGCKYTGITLSKEQLKYAQIKVREAGLQDHIRFYLCDYRQLPKANKY  219

Query  2509  DRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYI  2688
             DRIISCEM+E VGH++M EFF  CES+LA++G+LVLQF S PD+ YDEYR S  F+ EYI
Sbjct  220   DRIISCEMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYDEYRLSPGFLNEYI  279

Query  2689  FPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKK  2868
             FPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS+IL LGF++K
Sbjct  280   FPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQSEILALGFNEK  339

Query  2869  FIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3012
             FIRTWEYYFDYCAA F +  +G+YQIVFSRPG+V AF +PY+GL SAY
Sbjct  340   FIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGDVAAFSNPYEGLPSAY  387



>ref|XP_007035240.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06166.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=461

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/442 (65%), Positives = 352/442 (80%), Gaps = 1/442 (0%)
 Frame = +1

Query  1690  NNPNH-MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRV  1866
             ++P H M  S  ET AR +V +F   FI TG +ILLE+ GTV TF G+ +K  LKV+++V
Sbjct  18    SDPRHIMALSLMETVARHIVIKFFERFISTGCVILLEKEGTVLTFTGSMEKCSLKVVLKV  77

Query  1867  HSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRG  2046
             H+PQFYWK+ T+ADLGLADAYIHGD SF DK++GLLNL  I +ANR+ ++S S    KRG
Sbjct  78    HNPQFYWKIMTEADLGLADAYIHGDFSFEDKEDGLLNLILILIANRESNSSASGLIKKRG  137

Query  2047  WWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVF  2226
             WWTP LFT++I+SAKYF++ + RQNTLTQARRNISRHYD SNELF  F+DETM YS A+F
Sbjct  138   WWTPALFTASISSAKYFLKQVLRQNTLTQARRNISRHYDQSNELFESFMDETMQYSAAIF  197

Query  2227  KSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQ  2406
             K+ED+DLK AQ+RKI+ LIDKA+I K H ++E G GWG  AIE V+RTGCKYTG+TLSE+
Sbjct  198   KAEDDDLKVAQLRKITSLIDKARIEKWHEVIEFGSGWGYFAIEVVKRTGCKYTGVTLSEE  257

Query  2407  QLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCES  2586
             QLKYAE KV+EAGLQDNI+FLLCDYRQLP  C+YDRIISCEM E VG+E++ EFF  CES
Sbjct  258   QLKYAEAKVKEAGLQDNIKFLLCDYRQLPKTCKYDRIISCEMSEHVGNEYIEEFFRCCES  317

Query  2587  VLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  2766
             +LA++G+ VLQF S+ +  Y EY +S  F KEYIFPG CL SL+R+ SAMA +SRL VEH
Sbjct  318   ILAKDGLFVLQFTSVTEGLYHEYLRSPGFAKEYIFPGACLLSLTRILSAMATASRLSVEH  377

Query  2767  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  2946
             +E+IG +Y QTL+ WR NFL+ +S+IL LGFD+KF RTWEY+FDY AAGF + TL  YQ+
Sbjct  378   VENIGSNYVQTLKGWRKNFLKNKSKILALGFDEKFTRTWEYFFDYAAAGFKSRTLETYQV  437

Query  2947  VFSRPGNVTAFGDPYKGLASAY  3012
             VFSRPGN  A GDPY+G  SAY
Sbjct  438   VFSRPGNFAALGDPYQGFPSAY  459



>ref|XP_007035218.1| Cyclopropane fatty acid synthase isoform 2 [Theobroma cacao]
 gb|EOY06144.1| Cyclopropane fatty acid synthase isoform 2 [Theobroma cacao]
Length=412

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/430 (65%), Positives = 341/430 (79%), Gaps = 21/430 (5%)
 Frame = +1

Query  1723  ETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQ  1902
             ET AR +V +F   +I TG +ILLEE GTV TF G+ +K  LKV+++VH+PQFYWK+ T+
Sbjct  2     ETMARHIVIKFFEQYISTGCVILLEEEGTVLTFTGSMEKCSLKVVLKVHNPQFYWKIMTE  61

Query  1903  ADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIA  2082
             ADLGLADAYI GD SF DK+EGLLNLF IF+ANR   +S S  N KRGWW P LFT++I+
Sbjct  62    ADLGLADAYIQGDFSFEDKEEGLLNLFLIFIANRVSDSSASGLNKKRGWWAPALFTASIS  121

Query  2083  SAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQM  2262
             SAKYF++H+ RQNTL QARRNISRHY+L+                     E+EDLK AQ+
Sbjct  122   SAKYFLKHVLRQNTLIQARRNISRHYNLA---------------------ENEDLKVAQL  160

