BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25496_g1_i2 len=3336 path=[10125:0-998 8066:999-1011 8079:1012-1151
8167:1152-1160 8176:1161-1914 12014:1915-1996 12096:1997-2055
12155:2056-2536 5012:2537-3335]

Length=3336
                                                                      Score     E

ref|XP_009763750.1|  PREDICTED: uncharacterized protein LOC104215...   1130   0.0      
ref|XP_004247758.1|  PREDICTED: uncharacterized protein LOC101260476   1129   0.0      
ref|XP_006354448.1|  PREDICTED: uncharacterized protein LOC102604983   1128   0.0      
ref|XP_009625531.1|  PREDICTED: uncharacterized protein LOC104116...   1126   0.0      
ref|XP_009625533.1|  PREDICTED: uncharacterized protein LOC104116...   1125   0.0      
ref|XP_009625534.1|  PREDICTED: uncharacterized protein LOC104116...   1125   0.0      
ref|XP_009625535.1|  PREDICTED: uncharacterized protein LOC104116...   1124   0.0      
ref|XP_009617889.1|  PREDICTED: uncharacterized protein LOC104110...   1118   0.0      
ref|XP_009617893.1|  PREDICTED: uncharacterized protein LOC104110...   1117   0.0      
ref|XP_009617891.1|  PREDICTED: uncharacterized protein LOC104110...   1117   0.0      
ref|XP_011073566.1|  PREDICTED: uncharacterized protein LOC105158...   1102   0.0      
ref|XP_011073567.1|  PREDICTED: uncharacterized protein LOC105158...   1101   0.0      
ref|XP_002281958.1|  PREDICTED: uncharacterized protein LOC100249...   1077   0.0      Vitis vinifera
ref|XP_010650129.1|  PREDICTED: uncharacterized protein LOC100249...   1075   0.0      
gb|EYU32577.1|  hypothetical protein MIMGU_mgv1a001185mg               1072   0.0      
ref|XP_009586640.1|  PREDICTED: uncharacterized protein LOC104084...   1071   0.0      
emb|CBI23697.3|  unnamed protein product                               1068   0.0      
ref|XP_011029772.1|  PREDICTED: uncharacterized protein LOC105129...   1066   0.0      
ref|XP_011029770.1|  PREDICTED: uncharacterized protein LOC105129...   1064   0.0      
ref|XP_011029773.1|  PREDICTED: uncharacterized protein LOC105129...   1062   0.0      
ref|XP_010650134.1|  PREDICTED: uncharacterized protein LOC100242...   1060   0.0      
ref|XP_010650133.1|  PREDICTED: uncharacterized protein LOC100242...   1060   0.0      
ref|XP_002311690.2|  cyclopropane-fatty-acyl-phospholipid synthas...   1058   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004296397.1|  PREDICTED: uncharacterized protein LOC101309817   1055   0.0      
ref|XP_010650132.1|  PREDICTED: uncharacterized protein LOC100242...   1055   0.0      
ref|XP_006493505.1|  PREDICTED: uncharacterized protein LOC102615...   1055   0.0      
ref|XP_007227011.1|  hypothetical protein PRUPE_ppa001275mg            1051   0.0      
ref|XP_010317817.1|  PREDICTED: uncharacterized protein LOC101256...   1051   0.0      
ref|XP_010264925.1|  PREDICTED: uncharacterized protein LOC104602...   1051   0.0      
ref|XP_009357997.1|  PREDICTED: uncharacterized protein LOC103948...   1051   0.0      
ref|XP_004234691.1|  PREDICTED: uncharacterized protein LOC101256...   1051   0.0      
ref|XP_009358001.1|  PREDICTED: uncharacterized protein LOC103948...   1050   0.0      
ref|XP_008224158.1|  PREDICTED: uncharacterized protein LOC103323...   1049   0.0      
ref|XP_010264927.1|  PREDICTED: uncharacterized protein LOC104602...   1049   0.0      
ref|XP_006421140.1|  hypothetical protein CICLE_v10004346mg            1049   0.0      
ref|XP_008224157.1|  PREDICTED: uncharacterized protein LOC103323...   1048   0.0      
emb|CBI23694.3|  unnamed protein product                               1046   0.0      
ref|XP_007035209.1|  Cyclopropane-fatty-acyl-phospholipid synthas...   1046   0.0      
ref|XP_002314493.2|  cyclopropane-fatty-acyl-phospholipid synthas...   1046   0.0      Populus trichocarpa [western balsam poplar]
gb|KDP40373.1|  hypothetical protein JCGZ_02371                        1043   0.0      
ref|XP_010527410.1|  PREDICTED: uncharacterized protein LOC104804765   1038   0.0      
emb|CDO99279.1|  unnamed protein product                               1036   0.0      
ref|XP_008460674.1|  PREDICTED: uncharacterized protein LOC103499...   1036   0.0      
ref|XP_010023867.1|  PREDICTED: uncharacterized protein LOC104414444   1036   0.0      
emb|CAN68017.1|  hypothetical protein VITISV_025151                    1035   0.0      Vitis vinifera
gb|KGN61573.1|  hypothetical protein Csa_2G171940                      1033   0.0      
gb|KEH42686.1|  cyclopropane-fatty-acyl-phospholipid synthase          1033   0.0      
ref|XP_002528810.1|  methyltransferase, putative                       1031   0.0      Ricinus communis
gb|AAT74602.1|  cyclopropane fatty acid synthase                       1026   0.0      Gossypium hirsutum [American cotton]
ref|XP_011030438.1|  PREDICTED: uncharacterized protein LOC105129...   1023   0.0      
ref|XP_010023868.1|  PREDICTED: uncharacterized protein LOC104414445   1023   0.0      
ref|XP_008340636.1|  PREDICTED: uncharacterized protein LOC103403...   1022   0.0      
ref|XP_004495453.1|  PREDICTED: uncharacterized protein LOC101501999   1022   0.0      
ref|XP_011030435.1|  PREDICTED: uncharacterized protein LOC105129...   1021   0.0      
ref|XP_006296683.1|  hypothetical protein CARUB_v10012958mg            1021   0.0      
ref|XP_006406021.1|  hypothetical protein EUTSA_v10020039mg            1020   0.0      
ref|XP_009586642.1|  PREDICTED: uncharacterized protein LOC104084...   1017   0.0      
ref|XP_009586641.1|  PREDICTED: uncharacterized protein LOC104084...   1016   0.0      
ref|XP_010670961.1|  PREDICTED: uncharacterized protein LOC104887...   1016   0.0      
ref|XP_009586644.1|  PREDICTED: uncharacterized protein LOC104084...   1016   0.0      
ref|XP_010670960.1|  PREDICTED: uncharacterized protein LOC104887...   1015   0.0      
gb|AAL57657.1|  AT3g23510/MEE5_5                                       1014   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102608.1|  PREDICTED: uncharacterized protein LOC103828731   1014   0.0      
ref|XP_002883433.1|  hypothetical protein ARALYDRAFT_898865            1013   0.0      
ref|NP_188993.2|  cyclopropane-fatty-acyl-phospholipid synthase        1013   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAD44154.1|  unnamed protein product                               1012   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_188995.2|  Cyclopropane-fatty-acyl-phospholipid synthase        1012   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010466687.1|  PREDICTED: uncharacterized protein LOC104746847   1011   0.0      
gb|KDO50392.1|  hypothetical protein CISIN_1g0358701mg                 1011   0.0      
ref|XP_010512493.1|  PREDICTED: uncharacterized protein LOC104788...   1010   0.0      
ref|XP_010490069.1|  PREDICTED: uncharacterized protein LOC104767788   1009   0.0      
ref|XP_006606354.1|  PREDICTED: uncharacterized protein LOC100815...   1009   0.0      
gb|KHG28467.1|  putative fatty acid methyltransferase                  1009   0.0      
gb|KHN01041.1|  Putative fatty acid methyltransferase                  1008   0.0      
ref|XP_010512500.1|  PREDICTED: uncharacterized protein LOC104788...   1008   0.0      
ref|XP_006350407.1|  PREDICTED: uncharacterized protein LOC102579...   1003   0.0      
ref|XP_007144121.1|  hypothetical protein PHAVU_007G1305000g           1001   0.0      
gb|KGN61574.1|  hypothetical protein Csa_2G171950                      1000   0.0      
ref|XP_006589307.1|  PREDICTED: uncharacterized protein LOC100801...   1000   0.0      
gb|KHN30725.1|  Putative fatty acid methyltransferase                   999   0.0      
gb|KCW60262.1|  hypothetical protein EUGRSUZ_H02971                     989   0.0      
ref|XP_011030437.1|  PREDICTED: uncharacterized protein LOC105129...    989   0.0      
ref|XP_010023866.1|  PREDICTED: uncharacterized protein LOC104414443    984   0.0      
ref|XP_006857466.1|  hypothetical protein AMTR_s00067p00185740          984   0.0      
gb|KHG28468.1|  putative fatty acid methyltransferase                   983   0.0      
ref|XP_010529627.1|  PREDICTED: uncharacterized protein LOC104806...    979   0.0      
ref|XP_006489661.1|  PREDICTED: uncharacterized protein LOC102611924    979   0.0      
ref|XP_006489662.1|  PREDICTED: uncharacterized protein LOC102612...    978   0.0      
emb|CDX85109.1|  BnaC07g07970D                                          976   0.0      
ref|XP_004147184.1|  PREDICTED: uncharacterized protein LOC101213850    969   0.0      
ref|XP_008796355.1|  PREDICTED: uncharacterized protein LOC103711...    968   0.0      
ref|XP_008796358.1|  PREDICTED: uncharacterized protein LOC103711...    967   0.0      
emb|CDX77504.1|  BnaA07g06420D                                          967   0.0      
ref|XP_006420314.1|  hypothetical protein CICLE_v10007034mg             966   0.0      
ref|XP_008796354.1|  PREDICTED: uncharacterized protein LOC103711...    963   0.0      
ref|XP_008796357.1|  PREDICTED: uncharacterized protein LOC103711...    962   0.0      
ref|XP_009763752.1|  PREDICTED: uncharacterized protein LOC104215...    960   0.0      
ref|XP_009625539.1|  PREDICTED: uncharacterized protein LOC104116...    958   0.0      
ref|XP_009625540.1|  PREDICTED: uncharacterized protein LOC104116...    956   0.0      
ref|XP_010532680.1|  PREDICTED: uncharacterized protein LOC104808649    954   0.0      
ref|XP_010936014.1|  PREDICTED: uncharacterized protein LOC105055...    953   0.0      
ref|XP_010936015.1|  PREDICTED: uncharacterized protein LOC105055...    952   0.0      
ref|XP_009135859.1|  PREDICTED: uncharacterized protein LOC103860003    951   0.0      
ref|XP_007035221.1|  Cyclopropane-fatty-acyl-phospholipid synthase      951   0.0      
emb|CDX92987.1|  BnaA03g37090D                                          950   0.0      
ref|XP_009102616.1|  PREDICTED: uncharacterized protein LOC103828...    949   0.0      
ref|XP_009617895.1|  PREDICTED: uncharacterized protein LOC104110...    949   0.0      
ref|XP_010532681.1|  PREDICTED: uncharacterized protein LOC104808651    946   0.0      
emb|CDY09021.1|  BnaC01g30700D                                          943   0.0      
dbj|BAJ93367.1|  predicted protein                                      942   0.0      
ref|NP_001147782.1|  cyclopropane fatty acid synthase                   942   0.0      Zea mays [maize]
gb|EMS55075.1|  Cyclopropane-fatty-acyl-phospholipid synthase           941   0.0      
ref|XP_006406026.1|  hypothetical protein EUTSA_v10020049mg             940   0.0      
dbj|BAJ95828.1|  predicted protein                                      939   0.0      
ref|XP_008667917.1|  PREDICTED: cyclopropane fatty acid synthase ...    939   0.0      
ref|XP_006406025.1|  hypothetical protein EUTSA_v10020040mg             936   0.0      
ref|XP_010670959.1|  PREDICTED: uncharacterized protein LOC104887...    936   0.0      
ref|XP_006489664.1|  PREDICTED: uncharacterized protein LOC102612...    935   0.0      
ref|XP_004957293.1|  PREDICTED: uncharacterized protein LOC101772901    934   0.0      
ref|XP_003581006.1|  PREDICTED: uncharacterized protein LOC100842...    931   0.0      
ref|XP_006489666.1|  PREDICTED: uncharacterized protein LOC102613...    931   0.0      
ref|XP_010239672.1|  PREDICTED: uncharacterized protein LOC100842...    929   0.0      
gb|EMT03310.1|  Cyclopropane-fatty-acyl-phospholipid synthase           929   0.0      
ref|XP_010532685.1|  PREDICTED: uncharacterized protein LOC104808...    925   0.0      
emb|CDX94854.1|  BnaC03g43340D                                          924   0.0      
ref|XP_009586643.1|  PREDICTED: uncharacterized protein LOC104084...    920   0.0      
ref|XP_011091265.1|  PREDICTED: uncharacterized protein LOC105171...    918   0.0      
dbj|BAB01742.1|  unnamed protein product                                918   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010650131.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    918   0.0      
ref|XP_011091266.1|  PREDICTED: uncharacterized protein LOC105171...    917   0.0      
ref|XP_009102765.1|  PREDICTED: uncharacterized protein LOC103828879    917   0.0      
ref|XP_006489756.1|  PREDICTED: uncharacterized protein LOC102615557    914   0.0      
ref|XP_002531842.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    907   0.0      Ricinus communis
ref|XP_011091264.1|  PREDICTED: uncharacterized protein LOC105171751    905   0.0      
ref|XP_006489667.1|  PREDICTED: uncharacterized protein LOC102613...    903   0.0      
ref|XP_011029775.1|  PREDICTED: uncharacterized protein LOC105129...    898   0.0      
ref|XP_004169247.1|  PREDICTED: uncharacterized protein LOC101225338    897   0.0      
gb|KDO54097.1|  hypothetical protein CISIN_1g0029283mg                  896   0.0      
gb|EEC82010.1|  hypothetical protein OsI_25960                          895   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_009780643.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    895   0.0      
dbj|BAB02771.1|  mycolic acid methyl transferase-like protein           891   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010670924.1|  PREDICTED: uncharacterized protein LOC104887...    889   0.0      
ref|XP_010670925.1|  PREDICTED: uncharacterized protein LOC104887...    889   0.0      
gb|KDO54095.1|  hypothetical protein CISIN_1g038410mg                   887   0.0      
emb|CDX77514.1|  BnaA07g06520D                                          884   0.0      
ref|XP_008460676.1|  PREDICTED: pavine N-methyltransferase-like i...    883   0.0      
ref|XP_010026810.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    882   0.0      
ref|XP_009102618.1|  PREDICTED: uncharacterized protein LOC103828...    879   0.0      
ref|XP_002528378.1|  cyclopropane-fatty-acyl-phospholipid synthas...    874   0.0      Ricinus communis
ref|XP_008340641.1|  PREDICTED: uncharacterized protein LOC103403...    867   0.0      
ref|XP_006606356.1|  PREDICTED: uncharacterized protein LOC100815...    865   0.0      
gb|EPS65744.1|  cyclopropane fatty acid synthase                        864   0.0      
gb|EPS70161.1|  hypothetical protein M569_04599                         831   0.0      
ref|XP_009586646.1|  PREDICTED: uncharacterized protein LOC104084...    792   0.0      
emb|CDX77513.1|  BnaA07g06510D                                          865   0.0      
ref|XP_006589308.1|  PREDICTED: uncharacterized protein LOC100801...    857   0.0      
ref|XP_006350408.1|  PREDICTED: uncharacterized protein LOC102579...    860   0.0      
ref|XP_007035215.1|  Cyclopropane fatty acid synthase                   863   0.0      
gb|AAM33848.1|AF470622_1  cyclopropane synthase                         857   0.0      Sterculia foetida
gb|AAT74601.1|  cyclopropane fatty acid synthase                        849   0.0      Gossypium hirsutum [American cotton]
gb|KHG13738.1|  Cyclopropane-fatty-acyl-phospholipid synthase           842   0.0      
ref|XP_002451281.1|  hypothetical protein SORBIDRAFT_05g026900          775   0.0      Sorghum bicolor [broomcorn]
ref|XP_007035214.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    844   0.0      
ref|XP_008796356.1|  PREDICTED: uncharacterized protein LOC103711...    838   0.0      
ref|XP_008796359.1|  PREDICTED: uncharacterized protein LOC103711...    825   0.0      
gb|AAT74600.1|  cyclopropane fatty acid synthase                        835   0.0      Gossypium hirsutum [American cotton]
ref|XP_006664478.1|  PREDICTED: uncharacterized protein LOC102701601    831   0.0      
ref|XP_008664677.1|  PREDICTED: uncharacterized protein LOC103643...    766   0.0      
ref|XP_008664676.1|  PREDICTED: uncharacterized protein LOC103643...    765   0.0      
ref|NP_001066537.1|  Os12g0267200                                       828   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010532686.1|  PREDICTED: uncharacterized protein LOC104808...    828   0.0      
gb|EYU18296.1|  hypothetical protein MIMGU_mgv1a024671mg                745   0.0      
ref|XP_004169418.1|  PREDICTED: cyclopropane-fatty-acyl-phospholi...    808   0.0      
ref|XP_008460675.1|  PREDICTED: uncharacterized protein LOC103499...    806   0.0      
gb|AES60365.2|  cyclopropane-fatty-acyl-phospholipid synthase           807   0.0      
ref|XP_001769171.1|  predicted protein                                  803   0.0      
ref|XP_002964119.1|  hypothetical protein SELMODRAFT_166747             803   0.0      
ref|XP_003590114.1|  Cyclopropane fatty acid synthase                   795   0.0      
ref|XP_006350427.1|  PREDICTED: uncharacterized protein LOC102587606    784   0.0      
gb|ABG37642.1|  cyclopropane fatty acid synthase                        822   0.0      Populus trichocarpa [western balsam poplar]
dbj|BAC83502.1|  putative cyclopropane synthase                         790   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC78767.1|  hypothetical protein OsI_18995                          811   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAK05892.1|  predicted protein                                      791   0.0      
dbj|BAK05129.1|  predicted protein                                      791   0.0      
ref|XP_006606355.1|  PREDICTED: uncharacterized protein LOC100815...    780   0.0      
ref|XP_004972625.1|  PREDICTED: uncharacterized protein LOC101764920    784   0.0      
ref|XP_004956057.1|  PREDICTED: uncharacterized protein LOC101762...    781   0.0      
gb|EMT06798.1|  Cyclopropane-fatty-acyl-phospholipid synthase           760   0.0      
ref|XP_004956056.1|  PREDICTED: uncharacterized protein LOC101762...    764   0.0      
ref|XP_008677860.1|  PREDICTED: uncharacterized protein LOC103652...    759   0.0      
ref|XP_010650130.1|  PREDICTED: uncharacterized protein LOC100249...    746   0.0      
ref|XP_010670963.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    722   0.0      
ref|XP_006421139.1|  hypothetical protein CICLE_v10004346mg             726   0.0      
gb|EEE62857.1|  hypothetical protein OsJ_17660                          726   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002528809.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    716   0.0      Ricinus communis
ref|XP_008224159.1|  PREDICTED: uncharacterized protein LOC103323...    720   0.0      
gb|KDO40331.1|  hypothetical protein CISIN_1g036521mg                   675   0.0      
ref|XP_006489668.1|  PREDICTED: uncharacterized protein LOC102613...    710   0.0      
ref|XP_006354535.1|  PREDICTED: pavine N-methyltransferase-like         703   0.0      
gb|KCW60259.1|  hypothetical protein EUGRSUZ_H029682                    698   0.0      
ref|XP_008677861.1|  PREDICTED: uncharacterized protein LOC103652...    704   0.0      
ref|XP_004247760.1|  PREDICTED: uncharacterized protein LOC101261068    677   0.0      
ref|XP_011013987.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    678   0.0      
emb|CDY67345.1|  BnaCnng54600D                                          675   0.0      
ref|XP_002314497.2|  hypothetical protein POPTR_0010s07830g             672   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002314494.2|  hypothetical protein POPTR_0010s07840g             667   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002314496.2|  hypothetical protein POPTR_0010s07820g             662   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007035212.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    671   0.0      
ref|XP_006378321.1|  hypothetical protein POPTR_0010s07800g             657   0.0      
ref|XP_010532687.1|  PREDICTED: uncharacterized protein LOC104808...    665   0.0      
emb|CDY18120.1|  BnaA01g23810D                                          654   0.0      
ref|XP_009107970.1|  PREDICTED: uncharacterized protein LOC103833648    653   0.0      
ref|NP_188989.2|  cyclopropane-fatty-acyl-phospholipid synthase         650   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011041421.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    648   0.0      
ref|XP_010936016.1|  PREDICTED: uncharacterized protein LOC105055...    657   0.0      
ref|XP_010532682.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    644   0.0      
ref|XP_010488415.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    636   0.0      
ref|XP_010532683.1|  PREDICTED: (S)-coclaurine N-methyltransferas...    633   0.0      
ref|XP_007035217.1|  Cyclopropane fatty acid synthase isoform 1         631   0.0      
ref|XP_004296401.1|  PREDICTED: cyclopropane-fatty-acyl-phospholi...    627   0.0      
ref|XP_011041574.1|  PREDICTED: uncharacterized protein LOC105137508    627   0.0      
gb|KFK39641.1|  hypothetical protein AALP_AA3G270000                    617   0.0      
ref|XP_002528379.1|  2-heptaprenyl-1,4-naphthoquinone methyltrans...    612   0.0      Ricinus communis
ref|XP_010466684.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    612   0.0      
ref|XP_010466685.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    611   0.0      
ref|XP_010466683.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    611   0.0      
ref|XP_007035213.1|  Cyclopropane-fatty-acyl-phospholipid synthas...    612   0.0      
ref|XP_006299255.1|  hypothetical protein CARUB_v10015414mg             603   0.0      
ref|XP_004307321.1|  PREDICTED: probable fatty acid methyltransfe...    601   0.0      
ref|NP_188990.4|  Cyclopropane-fatty-acyl-phospholipid synthase         599   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006658552.1|  PREDICTED: uncharacterized protein LOC102715408    609   0.0      
ref|XP_010532684.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    594   0.0      
gb|KDO54091.1|  hypothetical protein CISIN_1g0146251mg                  590   0.0      
ref|XP_007035240.1|  Cyclopropane fatty acid synthase                   591   0.0      
ref|XP_007035218.1|  Cyclopropane fatty acid synthase isoform 2         587   0.0      
ref|XP_010670965.1|  PREDICTED: (S)-tetrahydroprotoberberine N-me...    573   0.0      
gb|EMS47376.1|  Cyclopropane-fatty-acyl-phospholipid synthase           580   0.0      
ref|XP_007035220.1|  Cyclopropane fatty acid synthase                   566   0.0      
gb|EEE67149.1|  hypothetical protein OsJ_24210                          577   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAB01740.1|  cyclopocyclopropane fatty acid synthase-like pro...    563   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EMS56688.1|  Cyclopropane-fatty-acyl-phospholipid synthase           565   0.0      
ref|NP_001059618.1|  Os07g0474600                                       555   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001189954.1|  Cyclopropane-fatty-acyl-phospholipid synthase      541   1e-177   
ref|XP_004173332.1|  PREDICTED: LOW QUALITY PROTEIN: probable fat...    533   9e-177   
ref|XP_006431328.1|  hypothetical protein CICLE_v10030464mg             536   3e-174   
ref|XP_005824669.1|  hypothetical protein GUITHDRAFT_165417             450   3e-172   
gb|AFW60130.1|  hypothetical protein ZEAMMB73_361545                    525   4e-172   
gb|KFK39644.1|  hypothetical protein AALP_AA3G270300                    524   4e-172   
ref|XP_009388106.1|  PREDICTED: uncharacterized protein LOC103974927    521   7e-172   
ref|XP_009414043.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    513   6e-169   
dbj|BAB01739.1|  unnamed protein product                                518   4e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006406023.1|  hypothetical protein EUTSA_v10022172mg             513   7e-168   
ref|XP_002467653.1|  hypothetical protein SORBIDRAFT_01g031685          512   1e-163   Sorghum bicolor [broomcorn]
ref|XP_005648777.1|  cyclopropane fatty acid synthase                   417   3e-161   
ref|XP_002883432.1|  predicted protein                                  490   4e-160   
ref|XP_004173387.1|  PREDICTED: probable fatty acid methyltransfe...    484   1e-158   
dbj|BAJ91247.1|  predicted protein                                      477   2e-155   
ref|XP_004172280.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    475   3e-152   
ref|XP_004147183.1|  PREDICTED: uncharacterized protein LOC101213610    488   5e-152   
ref|XP_002183150.1|  predicted protein                                  388   6e-152   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009757348.1|  PREDICTED: uncharacterized protein LOC104210208    460   3e-149   
gb|KDO54102.1|  hypothetical protein CISIN_1g043102mg                   462   1e-146   
ref|XP_003083973.1|  unnamed protein product                            380   2e-144   
emb|CEG00624.1|  Mycolic acid cyclopropane synthase                     380   2e-144   
ref|XP_005792764.1|  hypothetical protein EMIHUDRAFT_454253             372   6e-140   
ref|XP_006489663.1|  PREDICTED: uncharacterized protein LOC102612...    452   1e-139   
gb|KDO40332.1|  hypothetical protein CISIN_1g0240962mg                  431   1e-138   
gb|EMS68326.1|  Cyclopropane-fatty-acyl-phospholipid synthase           433   1e-137   
ref|XP_002460494.1|  hypothetical protein SORBIDRAFT_02g029350          435   9e-137   Sorghum bicolor [broomcorn]
gb|KGN61575.1|  hypothetical protein Csa_2G171960                       426   9e-137   
ref|XP_002451282.1|  hypothetical protein SORBIDRAFT_05g026910          443   2e-136   Sorghum bicolor [broomcorn]
ref|XP_006420313.1|  hypothetical protein CICLE_v10005536mg             426   5e-136   
gb|KDO39428.1|  hypothetical protein CISIN_1g047022mg                   422   1e-133   
emb|CDY09024.1|  BnaC01g30670D                                          420   1e-133   
ref|XP_005708372.1|  cyclopropane-fatty-acyl-phospholipid synthase      346   4e-131   
ref|XP_009758040.1|  PREDICTED: uncharacterized protein LOC104210742    404   2e-128   
ref|XP_002294769.1|  predicted protein                                  402   7e-120   Thalassiosira pseudonana CCMP1335
gb|KGN61578.1|  hypothetical protein Csa_2G172480                       382   1e-119   
ref|XP_006420311.1|  hypothetical protein CICLE_v10005727mg             376   4e-118   
gb|KDO54094.1|  hypothetical protein CISIN_1g048309mg                   378   5e-118   
gb|EMS47377.1|  Cyclopropane-fatty-acyl-phospholipid synthase           385   3e-116   
ref|XP_001695321.1|  cyclopropane fatty acid synthase                   397   2e-115   
dbj|BAJ92759.1|  predicted protein                                      362   2e-112   
dbj|BAJ86532.1|  predicted protein                                      358   4e-111   
gb|EMS64510.1|  Cyclopropane-fatty-acyl-phospholipid synthase           375   7e-111   
ref|XP_007512428.1|  cyclopropane-fatty-acyl-phospholipid synthase      382   1e-110   
ref|XP_008466845.1|  PREDICTED: probable (S)-tetrahydroprotoberbe...    349   4e-108   
gb|EWM29595.1|  cyclopropane fatty acid synthase                        274   7e-107   
ref|XP_002502708.1|  predicted protein                                  367   1e-106   
ref|XP_005853443.1|  amine oxidase                                      274   1e-106   
ref|XP_009388278.1|  PREDICTED: phytoene desaturase-like                339   6e-105   
ref|XP_008460733.1|  PREDICTED: uncharacterized protein LOC103499495    359   5e-104   
ref|XP_005717868.1|  unnamed protein product                            345   1e-103   
gb|EMS68524.1|  Cyclopropane-fatty-acyl-phospholipid synthase           362   3e-102   
dbj|GAM27526.1|  hypothetical protein SAMD00019534_107020               339   8e-101   
emb|CDY54629.1|  BnaCnng27480D                                          323   1e-98    
emb|CDX85102.1|  BnaC07g08040D                                          317   5e-97    
ref|XP_004356254.1|  cyclopropane fatty acid synthase                   327   1e-96    
gb|EFA79547.1|  cyclopropane fatty acid synthase                        324   3e-96    
ref|XP_002862681.1|  hypothetical protein ARALYDRAFT_359447             315   5e-96    
gb|KGN61577.1|  hypothetical protein Csa_2G172470                       311   2e-94    
ref|WP_033423299.1|  cyclopropane-fatty-acyl-phospholipid synthase      326   3e-94    
ref|XP_638909.1|  cyclopropane fatty acid synthase                      319   3e-94    
ref|XP_003289116.1|  hypothetical protein DICPUDRAFT_48369              315   1e-92    
ref|WP_015774604.1|  cyclopropane-fatty-acyl-phospholipid synthase      321   2e-92    
ref|WP_028577058.1|  cyclopropane-fatty-acyl-phospholipid synthase      317   1e-90    
ref|XP_001804144.1|  hypothetical protein SNOG_13944                    309   2e-90    
gb|EKG13441.1|  Cyclopropane-fatty-acyl-phospholipid/mycolic acid...    309   2e-90    
dbj|GAK56531.1|  cyclopropane-fatty-acyl-phospholipid synthase          305   3e-89    
ref|WP_013031406.1|  cyclopropane-fatty-acyl-phospholipid synthase      305   3e-89    
ref|WP_037046900.1|  cyclopropane-fatty-acyl-phospholipid synthase      305   4e-89    
gb|KIH76553.1|  cyclopropane-fatty-acyl-phospholipid synthase           311   1e-88    
ref|WP_029916671.1|  cyclopropane-fatty-acyl-phospholipid synthase      310   2e-88    
gb|KEF51607.1|  cyclopropane-fatty-acyl-phospholipid synthase           303   4e-88    
ref|WP_015724829.1|  cyclopropane-fatty-acyl-phospholipid synthase      309   4e-88    
ref|WP_032830102.1|  cyclopropane-fatty-acyl-phospholipid synthase      302   4e-88    
ref|WP_032829569.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    302   5e-88    
ref|WP_004765858.1|  cyclopropane-fatty-acyl-phospholipid synthase      302   6e-88    
ref|XP_010109738.1|  Cyclopropane-fatty-acyl-phospholipid synthase      291   7e-88    
gb|EMJ93734.1|  cyclopropane-fatty-acyl-phospholipid synthase           301   7e-88    
ref|WP_028614521.1|  cyclopropane-fatty-acyl-phospholipid synthase      300   1e-87    
gb|KEQ88104.1|  cyclopropane-fatty-acyl-phospholipid synthase           302   1e-87    
ref|WP_007228810.1|  cyclopropane-fatty-acyl-phospholipid synthase      300   1e-87    
ref|WP_007967311.1|  cyclopropane-fatty-acyl-phospholipid synthase      300   1e-87    
ref|WP_036537494.1|  cyclopropane-fatty-acyl-phospholipid synthase      299   2e-87    
ref|XP_007707490.1|  hypothetical protein COCCADRAFT_32698              300   3e-87    
ref|WP_026107288.1|  cyclopropane-fatty-acyl-phospholipid synthase      300   3e-87    
ref|WP_008223526.1|  cyclopropane-fatty-acyl-phospholipid synthase      299   3e-87    
ref|WP_008588835.1|  cyclopropane-fatty-acyl-phospholipid synthase      299   5e-87    
ref|WP_034225625.1|  cyclopropane-fatty-acyl-phospholipid synthase      299   5e-87    
ref|WP_008952004.1|  cyclopropane-fatty-acyl-phospholipid synthase      298   6e-87    
ref|WP_008983445.1|  cyclopropane-fatty-acyl-phospholipid synthase      298   8e-87    
ref|XP_007690517.1|  hypothetical protein COCMIDRAFT_102075             299   9e-87    
gb|KEQ71785.1|  cyclopropane-fatty-acyl-phospholipid synthase           300   9e-87    
ref|WP_002997644.1|  cyclopropane-fatty-acyl-phospholipid synthase      298   2e-86    
ref|WP_013135425.1|  cyclopropane-fatty-acyl-phospholipid synthase      296   2e-86    
gb|EMD86301.1|  hypothetical protein COCHEDRAFT_1198234                 298   2e-86    
ref|WP_010151137.1|  cyclopropane-fatty-acyl-phospholipid synthase      297   3e-86    
ref|WP_008610474.1|  cyclopropane-fatty-acyl-phospholipid synthase      296   3e-86    
ref|XP_007695176.1|  hypothetical protein COCSADRAFT_216295             297   4e-86    
gb|KER00237.1|  hypothetical protein AUEXF2481DRAFT_34438               297   7e-86    
ref|WP_007641361.1|  cyclopropane-fatty-acyl-phospholipid synthase      295   9e-86    
gb|KEQ62956.1|  cyclopropane-fatty-acyl-phospholipid synthase           297   9e-86    
gb|KCW60260.1|  hypothetical protein EUGRSUZ_H029681                    292   9e-86    
gb|ERZ99035.1|  hypothetical protein GLOINDRAFT_339331                  296   9e-86    
ref|XP_007144120.1|  hypothetical protein PHAVU_007G1305001g            285   1e-85    
ref|WP_029221686.1|  cyclopropane-fatty-acyl-phospholipid synthase      295   1e-85    
ref|WP_003456705.1|  SAM dependent methyltransferase, cyclopropan...    294   3e-85    
ref|XP_006676884.1|  hypothetical protein BATDEDRAFT_86144              295   3e-85    
ref|WP_020414996.1|  hypothetical protein                               294   3e-85    
ref|WP_010572522.1|  cyclopropane-fatty-acyl-phospholipid synthase      294   4e-85    
ref|WP_007974402.1|  cyclopropane-fatty-acyl-phospholipid synthase      293   6e-85    
ref|WP_008293215.1|  cyclopropane-fatty-acyl-phospholipid synthase      293   7e-85    
ref|XP_008716404.1|  hypothetical protein HMPREF1541_03834              293   8e-85    
ref|WP_013714269.1|  cyclopropane-fatty-acyl-phospholipid synthase      293   9e-85    
gb|KHJ36351.1|  putative cyclopropane-fatty-acyl-phospholipid syn...    295   9e-85    
ref|WP_017361874.1|  cyclopropane-fatty-acyl-phospholipid synthase      293   9e-85    
ref|WP_020770137.1|  cyclopropane-fatty-acyl-phospholipid synthase      292   1e-84    
ref|WP_017678135.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    292   1e-84    
gb|EME40925.1|  hypothetical protein DOTSEDRAFT_74470                   294   1e-84    
ref|WP_023443719.1|  cyclopropane-fatty-acyl-phospholipid synthase      292   2e-84    
ref|WP_016551412.1|  cyclopropane-fatty-acyl-phospholipid synthase      292   2e-84    
gb|ACT36384.1|  cylcopropane fatty acid acyl phospholipid synthase      291   2e-84    
ref|WP_037020191.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   2e-84    
emb|CEG52018.1|  cyclopropane-fatty-acyl-phospholipid synthase          291   3e-84    
gb|EMN02370.1|  cyclopropane-fatty-acyl-phospholipid synthase           290   3e-84    
gb|EKM95559.1|  cyclopropane-fatty-acyl-phospholipid synthase           291   3e-84    
ref|XP_003837090.1|  hypothetical protein LEMA_P033240.1                296   3e-84    
ref|WP_027671132.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   3e-84    
ref|WP_021701492.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   3e-84    
ref|WP_027950607.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   3e-84    
ref|WP_002644825.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   4e-84    
ref|WP_024025660.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   4e-84    
ref|WP_019676732.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   4e-84    
ref|WP_024162296.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   4e-84    
ref|WP_016545452.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   4e-84    
ref|WP_010568252.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   5e-84    
ref|WP_035517956.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   5e-84    
gb|EMS82095.1|  cyclopropane-fatty-acyl-phospholipid synthase           290   5e-84    
ref|WP_003282254.1|  cyclopropane-fatty-acyl-phospholipid synthase      291   5e-84    
ref|WP_014160581.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   5e-84    
ref|WP_004435713.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   5e-84    
ref|WP_011921129.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   5e-84    
ref|XP_008024747.1|  hypothetical protein SETTUDRAFT_62269              291   5e-84    
ref|WP_003246977.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   6e-84    
gb|EMO89818.1|  cyclopropane-fatty-acyl-phospholipid synthase           290   6e-84    
ref|WP_009024070.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   7e-84    
ref|WP_036032499.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   8e-84    
ref|WP_036073647.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   9e-84    
ref|WP_012476587.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   9e-84    
ref|WP_004426217.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   1e-83    
gb|EMS86753.1|  cyclopropane-fatty-acyl-phospholipid synthase           290   1e-83    
ref|WP_036098089.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   1e-83    
ref|WP_012476829.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   1e-83    
gb|KFJ90934.1|  cyclopropane-fatty-acyl-phospholipid synthase           289   1e-83    
ref|WP_013797662.1|  cyclopropane-fatty-acyl-phospholipid synthase      289   2e-83    
ref|WP_015682975.1|  cyclopropane-fatty-acyl-phospholipid synthase      290   2e-83    
ref|WP_012910566.1|  cyclopropane-fatty-acyl-phospholipid synthase      289   2e-83    
ref|WP_036079206.1|  cyclopropane-fatty-acyl-phospholipid synthase      289   2e-83    
ref|WP_008242442.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   2e-83    
ref|WP_026145216.1|  cyclopropane-fatty-acyl-phospholipid synthase      289   2e-83    
ref|WP_035611143.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   2e-83    
ref|WP_012071731.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   2e-83    
gb|EMI72021.1|  cyclopropane-fatty-acyl-phospholipid synthase           287   2e-83    
ref|WP_020306308.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   3e-83    
ref|WP_015636970.1|  methyltransferase                                  288   3e-83    
gb|EYC50934.1|  cyclopropane-fatty-acyl-phospholipid synthase           288   3e-83    
ref|WP_014503964.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   3e-83    
ref|WP_015679285.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   3e-83    
ref|WP_038140055.1|  hypothetical protein                               287   3e-83    
ref|WP_011913103.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   3e-83    
dbj|BAP41523.1|  cyclopropane-fatty-acyl-phospholipid synthase          288   3e-83    
ref|WP_026007620.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   3e-83    
ref|WP_013982666.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   4e-83    
ref|XP_003299747.1|  hypothetical protein PTT_10803                     289   4e-83    
ref|WP_014596593.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   4e-83    
ref|WP_039433432.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   4e-83    
ref|WP_003459518.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   4e-83    
ref|WP_036163665.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   4e-83    
ref|WP_029379353.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   4e-83    
ref|XP_007681330.1|  hypothetical protein BAUCODRAFT_313159             290   5e-83    
ref|WP_010380444.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   5e-83    
ref|WP_009472206.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   5e-83    
ref|WP_015277186.1|  methyltransferase, cyclopropane fatty acid s...    288   5e-83    
ref|WP_010366079.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   5e-83    
ref|WP_024775005.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   5e-83    
ref|WP_004229949.1|  Cyclopropane-fatty-acyl-phospholipid synthase      287   6e-83    
ref|WP_036062340.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   6e-83    
ref|WP_015487921.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   6e-83    
ref|WP_024744102.1|  cyclopropane-fatty-acyl-phospholipid synthase      288   6e-83    
ref|WP_008898188.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   7e-83    
ref|XP_003849419.1|  hypothetical protein MYCGRDRAFT_101230             289   7e-83    
gb|AHF66050.1|  cyclopropane-fatty-acyl-phospholipid synthase           287   7e-83    
ref|WP_029533711.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   8e-83    
ref|WP_019304527.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   9e-83    
ref|WP_036999199.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   9e-83    
ref|WP_006451778.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   1e-82    
ref|WP_039574900.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   1e-82    
ref|WP_010409431.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   1e-82    
ref|WP_039442644.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   1e-82    
ref|WP_019301959.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   1e-82    
ref|WP_014820390.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   1e-82    
ref|WP_006230151.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   1e-82    
ref|WP_024710277.1|  cyclopropane-fatty-acyl-phospholipid synthase      287   1e-82    
ref|WP_024307119.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   1e-82    
ref|WP_019406285.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   1e-82    
ref|WP_039423507.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   2e-82    
ref|WP_008578239.1|  MULTISPECIES: cyclopropane-fatty-acyl-phosph...    286   2e-82    
ref|WP_023280814.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   2e-82    
ref|WP_006297097.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   2e-82    
ref|WP_009575288.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   2e-82    
ref|WP_005993583.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   2e-82    
gb|EXV01329.1|  mycolic acid cyclopropane synthetase                    288   2e-82    
ref|WP_020316582.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   2e-82    
ref|WP_021443345.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   2e-82    
ref|WP_027331136.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   2e-82    
ref|WP_029529355.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   2e-82    
ref|WP_017915334.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   3e-82    
ref|WP_019408878.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   3e-82    
ref|WP_031421816.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   3e-82    
ref|WP_008107386.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   3e-82    
gb|EMJ87579.1|  cyclopropane-fatty-acyl-phospholipid synthase           284   4e-82    
ref|WP_012012891.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   4e-82    
ref|WP_016773216.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   4e-82    
ref|WP_002980649.1|  cyclopropane-fatty-acyl-phospholipid synthase      286   4e-82    
ref|WP_017245005.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   4e-82    
ref|WP_017155651.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   5e-82    
gb|KGY32352.1|  cyclopropane-fatty-acyl-phospholipid synthase           284   5e-82    
ref|WP_008043908.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   5e-82    
ref|WP_023283174.1|  cyclopropane-fatty-acyl-phospholipid synthase      284   5e-82    
ref|WP_024014288.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   5e-82    
ref|WP_009583767.1|  Cyclopropane-fatty-acyl-phospholipid synthase      285   5e-82    
ref|WP_019095041.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   5e-82    
gb|KGP57999.1|  cyclopropane-fatty-acyl-phospholipid synthase           285   5e-82    
ref|WP_017160022.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   6e-82    
ref|WP_039761286.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   6e-82    
ref|WP_011063399.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   6e-82    
ref|WP_004186829.1|  cyclopropane-fatty-acyl-phospholipid synthase      284   6e-82    
ref|WP_032433794.1|  cyclopropane-fatty-acyl-phospholipid synthase      284   7e-82    
emb|CCK76370.1|  Cyclopropane-fatty-acyl-phospholipid synthase          285   7e-82    
ref|WP_010342347.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   7e-82    
ref|WP_004872514.1|  cyclopropane-fatty-acyl-phospholipid synthase      284   7e-82    
gb|AIW19291.1|  cyclopropane-fatty-acyl-phospholipid synthase           284   8e-82    
ref|WP_032740359.1|  cyclopropane-fatty-acyl-phospholipid synthase      283   8e-82    
ref|WP_032415905.1|  cyclopropane-fatty-acyl-phospholipid synthase      283   8e-82    
ref|WP_003485448.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   9e-82    
ref|WP_035983460.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   9e-82    
ref|WP_023903310.1|  cyclopropane-fatty-acyl-phospholipid synthase      285   9e-82    
ref|WP_035470414.1|  cyclopropane-fatty-acyl-phospholipid synthase      284   9e-82    
ref|WP_021033053.1|  cyclopropane-fatty-acyl-phospholipid synthase      284   1e-81    
ref|WP_016567259.1|  Cyclopropane-fatty-acyl-phospholipid synthase      284   1e-81    
ref|WP_005924870.1|  cyclopropane-fatty-acyl-phospholipid synthase      284   1e-81    
ref|WP_032422000.1|  cyclopropane-fatty-acyl-phospholipid synthase      283   1e-81    
ref|WP_023339511.1|  cyclopropane-fatty-acyl-phospholipid synthase      283   1e-81    
gb|AAM36246.1|  cyclopropane-fatty-acyl-phospholipid synthase           285   1e-81    
ref|WP_023302427.1|  cyclopropane-fatty-acyl-phospholipid synthase      283   1e-81    
ref|WP_010384712.1|  cyclopropane-fatty-acyl-phospholipid synthase      284   1e-81    
ref|WP_019825100.1|  cyclopropane-fatty-acyl-phospholipid synthase      284   1e-81    
ref|WP_003408647.1|  cyclopropane-fatty-acyl-phospholipid synthase      284   1e-81    
ref|WP_021314311.1|  cyclopropane-fatty-acyl-phospholipid synthase      283   1e-81    