Query  2263  RKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREA  2442
             RKIS LIDKA+I K H +++IGCGWG  AIE V+RTGCKYTG+TLSE+QLKYAE KV+EA
Sbjct  161   RKISSLIDKARIEKGHEVIDIGCGWGYFAIEVVKRTGCKYTGVTLSEEQLKYAEAKVKEA  220

Query  2443  GLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQF  2622
             GLQDNIRFLLCDYRQLP+  +YDRIISCEM+E VG+E++ EFF  CES+LA++G+ VLQF
Sbjct  221   GLQDNIRFLLCDYRQLPETGKYDRIISCEMIEHVGNEYIEEFFRCCESILAKDGLFVLQF  280

Query  2623  ISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTL  2802
             IS+ +E++ E+ +S  F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTL
Sbjct  281   ISMTEEQFPEHLRSPGFVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTL  340

Query  2803  RCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG  2982
             RCWR NFLE +S+IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A G
Sbjct  341   RCWRKNFLENKSKILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALG  400

Query  2983  DPYKGLASAY  3012
             DPY+G   AY
Sbjct  401   DPYQGFPLAY  410



>ref|XP_010670965.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=436

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/437 (64%), Positives = 346/437 (79%), Gaps = 4/437 (1%)
 Frame = +1

Query  1705  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1884
             M  S  E+ ARL VTRFL  FI  G++ LLE+ GTV TFEG+ K   L V++++H+PQFY
Sbjct  1     MALSLTESAARLSVTRFLKDFISAGTLTLLEKDGTVLTFEGSLKICPLSVVIKIHNPQFY  60

Query  1885  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2064
             WKVAT+ADLG ADAYIHGD SF+DK EGL+N+  IF+A +DL +S S   +K  W T L 
Sbjct  61    WKVATEADLGFADAYIHGDFSFIDKDEGLVNIIMIFIACKDLQSSASIV-TKWDWLTSLF  119

Query  2065  -FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDE  2241
              F++ I SAKY  R+  R+NTLTQARRNISRHYD+SNE+FSLF+DETM YSCA+ KSE+E
Sbjct  120   SFSAWIISAKYIYRNFCRRNTLTQARRNISRHYDMSNEMFSLFMDETMMYSCAIHKSENE  179

Query  2242  DLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYA  2421
             DLK AQMRKISLLI+KA++ + H +LEIG GWG  AIE V++TGCKYTG+TLS++QLK+A
Sbjct  180   DLKVAQMRKISLLIEKARVEQHHEVLEIGSGWGIFAIELVKKTGCKYTGLTLSKEQLKFA  239

Query  2422  EDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAEN  2601
             EDKV++AGL+D I+FLLCDYR+L D  +YDRII+CEM+EAVG E++ EFF  C+S L  N
Sbjct  240   EDKVKKAGLEDRIKFLLCDYRELKDVNKYDRIIACEMIEAVGDEYIEEFFRCCDSSLTTN  299

Query  2602  GILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIG  2781
             G+LVLQF ++ DE Y+++R+   FI EYIFPGG L SLSRVTSAM  +S+L VEH+E+IG
Sbjct  300   GLLVLQFTAVRDEGYEKFRKCPGFIPEYIFPGGHLFSLSRVTSAMGTASKLSVEHVENIG  359

Query  2782  IHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRP  2961
              HYYQTLRCWR NFLE QS+IL LGF++KFI+TWEYYFDYCAAGF    L +YQIVFSR 
Sbjct  360   EHYYQTLRCWRKNFLENQSKILSLGFNEKFIQTWEYYFDYCAAGFKMRFLKNYQIVFSRR  419

Query  2962  GNVTAFGDPYKGLASAY  3012
             G  TAF DP   + SA+
Sbjct  420   G--TAFNDPSATIPSAH  434



>ref|XP_007035220.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06146.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=375

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/372 (70%), Positives = 315/372 (85%), Gaps = 0/372 (0%)
 Frame = +1

Query  1897  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2076
             T+ADLGLADAYI GD SF DK+EGLLNLF IF+ANR+  +S S  N KRGWW P LFT++
Sbjct  2     TEADLGLADAYIQGDFSFEDKEEGLLNLFLIFIANRESDSSASGLNKKRGWWAPALFTAS  61

Query  2077  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2256
             I+SAKYF++H+ RQNTL QARRNISRHY+LSNELF LFLDE M YS A+FK+E+EDLK A
Sbjct  62    ISSAKYFLKHVLRQNTLIQARRNISRHYNLSNELFELFLDEKMQYSSAIFKAENEDLKVA  121

Query  2257  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2436
             Q+RKIS LIDKA+I K H ++E G GWG  AIE V+RTGCKYTG+TLSE+QLKYAE KV+
Sbjct  122   QLRKISSLIDKARIEKGHEVIEFGSGWGYFAIEVVKRTGCKYTGVTLSEEQLKYAEAKVK  181

Query  2437  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2616
             EAGLQDNI+FLLCDYRQLP+  +YDRIISCEM+E VG+E++ EFF  CES+LA++G+ VL
Sbjct  182   EAGLQDNIKFLLCDYRQLPETGKYDRIISCEMIEHVGNEYIEEFFRCCESILAKDGLFVL  241

Query  2617  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2796
             QFIS+ +E++ EY +S  F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y Q
Sbjct  242   QFISMTEEQFPEYLRSPGFVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQ  301

Query  2797  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  2976
             TLRCWR NFLE +S+IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A
Sbjct  302   TLRCWRKNFLENKSKILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAA  361

Query  2977  FGDPYKGLASAY  3012
              GDPY+G  SAY
Sbjct  362   LGDPYQGFPSAY  373



>gb|EEE67149.1| hypothetical protein OsJ_24210 [Oryza sativa Japonica Group]
Length=719

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/411 (68%), Positives = 340/411 (83%), Gaps = 4/411 (1%)
 Frame = +1

Query  1789  LLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEG  1968
             LLEEGGT+F+F    KK   K ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDKK+G
Sbjct  309   LLEEGGTMFSFGEAGKKCQAKCVMRVHDPLFYWKVATEADLGLADAYINGYCSFVDKKQG  368

Query  1969  LLNLFKIFVANRDLSASVSRSNSK-RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRN  2145
             LLNL  I +ANRD +   S S S+ RGWWTP+L T+ +ASAKYF+RH+SR+NT+TQ R+N
Sbjct  369   LLNLLLILIANRDANKQSSTSTSRIRGWWTPMLLTAGVASAKYFLRHVSRKNTVTQTRQN  428

Query  2146  ISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEI  2325
             IS+HYDLSN+ FSLFLD +MTYSCAVFK EDE L+ AQ RK+SLLI KA++ ++HH+LEI
Sbjct  429   ISQHYDLSNDFFSLFLDPSMTYSCAVFKDEDESLEAAQQRKVSLLIHKARVERDHHVLEI  488

Query  2326  GCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCR  2505
             G GWGSLAI+ V++TGCKYTG+TLSE+QLKY + KV+EAGL+D++ FLLCDYRQ+P   +
Sbjct  489   GSGWGSLAIQVVKQTGCKYTGVTLSEEQLKYCQRKVKEAGLEDHMTFLLCDYRQIPTVRK  548

Query  2506  YDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEY  2685
             YDRIISCEM+E VGHE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR+SSDFIKEY
Sbjct  549   YDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFIKEY  608

Query  2686  IFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDK  2865
             IFPGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + +I  LGFD 
Sbjct  609   IFPGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANREEIKSLGFDD  668

Query  2866  KFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  3009
             KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  669   KFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  719


 Score =   419 bits (1078),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 209/309 (68%), Positives = 246/309 (80%), Gaps = 14/309 (5%)
 Frame = +1

Query  406   RVAVVGAGISGLVSAYVLAKGGAGVVV--YEKEDYLGGHAKTVTLDG----VDLDLGFMV  567
             RVAVVGAG+SGL +A+  A+GG GV V  YE+ED LGGHA+TV +DG    VDLDLGFMV
Sbjct  3     RVAVVGAGVSGLAAAHEAARGGGGVRVTLYEREDSLGGHARTVAVDGDAGPVDLDLGFMV  62

Query  568   FNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNG--HGYEWGSRNGFSGLFAQKKNLL  735
             FNRVTYPNMME FE LGV+ME+SDMSFSVS  L +G     EWGSRNG +GL AQK N +
Sbjct  63    FNRVTYPNMMEWFEELGVEMELSDMSFSVSAQLQDGDEQTMEWGSRNGLAGLLAQKTNAV  122

Query  736   NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             +P FW+MIREILKFK+DVL+YLEE D NPD+DRN+TLG F++S GYS LFQ+AY++P+CA
Sbjct  123   SPAFWRMIREILKFKDDVLTYLEEHDKNPDLDRNETLGHFVQSHGYSRLFQQAYLVPICA  182

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCE  1095
              IWSC S+GV+ FSA+ +LSFCRNHHLLQLFGRPQWLTVK RSH+YVN+VREELE  GC+
Sbjct  183   CIWSCPSQGVLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHTYVNRVREELESLGCQ  242

Query  1096  IRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELR  1275
             I+ GCEV SVS  E G  G  V+ +G    +EAYD  I A HAPD L +LG +AT DE R
Sbjct  243   IKTGCEVQSVSALEGG--GYRVVEAGGT--EEAYDSIIFAVHAPDALNILGDEATHDERR  298

Query  1276  ILGAFQYVY  1302
             ILGAFQYVY
Sbjct  299   ILGAFQYVY  307



>ref|XP_005648777.1| cyclopropane fatty acid synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE24233.1| cyclopropane fatty acid synthase [Coccomyxa subellipsoidea C-169]
Length=1165