>ref|XP_009763750.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009763751.1| PREDICTED: uncharacterized protein LOC104215602 isoform X1 [Nicotiana 
sylvestris]
Length=865

 Score =  1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/694 (79%), Positives = 613/694 (88%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RS +YVNKV+EELEKRGC++R GC
Sbjct  177   PSEGVMGFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEELEKRGCQLRTGC  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+S+ST+E+G       ++  +  ++ YDGC+MAAHAPDTL+MLGK+AT DE RILGAF
Sbjct  237   EVNSISTNEEGCT-----VTCTDGSEDVYDGCVMAAHAPDTLRMLGKEATCDETRILGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH +++F+PRN AAWSAWNFLGT+NN+VC+TYWLN LQNLG+T++PY VTLN
Sbjct  292   QYVYSDIYLHCDKTFLPRNPAAWSAWNFLGTMNNKVCVTYWLNILQNLGETERPYCVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP TPE  LLKWTTGHPVPSVAAS ASSEL++IQGKR IWFCGAYQGYGFHEDGLKAG+I
Sbjct  352   PPHTPEHTLLKWTTGHPVPSVAASIASSELDQIQGKRGIWFCGAYQGYGFHEDGLKAGVI  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLLK+  S L NP HMVP+WPETGARLLVTRFL SFI TG IILLE+GGT+FTFEGT
Sbjct  412   AAQGLLKRNYSVLKNPKHMVPTWPETGARLLVTRFLKSFITTGCIILLEDGGTMFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             + K+ LKV +RVHSPQFYWKVATQ DLGLADA+I GD SFVDK EGLLNLF IFV NRDL
Sbjct  472   ENKSSLKVSLRVHSPQFYWKVATQGDLGLADAFIQGDFSFVDKNEGLLNLFMIFVNNRDL  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              ASV+RS+ KRGWWTPLLFT+A++SAKYFIRH+S QNTLT+ARRNISRHYDLSNELFSLF
Sbjct  532   KASVTRSSKKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTRARRNISRHYDLSNELFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD+TMTYSCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RT
Sbjct  592   LDQTMTYSCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGH
Sbjct  652   GCKYTGITLSEQQLKYAQKRVQQAGLQDHIIFLLCDYRQLPNMSRYDRIISCEMLEAVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM EFF   ES LAE+G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS
Sbjct  712   EFMEEFFTCSESALAEDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  771

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAA
Sbjct  772   AMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAA  831

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  832   GFKTCTLGDYQIVFSRPGNVAAFGDPYHGVPSTY  865


 Score =   365 bits (937),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT++ VDLDLGFMVFNRVT
Sbjct  1     MKVAVVGAGISGLVSAYELAKAGVEVVVYEKEDYLGGHAKTVTVNDVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGVDMEISDMSFSVSLD G+G EWGSR G SGLFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFENLGVDMEISDMSFSVSLDKGYGCEWGSRTGLSGLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV+SYLEE DNNPD+DRN+TLG FI+S GYSELFQKAY+IP+CASIWSC SEG
Sbjct  121   EIIKFKQDVISYLEELDNNPDIDRNETLGHFIQSHGYSELFQKAYLIPICASIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSAYSILSFCRNHHLLQ F    W
Sbjct  181   VMGFSAYSILSFCRNHHLLQLFGRPQW  207



>ref|XP_004247758.1| PREDICTED: uncharacterized protein LOC101260476 [Solanum lycopersicum]
Length=862

 Score =  1129 bits (2921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/682 (80%), Positives = 606/682 (89%), Gaps = 7/682 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV+ RSH+YVNKV++ELEKRGC+IR GCEV+SVST
Sbjct  184   FSAYSILSFCRNHHLLQLFGRPQWLTVRWRSHTYVNKVKDELEKRGCQIRIGCEVNSVST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
             +E+G       ++  +  ++ YDGCIMAAHAPDTL+MLGK+ATFDE RILGAFQYVYSDI
Sbjct  244   NEEGCT-----VACTDGSKDVYDGCIMAAHAPDTLRMLGKEATFDETRILGAFQYVYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LH +Q+ +PRN AAWS+WNFLGT+N RVC+TYWLN LQNLG+T++PY VTLNPP TP+ 
Sbjct  299   FLHCDQTLLPRNSAAWSSWNFLGTMNGRVCVTYWLNILQNLGETERPYCVTLNPPHTPDH  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKWTTGHPVPSVAAS+ASSEL +IQGKR IWFCGAYQGYGFHEDGLKAG IAA GLLK
Sbjct  359   TLLKWTTGHPVPSVAASKASSELYQIQGKRGIWFCGAYQGYGFHEDGLKAGAIAAQGLLK  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  S L NP HMVP+WPETGARLLVTRFL SFI TG +ILLEEGGT+FTFEGT+KK+ LK
Sbjct  419   KNFSVLKNPTHMVPTWPETGARLLVTRFLKSFIATGCLILLEEGGTMFTFEGTEKKSFLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +RVHSPQFYWKVATQ DLGLADA+IHGD SFVDK +GLLNLF IFV NRDL ASV++ 
Sbjct  479   VSLRVHSPQFYWKVATQGDLGLADAFIHGDFSFVDKNDGLLNLFMIFVNNRDLKASVTKF  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + KRGWWTPLLFT+A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  539   SKKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FKSEDEDLK AQ RKISLLI KAK+ KEHHILEIGCGWGSLA+E V+RTGCKYTGI
Sbjct  599   SCAIFKSEDEDLKVAQERKISLLIKKAKVKKEHHILEIGCGWGSLAVEVVKRTGCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP   RYDRIISCEMLEAVGHEFM EFF
Sbjct  659   TLSEQQLKYAKLRVQQAGLQDHITFLLCDYRQLPKMSRYDRIISCEMLEAVGHEFMEEFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               CES LAE+G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAM+A+SR
Sbjct  719   TCCESALAEDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMSAASR  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEHLEDIGIHYYQTLRCWR NFLE+QSQI  LGFD KFIRTWEYYFDYCAAGF TCTL
Sbjct  779   LCVEHLEDIGIHYYQTLRCWRKNFLEKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKG  3010
             GDYQIVFSRPGNV AFGDPY G
Sbjct  839   GDYQIVFSRPGNVAAFGDPYNG  860


 Score =   369 bits (946),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VA+VGAGISGLVSAY LAK GA +V+YEKEDY+GGHAKTVT++GVDLDLGFMVFNRVT
Sbjct  1     MKVAIVGAGISGLVSAYELAKSGAKIVIYEKEDYIGGHAKTVTVNGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGISGLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI++FK DV+SYLEE DNNPD+DRN+TLG FI+S GYS+LFQKAY++P+CASIWSC S+G
Sbjct  121   EIIRFKQDVISYLEELDNNPDIDRNETLGHFIQSHGYSKLFQKAYLVPICASIWSCPSDG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSAYSILSFCRNHHLLQ F    W
Sbjct  181   VMGFSAYSILSFCRNHHLLQLFGRPQW  207



>ref|XP_006354448.1| PREDICTED: uncharacterized protein LOC102604983 [Solanum tuberosum]
Length=862

 Score =  1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/690 (79%), Positives = 610/690 (88%), Gaps = 7/690 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RSH+YVNKV++ELEKRGC+IR GC
Sbjct  177   PSDGVMGFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSHTYVNKVKDELEKRGCQIRTGC  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+SVST+E+G       ++  +  ++ YDGCIMAAHAPDTL+MLGK+AT+DE RILGAF
Sbjct  237   EVNSVSTNEEGCT-----VACTDGSKDIYDGCIMAAHAPDTLRMLGKEATYDETRILGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDI+LH +++ +PRN AAWS+WNFLGT+N RVC+TYWLN LQNLG+T++PY VTLN
Sbjct  292   QYVYSDIFLHCDKTLLPRNSAAWSSWNFLGTMNGRVCVTYWLNILQNLGETERPYCVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP TPE  LLKWTTGHPVPSVAAS+ASSEL +IQGKR IWFCGAYQGYGFHEDGLKAG I
Sbjct  352   PPHTPEHTLLKWTTGHPVPSVAASKASSELYQIQGKRGIWFCGAYQGYGFHEDGLKAGAI  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLLKK  S L NP HMVP+WPETGARLLVTRFL SFI TG +ILLEEGGT+FTFEGT
Sbjct  412   AAQGLLKKNFSILKNPKHMVPTWPETGARLLVTRFLKSFIATGCLILLEEGGTMFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             +KK+ LKV +RVHSPQFYWKVATQ DLGLADA+IHGD SFVDK +GLLNLF IFV NRDL
Sbjct  472   EKKSSLKVSLRVHSPQFYWKVATQGDLGLADAFIHGDFSFVDKNDGLLNLFMIFVNNRDL  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              ASV+RS+ KRGWWTPLLFT+A++S KYFIRH+S QNTLTQARRNISRHYDLSNELFSLF
Sbjct  532   KASVTRSSKKRGWWTPLLFTAAVSSVKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+FKSE+EDLK AQ RKISLLI KAK+ KEHHILEIGCGWGSLA+E V+RT
Sbjct  592   LDETMTYSCAIFKSEEEDLKVAQERKISLLIKKAKVKKEHHILEIGCGWGSLAVEVVKRT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGH
Sbjct  652   GCKYTGITLSEQQLKYAKLRVQQAGLQDHITFLLCDYRQLPNMSRYDRIISCEMLEAVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM EFF  CES LAE+G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTS
Sbjct  712   EFMEEFFTCCESALAEDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTS  771

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLCVEHLEDIGIHYYQTLRCWR NFLE+QSQI  LGFD KFIRTWEYYFDYCAA
Sbjct  772   AMSAASRLCVEHLEDIGIHYYQTLRCWRKNFLEKQSQIHALGFDDKFIRTWEYYFDYCAA  831

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGL  3013
             GF TCTLGDYQIVFSRPGNV AFGDPY G+
Sbjct  832   GFKTCTLGDYQIVFSRPGNVAAFGDPYNGV  861


 Score =   366 bits (939),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLVSAY LAK G  VV+Y+KE+Y+GGHAKTVT++GVDLDLGFMVFNRVT
Sbjct  1     MKVAVVGAGISGLVSAYELAKSGVKVVIYDKENYIGGHAKTVTVNGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGISGLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI++FK DV+SYLEE DNNPD+DRN+TLG FI+S GYSELFQKAY++P+CASIWSC S+G
Sbjct  121   EIIRFKQDVISYLEELDNNPDIDRNETLGHFIQSHGYSELFQKAYLVPICASIWSCPSDG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSAYSILSFCRNHHLLQ F    W
Sbjct  181   VMGFSAYSILSFCRNHHLLQLFGRPQW  207



>ref|XP_009625531.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009625532.1| PREDICTED: uncharacterized protein LOC104116392 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/694 (78%), Positives = 614/694 (88%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RS +YVNKV+EE+EKRGC++R G 
Sbjct  177   PSEGVMCFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEEMEKRGCQLRTGY  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+S+ST+E+G       ++  +  ++ YDGC+MAAHAPDTL+MLGK+AT+DE RILGAF
Sbjct  237   EVNSISTNEEGCT-----VACTDGSKDVYDGCVMAAHAPDTLRMLGKEATYDETRILGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLN
Sbjct  292   QYVYSDIYLHCDKTFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PPRTPE  LLKWTTGHPVPSVAAS ASSEL++IQG+R IWFCGAYQGYGFHEDG+KAG I
Sbjct  352   PPRTPEHTLLKWTTGHPVPSVAASIASSELDQIQGERGIWFCGAYQGYGFHEDGVKAGAI  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLLK+  S LNNP HMVP+WPETGARLLVTRFL SFI T  IILLEEGGT+FTFEGT
Sbjct  412   AAQGLLKRNYSVLNNPKHMVPTWPETGARLLVTRFLKSFISTECIILLEEGGTMFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             + K+ LKV +RVHSPQFYWKVATQ DLGLADA+I GD SFVDK +GLLNLF IFV NRDL
Sbjct  472   ENKSSLKVSLRVHSPQFYWKVATQGDLGLADAFIQGDFSFVDKNDGLLNLFMIFVNNRDL  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              ASV+RS+ KRGWWTPLLFT+A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLF
Sbjct  532   KASVTRSSKKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RT
Sbjct  592   LDETMTYSCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSEQQLKYA+ +V++AGLQD+I F+LCDYRQLP+  RYDRIISCEMLEAVGH
Sbjct  652   GCKYTGITLSEQQLKYAQIRVQQAGLQDHITFILCDYRQLPNMSRYDRIISCEMLEAVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM+EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTS
Sbjct  712   EFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTS  771

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAA
Sbjct  772   AMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAA  831

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  832   GFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  865


 Score =   368 bits (944),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT+DGVDLDLGFMVFNRVT
Sbjct  1     MKVAVVGAGISGLVSAYELAKAGVKVVVYEKEDYLGGHAKTVTVDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV+SYLE  DNNPD+DRN+TLG FI++ GYSELFQKAY+IP+CASIWSC SEG
Sbjct  121   EIIKFKRDVISYLEALDNNPDIDRNETLGHFIQTHGYSELFQKAYLIPICASIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSAYSILSFCRNHHLLQ F    W
Sbjct  181   VMCFSAYSILSFCRNHHLLQLFGRPQW  207



>ref|XP_009625533.1| PREDICTED: uncharacterized protein LOC104116392 isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =  1125 bits (2910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/694 (78%), Positives = 613/694 (88%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RS +YVNKV+EE+EKRGC++R G 
Sbjct  177   PSEGVMCFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEEMEKRGCQLRTGY  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+S+ST+E+G       ++  +  ++ YDGC+MAAHAPDTL+MLGK+AT+DE RILGAF
Sbjct  237   EVNSISTNEEGCT-----VACTDGSKDVYDGCVMAAHAPDTLRMLGKEATYDETRILGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLN
Sbjct  292   QYVYSDIYLHCDKTFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP TPE  +LKWTTGHP+PSVAAS ASSEL++IQGKR IWFCGAYQGYGFHEDG+KAG I
Sbjct  352   PPHTPEHTMLKWTTGHPIPSVAASIASSELDQIQGKRGIWFCGAYQGYGFHEDGVKAGAI  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLLK+  S LNNP HMVP+WPETGARLLVTRFL SFI T  IILLEEGGT+FTFEGT
Sbjct  412   AAQGLLKRNYSVLNNPKHMVPTWPETGARLLVTRFLKSFISTECIILLEEGGTMFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             + K+ LKV +RVHSPQFYWKVATQ DLGLADA+I GD SFVDK +GLLNLF IFV NRDL
Sbjct  472   ENKSSLKVSLRVHSPQFYWKVATQGDLGLADAFIQGDFSFVDKNDGLLNLFMIFVNNRDL  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              ASV+RS+ KRGWWTPLLFT+A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLF
Sbjct  532   KASVTRSSKKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RT
Sbjct  592   LDETMTYSCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSEQQLKYA+ +V++AGLQD+I F+LCDYRQLP+  RYDRIISCEMLEAVGH
Sbjct  652   GCKYTGITLSEQQLKYAQIRVQQAGLQDHITFILCDYRQLPNMSRYDRIISCEMLEAVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM+EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTS
Sbjct  712   EFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTS  771

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAA
Sbjct  772   AMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAA  831

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  832   GFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  865