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/909 (39%), Positives = 496/909 (55%), Gaps = 70/909 (8%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             + RVAVVG+GI+GL +A++L + GA V +YE E   GGH  T    G  +DLGF V+N  
Sbjct  8     RKRVAVVGSGITGLSAAWLLHRSGASVTLYESESRCGGHTLTDDSPGYPVDLGFQVYNLT  67

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPN++ L E LGVD E SDMSF +S+D G   EWGSR G   +FAQ++NLL+P F +MI
Sbjct  68    TYPNLVGLLEELGVDTEPSDMSFGLSIDGG-ALEWGSR-GLGAIFAQRRNLLSPGFLRMI  125

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
              ++++F  +    L+      +     +LG++I+ +GYS  F   Y++PMCA++WS  + 
Sbjct  126   WDVIRFGREAPEVLKP--GTSEKYAQHSLGQYIREKGYSRAFVTQYLLPMCAAVWSVPNA  183

Query  940   GVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1119
              VM F    ++ F  NHHLL L  RP W  VK RS SYVNK+  +L     ++R    V 
Sbjct  184   QVMEFPVVMLVRFWANHHLLDLLQRPLWRVVKDRSRSYVNKILADLP----DVRTSAPVT  239

Query  1120  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1299
              V   E  S  G  ++     V E +D  I A H   TL  LG  A      +L A  Y 
Sbjct  240   RV---EPASGDGRAVVHAAGFVAEEFDAVIFATHTNTTLAALGSAAPEGVRPLLEAIPYG  296

Query  1300  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNN---------RVCLTYWLNTLQNLGDTKQP  1452
              +DIYLH +   MPR  A WS+WNFLG+ ++          VC+TYWLN LQ L      
Sbjct  297   TNDIYLHTDVDLMPRAHATWSSWNFLGSSSHAADPAADTAAVCVTYWLNNLQRLPPGAPD  356

Query  1453  YLVTLNPPRTP--EQCLLKWTTGHpvpsvaasrassELERIQ--------------GKRR  1584
               VTLNPPR P  E+ +      HPV S A+  A   L  +Q              GK  
Sbjct  357   TFVTLNPPRPPAAERTIRHLHLAHPVFSSASYEAQQRLPSVQARLPLSFVSLVLQSGKGG  416

Query  1585  IWFCGAYQGYGFHEDGLKAGMIAAHGL------LKKRCSP-LNNPNHMVPSWPETGARLL  1743
             I++ GA+ GYGFHEDGLKAGM AA  L           SP ++  +    S  +  AR  
Sbjct  417   IYYAGAWCGYGFHEDGLKAGMAAATALGATIPWTPHATSPKMSLADMFFMSTFDKFARRA  476

Query  1744  VTRFLASFIVTGS--IILLEEGGTVFTFEGTDK---KNLLKVLVRVHSPQFYWKVATQAD  1908
             ++     FI+     ++  ++     +    D+   K +L   VRV    F+ KV T+ D
Sbjct  477   ISLGRLRFILPNGEELVYGDDASAARSLPKEDEWMGKPVLCATVRVLRMAFFRKVITRHD  536

Query  1909  LGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASA  2088
              GL +AY+ GD   VD    LL           ++A+       RG    L   + I   
Sbjct  537   TGLGEAYMDGDF-LVDDLGALLA---------AVTANAGNIEGNRG---ALGILNRIGDW  583

Query  2089  KYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRK  2268
                + H +R NT+  +RRNI  HYD  N ++ LFLD ++TYS  + +  D  L+ AQM K
Sbjct  584   LLLLAHRARANTIEGSRRNIEEHYDAGNAMYKLFLDPSLTYSSGIHRPGDS-LEQAQMNK  642

Query  2269  ISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGL  2448
             +  L+  A I+K+ H+LEIGCGWGS+AI AV+ TGC++TG+T+S+QQL+    +V+ A L
Sbjct  643   LDALVSMAGITKDDHVLEIGCGWGSMAIRAVQTTGCRWTGLTVSKQQLEEGVARVKAADL  702

Query  2449  QDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFIS  2628
              D I  L CDYRQ      +D+++SCEM+EAVGHE +  +F     +L   G  V+Q IS
Sbjct  703   SDRITLLFCDYRQAAHLGPFDKVLSCEMIEAVGHENLPAYFDAISGLLKPGGQAVIQAIS  762

Query  2629  IPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR---LCVEHLEDIGIHYYQT  2799
              PDERY+ Y  SSDFI+E+IFPGG LPS+     AM  S+R   L VE   DIG HY  T
Sbjct  763   EPDERYEAYCASSDFIREHIFPGGHLPSM----GAMVDSARGTGLHVEECRDIGPHYAVT  818

Query  2800  LRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAF  2979
             LR WR  +   ++ IL LG+ +++ R + +YF YC A F    + ++QI +++  +  A 
Sbjct  819   LRAWRETWERERAAILSLGYSERYWRKFRFYFAYCEAAFDAKYIHNFQIRWAKATDHPA-  877

Query  2980  GDPYKGLAS  3006
              DP +  +S
Sbjct  878   ADPLQPSSS  886



>dbj|BAB01740.1| cyclopocyclopropane fatty acid synthase-like protein [Arabidopsis 
thaliana]
Length=436

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/443 (61%), Positives = 331/443 (75%), Gaps = 13/443 (3%)
 Frame = +1

Query  1645  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1824
             M+ A GLL  + + + N  HMV S  E GARL VTRF   FI  G + +LE G T+F F 
Sbjct  1     MVIARGLLGIQTTLVKNMQHMVFSLTEAGARLFVTRFFRQFISIGCVTILE-GDTIFIFG  59

Query  1825  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2004
               +    LK ++++HSPQFYWKV T ADLGLADAYI+GD SFVDK  GLLNL  I +ANR
Sbjct  60    ENESTCPLKSILKIHSPQFYWKVMTLADLGLADAYINGDFSFVDKDSGLLNLIMILIANR  119

Query  2005  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2184
             DL++  S    KRGWWTP+  T+++ASA Y+++H+ RQNTLTQARRN+S HYDLSNE F 
Sbjct  120   DLNSRKSNLAKKRGWWTPVFLTASLASATYYLKHVCRQNTLTQARRNVSSHYDLSNEFFG  179

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2364
             LF+D+TM YS AVFK   ++ ++          DK    + + +LEIGCGWG+LAIE V+
Sbjct  180   LFMDDTMMYSSAVFKVTIKNFQSE---------DK---EEPYEVLEIGCGWGTLAIEVVK  227

Query  2365  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2544
             RTGCKYTG TLS +QLKY E+KV+EAGLQ+ I F LCDYRQL D  +YDRIISCEM+E V
Sbjct  228   RTGCKYTGFTLSIEQLKYVEEKVKEAGLQERITFKLCDYRQLCDTQKYDRIISCEMIEHV  287

Query  2545  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2724
             GH+FM  FF  CE+ LAE+GI VLQF +IP+E YDE R +S FI EYIFPGGCLPSL+RV
Sbjct  288   GHKFMETFFSHCEAALAEDGIFVLQFTAIPEELYDESRLTSGFITEYIFPGGCLPSLARV  347

Query  2725  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2904
             TSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ QI+DLGFD+KF+RTWEYYFDYC
Sbjct  348   TSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQKQIIDLGFDEKFLRTWEYYFDYC  407

Query  2905  AAGFHTCTLGDYQIVFSRPGNVT  2973
             AAGF T TL +YQ+  +    +T
Sbjct  408   AAGFKTLTLRNYQVTHTHSSTLT  430



>ref|NP_001059618.1| Os07g0474600 [Oryza sativa Japonica Group]
 dbj|BAF21532.1| Os07g0474600, partial [Oryza sativa Japonica Group]
Length=390

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/389 (68%), Positives = 326/389 (84%), Gaps = 4/389 (1%)
 Frame = +1

Query  1855  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2034
             ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDKK+GLLNL  I +ANRD +   S S 
Sbjct  2     VMRVHDPLFYWKVATEADLGLADAYINGYCSFVDKKQGLLNLLLILIANRDANKQSSTST  61

Query  2035  SK-RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2211
             S+ RGWWTP+L T+ +ASAKYF+RH+SR+NT+TQ R+NIS+HYDLSN+ FSLFLD +MTY
Sbjct  62    SRIRGWWTPMLLTAGVASAKYFLRHVSRKNTVTQTRQNISQHYDLSNDFFSLFLDPSMTY  121

Query  2212  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2391
             SCAVFK EDE L+ AQ RK+SLLI KA++ ++HH+LEIG GWGSLAI+ V++TGCKYTG+
Sbjct  122   SCAVFKDEDESLEAAQQRKVSLLIHKARVERDHHVLEIGSGWGSLAIQVVKQTGCKYTGV  181

Query  2392  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2571
             TLSE+QLKY + KV+EAGL+D++ FLLCDYRQ+P   +YDRIISCEM+E VGHE+M++FF
Sbjct  182   TLSEEQLKYCQRKVKEAGLEDHMTFLLCDYRQIPTVRKYDRIISCEMIEGVGHEYMDDFF  241

Query  2572  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2751
             G CES+LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSLSR+TSAM+ SSR
Sbjct  242   GCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLSRITSAMSTSSR  301

Query  2752  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2931
             LC+EHLE+IG HYY TL  WR NF+  + +I  LGFD KFIR WEYYF YCAAGF + TL
Sbjct  302   LCIEHLENIGYHYYPTLIRWRDNFMANREEIKSLGFDDKFIRIWEYYFIYCAAGFKSRTL  361