 Score =   368 bits (944),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT+DGVDLDLGFMVFNRVT
Sbjct  1     MKVAVVGAGISGLVSAYELAKAGVKVVVYEKEDYLGGHAKTVTVDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV+SYLE  DNNPD+DRN+TLG FI++ GYSELFQKAY+IP+CASIWSC SEG
Sbjct  121   EIIKFKRDVISYLEALDNNPDIDRNETLGHFIQTHGYSELFQKAYLIPICASIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSAYSILSFCRNHHLLQ F    W
Sbjct  181   VMCFSAYSILSFCRNHHLLQLFGRPQW  207



>ref|XP_009625534.1| PREDICTED: uncharacterized protein LOC104116392 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =  1125 bits (2909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/694 (78%), Positives = 614/694 (88%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RS +YVNKV+EE+EKRGC++R G 
Sbjct  120   PSEGVMCFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEEMEKRGCQLRTGY  179

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+S+ST+E+G       ++  +  ++ YDGC+MAAHAPDTL+MLGK+AT+DE RILGAF
Sbjct  180   EVNSISTNEEGCT-----VACTDGSKDVYDGCVMAAHAPDTLRMLGKEATYDETRILGAF  234

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLN
Sbjct  235   QYVYSDIYLHCDKTFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLN  294

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PPRTPE  LLKWTTGHPVPSVAAS ASSEL++IQG+R IWFCGAYQGYGFHEDG+KAG I
Sbjct  295   PPRTPEHTLLKWTTGHPVPSVAASIASSELDQIQGERGIWFCGAYQGYGFHEDGVKAGAI  354

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLLK+  S LNNP HMVP+WPETGARLLVTRFL SFI T  IILLEEGGT+FTFEGT
Sbjct  355   AAQGLLKRNYSVLNNPKHMVPTWPETGARLLVTRFLKSFISTECIILLEEGGTMFTFEGT  414

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             + K+ LKV +RVHSPQFYWKVATQ DLGLADA+I GD SFVDK +GLLNLF IFV NRDL
Sbjct  415   ENKSSLKVSLRVHSPQFYWKVATQGDLGLADAFIQGDFSFVDKNDGLLNLFMIFVNNRDL  474

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              ASV+RS+ KRGWWTPLLFT+A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLF
Sbjct  475   KASVTRSSKKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLF  534

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RT
Sbjct  535   LDETMTYSCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRT  594

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSEQQLKYA+ +V++AGLQD+I F+LCDYRQLP+  RYDRIISCEMLEAVGH
Sbjct  595   GCKYTGITLSEQQLKYAQIRVQQAGLQDHITFILCDYRQLPNMSRYDRIISCEMLEAVGH  654

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM+EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTS
Sbjct  655   EFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTS  714

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAA
Sbjct  715   AMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAA  774

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  775   GFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  808


 Score =   265 bits (678),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNMME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFWQM
Sbjct  2     VTYPNMMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFWQM  61

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IREI+KFK DV+SYLE  DNNPD+DRN+TLG FI++ GYSELFQKAY+IP+CASIWSC S
Sbjct  62    IREIIKFKRDVISYLEALDNNPDIDRNETLGHFIQTHGYSELFQKAYLIPICASIWSCPS  121

Query  937   EGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             EGVM FSAYSILSFCRNHHLLQ F    W
Sbjct  122   EGVMCFSAYSILSFCRNHHLLQLFGRPQW  150



>ref|XP_009625535.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625536.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009625538.1| PREDICTED: uncharacterized protein LOC104116392 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/694 (78%), Positives = 614/694 (88%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RS +YVNKV+EE+EKRGC++R G 
Sbjct  114   PSEGVMCFSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEEMEKRGCQLRTGY  173

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+S+ST+E+G       ++  +  ++ YDGC+MAAHAPDTL+MLGK+AT+DE RILGAF
Sbjct  174   EVNSISTNEEGCT-----VACTDGSKDVYDGCVMAAHAPDTLRMLGKEATYDETRILGAF  228

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLN
Sbjct  229   QYVYSDIYLHCDKTFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLN  288

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PPRTPE  LLKWTTGHPVPSVAAS ASSEL++IQG+R IWFCGAYQGYGFHEDG+KAG I
Sbjct  289   PPRTPEHTLLKWTTGHPVPSVAASIASSELDQIQGERGIWFCGAYQGYGFHEDGVKAGAI  348

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLLK+  S LNNP HMVP+WPETGARLLVTRFL SFI T  IILLEEGGT+FTFEGT
Sbjct  349   AAQGLLKRNYSVLNNPKHMVPTWPETGARLLVTRFLKSFISTECIILLEEGGTMFTFEGT  408

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             + K+ LKV +RVHSPQFYWKVATQ DLGLADA+I GD SFVDK +GLLNLF IFV NRDL
Sbjct  409   ENKSSLKVSLRVHSPQFYWKVATQGDLGLADAFIQGDFSFVDKNDGLLNLFMIFVNNRDL  468

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              ASV+RS+ KRGWWTPLLFT+A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLF
Sbjct  469   KASVTRSSKKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLF  528

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RT
Sbjct  529   LDETMTYSCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRT  588

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSEQQLKYA+ +V++AGLQD+I F+LCDYRQLP+  RYDRIISCEMLEAVGH
Sbjct  589   GCKYTGITLSEQQLKYAQIRVQQAGLQDHITFILCDYRQLPNMSRYDRIISCEMLEAVGH  648

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM+EFF  CES LAE G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTS
Sbjct  649   EFMDEFFTCCESALAEYGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTS  708

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAA+SRLCVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAA
Sbjct  709   AMAAASRLCVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAA  768

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF TCTLGDYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  769   GFKTCTLGDYQIVFSRPGNVAAFGDPYNGVPSTY  802


 Score =   254 bits (648),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FESLGVDMEISDMSFSVSLD G+  EWGSRNG SGLFAQKKN+LNPYFWQMIREI+
Sbjct  1     MMEFFESLGVDMEISDMSFSVSLDKGYCCEWGSRNGLSGLFAQKKNVLNPYFWQMIREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK DV+SYLE  DNNPD+DRN+TLG FI++ GYSELFQKAY+IP+CASIWSC SEGVM 
Sbjct  61    KFKRDVISYLEALDNNPDIDRNETLGHFIQTHGYSELFQKAYLIPICASIWSCPSEGVMC  120

Query  952   FSAYSILSFCRNHHLLQNFSPALW  1023
             FSAYSILSFCRNHHLLQ F    W
Sbjct  121   FSAYSILSFCRNHHLLQLFGRPQW  144



>ref|XP_009617889.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009617890.1| PREDICTED: uncharacterized protein LOC104110155 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/687 (78%), Positives = 607/687 (88%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV+ RS +YVNKV+EELEKRGC+++ GCEV+S+ST
Sbjct  184   FSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEELEKRGCQLKTGCEVNSLST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
             +E+G       ++  +  ++ YDGCIMAAHAPDTL+MLGK+AT+DE RILGAFQYVYSDI
Sbjct  244   NEEGCT-----VACTDGCKDVYDGCIMAAHAPDTLRMLGKEATYDETRILGAFQYVYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPP TPE 
Sbjct  299   YLHCDKNFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPHTPEH  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              +LKWTTGHPVPSVAAS ASSEL +IQGKR IWFCGAYQGYGFHEDGLKAG IAA GLLK
Sbjct  359   TMLKWTTGHPVPSVAASIASSELHQIQGKRGIWFCGAYQGYGFHEDGLKAGAIAAQGLLK  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             +  S LNNP HMVP+W ETGARLLVTRFL SFI TG IILLEEGGT+FTFEGT+ K+ LK
Sbjct  419   RNYSVLNNPKHMVPTWKETGARLLVTRFLKSFISTGCIILLEEGGTMFTFEGTENKSSLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +RVHSP+FYWKVATQ DLGLADA+I GD SFVDK EGLLNLF IFV NRDL ASV+RS
Sbjct  479   VSLRVHSPRFYWKVATQGDLGLADAFIQGDFSFVDKNEGLLNLFMIFVNNRDLKASVTRS  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + KRGWWTPLLFT+A++SAKYF+RH+S QNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  539   SKKRGWWTPLLFTAAVSSAKYFVRHVSNQNTLTQARRNISRHYDLSNELFSLFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E  +RTGCKYTGI
Sbjct  599   SCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVAKRTGCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGHEFM EFF
Sbjct  659   TLSEQQLKYAQLRVQQAGLQDHITFLLCDYRQLPNMSRYDRIISCEMLEAVGHEFMEEFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               CES LA +G+LVLQFISIPDERYDEYRQSSDFIKEYIFPG CLP+LSRVTSAMAA+SR
Sbjct  719   TCCESALAGDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGACLPALSRVTSAMAAASR  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             L VEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTL
Sbjct  779   LSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDNKFIRTWEYYFDYCAAGFKTCTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  839   GDYQIVFSRPGNIAAFGDPYSAVPSAY  865


 Score =   369 bits (948),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLVSAY LAK G  VVVYEKEDYLGGHAKTVT+DGVDLDLGFMVFNRVT
Sbjct  1     MKVAVVGAGISGLVSAYELAKAGVKVVVYEKEDYLGGHAKTVTVDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM+E FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMLEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGLSGLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV+SYLE  DNNPD+DRN+TLG FI+S  YSELFQKAY+IP+CASIWSC S+G
Sbjct  121   EIIKFKQDVISYLEALDNNPDIDRNETLGHFIQSHSYSELFQKAYLIPICASIWSCPSDG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSAYSILSFCRNHHLLQ F    W
Sbjct  181   VMGFSAYSILSFCRNHHLLQLFGRPQW  207



>ref|XP_009617893.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
 ref|XP_009617894.1| PREDICTED: uncharacterized protein LOC104110155 isoform X4 [Nicotiana 
tomentosiformis]
Length=802

 Score =  1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/687 (78%), Positives = 607/687 (88%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV+ RS +YVNKV+EELEKRGC+++ GCEV+S+ST
Sbjct  121   FSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEELEKRGCQLKTGCEVNSLST  180

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
             +E+G       ++  +  ++ YDGCIMAAHAPDTL+MLGK+AT+DE RILGAFQYVYSDI
Sbjct  181   NEEGCT-----VACTDGCKDVYDGCIMAAHAPDTLRMLGKEATYDETRILGAFQYVYSDI  235

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPP TPE 
Sbjct  236   YLHCDKNFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPHTPEH  295

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              +LKWTTGHPVPSVAAS ASSEL +IQGKR IWFCGAYQGYGFHEDGLKAG IAA GLLK
Sbjct  296   TMLKWTTGHPVPSVAASIASSELHQIQGKRGIWFCGAYQGYGFHEDGLKAGAIAAQGLLK  355

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             +  S LNNP HMVP+W ETGARLLVTRFL SFI TG IILLEEGGT+FTFEGT+ K+ LK
Sbjct  356   RNYSVLNNPKHMVPTWKETGARLLVTRFLKSFISTGCIILLEEGGTMFTFEGTENKSSLK  415

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +RVHSP+FYWKVATQ DLGLADA+I GD SFVDK EGLLNLF IFV NRDL ASV+RS
Sbjct  416   VSLRVHSPRFYWKVATQGDLGLADAFIQGDFSFVDKNEGLLNLFMIFVNNRDLKASVTRS  475

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + KRGWWTPLLFT+A++SAKYF+RH+S QNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  476   SKKRGWWTPLLFTAAVSSAKYFVRHVSNQNTLTQARRNISRHYDLSNELFSLFLDETMTY  535

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E  +RTGCKYTGI
Sbjct  536   SCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVAKRTGCKYTGI  595

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGHEFM EFF
Sbjct  596   TLSEQQLKYAQLRVQQAGLQDHITFLLCDYRQLPNMSRYDRIISCEMLEAVGHEFMEEFF  655

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               CES LA +G+LVLQFISIPDERYDEYRQSSDFIKEYIFPG CLP+LSRVTSAMAA+SR
Sbjct  656   TCCESALAGDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGACLPALSRVTSAMAAASR  715

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             L VEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTL
Sbjct  716   LSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDNKFIRTWEYYFDYCAAGFKTCTL  775

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  776   GDYQIVFSRPGNIAAFGDPYSAVPSAY  802


 Score =   255 bits (651),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             M+E FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQMIREI+
Sbjct  1     MLEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGLSGLFAQKKNVLNPYFWQMIREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK DV+SYLE  DNNPD+DRN+TLG FI+S  YSELFQKAY+IP+CASIWSC S+GVM 
Sbjct  61    KFKQDVISYLEALDNNPDIDRNETLGHFIQSHSYSELFQKAYLIPICASIWSCPSDGVMG  120

Query  952   FSAYSILSFCRNHHLLQNFSPALW  1023
             FSAYSILSFCRNHHLLQ F    W
Sbjct  121   FSAYSILSFCRNHHLLQLFGRPQW  144



>ref|XP_009617891.1| PREDICTED: uncharacterized protein LOC104110155 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009617892.1| PREDICTED: uncharacterized protein LOC104110155 isoform X3 [Nicotiana 
tomentosiformis]
Length=808

 Score =  1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/687 (78%), Positives = 607/687 (88%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV+ RS +YVNKV+EELEKRGC+++ GCEV+S+ST
Sbjct  127   FSAYSILSFCRNHHLLQLFGRPQWLTVRWRSRTYVNKVKEELEKRGCQLKTGCEVNSLST  186

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
             +E+G       ++  +  ++ YDGCIMAAHAPDTL+MLGK+AT+DE RILGAFQYVYSDI
Sbjct  187   NEEGCT-----VACTDGCKDVYDGCIMAAHAPDTLRMLGKEATYDETRILGAFQYVYSDI  241

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +++F+PRN AAWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPP TPE 
Sbjct  242   YLHCDKNFLPRNPAAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPHTPEH  301

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              +LKWTTGHPVPSVAAS ASSEL +IQGKR IWFCGAYQGYGFHEDGLKAG IAA GLLK
Sbjct  302   TMLKWTTGHPVPSVAASIASSELHQIQGKRGIWFCGAYQGYGFHEDGLKAGAIAAQGLLK  361

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             +  S LNNP HMVP+W ETGARLLVTRFL SFI TG IILLEEGGT+FTFEGT+ K+ LK
Sbjct  362   RNYSVLNNPKHMVPTWKETGARLLVTRFLKSFISTGCIILLEEGGTMFTFEGTENKSSLK  421

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +RVHSP+FYWKVATQ DLGLADA+I GD SFVDK EGLLNLF IFV NRDL ASV+RS
Sbjct  422   VSLRVHSPRFYWKVATQGDLGLADAFIQGDFSFVDKNEGLLNLFMIFVNNRDLKASVTRS  481

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + KRGWWTPLLFT+A++SAKYF+RH+S QNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  482   SKKRGWWTPLLFTAAVSSAKYFVRHVSNQNTLTQARRNISRHYDLSNELFSLFLDETMTY  541

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E  +RTGCKYTGI
Sbjct  542   SCAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVAKRTGCKYTGI  601

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGHEFM EFF
Sbjct  602   TLSEQQLKYAQLRVQQAGLQDHITFLLCDYRQLPNMSRYDRIISCEMLEAVGHEFMEEFF  661

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               CES LA +G+LVLQFISIPDERYDEYRQSSDFIKEYIFPG CLP+LSRVTSAMAA+SR
Sbjct  662   TCCESALAGDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGACLPALSRVTSAMAAASR  721

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             L VEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTL
Sbjct  722   LSVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDNKFIRTWEYYFDYCAAGFKTCTL  781

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GDYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  782   GDYQIVFSRPGNIAAFGDPYSAVPSAY  808


 Score =   266 bits (681),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 122/149 (82%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNM+E FESLGVDMEISDMSFSVSLD GHG EWGSRNG SGLFAQKKN+LNPYFWQM
Sbjct  2     VTYPNMLEFFESLGVDMEISDMSFSVSLDKGHGCEWGSRNGLSGLFAQKKNVLNPYFWQM  61

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IREI+KFK DV+SYLE  DNNPD+DRN+TLG FI+S  YSELFQKAY+IP+CASIWSC S
Sbjct  62    IREIIKFKQDVISYLEALDNNPDIDRNETLGHFIQSHSYSELFQKAYLIPICASIWSCPS  121

Query  937   EGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             +GVM FSAYSILSFCRNHHLLQ F    W
Sbjct  122   DGVMGFSAYSILSFCRNHHLLQLFGRPQW  150



>ref|XP_011073566.1| PREDICTED: uncharacterized protein LOC105158481 isoform X1 [Sesamum 
indicum]
Length=869

 Score =  1102 bits (2849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/687 (78%), Positives = 605/687 (88%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTVK RS  YVN+VR+ LE RG  IR   EV SVST
Sbjct  188   FSAYSILSFCRNHHLLQLFGRPQWLTVKWRSQDYVNRVRDVLESRGSHIRTNSEVCSVST  247

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
             ++ G       IS K+  ++ YDGCI+AAHAPD LKMLG+QATFDELRILGAFQY YSDI
Sbjct  248   NDDGCT-----ISCKDGSEDTYDGCIIAAHAPDALKMLGQQATFDELRILGAFQYAYSDI  302

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++ MPRN AAWSAWNFLG+V+N+VC+TYWLN LQN+ +T  P+LVTLNPP TPE 
Sbjct  303   FLHRDKTLMPRNPAAWSAWNFLGSVDNKVCVTYWLNILQNISETGLPFLVTLNPPSTPEH  362

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGHP+PSVAA++ASSEL  IQGKRRIWFCGAYQGYGFHEDGLKAG++AA+GLL+
Sbjct  363   TLLKWSTGHPIPSVAATKASSELNLIQGKRRIWFCGAYQGYGFHEDGLKAGVVAANGLLR  422

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             +RC+  NNP HMVP+W ETGARLLVTRFL SFI TG IILLE GGT+FTFEGT KK+ LK
Sbjct  423   ERCTLHNNPKHMVPTWLETGARLLVTRFLDSFIATGCIILLETGGTMFTFEGTKKKSSLK  482

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +R+H+PQFYWKVAT+ADLGLADAYI+GD SFVDK EGLLNLF IFVANRDLS S S+ 
Sbjct  483   VSLRIHTPQFYWKVATEADLGLADAYINGDFSFVDKNEGLLNLFMIFVANRDLSTSTSKL  542

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N+KRGWWTPLLFTSAIASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  543   NNKRGWWTPLLFTSAIASAKYFFQHMSRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  602

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FK++DEDLK AQ+RK+ LLI+KA+I+K HHILEIGCGWG+LAIEAV RTGCKYTGI
Sbjct  603   SCAIFKTQDEDLKIAQLRKVFLLIEKARINKNHHILEIGCGWGTLAIEAVRRTGCKYTGI  662

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSEQQL+YAE KV+EAGLQD I+FLLCDYRQLP+  +YDRIISCEMLEAVGHE+M EFF
Sbjct  663   TLSEQQLQYAEAKVKEAGLQDRIKFLLCDYRQLPNTDKYDRIISCEMLEAVGHEYMEEFF  722

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               CESVL E+GILVLQFISIPDERY+EYRQS+DFIKEYIFPGGCLPSLSRVT+AM+A+SR
Sbjct  723   RCCESVLQEDGILVLQFISIPDERYNEYRQSADFIKEYIFPGGCLPSLSRVTTAMSAASR  782

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEHLEDIGIHYYQTLR WR +FLE+QS+I  LGFD+KFIRTWEYYFDYCAAGF TCTL
Sbjct  783   LCVEHLEDIGIHYYQTLRRWRESFLEKQSKIQALGFDEKFIRTWEYYFDYCAAGFKTCTL  842

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQIVFSRPGNV AFGDPYK + SAY
Sbjct  843   GNYQIVFSRPGNVEAFGDPYKTIPSAY  869


 Score =   333 bits (855),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             +MRVAVVG G+SGLV+AY+L  GG  VV+YEKEDYLGGHAKTVT+DG  LDLGFMVFNRV
Sbjct  4     RMRVAVVGGGVSGLVAAYILEGGGVEVVLYEKEDYLGGHAKTVTVDGTSLDLGFMVFNRV  63

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGVDME+SDMSF+VSLD G G EWGSRNGFSGLFAQK N+LNPYFW MI
Sbjct  64    TYPNMMEFFETLGVDMELSDMSFAVSLDGGRGCEWGSRNGFSGLFAQKTNILNPYFWTMI  123

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK+DVL+YLE+ DNNPD+DR +TLG F++S GYSELFQKAY+IP+C SIWSCSSE
Sbjct  124   REIIKFKDDVLNYLEQLDNNPDIDRTETLGHFVQSHGYSELFQKAYLIPICGSIWSCSSE  183

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GVM+FSAYSILSFCRNHHLLQ F    W
Sbjct  184   GVMSFSAYSILSFCRNHHLLQLFGRPQW  211



>ref|XP_011073567.1| PREDICTED: uncharacterized protein LOC105158481 isoform X2 [Sesamum 
indicum]
Length=802

 Score =  1101 bits (2847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/687 (78%), Positives = 605/687 (88%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTVK RS  YVN+VR+ LE RG  IR   EV SVST
Sbjct  121   FSAYSILSFCRNHHLLQLFGRPQWLTVKWRSQDYVNRVRDVLESRGSHIRTNSEVCSVST  180

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
             ++ G       IS K+  ++ YDGCI+AAHAPD LKMLG+QATFDELRILGAFQY YSDI
Sbjct  181   NDDGCT-----ISCKDGSEDTYDGCIIAAHAPDALKMLGQQATFDELRILGAFQYAYSDI  235

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++ MPRN AAWSAWNFLG+V+N+VC+TYWLN LQN+ +T  P+LVTLNPP TPE 
Sbjct  236   FLHRDKTLMPRNPAAWSAWNFLGSVDNKVCVTYWLNILQNISETGLPFLVTLNPPSTPEH  295

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGHP+PSVAA++ASSEL  IQGKRRIWFCGAYQGYGFHEDGLKAG++AA+GLL+
Sbjct  296   TLLKWSTGHPIPSVAATKASSELNLIQGKRRIWFCGAYQGYGFHEDGLKAGVVAANGLLR  355

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             +RC+  NNP HMVP+W ETGARLLVTRFL SFI TG IILLE GGT+FTFEGT KK+ LK
Sbjct  356   ERCTLHNNPKHMVPTWLETGARLLVTRFLDSFIATGCIILLETGGTMFTFEGTKKKSSLK  415

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +R+H+PQFYWKVAT+ADLGLADAYI+GD SFVDK EGLLNLF IFVANRDLS S S+ 
Sbjct  416   VSLRIHTPQFYWKVATEADLGLADAYINGDFSFVDKNEGLLNLFMIFVANRDLSTSTSKL  475

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N+KRGWWTPLLFTSAIASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  476   NNKRGWWTPLLFTSAIASAKYFFQHMSRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  535

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FK++DEDLK AQ+RK+ LLI+KA+I+K HHILEIGCGWG+LAIEAV RTGCKYTGI
Sbjct  536   SCAIFKTQDEDLKIAQLRKVFLLIEKARINKNHHILEIGCGWGTLAIEAVRRTGCKYTGI  595

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSEQQL+YAE KV+EAGLQD I+FLLCDYRQLP+  +YDRIISCEMLEAVGHE+M EFF
Sbjct  596   TLSEQQLQYAEAKVKEAGLQDRIKFLLCDYRQLPNTDKYDRIISCEMLEAVGHEYMEEFF  655

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               CESVL E+GILVLQFISIPDERY+EYRQS+DFIKEYIFPGGCLPSLSRVT+AM+A+SR
Sbjct  656   RCCESVLQEDGILVLQFISIPDERYNEYRQSADFIKEYIFPGGCLPSLSRVTTAMSAASR  715

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEHLEDIGIHYYQTLR WR +FLE+QS+I  LGFD+KFIRTWEYYFDYCAAGF TCTL
Sbjct  716   LCVEHLEDIGIHYYQTLRRWRESFLEKQSKIQALGFDEKFIRTWEYYFDYCAAGFKTCTL  775

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQIVFSRPGNV AFGDPYK + SAY
Sbjct  776   GNYQIVFSRPGNVEAFGDPYKTIPSAY  802


 Score =   250 bits (639),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FE+LGVDME+SDMSF+VSLD G G EWGSRNGFSGLFAQK N+LNPYFW MIREI+
Sbjct  1     MMEFFETLGVDMELSDMSFAVSLDGGRGCEWGSRNGFSGLFAQKTNILNPYFWTMIREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK+DVL+YLE+ DNNPD+DR +TLG F++S GYSELFQKAY+IP+C SIWSCSSEGVM+
Sbjct  61    KFKDDVLNYLEQLDNNPDIDRTETLGHFVQSHGYSELFQKAYLIPICGSIWSCSSEGVMS  120

Query  952   FSAYSILSFCRNHHLLQNFSPALW  1023
             FSAYSILSFCRNHHLLQ F    W
Sbjct  121   FSAYSILSFCRNHHLLQLFGRPQW  144



>ref|XP_002281958.1| PREDICTED: uncharacterized protein LOC100249441 isoform X1 [Vitis 
vinifera]
Length=865

 Score =  1077 bits (2784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/687 (75%), Positives = 594/687 (86%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTVK RSH YVNKVREELE +GC+IR GCEV SVST
Sbjct  184   FSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHYYVNKVREELESKGCQIRTGCEVVSVST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G      +  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV SDI
Sbjct  244   TDDG----CTVFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVSSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LH +++FMP+N AAWSAWNFLGT++N+VCLTYWLN LQN+  T +P+LVTLNPP TP+ 
Sbjct  299   FLHCDKNFMPQNPAAWSAWNFLGTIDNKVCLTYWLNVLQNIDQTSRPFLVTLNPPHTPDH  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+T HP PSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAHG+L 
Sbjct  359   TLLKWSTSHPFPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHGMLG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK LLK
Sbjct  419   KGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSRKKCLLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +++H+PQFYWK+ATQADLGLADAYI+GD S VDK EGL NLF IF+ANRDL +S+SR 
Sbjct  479   VSLKIHNPQFYWKIATQADLGLADAYINGDFSLVDKDEGLQNLFMIFIANRDLDSSLSRL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N+KRGWWTPL FT+ IASA+YF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  539   NNKRGWWTPLFFTAGIASARYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK+E EDLK AQ+RKISLLI+K +I K+H +LEIGCGWGSLAIE V+RTGCKYTGI
Sbjct  599   SCAVFKTEGEDLKVAQLRKISLLIEKVRIDKKHEVLEIGCGWGSLAIEVVKRTGCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLK+AE KV+EAGLQDNIRFLLCDYRQL D+ +YDRIISCEMLEAVGHE+M EFF
Sbjct  659   TLSEEQLKFAEMKVKEAGLQDNIRFLLCDYRQLSDSYKYDRIISCEMLEAVGHEYMEEFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAASSR
Sbjct  719   GCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAASSR  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TL
Sbjct  779   LCMEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTHTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  839   GNYQIVFSRPGNAAAFSNPYESVVSTY  865


 Score =   355 bits (912),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV LDLGFMVFNRVT
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVPLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGVDME+SDMSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61    YPNMMEFFETLGVDMELSDMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             +++KFK+DVL YLEE +NNPDMDRN TLG+FIK RGYSELFQKAY++P+CASIWSC +EG
Sbjct  121   DVIKFKDDVLKYLEELENNPDMDRNQTLGDFIKCRGYSELFQKAYLVPICASIWSCPAEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   VMTFSAFSVLSFCRNHHLLQLFGRPQW  207



>ref|XP_010650129.1| PREDICTED: uncharacterized protein LOC100249441 isoform X2 [Vitis 
vinifera]
Length=684

 Score =  1075 bits (2781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/687 (75%), Positives = 594/687 (86%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTVK RSH YVNKVREELE +GC+IR GCEV SVST
Sbjct  3     FSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHYYVNKVREELESKGCQIRTGCEVVSVST  62

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G      +  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV SDI
Sbjct  63    TDDG----CTVFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVSSDI  117

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LH +++FMP+N AAWSAWNFLGT++N+VCLTYWLN LQN+  T +P+LVTLNPP TP+ 
Sbjct  118   FLHCDKNFMPQNPAAWSAWNFLGTIDNKVCLTYWLNVLQNIDQTSRPFLVTLNPPHTPDH  177

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+T HP PSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAHG+L 
Sbjct  178   TLLKWSTSHPFPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHGMLG  237

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK LLK
Sbjct  238   KGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSRKKCLLK  297

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +++H+PQFYWK+ATQADLGLADAYI+GD S VDK EGL NLF IF+ANRDL +S+SR 
Sbjct  298   VSLKIHNPQFYWKIATQADLGLADAYINGDFSLVDKDEGLQNLFMIFIANRDLDSSLSRL  357

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N+KRGWWTPL FT+ IASA+YF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  358   NNKRGWWTPLFFTAGIASARYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  417

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK+E EDLK AQ+RKISLLI+K +I K+H +LEIGCGWGSLAIE V+RTGCKYTGI
Sbjct  418   SCAVFKTEGEDLKVAQLRKISLLIEKVRIDKKHEVLEIGCGWGSLAIEVVKRTGCKYTGI  477

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLK+AE KV+EAGLQDNIRFLLCDYRQL D+ +YDRIISCEMLEAVGHE+M EFF
Sbjct  478   TLSEEQLKFAEMKVKEAGLQDNIRFLLCDYRQLSDSYKYDRIISCEMLEAVGHEYMEEFF  537

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAASSR
Sbjct  538   GCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAASSR  597

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TL
Sbjct  598   LCMEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTHTL  657

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  658   GNYQIVFSRPGNAAAFSNPYESVVSTY  684



>gb|EYU32577.1| hypothetical protein MIMGU_mgv1a001185mg [Erythranthe guttata]
Length=870

 Score =  1072 bits (2772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/687 (75%), Positives = 588/687 (86%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV+ RS  YV++V E LE RGC+IR   EV SVS 
Sbjct  188   FSAYSILSFCRNHHLLQLFGRPQWLTVRWRSQDYVHRVTEFLESRGCQIRTNSEVCSVSA  247