Query  2932  GDYQIVFSRPGN--VTAFGD-PYKGLASA  3009
             G+YQIV SRPGN  +  F D PY    +A
Sbjct  362   GNYQIVLSRPGNDKLLPFADNPYATFPAA  390



>ref|XP_002183150.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC45368.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=949

 Score =   558 bits (1438),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 343/916 (37%), Positives = 498/916 (54%), Gaps = 67/916 (7%)
 Frame = +1

Query  394   LLKMRVAVVGAGISGLVSAYVLA-KGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVF  570
             L   +VA+VG G++GL +A+ L+   GA V ++E E  LGGHA T  +DGVD+D+GFMV+
Sbjct  10    LTDQKVAIVGGGVAGLSAAWHLSVNTGAHVQLFEAESRLGGHAYTTNVDGVDVDIGFMVY  69

Query  571   NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  750
             N   YPNM+E F +LGV  E SDMS SVSLD G   EW S +G  GLFA ++ L++P F+
Sbjct  70    NETNYPNMVEWFRTLGVTQEDSDMSLSVSLDGGDTVEWSS-DGLDGLFANRRQLVSPPFY  128

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSC  930
             + ++++++F     + L   D++P   ++ T  ++++  GYS  F K Y+ PM A++WS 
Sbjct  129   RFLKDMIRFNQQAANILLLTDDDPR--KHVTTAQYLREHGYSTEFAKFYVFPMMAALWSA  186

Query  931   SSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCE-IRCG  1107
             S E V+ F A  ++ F  NH +LQLF RPQW TV  RS  Y N V+  L   G E +   
Sbjct  187   SMEDVLRFPAAQLIGFLCNHKMLQLFDRPQWKTVAGRSQQYTNLVQSIL---GFEAVHLD  243

Query  1108  CEVHSVSTDEQGSAGGVVII-------SGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFD  1266
               VH V   E  +   V +        S   +    +D  + A H P    +L +  +  
Sbjct  244   TPVHKVEKLEDQTYRLVTLRKEDGEHGSATEVSLGVFDQVVFACHPPTAHDILQRSTSVS  303

Query  1267  E-------------LRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLT  1407
                           L++L   +Y  + +Y+H + S MP+   AW++WN +      V +T
Sbjct  304   NNPTNKEHQDHQLLLQLLAQIEYADNVVYVHSDPSLMPKRRHAWASWNCIHGRMKAVFVT  363

Query  1408  YWLNTLQNLGDTKQPYLVTLNPPRTPEQCLL--KWTTGHpvpsvaasrassELERIQGKR  1581
             YWLN LQNL +T +   V+LNP   PE  L   +    HP  +    +A  +L  +QGK 
Sbjct  364   YWLNRLQNL-ETDRDIFVSLNPHHAPEPALTHQRVILAHPQFNSKTLQAREKLGALQGKD  422

Query  1582  RIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVP-SWPETGARLLVTRFL  1758
              +WFCGA+ GYGFHEDG + G   A  +   R +        V    P    R L   F+
Sbjct  423   GLWFCGAWSGYGFHEDGCRDGFRVATAINHTRMTLWQALYQRVTYDLPVAICRQLSFYFM  482

Query  1759  ASFIVTGSIILLEEGGTVFTF-EGTDKK-NLLKVLVRVHSPQFYWKVATQADLGLADAYI  1932
                +  G + L    G+V +F +GT    +   V +RV  P F+ K+AT+ DLGLA +Y+
Sbjct  483   KQAVQMGRLRLKFNDGSVVSFGDGTPCGCDTSDVTIRVFDPWFFVKLATEYDLGLARSYM  542

Query  1933  HG-----DISFVDKKEGLLNLFKIFVANRDLSASVS----RSNSKRGWWTPLLFTSAIAS  2085
              G      I+  D   GL  LF + + NRD +A+ +    R+     +   L   S +  
Sbjct  543   AGHFIEATITLGDPI-GLTRLFLLLIGNRDDNAAKAHIPRRAGRGHKYANALSNASGLVL  601

Query  2086  AKY--FIRHISRQNTLTQARR-----NISRHYDLSNELFSLFLD-ETMTYSCAVFKSEDE  2241
             A+   F+ ++  + T+  + R     NI  HYDLSN+LF  FLD ET+ YS A++ +   
Sbjct  602   AQMGSFVNYLRYKLTMDNSERGGSLKNIHAHYDLSNDLFKTFLDKETLMYSSAIYDAVPA  661

Query  2242  -----------DLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTG  2388
                         L+ AQ RK+  L+D+A+I     +L+IG GWG L+I A ++ GCK TG
Sbjct  662   PRPHSGLVFRGSLEEAQWRKLDTLLDRAQIQPGQTVLDIGFGWGGLSIHAAKKYGCKVTG  721