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
             D+ G       IS K+  ++ YD CI+ AHAPD LKMLG+ AT+DE RILGAFQY YSDI
Sbjct  248   DDDGCT-----ISCKDGSEDKYDACIIGAHAPDALKMLGQHATYDESRILGAFQYAYSDI  302

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR++  MP+N AAWSAWNFLGT+NN+VC+TYWLN LQN+  T  P+L+TLNPP TPE 
Sbjct  303   FLHRDKKLMPKNTAAWSAWNFLGTINNKVCVTYWLNILQNISQTGPPFLITLNPPSTPEN  362

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGHP+PSVAA++ASSEL  IQGKRRIWF GAYQGYGFHEDG+KAG++AA+GLL 
Sbjct  363   TLLKWSTGHPIPSVAANKASSELNLIQGKRRIWFAGAYQGYGFHEDGVKAGIVAANGLLG  422

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+   NP HMVPSW ETGARLLVTRFL S I  G++ILLE+GGT+FTFEGT KK+ LK
Sbjct  423   KSCTLRYNPKHMVPSWLETGARLLVTRFLQSLISIGTLILLEDGGTMFTFEGTKKKSFLK  482

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +R+H+PQFYWKVAT+ADLGLADAYI+GD SFVDK EG+LNLF IFVANR+LS S S+ 
Sbjct  483   VSLRIHTPQFYWKVATEADLGLADAYINGDFSFVDKNEGMLNLFMIFVANRELSTSNSKL  542

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N+KRGWWTPLL TSAI+SAKYF  H+SRQN+LTQARRNISRHYDLSNELF+LFLDETM Y
Sbjct  543   NNKRGWWTPLLLTSAISSAKYFYNHVSRQNSLTQARRNISRHYDLSNELFALFLDETMMY  602

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FK++DED+K AQ+RK+SLLI+K KI K  HILEIGCGWG+LAIEAV+RTGCKYTGI
Sbjct  603   SCAIFKTQDEDMKIAQLRKVSLLIEKGKIRKNDHILEIGCGWGTLAIEAVKRTGCKYTGI  662

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSEQQL+YAE KV+EAGLQD I+FLLCDYRQLP   +Y+RIISCEMLEAVGHE+M EFF
Sbjct  663   TLSEQQLEYAELKVKEAGLQDQIKFLLCDYRQLPKTEKYNRIISCEMLEAVGHEYMEEFF  722

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CES LAE+G+ VLQFISIPDERY EYR+SSDFIKEYIFPGGCLPSLSRVTSAMAA+SR
Sbjct  723   GCCESALAEDGLFVLQFISIPDERYTEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAAASR  782

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH+EDIGIHYYQTLRCWR NFL R S+I +LGFD+KFIRTWEYYFDYCAAGF TCTL
Sbjct  783   LCVEHVEDIGIHYYQTLRCWRENFLNRTSEIKNLGFDEKFIRTWEYYFDYCAAGFKTCTL  842

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GDYQIVFSRPGNV AFGDPYK +  AY
Sbjct  843   GDYQIVFSRPGNVAAFGDPYKSVPCAY  869


 Score =   346 bits (887),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 171/208 (82%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KMRVAVVG G+SGLVSAYV+AKGG  VVVYEKEDYLGGHAKTVT+DG  LDLGFMVFNRV
Sbjct  4     KMRVAVVGGGVSGLVSAYVVAKGGVEVVVYEKEDYLGGHAKTVTVDGTSLDLGFMVFNRV  63

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGV+MEISDMSFSVSLD G G EWGSR GFSGLFAQKKN +NPYFW+MI
Sbjct  64    TYPNMMEFFETLGVEMEISDMSFSVSLDKGQGCEWGSRTGFSGLFAQKKNAINPYFWKMI  123

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             +EILKFK+DV++Y+EE DNNPD DRN+TLG FI+SRGYSELFQKAY+IP+C SIWSCSSE
Sbjct  124   KEILKFKDDVINYVEELDNNPDFDRNETLGHFIQSRGYSELFQKAYLIPICGSIWSCSSE  183

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GVM+FSAYSILSFCRNHHLLQ F    W
Sbjct  184   GVMSFSAYSILSFCRNHHLLQLFGRPQW  211



>ref|XP_009586640.1| PREDICTED: uncharacterized protein LOC104084479 isoform X1 [Nicotiana 
tomentosiformis]
Length=865

 Score =  1071 bits (2769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/672 (76%), Positives = 589/672 (88%), Gaps = 5/672 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQLF  PQ LTV+ +S++YVNKV+E+LEKRGC+IR GCEV+ VST+E+G       I+  
Sbjct  199   LQLFSLPQLLTVRWKSYAYVNKVKEDLEKRGCQIRTGCEVNFVSTNEEGCT-----IACN  253

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
             +  +E YDGC+MA HAPDTLKMLGK+AT+DE RILGAFQY+ SDI+LHR+++F+PR+ AA
Sbjct  254   DGAKEVYDGCVMAGHAPDTLKMLGKEATYDETRILGAFQYICSDIFLHRDKTFLPRDPAA  313

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSA NFLGT+N+R  +TYWLN +QNLG T+QPY VTLNPP TPE  +LKWTTGHPVPSVA
Sbjct  314   WSALNFLGTMNSRGSMTYWLNIIQNLGGTEQPYCVTLNPPHTPEHTMLKWTTGHPVPSVA  373

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             AS ASSEL +IQGKR IWFCGAYQGYG HEDGLKAG+ AA G+L++ CS L+NP HMVP+
Sbjct  374   ASIASSELHQIQGKRGIWFCGAYQGYGLHEDGLKAGVTAADGVLRRNCSILDNPKHMVPT  433

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
             WPETGARLLVTRFL SFI TG IILLE GGT+FTF+GTDKK  LKV +RVHS QFYWKVA
Sbjct  434   WPETGARLLVTRFLKSFIETGCIILLENGGTIFTFQGTDKKCSLKVSLRVHSTQFYWKVA  493

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             TQ DLGLADA+IHGD SFVDK EGLLNLF IFVANRDL ASV+RS+ KRGWWTPLL T+A
Sbjct  494   TQGDLGLADAFIHGDFSFVDKNEGLLNLFMIFVANRDLKASVTRSSKKRGWWTPLLSTAA  553

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
             ++SAKYFI+H+S QNTLT+ARRNISRHYDLSNELFSLFLDETMTYSCA+FKSE+EDLK A
Sbjct  554   LSSAKYFIQHVSNQNTLTKARRNISRHYDLSNELFSLFLDETMTYSCAIFKSENEDLKVA  613

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q+RKISLLI KAKISKEHHILEIG GWGSLA+E V++TGCKYTG+TLSEQQLKYA+  V+
Sbjct  614   QLRKISLLIKKAKISKEHHILEIGFGWGSLAVEVVKQTGCKYTGVTLSEQQLKYAQSIVQ  673

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             +AGLQD I FLLCDYRQ+P+N +YDRIISC MLE VGH+F+ EFF  CE+ LAE+G+LV+
Sbjct  674   QAGLQDQITFLLCDYRQMPNNYKYDRIISCGMLEHVGHDFIGEFFSCCETALAEDGLLVV  733

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2809
             QFISIPDERY+EYR+SSDFIKEYIFPGGCLP+L+RVTSAMAA+SRLCV HLE+IGIHYYQ
Sbjct  734   QFISIPDERYEEYRRSSDFIKEYIFPGGCLPALNRVTSAMAAASRLCVVHLEEIGIHYYQ  793

Query  2810  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  2989
             TLRCWR  FL+ QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV  
Sbjct  794   TLRCWREKFLKNQSQIRALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAV  853

Query  2990  FGDPYKGLASAY  3025
             FGDPY G+ SAY
Sbjct  854   FGDPYNGVPSAY  865


 Score =   338 bits (868),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 179/207 (86%), Gaps = 1/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLV AY LAK G  VVVYEKEDYLGGHAKTVT+DGV LDLGFM FN+VT
Sbjct  1     MKVAVVGAGISGLVCAYELAKSGVKVVVYEKEDYLGGHAKTVTVDGVHLDLGFMFFNQVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME F  LG D EISDMSFSVSLD+GHG EWG+RNGFS LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFVFLGADTEISDMSFSVSLDHGHGCEWGTRNGFSSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK DV SYLE  DNNPD+D + T+G+FIKS GYSELFQK+Y+IP+C+SIWSC SEG
Sbjct  121   EISKFKQDVTSYLEALDNNPDIDCDKTIGQFIKSHGYSELFQKSYLIPICSSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFS-PAL  1020
             VM FSAYSILSF R+HHLLQ FS P L
Sbjct  181   VMGFSAYSILSFFRDHHLLQLFSLPQL  207



>emb|CBI23697.3| unnamed protein product [Vitis vinifera]
Length=898

 Score =  1068 bits (2763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/697 (74%), Positives = 594/697 (85%), Gaps = 17/697 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTVK RSH YVNKVREELE +GC+IR GCEV SVST
Sbjct  207   FSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHYYVNKVREELESKGCQIRTGCEVVSVST  266

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G      +  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV SDI
Sbjct  267   TDDG----CTVFCGDG-SQEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVSSDI  321

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LH +++FMP+N AAWSAWNFLGT++N+VCLTYWLN LQN+  T +P+LVTLNPP TP+ 
Sbjct  322   FLHCDKNFMPQNPAAWSAWNFLGTIDNKVCLTYWLNVLQNIDQTSRPFLVTLNPPHTPDH  381

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+T HP PSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAHG+L 
Sbjct  382   TLLKWSTSHPFPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHGMLG  441

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK LLK
Sbjct  442   KGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSRKKCLLK  501

Query  1865  VLVRVHSPQFYWK----------VATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2014
             V +++H+PQFYWK          +ATQADLGLADAYI+GD S VDK EGL NLF IF+AN
Sbjct  502   VSLKIHNPQFYWKAWPFHLHSLQIATQADLGLADAYINGDFSLVDKDEGLQNLFMIFIAN  561

Query  2015  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2194
             RDL +S+SR N+KRGWWTPL FT+ IASA+YF +H+SRQNTLTQARRNISRHYDLSNELF
Sbjct  562   RDLDSSLSRLNNKRGWWTPLFFTAGIASARYFFQHVSRQNTLTQARRNISRHYDLSNELF  621

Query  2195  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2374
             SLFLDETMTYSCAVFK+E EDLK AQ+RKISLLI+K +I K+H +LEIGCGWGSLAIE V
Sbjct  622   SLFLDETMTYSCAVFKTEGEDLKVAQLRKISLLIEKVRIDKKHEVLEIGCGWGSLAIEVV  681

Query  2375  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2554
             +RTGCKYTGITLSE+QLK+AE KV+EAGLQDNIRFLLCDYRQL D+ +YDRIISCEMLEA
Sbjct  682   KRTGCKYTGITLSEEQLKFAEMKVKEAGLQDNIRFLLCDYRQLSDSYKYDRIISCEMLEA  741

Query  2555  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2734
             VGHE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR
Sbjct  742   VGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSR  801

Query  2735  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2914
             VT+AMAASSRLC+EHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDY
Sbjct  802   VTTAMAASSRLCMEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDY  861

Query  2915  CAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             CAAGF T TLG+YQIVFSRPGN  AF +PY+ + S Y
Sbjct  862   CAAGFKTHTLGNYQIVFSRPGNAAAFSNPYESVVSTY  898


 Score =   326 bits (836),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 157/230 (68%), Positives = 179/230 (78%), Gaps = 23/230 (10%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGF-------  561
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV   LGF       
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVTGILGFRNGTIMS  60

Query  562   ----------------MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  693
                             M+   VTYPNMME FE+LGVDME+SDMSF+VSLD G G EWGSR
Sbjct  61    VNFVLLGTYILLDLIGMMARDVTYPNMMEFFETLGVDMELSDMSFAVSLDEGRGCEWGSR  120

Query  694   NGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGY  873
             NG S LFAQKKN+LNPYFWQMI +++KFK+DVL YLEE +NNPDMDRN TLG+FIK RGY
Sbjct  121   NGLSSLFAQKKNILNPYFWQMIGDVIKFKDDVLKYLEELENNPDMDRNQTLGDFIKCRGY  180

Query  874   SELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             SELFQKAY++P+CASIWSC +EGVM FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   SELFQKAYLVPICASIWSCPAEGVMTFSAFSVLSFCRNHHLLQLFGRPQW  230



>ref|XP_011029772.1| PREDICTED: uncharacterized protein LOC105129420 isoform X2 [Populus 
euphratica]
Length=865

 Score =  1066 bits (2756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/694 (73%), Positives = 590/694 (85%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    L+LFGRPQWLTV RRSHSYVNKVRE+LE  GC+IR GC
Sbjct  177   PSEGVMSFSAFSVLSFCRNHHLLELFGRPQWLTVTRRSHSYVNKVREKLESWGCQIRTGC  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             E+ +VST ++G A     +  ++ + E Y GCIMA HAPD L +LGKQATFDE RILGAF
Sbjct  237   EIQAVSTKDEGCA-----VLCRDGLLEMYSGCIMAVHAPDALALLGKQATFDETRILGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY+YSDI+LHR++ FMP+N AAWSAWNFLG+ +N+VCLTYWLN LQN+ +T  P+LVTLN
Sbjct  292   QYMYSDIFLHRDKKFMPQNSAAWSAWNFLGSTDNKVCLTYWLNVLQNIDETGLPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   P+  L+KW+TGHPVPSVAA++AS EL+ IQGKRRIWFCGAYQGYGFHEDGLK+GM+
Sbjct  352   PDHVPDHTLVKWSTGHPVPSVAATKASLELDHIQGKRRIWFCGAYQGYGFHEDGLKSGMV  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHGLL  RC+ L+NP HM PS  ETGARL VTRFL  +I TG +ILLEEGGTVF+FEGT
Sbjct  412   AAHGLLGNRCAILSNPKHMAPSMLETGARLFVTRFLGHYISTGCLILLEEGGTVFSFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              KK  LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFV+K EGLLNL  I + NRD+
Sbjct  472   SKKCSLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVNKDEGLLNLLMILIVNRDV  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             + S S+ N KRGWWTPLLFT+ IASAK+FI+H+SRQNTLTQARRNISRHYDLSNELF+LF
Sbjct  532   NKSASKLNKKRGWWTPLLFTAGIASAKFFIQHVSRQNTLTQARRNISRHYDLSNELFALF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSC VFK+EDEDLK AQMRKISLLI+KA ISK+H ILEIGCGWG+LAIEAV+RT
Sbjct  592   LDETMTYSCGVFKTEDEDLKDAQMRKISLLIEKAGISKDHEILEIGCGWGTLAIEAVQRT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLK+AE KV+EAGLQD I F LCDYRQLP   +YDRIISCEM+EAVGH
Sbjct  652   GCKYTGITLSEEQLKHAEMKVKEAGLQDRIAFHLCDYRQLPKTHKYDRIISCEMIEAVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M EFFG CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TS
Sbjct  712   EYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITS  771

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDY AA
Sbjct  772   AMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYSAA  831

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  832   GFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  865


 Score =   361 bits (926),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV+ DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVVGAGISGLVSAYVLAKAGVEVVLYEKENYLGGHAKTVSFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLG+DME+SDMSFSVSLD G G EWGSRNG SGLFAQKKN+L+PYFW+M+R
Sbjct  61    YPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLSPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DVLSYLE  +NNPD+DRN+TLG+F+KSRGYSELFQKAY+IP+C SIWSC SEG
Sbjct  121   EIIKFKDDVLSYLEMLENNPDVDRNETLGKFVKSRGYSELFQKAYLIPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM+FSA+S+LSFCRNHHLL+ F    W
Sbjct  181   VMSFSAFSVLSFCRNHHLLELFGRPQW  207



>ref|XP_011029770.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
 ref|XP_011029771.1| PREDICTED: uncharacterized protein LOC105129420 isoform X1 [Populus 
euphratica]
Length=866

 Score =  1064 bits (2752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/695 (74%), Positives = 590/695 (85%), Gaps = 8/695 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    L+LFGRPQWLTV RRSHSYVNKVRE+LE  GC+IR GC
Sbjct  177   PSEGVMSFSAFSVLSFCRNHHLLELFGRPQWLTVTRRSHSYVNKVREKLESWGCQIRTGC  236

Query  1124  EVHSVST-DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGA  1300
             E+ +VST DE G A     +  ++ + E Y GCIMA HAPD L +LGKQATFDE RILGA
Sbjct  237   EIQAVSTKDEAGCA-----VLCRDGLLEMYSGCIMAVHAPDALALLGKQATFDETRILGA  291

Query  1301  FQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTL  1480
             FQY+YSDI+LHR++ FMP+N AAWSAWNFLG+ +N+VCLTYWLN LQN+ +T  P+LVTL
Sbjct  292   FQYMYSDIFLHRDKKFMPQNSAAWSAWNFLGSTDNKVCLTYWLNVLQNIDETGLPFLVTL  351

Query  1481  NPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGM  1660
             NP   P+  L+KW+TGHPVPSVAA++AS EL+ IQGKRRIWFCGAYQGYGFHEDGLK+GM
Sbjct  352   NPDHVPDHTLVKWSTGHPVPSVAATKASLELDHIQGKRRIWFCGAYQGYGFHEDGLKSGM  411

Query  1661  IAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEG  1840
             +AAHGLL  RC+ L+NP HM PS  ETGARL VTRFL  +I TG +ILLEEGGTVF+FEG
Sbjct  412   VAAHGLLGNRCAILSNPKHMAPSMLETGARLFVTRFLGHYISTGCLILLEEGGTVFSFEG  471

Query  1841  TDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD  2020
             T KK  LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFV+K EGLLNL  I + NRD
Sbjct  472   TSKKCSLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVNKDEGLLNLLMILIVNRD  531

Query  2021  LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSL  2200
             ++ S S+ N KRGWWTPLLFT+ IASAK+FI+H+SRQNTLTQARRNISRHYDLSNELF+L
Sbjct  532   VNKSASKLNKKRGWWTPLLFTAGIASAKFFIQHVSRQNTLTQARRNISRHYDLSNELFAL  591

Query  2201  FLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVER  2380
             FLDETMTYSC VFK+EDEDLK AQMRKISLLI+KA ISK+H ILEIGCGWG+LAIEAV+R
Sbjct  592   FLDETMTYSCGVFKTEDEDLKDAQMRKISLLIEKAGISKDHEILEIGCGWGTLAIEAVQR  651

Query  2381  TGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVG  2560
             TGCKYTGITLSE+QLK+AE KV+EAGLQD I F LCDYRQLP   +YDRIISCEM+EAVG
Sbjct  652   TGCKYTGITLSEEQLKHAEMKVKEAGLQDRIAFHLCDYRQLPKTHKYDRIISCEMIEAVG  711

Query  2561  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  2740
             HE+M EFFG CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+T
Sbjct  712   HEYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRIT  771

Query  2741  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  2920
             SAMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDY A
Sbjct  772   SAMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYSA  831

Query  2921  AGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             AGF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  832   AGFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  866


 Score =   361 bits (926),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV+ DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVVGAGISGLVSAYVLAKAGVEVVLYEKENYLGGHAKTVSFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLG+DME+SDMSFSVSLD G G EWGSRNG SGLFAQKKN+L+PYFW+M+R
Sbjct  61    YPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLSPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DVLSYLE  +NNPD+DRN+TLG+F+KSRGYSELFQKAY+IP+C SIWSC SEG
Sbjct  121   EIIKFKDDVLSYLEMLENNPDVDRNETLGKFVKSRGYSELFQKAYLIPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM+FSA+S+LSFCRNHHLL+ F    W
Sbjct  181   VMSFSAFSVLSFCRNHHLLELFGRPQW  207



>ref|XP_011029773.1| PREDICTED: uncharacterized protein LOC105129420 isoform X3 [Populus 
euphratica]
Length=732

 Score =  1062 bits (2747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/694 (74%), Positives = 591/694 (85%), Gaps = 6/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    L+LFGRPQWLTV RRSHSYVNKVRE+LE  GC+IR GC
Sbjct  43    PSEGVMSFSAFSVLSFCRNHHLLELFGRPQWLTVTRRSHSYVNKVREKLESWGCQIRTGC  102

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             E+ +VST ++  AG  V+   ++ + E Y GCIMA HAPD L +LGKQATFDE RILGAF
Sbjct  103   EIQAVSTKDE--AGCAVLC--RDGLLEMYSGCIMAVHAPDALALLGKQATFDETRILGAF  158

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY+YSDI+LHR++ FMP+N AAWSAWNFLG+ +N+VCLTYWLN LQN+ +T  P+LVTLN
Sbjct  159   QYMYSDIFLHRDKKFMPQNSAAWSAWNFLGSTDNKVCLTYWLNVLQNIDETGLPFLVTLN  218

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   P+  L+KW+TGHPVPSVAA++AS EL+ IQGKRRIWFCGAYQGYGFHEDGLK+GM+
Sbjct  219   PDHVPDHTLVKWSTGHPVPSVAATKASLELDHIQGKRRIWFCGAYQGYGFHEDGLKSGMV  278

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHGLL  RC+ L+NP HM PS  ETGARL VTRFL  +I TG +ILLEEGGTVF+FEGT
Sbjct  279   AAHGLLGNRCAILSNPKHMAPSMLETGARLFVTRFLGHYISTGCLILLEEGGTVFSFEGT  338

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              KK  LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFV+K EGLLNL  I + NRD+
Sbjct  339   SKKCSLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVNKDEGLLNLLMILIVNRDV  398

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             + S S+ N KRGWWTPLLFT+ IASAK+FI+H+SRQNTLTQARRNISRHYDLSNELF+LF
Sbjct  399   NKSASKLNKKRGWWTPLLFTAGIASAKFFIQHVSRQNTLTQARRNISRHYDLSNELFALF  458

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSC VFK+EDEDLK AQMRKISLLI+KA ISK+H ILEIGCGWG+LAIEAV+RT
Sbjct  459   LDETMTYSCGVFKTEDEDLKDAQMRKISLLIEKAGISKDHEILEIGCGWGTLAIEAVQRT  518

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLK+AE KV+EAGLQD I F LCDYRQLP   +YDRIISCEM+EAVGH
Sbjct  519   GCKYTGITLSEEQLKHAEMKVKEAGLQDRIAFHLCDYRQLPKTHKYDRIISCEMIEAVGH  578

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M EFFG CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TS
Sbjct  579   EYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITS  638

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA SSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDY AA
Sbjct  639   AMATSSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYSAA  698

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  699   GFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  732


 Score =   125 bits (315),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +1

Query  808   FDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRN  987
              +NNPD+DRN+TLG+F+KSRGYSELFQKAY+IP+C SIWSC SEGVM+FSA+S+LSFCRN
Sbjct  2     LENNPDVDRNETLGKFVKSRGYSELFQKAYLIPVCGSIWSCPSEGVMSFSAFSVLSFCRN  61

Query  988   HHLLQNFSPALW  1023
             HHLL+ F    W
Sbjct  62    HHLLELFGRPQW  73



>ref|XP_010650134.1| PREDICTED: uncharacterized protein LOC100242555 isoform X3 [Vitis 
vinifera]
Length=865

 Score =  1060 bits (2741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/687 (74%), Positives = 587/687 (85%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F +    +FCR    LQLFG PQWLTVK  SH YVNKVREELE +GC+IR  CEV SVST
Sbjct  184   FSAFLVLSFCRNHHLLQLFGHPQWLTVKCCSHYYVNKVREELESKGCQIRTACEVVSVST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G      I  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV SDI
Sbjct  244   TDDG----CTIFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVSSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++FMP+N AAWSAWNFLGT+ N+VCL+YWLN LQN+  T  P+LVTLNP  TP+ 
Sbjct  299   FLHRDKNFMPQNPAAWSAWNFLGTIENKVCLSYWLNVLQNIDQTSLPFLVTLNPSHTPDH  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAH +L 
Sbjct  359   TLLKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHSILG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK LLK
Sbjct  419   KGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSGKKCLLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +++H+PQFYWK+ATQADLGLADAYI+GD S VDK EGL +LF IF+ANRDL +S+SR 
Sbjct  479   VALKIHNPQFYWKIATQADLGLADAYINGDFSLVDKDEGLQSLFMIFIANRDLDSSLSRL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N KRGWWTPL FT+ IASAKY+ +H+SRQNTLTQARRN+SRHYDLSNELFSLFLDETMTY
Sbjct  539   NKKRGWWTPLFFTAGIASAKYYFQHVSRQNTLTQARRNVSRHYDLSNELFSLFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK+E EDLK AQ+RKISLLI+KA+I K+H +LEIGCGWGSLAIE V++TGCKYTGI
Sbjct  599   SCAVFKTEGEDLKVAQLRKISLLIEKARIDKKHEVLEIGCGWGSLAIEVVKQTGCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             T S++QLK+AE KV+EAGLQDNIRFLLCDYRQLP++ +YDRIISC MLE+VGHE+M EFF
Sbjct  659   TPSKEQLKFAEMKVKEAGLQDNIRFLLCDYRQLPNSYKYDRIISCGMLESVGHEYMEEFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMA +SR
Sbjct  719   GCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMATASR  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TL
Sbjct  779   LCVEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTRTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GDYQIVFSRPGN TAF DPYK + S Y
Sbjct  839   GDYQIVFSRPGNATAFSDPYKSVVSPY  865


 Score =   341 bits (874),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+VT
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61    YPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK+DVL YLEE +NNPD+DRN TLG+FIK RGYSELFQKAY++P+CASIW CS+EG
Sbjct  121   EMIKFKDDVLKYLEELENNPDIDRNQTLGDFIKCRGYSELFQKAYLVPICASIWPCSAEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM+FSA+ +LSFCRNHHLLQ F    W
Sbjct  181   VMSFSAFLVLSFCRNHHLLQLFGHPQW  207



>ref|XP_010650133.1| PREDICTED: uncharacterized protein LOC100242555 isoform X2 [Vitis 
vinifera]
Length=866

 Score =  1060 bits (2740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/687 (74%), Positives = 587/687 (85%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F +    +FCR    LQLFG PQWLTVK  SH YVNKVREELE +GC+IR  CEV SVST
Sbjct  185   FSAFLVLSFCRNHHLLQLFGHPQWLTVKCCSHYYVNKVREELESKGCQIRTACEVVSVST  244

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G      I  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV SDI
Sbjct  245   TDDG----CTIFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVSSDI  299

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++FMP+N AAWSAWNFLGT+ N+VCL+YWLN LQN+  T  P+LVTLNP  TP+ 
Sbjct  300   FLHRDKNFMPQNPAAWSAWNFLGTIENKVCLSYWLNVLQNIDQTSLPFLVTLNPSHTPDH  359

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAH +L 
Sbjct  360   TLLKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHSILG  419

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK LLK
Sbjct  420   KGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSGKKCLLK  479

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +++H+PQFYWK+ATQADLGLADAYI+GD S VDK EGL +LF IF+ANRDL +S+SR 
Sbjct  480   VALKIHNPQFYWKIATQADLGLADAYINGDFSLVDKDEGLQSLFMIFIANRDLDSSLSRL  539

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N KRGWWTPL FT+ IASAKY+ +H+SRQNTLTQARRN+SRHYDLSNELFSLFLDETMTY
Sbjct  540   NKKRGWWTPLFFTAGIASAKYYFQHVSRQNTLTQARRNVSRHYDLSNELFSLFLDETMTY  599

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK+E EDLK AQ+RKISLLI+KA+I K+H +LEIGCGWGSLAIE V++TGCKYTGI
Sbjct  600   SCAVFKTEGEDLKVAQLRKISLLIEKARIDKKHEVLEIGCGWGSLAIEVVKQTGCKYTGI  659

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             T S++QLK+AE KV+EAGLQDNIRFLLCDYRQLP++ +YDRIISC MLE+VGHE+M EFF
Sbjct  660   TPSKEQLKFAEMKVKEAGLQDNIRFLLCDYRQLPNSYKYDRIISCGMLESVGHEYMEEFF  719

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMA +SR
Sbjct  720   GCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMATASR  779

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TL
Sbjct  780   LCVEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTRTL  839

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GDYQIVFSRPGN TAF DPYK + S Y
Sbjct  840   GDYQIVFSRPGNATAFSDPYKSVVSPY  866


 Score =   337 bits (863),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR-V  579
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+ V
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQQV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
              E++KFK+DVL YLEE +NNPD+DRN TLG+FIK RGYSELFQKAY++P+CASIW CS+E
Sbjct  121   GEMIKFKDDVLKYLEELENNPDIDRNQTLGDFIKCRGYSELFQKAYLVPICASIWPCSAE  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GVM+FSA+ +LSFCRNHHLLQ F    W
Sbjct  181   GVMSFSAFLVLSFCRNHHLLQLFGHPQW  208



>ref|XP_002311690.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEE89057.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=858

 Score =  1058 bits (2736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/694 (73%), Positives = 585/694 (84%), Gaps = 14/694 (2%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    L++FGRPQWLTV RRSHSYV+KVRE+LE  GC+IR GC
Sbjct  177   PSEGVMSFSAFSVLSFCRNHHLLEVFGRPQWLTVTRRSHSYVDKVREKLESWGCQIRTGC  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             E+            G   +  ++ + E Y GCIMA HAPD L +LGKQATFDE RILGAF
Sbjct  237   EI------------GCCAVLCRDGLLEMYSGCIMAVHAPDALALLGKQATFDETRILGAF  284

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY+YSDI+LHR++ FMP+N AAWSAWNFLG+ +N+VCLTYWLN LQN+ +T  P+LVTLN
Sbjct  285   QYMYSDIFLHRDKKFMPQNSAAWSAWNFLGSTDNKVCLTYWLNVLQNIDETGLPFLVTLN  344

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   P+  L+KW+TGHPVPSVAA++AS EL+ IQGKRRIWFCGAYQGYGFHEDGLK+GM+
Sbjct  345   PDHAPDHTLVKWSTGHPVPSVAATKASLELDHIQGKRRIWFCGAYQGYGFHEDGLKSGMV  404

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHGLL   C+ L+NP HM PS  ETGARL VTRFL  +I TG +ILLEEGGTVF+FEGT
Sbjct  405   AAHGLLGNSCAILSNPKHMAPSMLETGARLFVTRFLGHYISTGCLILLEEGGTVFSFEGT  464

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              KK  LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFV+K EGLLNLF I + NRD 
Sbjct  465   SKKCSLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVNKDEGLLNLFMILIVNRDA  524

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             + S S+ N KRGWWTPLLFT+ IASAK+FI+HISRQNTLTQARRNISRHYDLSNELF+LF
Sbjct  525   NKSASKLNKKRGWWTPLLFTAGIASAKFFIQHISRQNTLTQARRNISRHYDLSNELFALF  584

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSC VFK+EDEDLK AQMRKISLLI+KA+ISK+H ILEIGCGWG+LAIEAV+RT
Sbjct  585   LDETMTYSCGVFKTEDEDLKDAQMRKISLLIEKARISKDHEILEIGCGWGTLAIEAVQRT  644

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYAE KV+EAGLQD I F LCDYRQLP   +YDRIISCEM+EAVGH
Sbjct  645   GCKYTGITLSEEQLKYAEMKVKEAGLQDRIAFHLCDYRQLPKTHKYDRIISCEMIEAVGH  704

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M EFFG CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TS
Sbjct  705   EYMEEFFGCCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITS  764

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAASSRLCVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDYCAA
Sbjct  765   AMAASSRLCVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYCAA  824

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLG+YQ+VFSRPGNV A  +PYK   SAY
Sbjct  825   GFKTHTLGNYQVVFSRPGNVVALSNPYKSFPSAY  858


 Score =   364 bits (935),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV+ DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVVGAGISGLVSAYVLAKAGVEVVLYEKEDYLGGHAKTVSFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLG+DME+SDMSFSVSLD G G EWGSRNG SGLFAQKKN+LNPYFW+M+R
Sbjct  61    YPNMMEFFESLGIDMELSDMSFSVSLDEGQGCEWGSRNGLSGLFAQKKNMLNPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DVLSYLE  +NNPD+DRN+TLG+F+KSRGYSELFQKAY+IP+C SIWSC SEG
Sbjct  121   EIIKFKDDVLSYLEMLENNPDVDRNETLGKFVKSRGYSELFQKAYLIPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM+FSA+S+LSFCRNHHLL+ F    W
Sbjct  181   VMSFSAFSVLSFCRNHHLLEVFGRPQW  207



>ref|XP_004296397.1| PREDICTED: uncharacterized protein LOC101309817 [Fragaria vesca 
subsp. vesca]
Length=865

 Score =  1055 bits (2729),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/687 (74%), Positives = 584/687 (85%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV+ RSH YV KVRE LE +GC IR  CEVH VST
Sbjct  184   FSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCRIRTSCEVHKVST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
             +++GS     ++SG    +E Y+GCIMA HAPD +++LG QAT DELR+LGAFQYVYSDI
Sbjct  244   NDEGS----TVVSGDEF-EEIYNGCIMAVHAPDAVRILGDQATSDELRVLGAFQYVYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR++  MP+N AAWSAWNFLG+ +N+VCLTYWLN LQNLG+T  P+LVTLNP  TP+ 
Sbjct  299   FLHRDKDLMPQNPAAWSAWNFLGSTDNKVCLTYWLNVLQNLGETSLPFLVTLNPDHTPKH  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+T HP+PSVAAS+A+ EL  IQGKR IWFCGAYQGYGFHEDGLKAGM AAHG+L 
Sbjct  359   TLLKWSTTHPIPSVAASKAALELPHIQGKRGIWFCGAYQGYGFHEDGLKAGMAAAHGILG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
               C+ L+NP HMVPS  ETGARL VTRF+  +I TG +ILLEEGGT+FTFEGT K   LK
Sbjct  419   NNCALLSNPKHMVPSLTETGARLFVTRFIRHYISTGCLILLEEGGTMFTFEGTRKGCSLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              +++VH+PQFYWKV TQADLGLADAYI+GD SFVDK  GLLNLF I +ANRD  +S S+ 
Sbjct  479   CVLKVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDRGLLNLFMILIANRDNDSSDSKL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWWTP+LFT++IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  539   IKKRGWWTPMLFTASIASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S AVFK+EDE+LK AQ+RKIS+LI+KAKISK H +LEIGCGWGSLAIE V +TGC+YTGI
Sbjct  599   SSAVFKTEDEELKIAQLRKISILIEKAKISKNHEVLEIGCGWGSLAIEVVRQTGCRYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS++QLKYA+ KV++A LQD IRFLLCDYRQ+P N + DRIISCEMLE+VGHEFMN+FF
Sbjct  659   TLSQEQLKYAQQKVKDADLQDRIRFLLCDYRQMPANYKCDRIISCEMLESVGHEFMNDFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               CESVLAENG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAM  SSR
Sbjct  719   ASCESVLAENGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMVNSSR  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH+E+IGIHYYQTLR WR NFLERQS+IL LGF++KFIRTWEYYFDYCAAGF T TL
Sbjct  779   LCVEHIENIGIHYYQTLRYWRKNFLERQSEILALGFNEKFIRTWEYYFDYCAAGFKTYTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  839   GNYQIVFSRPGNVPAFSNPYKGFPSAY  865


 Score =   350 bits (898),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 186/216 (86%), Gaps = 2/216 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG+GISGLV+AYVLAK G  V +YEKEDYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVVGSGISGLVAAYVLAKDGVEVDLYEKEDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGV+MEISDMSFS SLD G GYEWGSRNG S LFAQK N+LNPYFWQM+R
Sbjct  61    YPNMMEFFESLGVEMEISDMSFSASLDKGKGYEWGSRNGLSSLFAQKSNVLNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D LSYLE  +NNPD+DRN+TLG+FI+SR YSELFQKAY++P+C SIWSC +EG
Sbjct  121   EITKFKHDALSYLEVRENNPDIDRNETLGKFIESRHYSELFQKAYLVPICGSIWSCPAEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALWSPT--MAHC  1044
             VM+FSA+S+LSFCRNHHLLQ F    W      +HC
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHC  216



>ref|XP_010650132.1| PREDICTED: uncharacterized protein LOC100242555 isoform X1 [Vitis 
vinifera]
Length=868

 Score =  1055 bits (2728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/689 (74%), Positives = 587/689 (85%), Gaps = 9/689 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F +    +FCR    LQLFG PQWLTVK  SH YVNKVREELE +GC+IR  CEV SVST
Sbjct  185   FSAFLVLSFCRNHHLLQLFGHPQWLTVKCCSHYYVNKVREELESKGCQIRTACEVVSVST  244

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G      I  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV SDI
Sbjct  245   TDDG----CTIFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVSSDI  299

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++FMP+N AAWSAWNFLGT+ N+VCL+YWLN LQN+  T  P+LVTLNP  TP+ 
Sbjct  300   FLHRDKNFMPQNPAAWSAWNFLGTIENKVCLSYWLNVLQNIDQTSLPFLVTLNPSHTPDH  359

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAH +L 
Sbjct  360   TLLKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHSILG  419

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK LLK
Sbjct  420   KGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSGKKCLLK  479

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +++H+PQFYWK+ATQADLGLADAYI+GD S VDK EGL +LF IF+ANRDL +S+SR 
Sbjct  480   VALKIHNPQFYWKIATQADLGLADAYINGDFSLVDKDEGLQSLFMIFIANRDLDSSLSRL  539

Query  2045  NSK--RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETM  2218
             N K  RGWWTPL FT+ IASAKY+ +H+SRQNTLTQARRN+SRHYDLSNELFSLFLDETM
Sbjct  540   NKKSFRGWWTPLFFTAGIASAKYYFQHVSRQNTLTQARRNVSRHYDLSNELFSLFLDETM  599

Query  2219  TYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYT  2398
             TYSCAVFK+E EDLK AQ+RKISLLI+KA+I K+H +LEIGCGWGSLAIE V++TGCKYT
Sbjct  600   TYSCAVFKTEGEDLKVAQLRKISLLIEKARIDKKHEVLEIGCGWGSLAIEVVKQTGCKYT  659

Query  2399  GITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNE  2578
             GIT S++QLK+AE KV+EAGLQDNIRFLLCDYRQLP++ +YDRIISC MLE+VGHE+M E
Sbjct  660   GITPSKEQLKFAEMKVKEAGLQDNIRFLLCDYRQLPNSYKYDRIISCGMLESVGHEYMEE  719

Query  2579  FFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAAS  2758
             FFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMA +
Sbjct  720   FFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMATA  779

Query  2759  SRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTC  2938
             SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T 
Sbjct  780   SRLCVEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTR  839

Query  2939  TLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  840   TLGDYQIVFSRPGNATAFSDPYKSVVSPY  868


 Score =   336 bits (862),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR-V  579
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+ V
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQQV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
              E++KFK+DVL YLEE +NNPD+DRN TLG+FIK RGYSELFQKAY++P+CASIW CS+E
Sbjct  121   GEMIKFKDDVLKYLEELENNPDIDRNQTLGDFIKCRGYSELFQKAYLVPICASIWPCSAE  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GVM+FSA+ +LSFCRNHHLLQ F    W
Sbjct  181   GVMSFSAFLVLSFCRNHHLLQLFGHPQW  208



>ref|XP_006493505.1| PREDICTED: uncharacterized protein LOC102615883 isoform X1 [Citrus 
sinensis]
 ref|XP_006493506.1| PREDICTED: uncharacterized protein LOC102615883 isoform X2 [Citrus 
sinensis]
Length=869

 Score =  1055 bits (2727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/694 (74%), Positives = 585/694 (84%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RSHSYVNKVR++LE  GC+IR   
Sbjct  181   PSEGVTSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHSYVNKVRKQLESWGCQIRTSS  240

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV SV   ++G      I+ G    +E Y+ C+MA HAPD LK+LG QATFDE RILGAF
Sbjct  241   EVCSVLPADKG----CTIVCGDG-SREFYNSCVMALHAPDALKILGNQATFDETRILGAF  295

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDI+LHR++ FMP+N AAWSAWNFL + +++VCLTYWLN LQNLG+T  P+LVTLN
Sbjct  296   QYVYSDIFLHRDKRFMPQNPAAWSAWNFLESFDSKVCLTYWLNVLQNLGETSLPFLVTLN  355

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   PE  LLKW+TGHPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  356   PDHVPEHTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMT  415

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHG+L K C+ L+NP HMVPS  ETGARL V RFL  +I TGS+ILLEEGGT+FTFEGT
Sbjct  416   AAHGVLGKSCTLLSNPRHMVPSLKETGARLFVARFLGQYISTGSMILLEEGGTIFTFEGT  475

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K   LK ++R+HSPQFYWKV TQADLGLADAYI+GD SFVDK EGLLNLF I +ANRDL
Sbjct  476   RKNCHLKTVLRIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNLFMILIANRDL  535

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              +SVS+   KRGWW+P+LFT+ IASAKYF RHISRQNTLTQARRNISRHYDLSNELFSLF
Sbjct  536   DSSVSKLKQKRGWWSPMLFTAGIASAKYFFRHISRQNTLTQARRNISRHYDLSNELFSLF  595

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDE+MTYSCAVFKSEDEDLK AQMRK+SLLI+KA++SK   +LEIGCGWG+LAIE V+RT
Sbjct  596   LDESMTYSCAVFKSEDEDLKAAQMRKVSLLIEKARVSKGQEVLEIGCGWGTLAIEIVKRT  655

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYAE KV+EAGLQD+IR  LCDYRQL    +YDRIISCEM+EAVGH
Sbjct  656   GCKYTGITLSEEQLKYAEMKVKEAGLQDHIRLYLCDYRQLAKANKYDRIISCEMIEAVGH  715

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM EFFG CES+L E+G+LVLQFISIPDERY+EYR SSDFIKEYIFPGGCLPSLSR+TS
Sbjct  716   EFMEEFFGCCESLLVEDGLLVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPSLSRITS  775

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLCVE +E+IGIHYYQTLRCWR NF+E+QS+IL LGF+ KFIRTWEYYFDYCAA
Sbjct  776   AMSAASRLCVEQVENIGIHYYQTLRCWRKNFMEKQSKILALGFNDKFIRTWEYYFDYCAA  835

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF + TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  836   GFKSYTLGNYQIVFSRPGNVAAFSNPYKGFPSAY  869


 Score =   360 bits (924),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KMRVAV+GAGISGLVSAYVLAK G  VV+YEK+DYLGGHAKTVT DGVDLDLGFMVFNRV
Sbjct  4     KMRVAVIGAGISGLVSAYVLAKAGVEVVLYEKDDYLGGHAKTVTFDGVDLDLGFMVFNRV  63

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFWQM+
Sbjct  64    TYPNMMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFWQML  123

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK+DVL YL+E ++NPD+DR++TLG+F+ SRGYSELFQKAY+IP+C SIWSC SE
Sbjct  124   REIIKFKDDVLGYLKELESNPDIDRSETLGQFVNSRGYSELFQKAYLIPICGSIWSCPSE  183

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV +FSA+S+LSFCRNHHLLQ F    W
Sbjct  184   GVTSFSAFSVLSFCRNHHLLQLFGRPQW  211



>ref|XP_007227011.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
 gb|EMJ28210.1| hypothetical protein PRUPE_ppa001275mg [Prunus persica]
Length=866

 Score =  1051 bits (2719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/693 (74%), Positives = 587/693 (85%), Gaps = 8/693 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RSH YV KVR+ LE +GC+IR   
Sbjct  177   PSEGVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVRQVLESKGCQIRTSS  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EVH VST ++G +    ++SG  + +E YD C+MA HAPD +++LG QAT DELR+LGAF
Sbjct  237   EVHRVSTTDEGCS----VLSGDGL-EEIYDRCVMAVHAPDAVRILGDQATSDELRVLGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDI+LHR+++ MP+N AAWSAWNFLG+  N+VCLTYWLN LQN+ +   P+LVTLN
Sbjct  292   QYVYSDIFLHRDKTLMPQNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDEKGLPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TPE  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  352   PDHTPEHTLLKWSTSHPVPSVAASKASVELHRIQGKRGIWFCGAYQGYGFHEDGLKAGMA  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHG+L K CS L+NP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT+F FEGT
Sbjct  412   AAHGMLGKGCSLLSNPKHMVPSLTETGARLFVTRFLRHYISTGCLILLEEGGTIFNFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K   LK ++RVH+PQFYWKV TQADLGLADAYI+ D SF+DK +GLLNLF I +ANRD 
Sbjct  472   RKGCSLKCVLRVHTPQFYWKVMTQADLGLADAYINRDFSFIDKDKGLLNLFMILIANRDS  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S S+ N KRGWWTPLLFT++IASAKYF +H+SRQNTLTQARRNISRHYDLSN+LFSLF
Sbjct  532   NSSDSKLNKKRGWWTPLLFTASIASAKYFFQHVSRQNTLTQARRNISRHYDLSNDLFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYS AVFK+EDEDLKTAQ+RKISL I+K++I K H +LEIGCGWGSLAIE V++T
Sbjct  592   LDETMTYSSAVFKTEDEDLKTAQLRKISLFIEKSRIEKNHEVLEIGCGWGSLAIEVVKQT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYA+ KV++AGLQD IRFLLCDYRQLP N +YDRIISCEMLE+VGH
Sbjct  652   GCKYTGITLSEEQLKYAQKKVKDAGLQDRIRFLLCDYRQLP-NYKYDRIISCEMLESVGH  710

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM+EFF  CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTS
Sbjct  711   EFMDEFFACCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTS  770

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAASSRLCVEHLE+IGIHYYQTLRCWR NFLER S+IL LGF++ FIRTWEYYFDYCAA
Sbjct  771   AMAASSRLCVEHLENIGIHYYQTLRCWRKNFLERHSEILALGFNENFIRTWEYYFDYCAA  830

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             GF T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  831   GFKTYTLGNYQIVFSRPGNTPAFADPYKGFPSA  863


 Score =   358 bits (919),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFWQM+R
Sbjct  61    YPNMMELFERLGVDMETSDMSFSASLDKGQGCEWGSRNGLSSLFAQKRNLFNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D ++YLEE +NNPD+DRN+TLG+FIKSRGYSELFQKAY++P+C SIWSC SEG
Sbjct  121   EITKFKHDAINYLEELENNPDIDRNETLGQFIKSRGYSELFQKAYLVPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALWSPT--MAHC  1044
             VM+FSA+S+LSFCRNHHLLQ F    W      +HC
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHC  216



>ref|XP_010317817.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317818.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010317819.1| PREDICTED: uncharacterized protein LOC101256851 isoform X2 [Solanum 
lycopersicum]
Length=805

 Score =  1051 bits (2718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/672 (75%), Positives = 579/672 (86%), Gaps = 5/672 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQ+F  PQ LTV+ RS +YVNKV+EELEKRGC+IR GCEV+SVST+E+G       I+  
Sbjct  136   LQIFDLPQLLTVRWRSQTYVNKVKEELEKRGCQIRTGCEVNSVSTNEEGCT-----IACT  190

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
             +   E YDGCI+  HAPDTLKMLG++AT+DE RILGAF Y+YSDI+LHR+++F+P N  A
Sbjct  191   DGATEVYDGCIITTHAPDTLKMLGEEATYDETRILGAFHYIYSDIFLHRDKTFLPHNPEA  250

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSA NFLGT+N+R C+TY LN +QNLGD+ QPYLVTL+PP+ P+  LLKWTTGH VPSVA
Sbjct  251   WSACNFLGTMNDRSCVTYSLNIMQNLGDSNQPYLVTLDPPQEPDHTLLKWTTGHLVPSVA  310

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             AS+AS+EL +IQGKR IWFCG YQGYGFHEDGLKAGM+AA G+L++ C  L+NP HMVP+
Sbjct  311   ASKASNELHQIQGKRGIWFCGTYQGYGFHEDGLKAGMVAADGMLRRNCRILDNPKHMVPT  370

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
             W ETGARL+VTRFL SFI TG IILLEEGGT+FTF+GTD+K  LKVL+R+HS +FYWKVA
Sbjct  371   WTETGARLVVTRFLKSFIETGCIILLEEGGTIFTFQGTDRKCCLKVLLRIHSTKFYWKVA  430

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             TQADLGLADA+IHGD SFVDK EGLLNL  IFVANRD+ ASV RS+ KRGWW PL+FT+A
Sbjct  431   TQADLGLADAFIHGDFSFVDKNEGLLNLLMIFVANRDMKASVKRSSKKRGWWMPLIFTAA  490

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
             ++SAKYFI+H+S  NTLTQARRNISRHYDLSNELFSLFLDETMTYSCA+FKSEDEDLK A
Sbjct  491   LSSAKYFIQHVSNHNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAIFKSEDEDLKDA  550

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q+RKI  LI KAKIS EHHILEIG GWGSLA+E V++TGCKYTGITLSEQQL+YA+ +V 
Sbjct  551   QLRKIRRLISKAKISAEHHILEIGFGWGSLAMEVVKQTGCKYTGITLSEQQLEYAQLRVE  610

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             +AGLQD I FLLCDYRQ+P+  +YDRIISC MLE VGH+F+ EFF  CES LAE G+LVL
Sbjct  611   QAGLQDQITFLLCDYRQIPNKDKYDRIISCGMLEHVGHDFIGEFFTCCESALAEYGLLVL  670

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2809
             QFISIPDERY+EYRQSSDF+KEYIFPGGC+P+LSRVTSAMAA+SRLCVEHLE+IGIHYYQ
Sbjct  671   QFISIPDERYEEYRQSSDFMKEYIFPGGCVPALSRVTSAMAAASRLCVEHLEEIGIHYYQ  730

Query  2810  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  2989
             TLRCWR NFL+ +SQI  LGFD KFIRTWEYYFDYCAAGF TCT+GDYQIVFSRPGNV  
Sbjct  731   TLRCWRENFLKNKSQIRSLGFDDKFIRTWEYYFDYCAAGFKTCTIGDYQIVFSRPGNVAV  790

Query  2990  FGDPYKGLASAY  3025
             FGDPY    S Y
Sbjct  791   FGDPYNYSPSTY  802


 Score =   223 bits (567),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FE LGVDME   MS SVSLD+GHG EWG+R GFS LFAQKKNLLNPYF QMIREI+
Sbjct  1     MMEFFECLGVDMETYHMSLSVSLDHGHGCEWGTRKGFSSLFAQKKNLLNPYFLQMIREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             +FK DV+SYLEE DNNPD+D N+TLG+FIKS GYSELFQKAY+IP+CASIWSC   GV++
Sbjct  61    RFKQDVISYLEEVDNNPDIDCNETLGQFIKSHGYSELFQKAYLIPICASIWSCPLAGVLS  120

Query  952   FSAYSILSFCRNHHLLQNF  1008
             FS+Y IL F R+HHLLQ F
Sbjct  121   FSSYYILLFFRDHHLLQIF  139



>ref|XP_010264925.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010264926.1| PREDICTED: uncharacterized protein LOC104602804 isoform X1 [Nelumbo 
nucifera]
Length=865

 Score =  1051 bits (2718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/687 (73%), Positives = 593/687 (86%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTVK RSH+YVNKV+EELEKR CEI+ G  V SVST
Sbjct  184   FSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHAYVNKVQEELEKRNCEIKTGYAVQSVST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              +    GG  +I G++  Q+ Y+GC++A HAPD L MLG +AT++E R+LGAFQY YSDI
Sbjct  244   FD----GGCTVI-GEDGSQDTYNGCVIAVHAPDALTMLGTEATYEERRVLGAFQYAYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLHR++  MP+N  AWSAWNFLGT +N+VCLTYWLN LQN+G+T  P+LVTLNPP  PE 
Sbjct  299   YLHRDKKLMPQNPTAWSAWNFLGTTDNKVCLTYWLNVLQNIGETSLPFLVTLNPPYIPEH  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              +LKW+T HPVPSVAAS AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAH  L 
Sbjct  359   NILKWSTSHPVPSVAASNASLELDEIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHTFLG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ L NP  MVPS  ETGARL+VTRFL  +I  G ++LLEEGGTVFTFEG++KK  LK
Sbjct  419   KNCAVLKNPEQMVPSLAETGARLIVTRFLRHYISAGCLMLLEEGGTVFTFEGSNKKCPLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              +++VH+PQFYWKVAT+AD+GLADAYI+GD SFVDK+EGLLNLF IF+ANR+L +S +R+
Sbjct  479   CVLKVHNPQFYWKVATEADIGLADAYINGDFSFVDKEEGLLNLFMIFIANRNLDSSDARN  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N++RGWWTPL  T+AIASAKYF  HISRQNTLTQARRNISRHYDLSN+LF+LFLD+TMTY
Sbjct  539   NNRRGWWTPLFLTAAIASAKYFFWHISRQNTLTQARRNISRHYDLSNDLFALFLDKTMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FK+E+EDLK AQ+RKIS+LI+KA+I + H ILEIGCGWGSLAIE V++TGCKYTGI
Sbjct  599   SCAIFKAENEDLKVAQLRKISVLIEKARIERNHEILEIGCGWGSLAIEVVKQTGCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLKYAE +V+EAGLQD+I+FLLCDYRQLP + +YDRIISCEMLEAVGHE+M EF 
Sbjct  659   TLSEEQLKYAEQRVKEAGLQDHIKFLLCDYRQLPYSHKYDRIISCEMLEAVGHEYMEEFL  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLAENG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGC+PSLSRVTSAMA++SR
Sbjct  719   GCCESVLAENGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCIPSLSRVTSAMASASR  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEHLE+IGIHYYQTL  WR +F+E+QS+IL LGFD+KFIRTWEYYF YCAAGF + TL
Sbjct  779   LCVEHLENIGIHYYQTLIYWRNSFMEKQSEILALGFDEKFIRTWEYYFIYCAAGFRSRTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQIVFSRPGN+TAF DPYKGL SA+
Sbjct  839   GNYQIVFSRPGNLTAFSDPYKGLPSAF  865


 Score =   353 bits (906),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGLVSAYVLA  G  VV+YEKEDYLGGH++TVT+DG+DLDLGFMVFNRVT
Sbjct  1     MRVAVVGAGISGLVSAYVLANAGVDVVLYEKEDYLGGHSRTVTIDGLDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGV+ME SDMSFSVSLD GH YEWGSRNG + LFAQK N LNPYFW+M+R
Sbjct  61    YPNMMEFFESLGVEMETSDMSFSVSLDKGHDYEWGSRNGLASLFAQKTNALNPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV  YLEE +NNPD+DRN+TLG FI+S GYSELF+KAY+ PMCASIWSCSSEG
Sbjct  121   EIIKFKEDVFKYLEELENNPDLDRNETLGHFIESHGYSELFEKAYLAPMCASIWSCSSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
              M FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   AMGFSAFSVLSFCRNHHLLQLFGRPQW  207



>ref|XP_009357997.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357998.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009357999.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009358000.1| PREDICTED: uncharacterized protein LOC103948676 isoform X1 [Pyrus 
x bretschneideri]
Length=863

 Score =  1051 bits (2718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/689 (74%), Positives = 587/689 (85%), Gaps = 8/689 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RSH YV KVRE LE +GC IR   
Sbjct  177   PSEGVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCHIRTSS  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EVH VST ++G      +ISG  + +E ++GCIMA HAPD +++LG QAT DELR+LGAF
Sbjct  237   EVHRVSTSDEG----CTVISGDGL-EEVFNGCIMAVHAPDAVRILGDQATSDELRVLGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDI+LHR+++ MPRN AAWSAWNFLG+  N+VCLTYWLN LQN+ +T  P+LVTLN
Sbjct  292   QYVYSDIFLHRDKNLMPRNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDETGLPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TP+  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  352   PEHTPKHTLLKWSTSHPVPSVAASKASLELPRIQGKRGIWFCGAYQGYGFHEDGLKAGMA  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHG L K C+ L+NP HMVPS  ETGARL VTRFL  FI TG +I LEEGGT+FTFEGT
Sbjct  412   AAHGFLGKGCALLDNPKHMVPSLTETGARLFVTRFLTHFISTGCLIFLEEGGTIFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K   LK +++VH+PQFYWKV TQADLGLADAYI+GD SFVDK +GLLNL  I +ANRD 
Sbjct  472   GKGCSLKCVIKVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDKGLLNLIMILIANRDA  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S S+   KRGWWTPLLFT++IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLF
Sbjct  532   NSSDSKLTKKRGWWTPLLFTASIASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYS AVFK+E+EDLK AQ+RKIS+LI+KA+I K H +LEIGCGWGSLAI+ V++T
Sbjct  592   LDETMTYSSAVFKTENEDLKVAQLRKISILIEKARIEKNHEVLEIGCGWGSLAIKVVKQT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYA++KV+EAGLQD I+FLLCDYRQL +N +YDRIISCEMLE+VGH
Sbjct  652   GCKYTGITLSEEQLKYAQEKVKEAGLQDRIKFLLCDYRQLANN-KYDRIISCEMLESVGH  710

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM+EFF  CESVLAENG+LVLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPSLSRVTS
Sbjct  711   EFMDEFFSCCESVLAENGLLVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTS  770

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAASSRLCVEHLE+IGIHY+QTLR WR NFLERQS+IL LGFD+KFIRTWEYYFDYCAA
Sbjct  771   AMAASSRLCVEHLENIGIHYFQTLRYWRKNFLERQSEILALGFDEKFIRTWEYYFDYCAA  830

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKG  3010
             GF TCTLG+YQ+VFSRPGNV AF +PY+G
Sbjct  831   GFRTCTLGNYQMVFSRPGNVPAFSNPYEG  859


 Score =   361 bits (927),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 189/216 (88%), Gaps = 2/216 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+GAGISGLVSAYVLAK G  VVVYEK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVIGAGISGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME SDMSFS SLDNG G EWGSRNG SGLFAQK NL+NPYFWQM+R
Sbjct  61    YPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGSRNGLSGLFAQKTNLINPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D ++YLEE +NNPD+DR++TLG+FIKSRGYSELFQKAY++P+C SIWSC SEG
Sbjct  121   EITKFKHDAINYLEELENNPDIDRSETLGQFIKSRGYSELFQKAYLVPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALWSPT--MAHC  1044
             VM+FSA+S+LSFCRNHHLLQ F    W      +HC
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHC  216



>ref|XP_004234691.1| PREDICTED: uncharacterized protein LOC101256851 isoform X1 [Solanum 
lycopersicum]
Length=868

 Score =  1051 bits (2718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/672 (75%), Positives = 579/672 (86%), Gaps = 5/672 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQ+F  PQ LTV+ RS +YVNKV+EELEKRGC+IR GCEV+SVST+E+G       I+  
Sbjct  199   LQIFDLPQLLTVRWRSQTYVNKVKEELEKRGCQIRTGCEVNSVSTNEEGCT-----IACT  253

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
             +   E YDGCI+  HAPDTLKMLG++AT+DE RILGAF Y+YSDI+LHR+++F+P N  A
Sbjct  254   DGATEVYDGCIITTHAPDTLKMLGEEATYDETRILGAFHYIYSDIFLHRDKTFLPHNPEA  313

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSA NFLGT+N+R C+TY LN +QNLGD+ QPYLVTL+PP+ P+  LLKWTTGH VPSVA
Sbjct  314   WSACNFLGTMNDRSCVTYSLNIMQNLGDSNQPYLVTLDPPQEPDHTLLKWTTGHLVPSVA  373

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             AS+AS+EL +IQGKR IWFCG YQGYGFHEDGLKAGM+AA G+L++ C  L+NP HMVP+
Sbjct  374   ASKASNELHQIQGKRGIWFCGTYQGYGFHEDGLKAGMVAADGMLRRNCRILDNPKHMVPT  433