Query  2389  ITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQL---PDNC-RYDRIISCEMLEAVGHEF  2556
             ITLS +Q   AE +V+E G++  I F + DYR       NC  +DR++SCEM+EAVGH  
Sbjct  722   ITLSVEQKALAEKRVKEEGIESLITFEVVDYRTFCARKSNCGMFDRVLSCEMIEAVGHGH  781

Query  2557  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2736
             + EFF   E VL  +G+LV++ I+ P+ERY+ Y +S+DFI   IFPG C PSL  +  A 
Sbjct  782   LVEFFWAVEQVLCRDGVLVMEAITTPEERYENYLRSTDFINTIIFPGSCCPSLHALVDAA  841

Query  2737  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2916
                S L +EH+++IG+HY QTL  WR  F   +  +  LGFD  F+R W YY  YC AGF
Sbjct  842   YRGSTLTLEHVDNIGLHYAQTLAEWRRRFNAEEPFVRQLGFDDVFLRAWNYYLTYCEAGF  901

Query  2917  HTCTLGDYQIVFSRPG  2964
              + T     +VF+RPG
Sbjct  902   FSQTENCLILVFARPG  917



>ref|NP_001189954.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AEE76770.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=492

 Score =   541 bits (1395),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 271/456 (59%), Positives = 327/456 (72%), Gaps = 27/456 (6%)
 Frame = +1

Query  1645  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1824
             M+ A GLL  + + + N  HMV S  E GARL VTRF   FI  G + +LE G T+F F 
Sbjct  1     MVIARGLLGIQTTLVKNMQHMVFSLTEAGARLFVTRFFRQFISIGCVTILE-GDTIFIFG  59

Query  1825  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2004
               +    LK ++++HSPQFYWKV T ADLGLADAYI+GD SFVDK  GLLNL  I +ANR
Sbjct  60    ENESTCPLKSILKIHSPQFYWKVMTLADLGLADAYINGDFSFVDKDSGLLNLIMILIANR  119

Query  2005  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2184
             DL++  S    KRGWWTP+  T+++ASA Y+++H                    SNE F 
Sbjct  120   DLNSRKSNLAKKRGWWTPVFLTASLASATYYLKH--------------------SNEFFG  159

Query  2185  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKE-HHILEIGCGWGSLAIEAV  2361
             LF+D+TM YS AVFK     +K  Q  K +    K +  +E + +LEIGCGWG+LAIE V
Sbjct  160   LFMDDTMMYSSAVFKV---TIKNFQNEKNTSFNRKGEDKEEPYEVLEIGCGWGTLAIEVV  216

Query  2362  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2541
             +RTGCKYTG TLS +QLKY E+KV+EAGLQ+ I F LCDYRQL D  +YDRIISCEM+E 
Sbjct  217   KRTGCKYTGFTLSIEQLKYVEEKVKEAGLQERITFKLCDYRQLCDTQKYDRIISCEMIEH  276

Query  2542  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2721
             VGH+FM  FF  CE+ LAE+GI VLQF +IP+E YDE R +S FI EYIFPGGCLPSL+R
Sbjct  277   VGHKFMETFFSHCEAALAEDGIFVLQFTAIPEELYDESRLTSGFITEYIFPGGCLPSLAR  336

Query  2722  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2901
             VTSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ QI+DLGFD+KF+RTWEYYFDY
Sbjct  337   VTSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQKQIIDLGFDEKFLRTWEYYFDY  396

Query  2902  CAAGFHTCTLGDYQIVFSRPGNVTAFG--DPYKGLA  3003
             CAAGF T TL +YQIVFSRPGNV AFG  DP+   A
Sbjct  397   CAAGFKTLTLRNYQIVFSRPGNVAAFGNDDPFHSSA  432



>ref|XP_007512428.1| cyclopropane-fatty-acyl-phospholipid synthase [Bathycoccus prasinos]
 emb|CCO17028.1| cyclopropane-fatty-acyl-phospholipid synthase [Bathycoccus prasinos]
Length=1056

 Score =   559 bits (1440),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 353/932 (38%), Positives = 498/932 (53%), Gaps = 102/932 (11%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGA-GVVVYEKEDYLGGHA----KTVTLDGVDLDLGFM  564
             K  V V+GAGISGL +AY+L +  A  V VYE E   GGHA    K+     +D+DLGF 
Sbjct  23    KQTVCVIGAGISGLSAAYLLHQSNAFAVTVYESEPTAGGHALTREKSKHAGELDVDLGFQ  82

Query  565   VFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPY  744
             VFN  TYP+++ LFE L V  E SDMSFS+  +     EWGS  G SG+FAQK+NL+NP 
Sbjct  83    VFNLTTYPHLVGLFEELRVKHEQSDMSFSLQSERT---EWGSL-GLSGIFAQKRNLINPK  138