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
             W ETGARL+VTRFL SFI TG IILLEEGGT+FTF+GTD+K  LKVL+R+HS +FYWKVA
Sbjct  434   WTETGARLVVTRFLKSFIETGCIILLEEGGTIFTFQGTDRKCCLKVLLRIHSTKFYWKVA  493

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             TQADLGLADA+IHGD SFVDK EGLLNL  IFVANRD+ ASV RS+ KRGWW PL+FT+A
Sbjct  494   TQADLGLADAFIHGDFSFVDKNEGLLNLLMIFVANRDMKASVKRSSKKRGWWMPLIFTAA  553

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
             ++SAKYFI+H+S  NTLTQARRNISRHYDLSNELFSLFLDETMTYSCA+FKSEDEDLK A
Sbjct  554   LSSAKYFIQHVSNHNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAIFKSEDEDLKDA  613

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q+RKI  LI KAKIS EHHILEIG GWGSLA+E V++TGCKYTGITLSEQQL+YA+ +V 
Sbjct  614   QLRKIRRLISKAKISAEHHILEIGFGWGSLAMEVVKQTGCKYTGITLSEQQLEYAQLRVE  673

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             +AGLQD I FLLCDYRQ+P+  +YDRIISC MLE VGH+F+ EFF  CES LAE G+LVL
Sbjct  674   QAGLQDQITFLLCDYRQIPNKDKYDRIISCGMLEHVGHDFIGEFFTCCESALAEYGLLVL  733

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2809
             QFISIPDERY+EYRQSSDF+KEYIFPGGC+P+LSRVTSAMAA+SRLCVEHLE+IGIHYYQ
Sbjct  734   QFISIPDERYEEYRQSSDFMKEYIFPGGCVPALSRVTSAMAAASRLCVEHLEEIGIHYYQ  793

Query  2810  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  2989
             TLRCWR NFL+ +SQI  LGFD KFIRTWEYYFDYCAAGF TCT+GDYQIVFSRPGNV  
Sbjct  794   TLRCWRENFLKNKSQIRSLGFDDKFIRTWEYYFDYCAAGFKTCTIGDYQIVFSRPGNVAV  853

Query  2990  FGDPYKGLASAY  3025
             FGDPY    S Y
Sbjct  854   FGDPYNYSPSTY  865


 Score =   319 bits (818),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 149/202 (74%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+V VVGAGI+GL+SAY LAK G  VV+YEKE ++GGHAKTV +DGV+LDLGF++FNRVT
Sbjct  1     MKVGVVGAGINGLISAYALAKCGVKVVIYEKEHFIGGHAKTVAVDGVELDLGFIIFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YP MME FE LGVDME   MS SVSLD+GHG EWG+R GFS LFAQKKNLLNPYF QMIR
Sbjct  61    YPYMMEFFECLGVDMETYHMSLSVSLDHGHGCEWGTRKGFSSLFAQKKNLLNPYFLQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI++FK DV+SYLEE DNNPD+D N+TLG+FIKS GYSELFQKAY+IP+CASIWSC   G
Sbjct  121   EIIRFKQDVISYLEEVDNNPDIDCNETLGQFIKSHGYSELFQKAYLIPICASIWSCPLAG  180

Query  943   VMAFSAYSILSFCRNHHLLQNF  1008
             V++FS+Y IL F R+HHLLQ F
Sbjct  181   VLSFSSYYILLFFRDHHLLQIF  202



>ref|XP_009358001.1| PREDICTED: uncharacterized protein LOC103948676 isoform X2 [Pyrus 
x bretschneideri]
Length=862

 Score =  1050 bits (2716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/689 (74%), Positives = 587/689 (85%), Gaps = 8/689 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RSH YV KVRE LE +GC IR   
Sbjct  177   PSEGVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCHIRTSS  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EVH VST ++G      +ISG  + +E ++GCIMA HAPD +++LG QAT DELR+LGAF
Sbjct  237   EVHRVSTSDEG----CTVISGDGL-EEVFNGCIMAVHAPDAVRILGDQATSDELRVLGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDI+LHR+++ MPRN AAWSAWNFLG+  N+VCLTYWLN LQN+ +T  P+LVTLN
Sbjct  292   QYVYSDIFLHRDKNLMPRNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDETGLPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TP+  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  352   PEHTPKHTLLKWSTSHPVPSVAASKASLELPRIQGKRGIWFCGAYQGYGFHEDGLKAGMA  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHG L K C+ L+NP HMVPS  ETGARL VTRFL  FI TG +I LEEGGT+FTFEGT
Sbjct  412   AAHGFLGKGCALLDNPKHMVPSLTETGARLFVTRFLTHFISTGCLIFLEEGGTIFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K   LK +++VH+PQFYWKV TQADLGLADAYI+GD SFVDK +GLLNL  I +ANRD 
Sbjct  472   GKGCSLKCVIKVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDKGLLNLIMILIANRDA  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S S+   KRGWWTPLLFT++IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLF
Sbjct  532   NSSDSKLTKKRGWWTPLLFTASIASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYS AVFK+E+EDLK AQ+RKIS+LI+KA+I K H +LEIGCGWGSLAI+ V++T
Sbjct  592   LDETMTYSSAVFKTENEDLKVAQLRKISILIEKARIEKNHEVLEIGCGWGSLAIKVVKQT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYA++KV+EAGLQD I+FLLCDYRQL +N +YDRIISCEMLE+VGH
Sbjct  652   GCKYTGITLSEEQLKYAQEKVKEAGLQDRIKFLLCDYRQLANN-KYDRIISCEMLESVGH  710

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM+EFF  CESVLAENG+LVLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPSLSRVTS
Sbjct  711   EFMDEFFSCCESVLAENGLLVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTS  770

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAASSRLCVEHLE+IGIHY+QTLR WR NFLERQS+IL LGFD+KFIRTWEYYFDYCAA
Sbjct  771   AMAASSRLCVEHLENIGIHYFQTLRYWRKNFLERQSEILALGFDEKFIRTWEYYFDYCAA  830

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKG  3010
             GF TCTLG+YQ+VFSRPGNV AF +PY+G
Sbjct  831   GFRTCTLGNYQMVFSRPGNVPAFSNPYEG  859


 Score =   361 bits (926),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 169/216 (78%), Positives = 189/216 (88%), Gaps = 2/216 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+GAGISGLVSAYVLAK G  VVVYEK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVIGAGISGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME SDMSFS SLDNG G EWGSRNG SGLFAQK NL+NPYFWQM+R
Sbjct  61    YPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGSRNGLSGLFAQKTNLINPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D ++YLEE +NNPD+DR++TLG+FIKSRGYSELFQKAY++P+C SIWSC SEG
Sbjct  121   EITKFKHDAINYLEELENNPDIDRSETLGQFIKSRGYSELFQKAYLVPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALWSPT--MAHC  1044
             VM+FSA+S+LSFCRNHHLLQ F    W      +HC
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHC  216



>ref|XP_008224158.1| PREDICTED: uncharacterized protein LOC103323914 isoform X2 [Prunus 
mume]
Length=866

 Score =  1049 bits (2713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/693 (74%), Positives = 585/693 (84%), Gaps = 8/693 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RSH YV KVRE LE +GC+IR   
Sbjct  177   PSEGVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCQIRTSS  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EVH VST ++G +    I+SG  + +E YDGCIMA HAPD +++LG QAT DELR+LGAF
Sbjct  237   EVHRVSTTDEGCS----ILSGDGL-EEIYDGCIMAVHAPDAVRILGDQATSDELRVLGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDI+LHR+++ MP+N AAWSAWNFLG+  N+VCLTYWLN LQN+ +   P+LVTLN
Sbjct  292   QYVYSDIFLHRDKTLMPQNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDEKGLPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TPE  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  352   PDHTPEHTLLKWSTSHPVPSVAASKASVELHRIQGKRGIWFCGAYQGYGFHEDGLKAGMA  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA G+L K CS L+NP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT+F FEGT
Sbjct  412   AARGILGKGCSLLSNPKHMVPSLTETGARLFVTRFLRHYISTGCLILLEEGGTIFNFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K   LK ++RVH+PQFYWKV TQADLGLADAYI+GD SF+DK +GLLNLF I +ANRD 
Sbjct  472   RKGCSLKCVLRVHTPQFYWKVMTQADLGLADAYINGDFSFIDKDKGLLNLFMILIANRDS  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S S  N KRGWWTPLLFT++IASAKYF +H+SR+NTLTQARRNISRHYDLSN+LFS F
Sbjct  532   NSSDSTLNKKRGWWTPLLFTASIASAKYFFQHVSRKNTLTQARRNISRHYDLSNDLFSQF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYS AVFK+EDEDLKTAQ+RKISLLI+K++I K H +LEIGCGWGSLAIE V++T
Sbjct  592   LDETMTYSSAVFKTEDEDLKTAQLRKISLLIEKSRIEKNHEVLEIGCGWGSLAIEVVKQT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYA+ KV++AGLQD IRFLLCDYRQL  N +YDRIISCEMLE+VGH
Sbjct  652   GCKYTGITLSEEQLKYAQQKVKDAGLQDRIRFLLCDYRQL-SNYKYDRIISCEMLESVGH  710

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM+EFF  CESVL +NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTS
Sbjct  711   EFMDEFFACCESVLTDNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTS  770

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAASSRLCVEHLE+IGIHYYQTLRCWR NFLER S+IL LGF++ FIRTWEYYFDYCAA
Sbjct  771   AMAASSRLCVEHLENIGIHYYQTLRCWRKNFLERHSEILALGFNENFIRTWEYYFDYCAA  830

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             GF T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  831   GFKTYTLGNYQIVFSRPGNTPAFTDPYKGFPSA  863


 Score =   358 bits (919),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 167/216 (77%), Positives = 188/216 (87%), Gaps = 2/216 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFWQM+R
Sbjct  61    YPNMMELFERLGVDMETSDMSFSASLDKGRGCEWGSRNGLSSLFAQKRNLFNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D ++YLEE +NNPD+DRN+TLG+FIKSRGYSELFQKAY++P+C SIWSC SEG
Sbjct  121   EITKFKHDAINYLEELENNPDIDRNETLGQFIKSRGYSELFQKAYLVPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALWSPT--MAHC  1044
             VM+FSA+S+LSFCRNHHLLQ F    W      +HC
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHC  216



>ref|XP_010264927.1| PREDICTED: uncharacterized protein LOC104602804 isoform X2 [Nelumbo 
nucifera]
Length=776

 Score =  1049 bits (2712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/687 (73%), Positives = 593/687 (86%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTVK RSH+YVNKV+EELEKR CEI+ G  V SVST
Sbjct  95    FSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHAYVNKVQEELEKRNCEIKTGYAVQSVST  154

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              +    GG  +I G++  Q+ Y+GC++A HAPD L MLG +AT++E R+LGAFQY YSDI
Sbjct  155   FD----GGCTVI-GEDGSQDTYNGCVIAVHAPDALTMLGTEATYEERRVLGAFQYAYSDI  209

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLHR++  MP+N  AWSAWNFLGT +N+VCLTYWLN LQN+G+T  P+LVTLNPP  PE 
Sbjct  210   YLHRDKKLMPQNPTAWSAWNFLGTTDNKVCLTYWLNVLQNIGETSLPFLVTLNPPYIPEH  269

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              +LKW+T HPVPSVAAS AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAH  L 
Sbjct  270   NILKWSTSHPVPSVAASNASLELDEIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHTFLG  329

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ L NP  MVPS  ETGARL+VTRFL  +I  G ++LLEEGGTVFTFEG++KK  LK
Sbjct  330   KNCAVLKNPEQMVPSLAETGARLIVTRFLRHYISAGCLMLLEEGGTVFTFEGSNKKCPLK  389

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              +++VH+PQFYWKVAT+AD+GLADAYI+GD SFVDK+EGLLNLF IF+ANR+L +S +R+
Sbjct  390   CVLKVHNPQFYWKVATEADIGLADAYINGDFSFVDKEEGLLNLFMIFIANRNLDSSDARN  449

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N++RGWWTPL  T+AIASAKYF  HISRQNTLTQARRNISRHYDLSN+LF+LFLD+TMTY
Sbjct  450   NNRRGWWTPLFLTAAIASAKYFFWHISRQNTLTQARRNISRHYDLSNDLFALFLDKTMTY  509

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FK+E+EDLK AQ+RKIS+LI+KA+I + H ILEIGCGWGSLAIE V++TGCKYTGI
Sbjct  510   SCAIFKAENEDLKVAQLRKISVLIEKARIERNHEILEIGCGWGSLAIEVVKQTGCKYTGI  569

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLKYAE +V+EAGLQD+I+FLLCDYRQLP + +YDRIISCEMLEAVGHE+M EF 
Sbjct  570   TLSEEQLKYAEQRVKEAGLQDHIKFLLCDYRQLPYSHKYDRIISCEMLEAVGHEYMEEFL  629

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLAENG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGC+PSLSRVTSAMA++SR
Sbjct  630   GCCESVLAENGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCIPSLSRVTSAMASASR  689

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEHLE+IGIHYYQTL  WR +F+E+QS+IL LGFD+KFIRTWEYYF YCAAGF + TL
Sbjct  690   LCVEHLENIGIHYYQTLIYWRNSFMEKQSEILALGFDEKFIRTWEYYFIYCAAGFRSRTL  749

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQIVFSRPGN+TAF DPYKGL SA+
Sbjct  750   GNYQIVFSRPGNLTAFSDPYKGLPSAF  776


 Score =   132 bits (331),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/78 (73%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +1

Query  790   LSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSI  969
             ++YLEE +NNPD+DRN+TLG FI+S GYSELF+KAY+ PMCASIWSCSSEG M FSA+S+
Sbjct  41    IAYLEELENNPDLDRNETLGHFIESHGYSELFEKAYLAPMCASIWSCSSEGAMGFSAFSV  100

Query  970   LSFCRNHHLLQNFSPALW  1023
             LSFCRNHHLLQ F    W
Sbjct  101   LSFCRNHHLLQLFGRPQW  118



>ref|XP_006421140.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
 gb|ESR34380.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
Length=802

 Score =  1049 bits (2712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/694 (73%), Positives = 582/694 (84%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RSHSYVNKVR++LE  GC+IR   
Sbjct  114   PSEGVTSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHSYVNKVRKQLESWGCQIRTSS  173

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV SV   ++G      I+ G    +E Y+ C+MA HAPD LK+LG QATFDE RILGAF
Sbjct  174   EVCSVLPADKG----CTIVCGDG-SREFYNSCVMALHAPDALKILGNQATFDETRILGAF  228

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSD++LHR++ FMP+N AAWSAWNFL + +++VCLTYWLN LQNLG+T  P+LVTLN
Sbjct  229   QYVYSDVFLHRDKRFMPQNPAAWSAWNFLESFDSKVCLTYWLNVLQNLGETSLPFLVTLN  288

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   PE  LLKW+TGHPVPSVAAS+A  EL  IQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  289   PDHVPEHTLLKWSTGHPVPSVAASKALLELNHIQGKRGIWFCGAYQGYGFHEDGLKAGMT  348

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAH +L K C+ L+NP HMVPS  ETGARL V RFL  +I TGS+ILLEEGGT+FTFEGT
Sbjct  349   AAHAVLGKSCTLLSNPRHMVPSLMETGARLFVARFLGQYISTGSMILLEEGGTIFTFEGT  408

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K   LK ++R+HSPQFYWKV TQADLG+ADAYI+GD SFVDK EGLLNLF I +ANRDL
Sbjct  409   RKNCHLKTVLRIHSPQFYWKVMTQADLGVADAYINGDFSFVDKDEGLLNLFMILIANRDL  468

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              +SVS+   KRGWW+P+LFT+ IASAKYF RHISRQNTLTQARRNISRHYDLSNELFSLF
Sbjct  469   DSSVSKLKQKRGWWSPMLFTAGIASAKYFFRHISRQNTLTQARRNISRHYDLSNELFSLF  528

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDE+MTYSCAVFKSEDEDLK AQMRK+SLLI+K ++SK   +LEIGCGWG+LAIE V+RT
Sbjct  529   LDESMTYSCAVFKSEDEDLKAAQMRKVSLLIEKVRVSKGQEVLEIGCGWGTLAIEIVKRT  588

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYAE KV+EAGLQD+IR  LCDYRQL    +YDRIISCEM+EAVGH
Sbjct  589   GCKYTGITLSEEQLKYAEMKVKEAGLQDHIRLYLCDYRQLAKANKYDRIISCEMIEAVGH  648

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM EFFG CES+LAE+G+LVLQFISIPDERY+EYR SSDFIKEYIFPGGCLPSLSR+TS
Sbjct  649   EFMEEFFGCCESMLAEDGLLVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPSLSRITS  708

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLCVE +E+IGIHYYQTLRCWR NF+E+QS+IL LGF+ KFIRTWEYYFDYCAA
Sbjct  709   AMSAASRLCVEQVENIGIHYYQTLRCWRKNFMEKQSKILALGFNDKFIRTWEYYFDYCAA  768

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF + TLG+YQIVFSRPGNV AF +PYKG  SAY
Sbjct  769   GFKSYTLGNYQIVFSRPGNVAAFSNPYKGFPSAY  802


 Score =   247 bits (631),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFWQM+REI+
Sbjct  1     MMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFWQMLREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK+DVLSYLEE ++NPD+DR++TLG+F+ SRGYSELFQKAY+IP+C SIWSC SEGV +
Sbjct  61    KFKDDVLSYLEELESNPDIDRSETLGQFVNSRGYSELFQKAYLIPICGSIWSCPSEGVTS  120

Query  952   FSAYSILSFCRNHHLLQNFSPALW  1023
             FSA+S+LSFCRNHHLLQ F    W
Sbjct  121   FSAFSVLSFCRNHHLLQLFGRPQW  144



>ref|XP_008224157.1| PREDICTED: uncharacterized protein LOC103323914 isoform X1 [Prunus 
mume]
Length=871

 Score =  1048 bits (2711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/693 (74%), Positives = 585/693 (84%), Gaps = 8/693 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RSH YV KVRE LE +GC+IR   
Sbjct  182   PSEGVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCQIRTSS  241

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EVH VST ++G +    I+SG  + +E YDGCIMA HAPD +++LG QAT DELR+LGAF
Sbjct  242   EVHRVSTTDEGCS----ILSGDGL-EEIYDGCIMAVHAPDAVRILGDQATSDELRVLGAF  296

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDI+LHR+++ MP+N AAWSAWNFLG+  N+VCLTYWLN LQN+ +   P+LVTLN
Sbjct  297   QYVYSDIFLHRDKTLMPQNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDEKGLPFLVTLN  356

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TPE  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  357   PDHTPEHTLLKWSTSHPVPSVAASKASVELHRIQGKRGIWFCGAYQGYGFHEDGLKAGMA  416

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA G+L K CS L+NP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT+F FEGT
Sbjct  417   AARGILGKGCSLLSNPKHMVPSLTETGARLFVTRFLRHYISTGCLILLEEGGTIFNFEGT  476

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K   LK ++RVH+PQFYWKV TQADLGLADAYI+GD SF+DK +GLLNLF I +ANRD 
Sbjct  477   RKGCSLKCVLRVHTPQFYWKVMTQADLGLADAYINGDFSFIDKDKGLLNLFMILIANRDS  536

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S S  N KRGWWTPLLFT++IASAKYF +H+SR+NTLTQARRNISRHYDLSN+LFS F
Sbjct  537   NSSDSTLNKKRGWWTPLLFTASIASAKYFFQHVSRKNTLTQARRNISRHYDLSNDLFSQF  596

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYS AVFK+EDEDLKTAQ+RKISLLI+K++I K H +LEIGCGWGSLAIE V++T
Sbjct  597   LDETMTYSSAVFKTEDEDLKTAQLRKISLLIEKSRIEKNHEVLEIGCGWGSLAIEVVKQT  656

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYA+ KV++AGLQD IRFLLCDYRQL  N +YDRIISCEMLE+VGH
Sbjct  657   GCKYTGITLSEEQLKYAQQKVKDAGLQDRIRFLLCDYRQL-SNYKYDRIISCEMLESVGH  715

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM+EFF  CESVL +NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVTS
Sbjct  716   EFMDEFFACCESVLTDNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTS  775

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAASSRLCVEHLE+IGIHYYQTLRCWR NFLER S+IL LGF++ FIRTWEYYFDYCAA
Sbjct  776   AMAASSRLCVEHLENIGIHYYQTLRCWRKNFLERHSEILALGFNENFIRTWEYYFDYCAA  835

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             GF T TLG+YQIVFSRPGN  AF DPYKG  SA
Sbjct  836   GFKTYTLGNYQIVFSRPGNTPAFTDPYKGFPSA  868


 Score =   360 bits (925),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 189/217 (87%), Gaps = 2/217 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KMRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRV
Sbjct  5     KMRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRV  64

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFWQM+
Sbjct  65    TYPNMMELFERLGVDMETSDMSFSASLDKGRGCEWGSRNGLSSLFAQKRNLFNPYFWQML  124

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI KFK+D ++YLEE +NNPD+DRN+TLG+FIKSRGYSELFQKAY++P+C SIWSC SE
Sbjct  125   REITKFKHDAINYLEELENNPDIDRNETLGQFIKSRGYSELFQKAYLVPVCGSIWSCPSE  184

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALWSPT--MAHC  1044
             GVM+FSA+S+LSFCRNHHLLQ F    W      +HC
Sbjct  185   GVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHC  221



>emb|CBI23694.3| unnamed protein product [Vitis vinifera]
Length=881

 Score =  1046 bits (2705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/702 (73%), Positives = 587/702 (84%), Gaps = 22/702 (3%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F +    +FCR    LQLFG PQWLTVK  SH YVNKVREELE +GC+IR  CEV SVST
Sbjct  185   FSAFLVLSFCRNHHLLQLFGHPQWLTVKCCSHYYVNKVREELESKGCQIRTACEVVSVST  244

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G      I  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV SDI
Sbjct  245   TDDG----CTIFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVSSDI  299

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++FMP+N AAWSAWNFLGT+ N+VCL+YWLN LQN+  T  P+LVTLNP  TP+ 
Sbjct  300   FLHRDKNFMPQNPAAWSAWNFLGTIENKVCLSYWLNVLQNIDQTSLPFLVTLNPSHTPDH  359

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLK----------A  1654
              LLKW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLK          A
Sbjct  360   TLLKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKVAIIKHPCSQA  419

Query  1655  GMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1834
             GM+AAH +L K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TF
Sbjct  420   GMVAAHSILGKGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTF  479

Query  1835  EGTDKKNLLKVLVRVHSPQFYWK-----VATQADLGLADAYIHGDISFVDKKEGLLNLFK  1999
             EG+ KK LLKV +++H+PQFYWK     +ATQADLGLADAYI+GD S VDK EGL +LF 
Sbjct  480   EGSGKKCLLKVALKIHNPQFYWKESKKRIATQADLGLADAYINGDFSLVDKDEGLQSLFM  539

Query  2000  IFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDL  2179
             IF+ANRDL +S+SR N KRGWWTPL FT+ IASAKY+ +H+SRQNTLTQARRN+SRHYDL
Sbjct  540   IFIANRDLDSSLSRLNKKRGWWTPLFFTAGIASAKYYFQHVSRQNTLTQARRNVSRHYDL  599

Query  2180  SNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSL  2359
             SNELFSLFLDETMTYSCAVFK+E EDLK AQ+RKISLLI+KA+I K+H +LEIGCGWGSL
Sbjct  600   SNELFSLFLDETMTYSCAVFKTEGEDLKVAQLRKISLLIEKARIDKKHEVLEIGCGWGSL  659

Query  2360  AIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISC  2539
             AIE V++TGCKYTGIT S++QLK+AE KV+EAGLQDNIRFLLCDYRQLP++ +YDRIISC
Sbjct  660   AIEVVKQTGCKYTGITPSKEQLKFAEMKVKEAGLQDNIRFLLCDYRQLPNSYKYDRIISC  719

Query  2540  EMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCL  2719
              MLE+VGHE+M EFFG CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCL
Sbjct  720   GMLESVGHEYMEEFFGCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCL  779

Query  2720  PSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWE  2899
             PSLSRVT+AMA +SRLCVEHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWE
Sbjct  780   PSLSRVTTAMATASRLCVEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWE  839

Query  2900  YYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             YYFDYCAAGF T TLGDYQIVFSRPGN TAF DPYK + S Y
Sbjct  840   YYFDYCAAGFKTRTLGDYQIVFSRPGNATAFSDPYKSVVSPY  881


 Score =   315 bits (807),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 174/208 (84%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKE+YLGGHAKTVT+DGV L+LGFM FN+VT
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKENYLGGHAKTVTVDGVPLNLGFMAFNQVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM+E FE+LG+DME+S MSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61    YPNMLEFFETLGIDMELSAMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSEL-FQKAYIIPMCASIWSCSSE  939
             E++KFK+DVL YLEE +NNPD+DRN TLG+FIK   YS +      I+P+CASIW CS+E
Sbjct  121   EMIKFKDDVLKYLEELENNPDIDRNQTLGDFIKCPLYSVISLSFKLIVPICASIWPCSAE  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GVM+FSA+ +LSFCRNHHLLQ F    W
Sbjct  181   GVMSFSAFLVLSFCRNHHLLQLFGHPQW  208



>ref|XP_007035209.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035210.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 ref|XP_007035211.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06135.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06136.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
 gb|EOY06137.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 1 [Theobroma 
cacao]
Length=865

 Score =  1046 bits (2705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/686 (72%), Positives = 591/686 (86%), Gaps = 7/686 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQW+TV+ RSH YVNKVR+ELE RGC+IR GCEVHSV T
Sbjct  184   FSAFSILSFCRNHHLLQLFGRPQWMTVRWRSHRYVNKVRKELESRGCQIRTGCEVHSVLT  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
                 +A G  ++ G +  QE Y+GC+MA HAPD L++LG QAT+DELR+LGAFQYVYSDI
Sbjct  244   ----TAEGCTVLCGDDS-QETYEGCVMAVHAPDALRLLGNQATYDELRVLGAFQYVYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++ MP+N AAWSAWNFLG+ + +VCLTYWLN LQNLG+T  P+LVTLNP   P+Q
Sbjct  299   FLHRDKNLMPKNPAAWSAWNFLGSTDKKVCLTYWLNVLQNLGETSLPFLVTLNPDYIPQQ  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW TGHPVPSVAA++AS EL++IQGKR IWFCGAYQGYGFHEDGLKAG +AA+G+L 
Sbjct  359   TLLKWKTGHPVPSVAATKASLELDQIQGKRGIWFCGAYQGYGFHEDGLKAGTVAANGVLG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K CS L+NP HMVPS  ETGARL VTRFL+ FI+TGS+ILLEEGGT+FTFEGT  K  LK
Sbjct  419   KSCSILSNPKHMVPSLVETGARLFVTRFLSHFILTGSVILLEEGGTMFTFEGTSTKCPLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              +++VH+P  YWKV T+ADLGLADAYI+G+ SFVDKKEGLLNL  I +ANRDL++S S+ 
Sbjct  479   TVLKVHNPHIYWKVMTEADLGLADAYINGEFSFVDKKEGLLNLIMILIANRDLNSSNSKL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + +RGWWTPLLFT+ + SAKYF++H+ R N+LTQARRNISRHYDLSN+LF+LFLDETMTY
Sbjct  539   SKQRGWWTPLLFTAGLTSAKYFLKHVLRHNSLTQARRNISRHYDLSNDLFALFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK+EDEDLK AQ RKISLLI+KA+I  +H ILEIGCGWGSLAIE V+RTGCKYTGI
Sbjct  599   SCAVFKTEDEDLKDAQQRKISLLIEKARIDSKHEILEIGCGWGSLAIEVVKRTGCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLK+AE+ V+EA LQDNIRF LCDYRQLP   +YDRIISCEM+EAVGHE+M +FF
Sbjct  659   TLSEEQLKFAENIVKEARLQDNIRFQLCDYRQLPSTNKYDRIISCEMVEAVGHEYMEDFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               CESVLAE+G+LVLQFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SR
Sbjct  719   SCCESVLAEDGLLVLQFISIPEERYDEYRRSSDFIKEYIFPGGCLPSLTRITSAMSAASR  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH+E+IG+HYYQTLR WR NFLE+QS+IL LGF++KFIRTWEYYFDYCAAGF + TL
Sbjct  779   LCVEHVENIGLHYYQTLRHWRKNFLEKQSKILALGFNEKFIRTWEYYFDYCAAGFKSNTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASA  3022
             G+YQ+VFSRPGNV A G+PYK   +A
Sbjct  839   GNYQVVFSRPGNVAALGNPYKRFPTA  864


 Score =   347 bits (889),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+G GISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1     MRTAVIGGGISGLVSAYVLAKSGVNVVLYEKEDYLGGHAKTVNFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME SDMSF+VSLD G G EWGSRNG S LFA+K N+LNPYFW+M+R
Sbjct  61    YPNMMEFFESLGVDMEASDMSFAVSLDEGKGCEWGSRNGLSSLFAKKMNILNPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+DV+SYLE  +NNPD+DRN+TLG+FI+SRGYSELFQKAY++P+C SIWSC +E 
Sbjct  121   EISKFKDDVISYLEVLENNPDIDRNETLGQFIESRGYSELFQKAYLVPICGSIWSCPTER  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSA+SILSFCRNHHLLQ F    W
Sbjct  181   VMGFSAFSILSFCRNHHLLQLFGRPQW  207



>ref|XP_002314493.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
 gb|EEF00664.2| cyclopropane-fatty-acyl-phospholipid synthase family protein 
[Populus trichocarpa]
Length=869

 Score =  1046 bits (2704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/695 (73%), Positives = 586/695 (84%), Gaps = 8/695 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+RRSHSYVNKVRE+LE  GC+IR GC
Sbjct  180   PSEGVMNFSAFSVLSFCRNHHLLQLFGRPQWLTVRRRSHSYVNKVREKLESWGCQIRTGC  239

Query  1124  EVHSVST-DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGA  1300
             EV +VST DE G A  V+ I G   + E Y GCIMA HAPD L +LG+QATFDE RILGA
Sbjct  240   EVQAVSTTDEAGCA--VLCIDG---LLEMYSGCIMAVHAPDALGLLGEQATFDETRILGA  294

Query  1301  FQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTL  1480
             FQY+YS+I+LHR++++MP+N AAWSAWNFLG+  N+VCLTYWLN LQN+ +T  P+LVTL
Sbjct  295   FQYMYSEIFLHRDKTYMPQNSAAWSAWNFLGSTENKVCLTYWLNVLQNIDETGLPFLVTL  354

Query  1481  NPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGM  1660
             NP   P+  LLKW+TG PVPSVAA++AS EL+ IQGKRRIWF GAYQGYGF+EDGLK+GM
Sbjct  355   NPDNAPDHTLLKWSTGRPVPSVAATKASLELDHIQGKRRIWFGGAYQGYGFYEDGLKSGM  414

Query  1661  IAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEG  1840
             +AAHGLL K C  L NP HMVPS  ETGARL VTRFL   I TG + LLE+GGTVF+FEG
Sbjct  415   VAAHGLLGKSCDILRNPKHMVPSMLETGARLFVTRFLGHHISTGCLTLLEDGGTVFSFEG  474

Query  1841  TDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD  2020
             T KK  LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFVDK EGL+NLF I + NRD
Sbjct  475   TSKKCSLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLINLFMILIVNRD  534

Query  2021  LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSL  2200
                S S+ N KRGWWTPLLFT+ IASAK+FI+H+SRQNTLTQARRNISRHYDLSNELF+L
Sbjct  535   ADNSTSKLNKKRGWWTPLLFTAGIASAKFFIQHVSRQNTLTQARRNISRHYDLSNELFAL  594

Query  2201  FLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVER  2380
             FLDETMTYSCA+FK EDEDLK AQ+RKISLLI+KA+++K+H +LEIGCGWG+LAIE V+R
Sbjct  595   FLDETMTYSCALFKKEDEDLKAAQIRKISLLIEKARVNKDHEVLEIGCGWGTLAIEVVQR  654

Query  2381  TGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVG  2560
             TGCKYTGITLSE+QLKYAE KV+EAGLQD+I+F LCDYRQLP   +YD IISCEM+EAVG
Sbjct  655   TGCKYTGITLSEEQLKYAELKVKEAGLQDSIKFHLCDYRQLPKTHKYDTIISCEMIEAVG  714

Query  2561  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  2740
             HE+M EFFG CESVLAENG+ VLQFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+T
Sbjct  715   HEYMEEFFGCCESVLAENGLFVLQFISIPEERYDEYRKSSDFIKEYIFPGGCLPSLTRIT  774

Query  2741  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  2920
             SAMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q + L LGF++KFIRTWEYYFDYCA
Sbjct  775   SAMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQRETLSLGFNEKFIRTWEYYFDYCA  834

Query  2921  AGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             AGF T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  835   AGFKTHTLGNYQVVFSRPGNVVALSNPYRGFPSAY  869


 Score =   357 bits (917),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             +MRVAVVGAGISGLVSAYVLAK GA VV+YEKED LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3     RMRVAVVGAGISGLVSAYVLAKAGAEVVLYEKEDSLGGHAKTVCFDGVDLDLGFMVFNRV  62

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LG+DME+SDMSFSVSLD G G EWGSRNGFSGLFAQKKN LNPYFW+M+
Sbjct  63    TYPNMMEFFENLGIDMELSDMSFSVSLDQGKGCEWGSRNGFSGLFAQKKNALNPYFWKML  122

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK+DVLSYLE  +N+P +DRN+TLG+F+KSRGYSELFQKAY++P+C SIWSC SE
Sbjct  123   REIVKFKDDVLSYLEVLENDPVVDRNETLGQFVKSRGYSELFQKAYLVPVCGSIWSCPSE  182

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GVM FSA+S+LSFCRNHHLLQ F    W
Sbjct  183   GVMNFSAFSVLSFCRNHHLLQLFGRPQW  210



>gb|KDP40373.1| hypothetical protein JCGZ_02371 [Jatropha curcas]
Length=869

 Score =  1043 bits (2697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/694 (72%), Positives = 590/694 (85%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTVK RS SYVNKV+E+LE  GC IR GC
Sbjct  181   PSDKVMSFSAFSILSFCRNHHLLQLFGRPQWLTVKSRSQSYVNKVKEKLETWGCRIRTGC  240

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV SVST+++G    V    G    ++ Y GCIMA HAPD LK+LG+QATF+E R+LGAF
Sbjct  241   EVASVSTNDEGCT--VFCTDGS---EDMYSGCIMAVHAPDALKILGEQATFEEKRVLGAF  295

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY+YS I+LHR++ FMP+N AAWSAWNFLG+  N+VCLTYWLN LQNLG+T  P+LVTLN
Sbjct  296   QYMYSHIFLHRDRKFMPQNQAAWSAWNFLGSTENKVCLTYWLNVLQNLGETGPPFLVTLN  355

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   P+  LLKW+TGHPVPSVAAS+AS EL+ IQG+R +WFCGAYQGYGFHEDGLK+GM+
Sbjct  356   PDNIPDHTLLKWSTGHPVPSVAASKASLELQHIQGRRGLWFCGAYQGYGFHEDGLKSGMV  415

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA+GLL K C+ L NP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT+FTFEG+
Sbjct  416   AANGLLGKSCTILCNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTMFTFEGS  475

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              KK  LK +++VH+P+ YWK+ TQADLGLADAYI+GD SFV+K EGLLNL  + + NRD 
Sbjct  476   AKKCDLKTVLKVHNPRLYWKITTQADLGLADAYINGDFSFVNKDEGLLNLIMVLIVNRDA  535

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             + +V+R N K+GWWTPLLFT++IASA++F+ H+SRQNTLTQARRNISRHYDLSNELF LF
Sbjct  536   NKTVARLNKKKGWWTPLLFTASIASAQFFVHHVSRQNTLTQARRNISRHYDLSNELFGLF  595

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCAVFK+EDEDLK AQMRKISLLI+KA+I+KEH ILEIGCGWG+LAIE V+RT
Sbjct  596   LDETMTYSCAVFKTEDEDLKAAQMRKISLLIEKARITKEHEILEIGCGWGALAIEVVKRT  655

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GC+YTGITLSE+QLK+AE KV+EAGLQD+IRFLLCDYRQLP N RYDRIISCEM+EAVGH
Sbjct  656   GCRYTGITLSEEQLKFAEMKVKEAGLQDSIRFLLCDYRQLPKNYRYDRIISCEMIEAVGH  715

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M EFFG CESVLAE+G++VLQFISIP+ERY+EYRQSSDFIKEYIFPGGCLPSL+R+ S
Sbjct  716   EYMEEFFGCCESVLAEDGLIVLQFISIPEERYEEYRQSSDFIKEYIFPGGCLPSLTRIAS  775

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLC+EH+E+IGIHYYQTLR WR NFL+ Q +IL LGF++KFIRTWEYYFDYCAA
Sbjct  776   AMSAASRLCMEHVENIGIHYYQTLRYWRKNFLDNQGKILALGFNEKFIRTWEYYFDYCAA  835

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLG+YQ+V SRPGN+ A G+P++G  SAY
Sbjct  836   GFKTHTLGNYQVVLSRPGNIAALGNPFQGFPSAY  869


 Score =   350 bits (897),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 191/221 (86%), Gaps = 1/221 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAY-VLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             +MRVAV+G GISGL+SAY V++  GA VV+YEKEDYLGGHA+TV+ DGVDLDLGFMVFNR
Sbjct  3     RMRVAVIGGGISGLISAYYVVSNSGAEVVLYEKEDYLGGHARTVSFDGVDLDLGFMVFNR  62

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNMMELFESLGVDME+SDMSFSVSLD G+GYEWGSRNG SG+FAQKKN+LNPYFWQM
Sbjct  63    VTYPNMMELFESLGVDMELSDMSFSVSLDKGNGYEWGSRNGLSGVFAQKKNILNPYFWQM  122

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             +REI+KFK+DVLSYL   + NPD+DR++TLG FI SRGYSELFQK Y++PMC SIWSC S
Sbjct  123   LREIIKFKDDVLSYLGTLEKNPDIDRSETLGHFINSRGYSELFQKGYLVPMCGSIWSCPS  182

Query  937   EGVMAFSAYSILSFCRNHHLLQNFSPALWSPTMAHCEAEVS  1059
             + VM+FSA+SILSFCRNHHLLQ F    W    +  ++ V+
Sbjct  183   DKVMSFSAFSILSFCRNHHLLQLFGRPQWLTVKSRSQSYVN  223



>ref|XP_010527410.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
 ref|XP_010527411.1| PREDICTED: uncharacterized protein LOC104804765 [Tarenaya hassleriana]
Length=870

 Score =  1038 bits (2683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/687 (72%), Positives = 571/687 (83%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV  RSH+YV KVR ELE+RGC IR  C+V SVST
Sbjct  187   FSAFSVLSFCRNHHLLQLFGRPQWLTVAGRSHTYVAKVRTELERRGCRIRTSCDVQSVST  246

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G     V +   +  +E +D CI+A HAPD L++LG+QATFDE R+LGAFQYVYSDI
Sbjct  247   SDNG-----VTVRCGDGSEELFDRCILAMHAPDALRLLGEQATFDETRVLGAFQYVYSDI  301

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +   MPRN +AWSAWNFLG+  NRVC+TYWLN LQNLG+  +P+ VTLNP R P++
Sbjct  302   YLHHDTDLMPRNQSAWSAWNFLGSTENRVCVTYWLNILQNLGEKGEPFFVTLNPNRIPKK  361

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              +LKW TGHPVPSVAA +AS EL +IQGKRR+WFCGAYQGYGFHEDGLKAG  AAH LL 
Sbjct  362   TMLKWRTGHPVPSVAAWKASQELHKIQGKRRLWFCGAYQGYGFHEDGLKAGFSAAHALLG  421

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K    LNNP HMVPS  ETGAR+ VTRF+  FI TG ++LLEEGGT+FTF+G   K  LK
Sbjct  422   KDIELLNNPTHMVPSLAETGARVFVTRFMGQFISTGCVMLLEEGGTMFTFDGKHPKCTLK  481

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLN+  I +ANRDL++  S  
Sbjct  482   TVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKNNGLLNMIMILIANRDLNSPKSNL  541

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWWTP+ FT+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF+LFLD+TMTY
Sbjct  542   AKKRGWWTPMFFTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFALFLDDTMTY  601

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S AVFKSEDEDL+TAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V RTGCKYTGI
Sbjct  602   SSAVFKSEDEDLRTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTGCKYTGI  661

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS +QLKYAE KV+EAGLQD+I F LCDYRQL D+ +YDRIISCEMLEAVGHEFM  FF
Sbjct  662   TLSIEQLKYAEAKVKEAGLQDHITFQLCDYRQLSDSRKYDRIISCEMLEAVGHEFMETFF  721

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
              RCES LAE+G++VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSAMA+SSR
Sbjct  722   SRCESALAEDGVIVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMASSSR  781

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EH+E+IGIHYYQTLRCWR NFLERQ QI+ LGF+++FIRTWEYYFDYCAAGF T TL
Sbjct  782   LCIEHVENIGIHYYQTLRCWRKNFLERQKQIMALGFNEEFIRTWEYYFDYCAAGFKTLTL  841

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQ+VFSRPGN  AFGDPY+   SA+
Sbjct  842   GNYQVVFSRPGNTAAFGDPYRSFPSAH  868


 Score =   309 bits (792),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 177/210 (84%), Gaps = 3/210 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK---GGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFN  573
             MRVAV+G GISGL SAYVLA    GG  VV+YEK+D LGGHAKTV  D  D+DLGFMVFN
Sbjct  1     MRVAVIGGGISGLGSAYVLATRHGGGDEVVLYEKDDALGGHAKTVRFDSADVDLGFMVFN  60

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  753
             RVTYPNMME FE LGVDME+SDMSFSVSLD+G G EWGSRNGFSGLFAQK N  NPYFW+
Sbjct  61    RVTYPNMMEFFEELGVDMEVSDMSFSVSLDDGRGCEWGSRNGFSGLFAQKSNAFNPYFWK  120

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MIREI+KFK+DVL Y+E  + NPD+DR++TLG+F+ S GYSELFQKAY++P+C SIWSC 
Sbjct  121   MIREIVKFKDDVLRYIESRELNPDLDRSETLGQFLDSHGYSELFQKAYLVPICGSIWSCP  180

Query  934   SEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             ++GV++FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   ADGVLSFSAFSVLSFCRNHHLLQLFGRPQW  210



>emb|CDO99279.1| unnamed protein product [Coffea canephora]
Length=851

 Score =  1036 bits (2680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/687 (73%), Positives = 586/687 (85%), Gaps = 24/687 (3%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV+ RS +Y++KV+++LE+RGC+IR GCEV +VST
Sbjct  187   FSAYSILSFCRNHHLLQLFGRPQWLTVRWRSQTYISKVKDDLERRGCQIRNGCEVRAVST  246

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              ++G      +++ +N   E Y+ CI+AAHAPD LK+LG+QAT+DE RILGAFQY YSDI
Sbjct  247   KDEG-----CVVTCENGSIEVYNSCIVAAHAPDALKILGEQATYDESRILGAFQYAYSDI  301

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++FMP+N AAWSAWNFLGTV+N+VC+TYWLN LQNLG+T  PYLVTLNPP TPE 
Sbjct  302   FLHRDKNFMPQNPAAWSAWNFLGTVDNKVCVTYWLNILQNLGETGLPYLVTLNPPHTPEN  361

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LL+W+TGHPVPSVAAS+AS+ L  IQGKR IWFCGAYQGYGFHEDGLKAG +AA  LL+
Sbjct  362   TLLRWSTGHPVPSVAASKASTRLNDIQGKRGIWFCGAYQGYGFHEDGLKAGTVAAQSLLR  421

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ L+NP HMVPSW ETGARLLVT+FL  FI TGS++LLEEGGT+F            
Sbjct  422   KSCTILSNPKHMVPSWTETGARLLVTKFLNGFIATGSLMLLEEGGTIF------------  469

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
               +  HS      VATQADLGLADAYI+GDISFVDK EGLLNLF ++VANRDL ASV+ S
Sbjct  470   --IGRHSISL---VATQADLGLADAYINGDISFVDKNEGLLNLFMVYVANRDLKASVTSS  524

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + +RGWWTPLL T+ +ASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  525   SYQRGWWTPLLLTAGLASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  584

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FKSEDEDLK AQ+RKISLLI++A+ISK+HH+LEIGCGWGSLAIE V+RTGC+YTGI
Sbjct  585   SCAIFKSEDEDLKIAQLRKISLLIERARISKDHHVLEIGCGWGSLAIEVVKRTGCQYTGI  644

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QL YAE KVRE G+QD+I+FLLCDYRQLP+  +YDRIISCEMLEAVGHEFM ++F
Sbjct  645   TLSEKQLTYAEQKVREVGMQDHIKFLLCDYRQLPETYKYDRIISCEMLEAVGHEFMEKYF  704

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               C SVLAE+GILVLQFISIPDERY+EYRQSSDFI+EYIFPGGCLPSLSRVTSAMAA+S 
Sbjct  705   SSCNSVLAEDGILVLQFISIPDERYEEYRQSSDFIREYIFPGGCLPSLSRVTSAMAAASG  764

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEHLE+ GIHYY TLR WR NFL +QS+IL+LGFD+KFIRTWEYYFDYCAAGF TCTL
Sbjct  765   LCVEHLENFGIHYYHTLRRWRTNFLSKQSEILELGFDEKFIRTWEYYFDYCAAGFKTCTL  824

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQ+VFSRPGNV +FG+  KG+ SAY
Sbjct  825   GNYQVVFSRPGNVVSFGNLQKGVPSAY  851


 Score =   363 bits (933),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 169/208 (81%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             K+RVAVVGAGISGLV+A+VLAK G  VV+YEKEDYLGGHAKTVT+DG+DLDLGFMVFNRV
Sbjct  3     KLRVAVVGAGISGLVAAHVLAKEGVDVVIYEKEDYLGGHAKTVTMDGIDLDLGFMVFNRV  62

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMMELFE+LGVDME+SDMSFSVSLD G G EWGSRNG S LFAQKKN+LNP FWQMI
Sbjct  63    TYPNMMELFENLGVDMELSDMSFSVSLDKGKGCEWGSRNGLSSLFAQKKNVLNPKFWQMI  122

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DV+SY+EE + NPD+DRN+TLG FI+SRGYSELFQKAY++P+CASIWSCSSE
Sbjct  123   REIVKFKADVISYVEELEKNPDLDRNETLGHFIRSRGYSELFQKAYLVPICASIWSCSSE  182

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV+ FSAYSILSFCRNHHLLQ F    W
Sbjct  183   GVLNFSAYSILSFCRNHHLLQLFGRPQW  210



>ref|XP_008460674.1| PREDICTED: uncharacterized protein LOC103499444 isoform X1 [Cucumis 
melo]
Length=865

 Score =  1036 bits (2679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/694 (71%), Positives = 581/694 (84%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTVK RSHSYV KV+E LE  GC+IR   
Sbjct  177   PSEGVLSFSAFSVLSFCRNHHLLQLFGRPQWLTVKGRSHSYVKKVQEVLESHGCQIRTSS  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+S+ST ++G       +S  + +QE +D CI+A HAPDTL+MLG QAT +ELR+LGAF
Sbjct  237   EVNSISTMDKGCK-----VSYGDDLQEIFDACIIATHAPDTLRMLGNQATSEELRVLGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY YSDI+LHR+++ MP+N AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLN
Sbjct  292   QYAYSDIFLHRDKNLMPQNPAAWSAWNFLGNTDKKVCLTYWLNILQNLGETGPPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P + P+  LLKW+TGHP+PSVAAS+AS+E   IQG RRIWFCGAYQGYGFHEDGLKAG++
Sbjct  352   PDKEPKNILLKWSTGHPIPSVAASKASNEFHSIQGNRRIWFCGAYQGYGFHEDGLKAGIV  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA  LL    + L+NP HM PS  +TGARL VTRFL  +I +GS+ L+E+GGT+FTFEGT
Sbjct  412   AAQNLLGNSFTLLSNPKHMAPSLVDTGARLFVTRFLGQYITSGSLTLIEDGGTIFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             DKK L KV V+VHSPQFYWK+ T+ADLGLADAYI+GD SFVDK EGLLN F I +A+RD 
Sbjct  472   DKKCLPKVAVKVHSPQFYWKIMTRADLGLADAYINGDFSFVDKDEGLLNFFLIIIASRDT  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S+++   KRGWWTP LFT+ IASAKYF +H SRQNTLTQARRNISRHYDLSNELFSLF
Sbjct  532   NSSIAKQKKKRGWWTPPLFTACIASAKYFFQHASRQNTLTQARRNISRHYDLSNELFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD+TMTYSCA+FK E+EDLK AQMRKISLLI+KA+I+K HH+LEIGCGWGSLAIE V++T
Sbjct  592   LDDTMTYSCAIFKGENEDLKVAQMRKISLLIEKARINKNHHVLEIGCGWGSLAIEIVKKT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GC YTGITLSE+QLKYAE +V++A LQD IRFLLCDYR+LP   RYDRIISCEM+EAVGH
Sbjct  652   GCHYTGITLSEEQLKYAEKRVKDANLQDRIRFLLCDYRKLPSTERYDRIISCEMIEAVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM +FFG CESVLAENG+ VLQFISIPDERYDEYR SSDFIKEYIFPGGCLP LSR+T+
Sbjct  712   EFMEDFFGSCESVLAENGLFVLQFISIPDERYDEYRLSSDFIKEYIFPGGCLPCLSRLTT  771

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE QS+IL LGFD+ FIRTWEYYFDYCAA
Sbjct  772   AMANASRLCVEHLENIGIHYHQTLRCWRKNFLENQSKILQLGFDESFIRTWEYYFDYCAA  831

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  832   GFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  865


 Score =   343 bits (880),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1     MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGV+ME SDMSFSVSLD G G EWGSRNG S LFAQKKNLLNPYFWQMIR
Sbjct  61    YPNMMEFFENLGVEMETSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNLLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV++YLE  +NN D+DRN+TLG+FIKSRGYSELFQ AY+IPMC SIWSC SEG
Sbjct  121   EIVKFKDDVINYLEVIENNSDIDRNETLGQFIKSRGYSELFQNAYLIPMCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             V++FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   VLSFSAFSVLSFCRNHHLLQLFGRPQW  207



>ref|XP_010023867.1| PREDICTED: uncharacterized protein LOC104414444 [Eucalyptus grandis]
 gb|KCW60266.1| hypothetical protein EUGRSUZ_H02976 [Eucalyptus grandis]
Length=865

 Score =  1036 bits (2679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/686 (72%), Positives = 577/686 (84%), Gaps = 7/686 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQ+ GRPQWLTV+RRSHSYVNKVR+ELE RGCEIR  CEV S+ST
Sbjct  184   FSAFSVLSFCRNHHLLQVLGRPQWLTVRRRSHSYVNKVRDELECRGCEIRTSCEVRSIST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              +QG     V+++G    +E YD CI+A HAPD L++LG QAT+DE+R+LGAFQY YSDI
Sbjct  244   SDQG----CVVLTGDG-SEELYDKCIVAVHAPDALRLLGDQATYDEMRVLGAFQYAYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLHR+++FMP+N AAWSAWNFLG+  N+VCLTYWL+ LQNL     P+LVTLNP R P+ 
Sbjct  299   YLHRDKTFMPKNPAAWSAWNFLGSTENKVCLTYWLDVLQNLDQKDLPFLVTLNPSREPQN  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW TGHP+PSVAAS+AS EL++IQGKR IWFCGAYQGYGFHEDGLKAGM AAHG++ 
Sbjct  359   TLLKWCTGHPIPSVAASKASQELDQIQGKRGIWFCGAYQGYGFHEDGLKAGMAAAHGVIG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             +  S L NP HMVPS  E GARL VTRFL  +I TGS+ILLEEGGT+FTFEGT K   L 
Sbjct  419   QSHSVLENPQHMVPSLMEMGARLFVTRFLGRYISTGSLILLEEGGTMFTFEGTTKGCPLT  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +R+HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNLF+I +ANRD   +VS+ 
Sbjct  479   VNLRIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDRGLLNLFQILIANRDSDTTVSKL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + KRGWWTP+L T+ IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  539   SKKRGWWTPMLLTAGIASAKYFFKHVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK E EDLK AQMRKI LLI KA+I K H +LEIGCGWGS AIE V +TGCKYTGI
Sbjct  599   SCAVFKMEGEDLKVAQMRKICLLIKKARIEKTHEVLEIGCGWGSFAIEVVRQTGCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS++QLKYAE +V+EAGLQD+I+FLLCDYRQLP   +YDRIISCEM+EAVGHE+M EFF
Sbjct  659   TLSKEQLKYAESRVKEAGLQDHIKFLLCDYRQLPSTYKYDRIISCEMIEAVGHEYMEEFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               CESVLA++G++VLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMA++SR
Sbjct  719   SCCESVLAKDGLVVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMASASR  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEHL++IGIHYYQTL+CWR NF+E++ +IL LGF+++FIRTWEYYFDYCAAGF   TL
Sbjct  779   LCVEHLDNIGIHYYQTLQCWRKNFMEKKRKILALGFNEEFIRTWEYYFDYCAAGFKLHTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASA  3022
             G+YQIVFSRPGN  AF DPY    S+
Sbjct  839   GNYQIVFSRPGNDDAFADPYVSFPSS  864


 Score =   332 bits (852),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = +1

Query  445   SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  624
             +AY  A+GGA VVVYEKEDYLGGHAKTV+ DGVDLDLGFMVFNRVTYPNMMELFESL VD
Sbjct  15    AAYEAARGGAKVVVYEKEDYLGGHAKTVSFDGVDLDLGFMVFNRVTYPNMMELFESLRVD  74

Query  625   MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLE  804
             MEISDMSFSVSLD G G EWGSRNG  GLFAQK N+LNPYFWQM+REI+KFK DVLSYLE
Sbjct  75    MEISDMSFSVSLDEGRGCEWGSRNGLLGLFAQKSNVLNPYFWQMLREIIKFKEDVLSYLE  134

Query  805   EFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCR  984
               + NPD+DRN+TLG+F+KSRGYSELFQ+AYIIP+C SIWSCSS+GVM+FSA+S+LSFCR
Sbjct  135   GLERNPDIDRNETLGQFVKSRGYSELFQRAYIIPICGSIWSCSSKGVMSFSAFSVLSFCR  194

Query  985   NHHLLQNFSPALW  1023
             NHHLLQ      W
Sbjct  195   NHHLLQVLGRPQW  207



>emb|CAN68017.1| hypothetical protein VITISV_025151 [Vitis vinifera]
Length=874

 Score =  1035 bits (2675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/681 (74%), Positives = 577/681 (85%), Gaps = 20/681 (3%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTVK RSH YV+KVREELE +GC IR GCEV SVST
Sbjct  184   FSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHYYVHKVREELESKGCRIRTGCEVVSVST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G      +  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV SDI
Sbjct  244   TDDG----CTVFCGDG-SQEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVSSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LH +++FMP+N AAWSAWNFLGT++N+VCLTYWLN LQN+  T +P+LVTLNPP TP+ 
Sbjct  299   FLHCDKNFMPQNPAAWSAWNFLGTIDNKVCLTYWLNVLQNIDQTSRPFLVTLNPPHTPDH  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+T HP PSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAHG+L 
Sbjct  359   TLLKWSTSHPFPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHGMLG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++T EG+ KK LLK
Sbjct  419   KGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTVEGSRKKCLLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             +             ATQADLGLADAYI+GD S VDK EGL NLF IF+ANRDL +S+SR 
Sbjct  479   I-------------ATQADLGLADAYINGDFSLVDKDEGLQNLFMIFIANRDLDSSLSRL  525

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N+KRGWWTPL FT+ IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  526   NNKRGWWTPLFFTAGIASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  585

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK+E EDLK AQ+RKISLLI+K +I K+H +LEIGCGWGSLAIE V++TGCKYTGI
Sbjct  586   SCAVFKTEREDLKVAQLRKISLLIEKVRIDKKHEVLEIGCGWGSLAIEVVKQTGCKYTGI  645

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLK+AE KV+EAGLQDNIRFLLCDYRQL D+ +YDRIISCEMLEAVGHE+M EFF
Sbjct  646   TLSEEQLKFAEMKVKEAGLQDNIRFLLCDYRQLSDSYKYDRIISCEMLEAVGHEYMEEFF  705

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLAE+G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAA+SR
Sbjct  706   GCCESVLAEDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAAASR  765

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EHLE+IGIHYYQTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TL
Sbjct  766   LCMEHLENIGIHYYQTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTHTL  825

Query  2945  GDYQIVFSRPGNVTAFGDPYK  3007
             G+YQIVFSRPGN  AF +PYK
Sbjct  826   GNYQIVFSRPGNAAAFSNPYK  846


 Score =   355 bits (912),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV LDLGFMVFNRVT
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVPLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGV+ME+SDMSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61    YPNMMEFFETLGVBMELSDMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             +++KFK+DVL YLEE +NNPDMDRN TLG+FIK RGYSELFQKAY++P+CASIWSC +EG
Sbjct  121   DVIKFKDDVLKYLEELENNPDMDRNQTLGDFIKCRGYSELFQKAYLVPICASIWSCPAEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   VMTFSAFSVLSFCRNHHLLQLFGRPQW  207



>gb|KGN61573.1| hypothetical protein Csa_2G171940 [Cucumis sativus]
Length=865

 Score =  1033 bits (2672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/694 (71%), Positives = 581/694 (84%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTVK RSHSYV KV+E LE  GC+IR   
Sbjct  177   PSEGVLSFSAFSVLSFCRNHHLLQLFGRPQWLTVKGRSHSYVKKVQEVLESHGCQIRTSS  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+S+ST ++G       +S  + +QE +D CI+A HAPDTL++LG +AT DELR+LGAF
Sbjct  237   EVNSISTMDKGCK-----VSYGDDLQEMFDACIIATHAPDTLRILGNEATSDELRVLGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY YSDI+LHR+++ MP+N AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLN
Sbjct  292   QYAYSDIFLHRDKNLMPQNPAAWSAWNFLGNTDKKVCLTYWLNVLQNLGETGPPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P + P+  LLKW+TGHP+P+ AAS+AS+E   IQG RRIWFCGAYQGYGFHEDGLKAG++
Sbjct  352   PDKEPKNILLKWSTGHPIPTDAASKASNEFHSIQGNRRIWFCGAYQGYGFHEDGLKAGIV  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA  LL    + L+NP HM PS  +TGARL VTRFL  +I +GS+ L+EEGGT+FTFEGT
Sbjct  412   AAQNLLGNSLTLLSNPKHMAPSLVDTGARLFVTRFLGQYITSGSLTLIEEGGTIFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             DKK L KV+V+VHSPQFYWK+ T+ADLGLADAYI+GD SFVDK EGLLN F I +A+RD 
Sbjct  472   DKKCLPKVVVKVHSPQFYWKIMTRADLGLADAYINGDFSFVDKDEGLLNFFLIIIASRDT  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S+++   KRGWWTP LFT+ IASAKYF +H SRQNTLTQARRNISRHYDLSNELFSLF
Sbjct  532   NSSIAKQKKKRGWWTPPLFTACIASAKYFFQHASRQNTLTQARRNISRHYDLSNELFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD+TMTYSCA+FK E+EDLK AQMRKISLLI+KA+I+K HH+LEIGCGWGSLAIE V++T
Sbjct  592   LDDTMTYSCAIFKGENEDLKVAQMRKISLLIEKARINKNHHVLEIGCGWGSLAIEIVKKT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GC YTGITLSE+QLKYAE +V++A LQD IRFLLCDYR+LP   +YDRIISCEM+EAVGH
Sbjct  652   GCHYTGITLSEEQLKYAEKRVKDANLQDRIRFLLCDYRKLPSTEKYDRIISCEMIEAVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM +FFG CESVLAENG+ VLQFISIPDERY+EYR SSDFIKEYIFPGGCLP LSR+T+
Sbjct  712   EFMEDFFGSCESVLAENGLFVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPCLSRLTT  771