Query  745   FWQMIREILKFK---NDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             FW MIREILKFK   +DVLS      +  +     TLGE+++  GYS+ F+  Y++PMCA
Sbjct  139   FWNMIREILKFKKVKHDVLS-----GSKKEYWEKKTLGEYLRENGYSDYFRDHYVLPMCA  193

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCE  1095
             +IWSC+ +  + F    +++F  NHHLL++F RP W  VK RS +YV  V + L   GC 
Sbjct  194   AIWSCNDKDALGFPLKPLITFWANHHLLEIFERPVWRVVKGRSKAYVEAVLKALPD-GC-  251

Query  1096  IRCGCEVHSVS---TDEQGSAGGVVIISGKN-----MVQEAYDGCIMAAHAPDTLKMLGK  1251
             ++ G  VH+V     D   S   V     K        +E +D  I A HA   L M+GK
Sbjct  252   VKTGRYVHTVHRYFDDASKSRIKVKTTETKKAATGEQTKEKFDHVIFACHAHQALAMIGK  311

Query  1252  QATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWN--FLGTV--NNRVCLTYWLN  1419
              AT  EL IL  F+   +++ LH +  FMP+N +AW++WN   +G    N+ VC+TYW+N
Sbjct  312   NATEKELEILSNFRTTRNEVVLHDDPQFMPKNRSAWASWNCKSIGKKGENDSVCVTYWVN  371

Query  1420  TLQNLGDTKQPYLVTLNPPRT--PEQCLLKWTTGHpvpsvaasrassELE-RIQGKRRIW  1590
              LQNL    +   VTLNP      E+   K   GHPV +  A +A  +L+ R+QG+   W
Sbjct  372   LLQNLPKGAKDVFVTLNPTEKIDEERVEFKKYLGHPVFNENAIKAQEDLKSRLQGENNTW  431

Query  1591  FCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWP----ETGARLLVTRFL  1758
             F GA+  YGFHEDG+ + +        + C  L   + +VP  P    E    LL + F+
Sbjct  432   FTGAWLRYGFHEDGIHSAV--------EMCKKLLGKDDVVPWMPRFDVEPKQSLLGSAFM  483

Query  1759  ASFIVTGSIILLEEGGTVFT------FEGTDKKNLLK-----VLVRVHSPQFYWKVATQA  1905
             + F       +       FT      F  + K++  K     V + + S   + +  T+ 
Sbjct  484   SMFQTIAGKWMPPNAKLTFTLPTGVDFSISGKRDKSKPVPDEVRLTIFSEDMFKQCITRQ  543

Query  1906  DLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSR--SNSKRGWWTPLLFTSAI  2079
             D+GL +AY++ D  F       L+L      ++   ++  +  SN K+ W+ P    +AI
Sbjct  544   DIGLGEAYMNND--FSGDVMAFLDLICSGHPSKQEKSNRKKGLSNPKKNWFNPKELVAAI  601

Query  2080  AS----AKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAV--------  2223
              S    A     H +  NT   +++NI  HYD  N  +SLFLD T+ YS AV        
Sbjct  602   LSILGGAAEMAAHKALSNTKEGSKKNIEYHYDAGNAFYSLFLDNTLLYSSAVHVKNADGT  661

Query  2224  ------------------------FKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGC  2331
                                     F+ ++  L+ +Q  KI  +I +    K   +LEIGC
Sbjct  662   PAELNGDDNMYIDKLLMNGNREMTFEEKEIHLEQSQYDKIDAMIARLDFKKTDEVLEIGC  721

Query  2332  GWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYD  2511
             GWG LAI    + GCK TG+TLS++Q   A  +V +  L   I   + DYR   +   YD
Sbjct  722   GWGQLAIRLATKIGCKVTGLTLSKEQAAEARARVAKLKLSHLIEIKIQDYRD--ETNVYD  779

Query  2512  RIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEY-RQSSDFIKEYI  2688
             ++IS EMLEAVGHE +  FF    + L  NG   +Q I+IPDERY +Y   +SDFI+ YI
Sbjct  780   KVISIEMLEAVGHEHLPTFFETVRNCLKPNGTCAIQVITIPDERYKQYCETTSDFIRAYI  839

Query  2689  FPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKK  2868
             FPGG LPS+S + +  AA + L ++  +DIG+HY  TLR WR   L R+ ++ DLG+ K+
Sbjct  840   FPGGHLPSISAMKN--AAPNGLSLDSYDDIGLHYAVTLRLWRERMLARKQKVFDLGYSKR  897

Query  2869  FIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2964
             F+R +E+YF YC A F    +GD Q+ + R G
Sbjct  898   FVRMYEFYFAYCEAAFKHGLIGDLQMTWKRDG  929



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11128933881534