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA +SRLCVEHLE+IGIHY+QTLRCWR NFLE +S+IL LGFD+ FIRTWEYYFDYCAA
Sbjct  772   AMANASRLCVEHLENIGIHYHQTLRCWRKNFLENKSKILQLGFDESFIRTWEYYFDYCAA  831

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  832   GFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  865


 Score =   338 bits (867),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1     MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LF+QKKNLLNPYFWQMIR
Sbjct  61    YPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFSQKKNLLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV +YLE  +NN D+DRN+TLG+FIKS GYSELFQ  Y+IPMC SIWSC SEG
Sbjct  121   EIVKFKDDVTNYLEVLENNSDIDRNETLGQFIKSMGYSELFQNGYLIPMCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             V++FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   VLSFSAFSVLSFCRNHHLLQLFGRPQW  207



>gb|KEH42686.1| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=860

 Score =  1033 bits (2671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/681 (72%), Positives = 577/681 (85%), Gaps = 8/681 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV+ RS +YV KV+EEL+  G +I   CEV  VS+
Sbjct  183   FSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSQNYVKKVKEELQSNGSQIITNCEVDFVSS  242

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E+G      ++ GK+  +E YDGCIM+ HAPD L++LG +AT+DE RI+GAFQY YSDI
Sbjct  243   SEKG-----CVVYGKDGSEEVYDGCIMSVHAPDALRLLGDEATYDERRIIGAFQYAYSDI  297

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLHR+++ MP+N AAWSAWNFLG+ NN+VC+TYWLN LQN+ +  +P+ VTLNP   PE 
Sbjct  298   YLHRDKNLMPQNPAAWSAWNFLGSNNNKVCVTYWLNILQNIEEAGKPFFVTLNPDHVPEN  357

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGHPVPSVAA +AS EL+RIQGKR+IWF GAYQGYGFHEDGLKAGM AAHG+L 
Sbjct  358   TLLKWSTGHPVPSVAAYKASVELDRIQGKRKIWFSGAYQGYGFHEDGLKAGMTAAHGILG  417

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
               C+   NP HMVPSW E GAR+ VTRFL+SFI TGS+ LLEEGGT+FTFEGT KK   K
Sbjct  418   DCCTLKTNPKHMVPSWKELGARIFVTRFLSSFITTGSLTLLEEGGTMFTFEGTGKKCSPK  477

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++RVHSPQFYWKV TQADLGLADAYI+GD SFVDK EGLLN F + +ANRDL++S  + 
Sbjct  478   SVLRVHSPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNFFLVLIANRDLNSSNPKL  537

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
              S RGWWTP+LFT+ + SAK+F+ H+SR+NTLTQARRNISRHYDLSNELF+LFLDETMTY
Sbjct  538   KS-RGWWTPILFTAGLTSAKFFMDHVSRKNTLTQARRNISRHYDLSNELFALFLDETMTY  596

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK EDEDLK AQMRKISLLI+KA+I K+H ILEIGCGWGSLAIE V+RTGCKYTGI
Sbjct  597   SCAVFKDEDEDLKEAQMRKISLLIEKARIEKKHEILEIGCGWGSLAIEVVKRTGCKYTGI  656

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLK AE +V++AGLQDNI+FLLCDYRQLP   +YDRIISCEM+EAVGHE+M EFF
Sbjct  657   TLSEEQLKLAEKRVKDAGLQDNIKFLLCDYRQLPKTYKYDRIISCEMIEAVGHEYMEEFF  716

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESV+A +G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TS+MA++SR
Sbjct  717   GCCESVMANDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSSMASTSR  776

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH+E+ GIHYYQTLR WR NFLERQS+IL LGF++KFIRTWEYYFDYC AGF + TL
Sbjct  777   LCVEHVENFGIHYYQTLRLWRKNFLERQSEILALGFNEKFIRTWEYYFDYCGAGFKSRTL  836

Query  2945  GDYQIVFSRPGNVTAFGDPYK  3007
             G+YQ+VFSRPGNVTAF DPYK
Sbjct  837   GNYQVVFSRPGNVTAFTDPYK  857


 Score =   350 bits (899),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 186/207 (90%), Gaps = 1/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG GISGLVSAYVLAKGG  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVVGGGISGLVSAYVLAKGGVNVVLYEKEDYLGGHAKTVNADGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGV+ME+SDMSFSVSLD G G EWGSR+  SGLFAQK+N LNPYFWQMIR
Sbjct  61    YPNMMEFFESLGVEMELSDMSFSVSLDKGRGCEWGSRS-LSGLFAQKRNALNPYFWQMIR  119

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+D +SY++ F+NNPDMD N++LG+F+KSRGYSELFQKAY+IP+C SIWSCSSEG
Sbjct  120   EIVKFKDDAISYIDMFENNPDMDHNESLGQFLKSRGYSELFQKAYLIPICGSIWSCSSEG  179

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             V++FSA+S+LSFCRNHHLLQ F    W
Sbjct  180   VLSFSAFSVLSFCRNHHLLQLFGRPQW  206



>ref|XP_002528810.1| methyltransferase, putative [Ricinus communis]
 gb|EEF33544.1| methyltransferase, putative [Ricinus communis]
Length=865

 Score =  1031 bits (2666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/693 (71%), Positives = 585/693 (84%), Gaps = 7/693 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTVK RSHSYV+KVRE+LE  GC IR G 
Sbjct  177   PSEKVMSFSAYSILSFCRNHHLLQLFGRPQWLTVKCRSHSYVHKVREKLESWGCVIRTGH  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EVH VST+++G      ++ G    +E Y  CI+  HAPD LK+LG QATFDE R+LGAF
Sbjct  237   EVHLVSTNDKG----CTVLCGDGS-EEQYSRCIIGVHAPDALKLLGNQATFDEKRVLGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY+YS+I+LHR++ FMP+   AWSAWNFLG  +N+VCLTYWLN LQNLG+T  P+LVTLN
Sbjct  292   QYLYSEIFLHRDKKFMPQKPTAWSAWNFLGNTDNKVCLTYWLNVLQNLGETNLPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TP+  LLKWTTGHPVPSVAAS+AS ELE IQG+R +WFCGAYQGYGFHEDGLK+GM+
Sbjct  352   PDHTPDNTLLKWTTGHPVPSVAASKASLELEHIQGRRGLWFCGAYQGYGFHEDGLKSGMV  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAH LL+K C+ L+NP HMVPS  ETGARL V+RFL  +I TG +ILLEEGGT+FTFEGT
Sbjct  412   AAHSLLEKSCAILSNPKHMVPSLLETGARLFVSRFLGQYISTGRVILLEEGGTIFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              KK   + +++VH+PQFYWK+ TQADLGLADAYI+GD SFVDK EGLLNLF + + NRD 
Sbjct  472   AKKCFSQTVMKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLLNLFMVLIVNRDA  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             +   S  N ++GWWTP+LFT++IASAK+F RH+SRQN+LTQARRNISRHYDLSN+LFSLF
Sbjct  532   NKPESELNKRKGWWTPMLFTASIASAKFFFRHVSRQNSLTQARRNISRHYDLSNDLFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYS AVFK+EDEDLK AQMRKISLLI KA+I+KEH ILEIGCGWG+LAIE V+RT
Sbjct  592   LDETMTYSSAVFKTEDEDLKAAQMRKISLLIGKARINKEHEILEIGCGWGTLAIEVVKRT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYAE++V+EAGLQD+IRF L DYRQLPD C+YDRIISCEM+EAVGH
Sbjct  652   GCKYTGITLSEEQLKYAEERVKEAGLQDSIRFQLRDYRQLPDTCKYDRIISCEMIEAVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M +FF  CESVLA++G++VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+T+
Sbjct  712   EYMEKFFSCCESVLAKDGVIVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLTRITT  771

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAAS+RLCVEH+E+IGIHYYQTLR WR NF+E +S+I+ LGF++KFIRTWEYYFDYCAA
Sbjct  772   AMAASTRLCVEHVENIGIHYYQTLRYWRKNFVENKSKIMALGFNEKFIRTWEYYFDYCAA  831

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             GF T TLG+YQ+V SRPGNV A G+PYK   +A
Sbjct  832   GFKTLTLGNYQVVLSRPGNVAALGNPYKEFPAA  864


 Score =   359 bits (922),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG GISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV  DGVDLDLGFMVFN VT
Sbjct  1     MRVAVVGGGISGLVSAYVLAKDGVEVVLYEKEEYLGGHAKTVCFDGVDLDLGFMVFNCVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME+SDMSFSVSLDNG GYEWGSRNG  GLFAQK N  NPYFWQMIR
Sbjct  61    YPNMMEFFESLGVDMELSDMSFSVSLDNGKGYEWGSRNGLPGLFAQKTNAFNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK+DVLSYLE  +NNPD+DRN+TLG FIKSRGYSELFQKAY++PMC SIWSC SE 
Sbjct  121   EVIKFKDDVLSYLEVLENNPDIDRNETLGNFIKSRGYSELFQKAYLVPMCGSIWSCPSEK  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM+FSAYSILSFCRNHHLLQ F    W
Sbjct  181   VMSFSAYSILSFCRNHHLLQLFGRPQW  207



>gb|AAT74602.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =  1026 bits (2654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/686 (72%), Positives = 578/686 (84%), Gaps = 7/686 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQ+FGRPQW+TV+ RSH YVNKVREELE  GC+IR GCEVHSV +
Sbjct  184   FSAFSILSFCRNHHLLQIFGRPQWMTVRWRSHRYVNKVREELESTGCQIRTGCEVHSVLS  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
             D    A G  ++ G +   E Y GCIMA HAP  L++LG QAT+DE  +LGAFQYVYSDI
Sbjct  244   D----AEGCTVLCGDDS-HELYQGCIMAVHAPYALRLLGNQATYDESTVLGAFQYVYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLHR+++ MP+N AAWSAWNFLG+ +  V LTYWLN LQNLG+T  P+LVTLNP  TP+ 
Sbjct  299   YLHRDKNLMPKNPAAWSAWNFLGSTDKNVSLTYWLNVLQNLGETSLPFLVTLNPDYTPKH  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW TGHPVPSVAA++AS EL+RIQGKR IWFCGAY GYGFHEDGLKAGMIAA+GLL 
Sbjct  359   TLLKWRTGHPVPSVAATKASLELDRIQGKRGIWFCGAYLGYGFHEDGLKAGMIAANGLLG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ L+NP HMVPS  ETGARL VTRFL+ FI TG +ILLEEGGT+FTFEGT  K  LK
Sbjct  419   KSCNILSNPKHMVPSLMETGARLFVTRFLSHFISTGCVILLEEGGTMFTFEGTSNKCSLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              +++VHSP FYWKV T+ADLGLAD+YI+GD SFVDKK+GLLNL  I +ANRDL +S S+ 
Sbjct  479   TVIKVHSPHFYWKVMTEADLGLADSYINGDFSFVDKKDGLLNLVMILIANRDLISSNSKL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + KRGWWTPLLFT+ + SAKYF +H+ RQNTLTQARRNISRHYDLSN+LF+LFLDETMTY
Sbjct  539   SKKRGWWTPLLFTAGLTSAKYFFKHVLRQNTLTQARRNISRHYDLSNDLFALFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK+EDEDLK AQ RKISLLI+KA+I  +H ILEIGCGW SLAIE V+RTGCKYTGI
Sbjct  599   SCAVFKTEDEDLKDAQHRKISLLIEKARIDSKHEILEIGCGWXSLAIEVVKRTGCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLK AE +V+EAGLQ+NIRF LCDYRQLP   +YDRIISCEM+EAVGHE+M +FF
Sbjct  659   TLSEEQLKLAEKRVKEAGLQENIRFQLCDYRQLPSTYKYDRIISCEMIEAVGHEYMEDFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLA++G+LVLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+T+AM A+S+
Sbjct  719   GCCESVLADDGLLVLQFISIPEERYNEYRRSSDFIKEYIFPGGCLPSLARITTAMNAASK  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH+E+IG+HYYQTLR WR NFLE+QS+I  LGF+ KFIRTWEYYFDYCAAGF + TL
Sbjct  779   LCVEHVENIGLHYYQTLRYWRKNFLEKQSKIHALGFNDKFIRTWEYYFDYCAAGFKSNTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASA  3022
             G+YQ+VFSRPGNV A G+PYK   SA
Sbjct  839   GNYQVVFSRPGNVVALGNPYKDFPSA  864


 Score =   342 bits (877),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M++AV+G GISG+VSAY LAK GA VV+YEKE+YLGGH+KTV  DGVDLDLGFMVFNRVT
Sbjct  1     MKIAVIGGGISGVVSAYTLAKAGANVVLYEKEEYLGGHSKTVHFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFESLG+DME  DMS SVSL+ G G EWGSRNG S LFAQK NL NPYFWQM+R
Sbjct  61    YPNMMELFESLGIDMEPFDMSLSVSLNEGKGCEWGSRNGLSALFAQKSNLFNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EILKFKNDV+SYLE  +NNPD+DRN+TLG+FIKS+GYS+LFQKAY++P+C SIWSC +E 
Sbjct  121   EILKFKNDVISYLELLENNPDIDRNETLGQFIKSKGYSDLFQKAYLVPVCGSIWSCPTER  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSA+SILSFCRNHHLLQ F    W
Sbjct  181   VMDFSAFSILSFCRNHHLLQIFGRPQW  207



>ref|XP_011030438.1| PREDICTED: uncharacterized protein LOC105129890 isoform X3 [Populus 
euphratica]
Length=868

 Score =  1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/694 (71%), Positives = 578/694 (83%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +F R    LQLFGRP WL V+R+S SYVNKVRE+LE  GC+IR GC
Sbjct  180   PSEGVMNFSAFSVLSFFRNHHLLQLFGRPPWLRVRRQSRSYVNKVREKLESWGCQIRTGC  239

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV +VST ++G A     +  ++   E Y GCIMA HAPD L +LG+QATFDE RILGAF
Sbjct  240   EVQAVSTTDEGCA-----VLCRDGSLEMYSGCIMAVHAPDALGILGEQATFDETRILGAF  294

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY+YS+I+LHR++ FMP+N AAW AWNFLG+  N+ CLTYWLN LQN+ +T  P+LVTLN
Sbjct  295   QYMYSEIFLHRDKKFMPQNSAAWCAWNFLGSTENKACLTYWLNVLQNIDETGLPFLVTLN  354

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   P+  LL+W+TGHP+PSVAA++AS ELE IQGKRRIWF GAYQGYGFHED LK+GM+
Sbjct  355   PDNAPDHTLLQWSTGHPIPSVAATKASLELEHIQGKRRIWFGGAYQGYGFHEDRLKSGMV  414

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHGLL K C  + NP HMVPS  ETGARL VTRFL   I TG + LLE+GGTVF+FEGT
Sbjct  415   AAHGLLGKSCDIMRNPKHMVPSMLETGARLFVTRFLGHHISTGCLTLLEDGGTVFSFEGT  474

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              KK  LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFVDK EGL+NLF I + NRD 
Sbjct  475   SKKCSLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLINLFMILIVNRDA  534

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               S S+ N KRGWWTPLLFT+ IASAK+FI+H+SR+NTLTQARRNISRHYDLSNELF+LF
Sbjct  535   DNSTSKLNKKRGWWTPLLFTAGIASAKFFIQHVSRKNTLTQARRNISRHYDLSNELFALF  594

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+FK EDEDLK+AQ++KISLLI+KA+++K+H +LEIGCGWG+LAIE V+RT
Sbjct  595   LDETMTYSCALFKKEDEDLKSAQIQKISLLIEKARVNKDHEVLEIGCGWGTLAIEVVQRT  654

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GC+YTGITLSE+QLKYAE KV+EAGLQD+I+F LCDYRQLP   +YDRIISCEM+EAVGH
Sbjct  655   GCRYTGITLSEEQLKYAELKVKEAGLQDSIKFHLCDYRQLPMTHKYDRIISCEMIEAVGH  714

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M EFFG CESVL ENG+ VLQFISIP+ERYD YRQSSDFIKEYIFPGGCLPSL+++TS
Sbjct  715   EYMEEFFGCCESVLDENGLFVLQFISIPEERYDLYRQSSDFIKEYIFPGGCLPSLTKITS  774

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL LGF++KFIRTWEYYFDYCAA
Sbjct  775   AMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAA  834

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  835   GFKTHTLGNYQVVFSRPGNVAALSNPYRGFPSAY  868


 Score =   347 bits (890),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             +MRVAVVGAG+SGLVSAYVLA+ GA VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3     RMRVAVVGAGLSGLVSAYVLARAGAEVVLYEKEDYLGGHAKTVRFDGVDLDLGFMVFNRV  62

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             T PNMME FE+LG+DME+SD+SFSVSLD G GYEWGSRNGFSGLFAQKKN+L+PYFW+++
Sbjct  63    TCPNMMEFFENLGIDMELSDVSFSVSLDQGKGYEWGSRNGFSGLFAQKKNVLSPYFWKVL  122

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK+DVLSYLE  +NNP +DRN+TLG+F+KS GYSELFQKAY++P+C SIWSC SE
Sbjct  123   REIVKFKDDVLSYLEVLENNPVVDRNETLGQFVKSGGYSELFQKAYLVPVCGSIWSCPSE  182

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GVM FSA+S+LSF RNHHLLQ F    W
Sbjct  183   GVMNFSAFSVLSFFRNHHLLQLFGRPPW  210



>ref|XP_010023868.1| PREDICTED: uncharacterized protein LOC104414445 [Eucalyptus grandis]
 gb|KCW60265.1| hypothetical protein EUGRSUZ_H02975 [Eucalyptus grandis]
Length=865

 Score =  1023 bits (2644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/686 (71%), Positives = 573/686 (84%), Gaps = 7/686 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQ+ GRPQWLTV+RRSHSYVNKVR ELE RGCEIR  CEV S+ST
Sbjct  184   FSAFSVLSFCRNHHLLQVLGRPQWLTVRRRSHSYVNKVRGELECRGCEIRTSCEVRSIST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              +QG     V+++G    +E YD CI+A HAPD L++LG QAT+DE+R+LGAFQY YSDI
Sbjct  244   SDQG----CVVLTGDG-SEELYDKCIVAVHAPDALRLLGDQATYDEMRVLGAFQYAYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +++FMP+  AAWSAWNFLG+  N++CLTYWL+ +QNL     P+LVTLNP R P+ 
Sbjct  299   YLHHDKTFMPKKPAAWSAWNFLGSTENKLCLTYWLDVIQNLDQKDLPFLVTLNPSREPQN  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW TGHP+PSVAAS+AS EL++IQGKR IWFCGAYQGYGFHEDGLKAGM AAHG++ 
Sbjct  359   TLLKWCTGHPIPSVAASKASQELDQIQGKRGIWFCGAYQGYGFHEDGLKAGMAAAHGVIG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             +  S L NP HMVPS  E GARL VTRFL  +I TGS+ILLEEGG +FTFEGT K+  L 
Sbjct  419   QSHSVLENPQHMVPSLMEMGARLFVTRFLGRYISTGSLILLEEGGKMFTFEGTTKRCPLT  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +R+HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNLF+I +ANRD   +VS+ 
Sbjct  479   VNLRIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDRGLLNLFQILIANRDSDTTVSKL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + KRGWWTP+L T+ IASAKY+ +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  539   SKKRGWWTPMLLTAGIASAKYYFKHVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK   EDLK AQMRKI LLI KA+I K H +LEIGCGWGS AIE V +TGCKYTGI
Sbjct  599   SCAVFKMAGEDLKVAQMRKICLLIKKARIEKTHEVLEIGCGWGSFAIEVVRQTGCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS++QLKYAE +V+EAGLQD I+FLLC+YRQLP   +YDRIISCEM+EAVGHE+M EFF
Sbjct  659   TLSKEQLKYAESRVKEAGLQDRIKFLLCNYRQLPSTYKYDRIISCEMIEAVGHEYMEEFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               CESVLA+NG+LVLQFISIPDERYDE+R+SS F+KEYIFPGGCLPSLSR+TSAMA++SR
Sbjct  719   SCCESVLAKNGLLVLQFISIPDERYDEHRRSSSFMKEYIFPGGCLPSLSRITSAMASASR  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEHL++IGIHYYQTL+CWR NFLE++ +IL LGF+++FIRTWEYYFDYCAAGF + TL
Sbjct  779   LCVEHLDNIGIHYYQTLQCWRKNFLEKKRKILALGFNEEFIRTWEYYFDYCAAGFKSHTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASA  3022
             G+YQIVFSRPGN  AF DPY G  S+
Sbjct  839   GNYQIVFSRPGNDAAFADPYVGFLSS  864


 Score =   329 bits (843),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  445   SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  624
             +AY   +GGA VVVYEKEDYLGGHAKTV++DGVDLDLGFMVFNRVTYPNMMELFESLGVD
Sbjct  15    AAYEAVRGGAKVVVYEKEDYLGGHAKTVSIDGVDLDLGFMVFNRVTYPNMMELFESLGVD  74

Query  625   MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLE  804
             MEISDMSFSVSLD G G EWG RNG   LFAQK N+LNPYFWQM+REI+KFK DVLSYLE
Sbjct  75    MEISDMSFSVSLDEGQGCEWGGRNGLWSLFAQKSNVLNPYFWQMLREIIKFKEDVLSYLE  134

Query  805   EFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCR  984
               + NPD+DRN+TLG+F+KSRGYSELFQ+A+IIP+C SIWSCSS+GVM+FSA+S+LSFCR
Sbjct  135   GLERNPDIDRNETLGQFVKSRGYSELFQRAFIIPICGSIWSCSSKGVMSFSAFSVLSFCR  194

Query  985   NHHLLQNFSPALW  1023
             NHHLLQ      W
Sbjct  195   NHHLLQVLGRPQW  207



>ref|XP_008340636.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340637.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340639.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
 ref|XP_008340640.1| PREDICTED: uncharacterized protein LOC103403572 isoform X1 [Malus 
domestica]
Length=863

 Score =  1022 bits (2643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/689 (73%), Positives = 580/689 (84%), Gaps = 8/689 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RSH YV KVRE LE +GC IR   
Sbjct  177   PSEGVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCHIRTSS  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EVH VST ++G      +ISG  + +E ++GCI+A H PD +++LG QAT DELR+LGAF
Sbjct  237   EVHRVSTSDEG----CTVISGDGL-EEVFNGCIIAVHXPDAVRILGDQATSDELRVLGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDI+LHR++  MPRN AAWSAWNFLG+  N+VCLTYWLN LQN+ +T  P+LVTLN
Sbjct  292   QYVYSDIFLHRDKXLMPRNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDETGLPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TP+  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAY GYGFHEDGLKAGM 
Sbjct  352   PEHTPKHTLLKWSTSHPVPSVAASKASLELPRIQGKRGIWFCGAYXGYGFHEDGLKAGMD  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHGLL K  + L+NP HMVPS  ETGARL VTRFL  FI TG +I LEEGGT+FTFEGT
Sbjct  412   AAHGLLGKGXALLDNPKHMVPSLTETGARLFVTRFLTHFISTGCLIFLEEGGTIFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K   LK +++VH+PQFYWKV TQADLGLADAYI+GD SFVDK +GLLNL  I +ANRD 
Sbjct  472   RKGCSLKCVIKVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDKGLLNLIMILIANRDA  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S S+   KRGWWTPLLFT++IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFS F
Sbjct  532   NSSDSKLTKKRGWWTPLLFTASIASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSQF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYS AVFK+EDEDLK AQ+RKIS+LI+KA+I K H +LEIGCGWGSLAI+ V++T
Sbjct  592   LDETMTYSSAVFKTEDEDLKVAQLRKISILIEKARIEKNHEVLEIGCGWGSLAIKVVKQT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYA++KV+EAGLQD I+FLLCDYRQL  + +YDRIISCEMLE+VGH
Sbjct  652   GCKYTGITLSEEQLKYAQEKVKEAGLQDRIKFLLCDYRQLA-SYKYDRIISCEMLESVGH  710

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM+EFF  CESVLAENG+LVLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPSLSRVTS
Sbjct  711   EFMDEFFSCCESVLAENGLLVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTS  770

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAASSRLCVEHLE+IGIHY+QTLR WR NFL+RQ +IL LGFD+KFIRTWEYYFDYCAA
Sbjct  771   AMAASSRLCVEHLENIGIHYFQTLRYWRKNFLDRQGEILALGFDEKFIRTWEYYFDYCAA  830

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKG  3010
             GF T TLG+YQIVFSRPGNV AF +PYKG
Sbjct  831   GFRTYTLGNYQIVFSRPGNVPAFSNPYKG  859


 Score =   353 bits (905),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 166/216 (77%), Positives = 186/216 (86%), Gaps = 2/216 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+GAG+SGLVSAYVLAK G  VVVYEK+DYLGGHA+TVT DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVIGAGMSGLVSAYVLAKEGVEVVVYEKDDYLGGHARTVTFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME SDMSFS SLDNG G EWGSRNG S LFAQK NL+NPYFWQM+R
Sbjct  61    YPNMMEFFESLGVDMETSDMSFSASLDNGRGCEWGSRNGLSSLFAQKTNLINPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D ++YLEE +NN D+DR++TLG+FIKSRGYSELFQKAY +P+C SIWSC SEG
Sbjct  121   EITKFKHDAINYLEELENNQDIDRSETLGQFIKSRGYSELFQKAYXVPVCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALWSPT--MAHC  1044
             VM+FSA+S+LSFCRNHHLLQ F    W      +HC
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHC  216



>ref|XP_004495453.1| PREDICTED: uncharacterized protein LOC101501999 [Cicer arietinum]
Length=864

 Score =  1022 bits (2642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/683 (71%), Positives = 576/683 (84%), Gaps = 9/683 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTVK RS +YV KV+EEL+  G +I   CEV  VS 
Sbjct  184   FSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSQNYVKKVKEELQSNGSQIVANCEVDLVSA  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E G      ++  K+  +E YDGCIMA HAPD L++LG +AT+DE RI+GAFQY YSDI
Sbjct  244   SENG-----CVVHCKDGSEEMYDGCIMAIHAPDALRLLGDEATYDERRIIGAFQYAYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR++S MP+N AAWSAWNFLG+ NN+VC+TYWLN LQN+ +  +P+ VTLNP   PE 
Sbjct  299   FLHRDESLMPQNPAAWSAWNFLGSTNNKVCVTYWLNILQNIEEAGKPFFVTLNPDHVPEN  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGHPVPSVAA +AS+EL+ IQGKRRIWF GAYQGYGFHEDGLKAGM AAHG+L 
Sbjct  359   TLLKWSTGHPVPSVAAYKASAELDSIQGKRRIWFSGAYQGYGFHEDGLKAGMAAAHGILG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             + C+ L NP HMVPSW E GARL VTRFL+ FI TGS+ LLEEGGT+FTFEGT K    K
Sbjct  419   RCCALLTNPIHMVPSWKELGARLFVTRFLSCFITTGSLTLLEEGGTMFTFEGTGKMCSPK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++RVH+PQFYWKV TQADLGLADAYI+GD SFVDK EGLLN F + +ANRDL+AS S+ 
Sbjct  479   SVLRVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNFFLVLIANRDLNASNSKL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
                RGWWTP+LFT+ + SAK+F+ H+SR+NTLTQARRNISRHYDLSNELF++FLDETMTY
Sbjct  539   KKSRGWWTPILFTAGLTSAKFFMDHVSRKNTLTQARRNISRHYDLSNELFAIFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK+EDEDLK AQMRKISLLI+KAKI K+H ILEIGCGWGSLAIE V++TGCKYTGI
Sbjct  599   SCAVFKNEDEDLKDAQMRKISLLIEKAKIEKKHEILEIGCGWGSLAIEVVKKTGCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS++QLK AE +V++AGLQD+I+FLLCDYRQLP   ++DRIISCEM+EAVGHE+M EFF
Sbjct  659   TLSKEQLKLAEKRVQDAGLQDHIKFLLCDYRQLPKTYKFDRIISCEMIEAVGHEYMEEFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CES+LA++G+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMA++S+
Sbjct  719   GCCESLLADDGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMASTSK  778

Query  2765  LC--VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTC  2938
             LC  VEH+E++GIHYYQTLR WR NFLERQS+ILDLGF++KFIRTWEYYFDYC  GF + 
Sbjct  779   LCCSVEHVENMGIHYYQTLRWWRKNFLERQSEILDLGFNEKFIRTWEYYFDYCGGGFKSR  838

Query  2939  TLGDYQIVFSRPGNVTAFGDPYK  3007
             TLG+YQ+VFSRPGNVT F DPYK
Sbjct  839   TLGNYQVVFSRPGNVTTFSDPYK  861


 Score =   345 bits (885),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 183/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG+GISGLVSAYVLAK G  VV+YEKE+YLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1     MRVAVVGSGISGLVSAYVLAKAGVNVVLYEKENYLGGHAKTVNADGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME+SDMSFSVSLD G G EWGSRNG SGLFAQK+N+LNPYFWQMIR
Sbjct  61    YPNMMEFFESLGVDMELSDMSFSVSLDKGRGCEWGSRNGLSGLFAQKRNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+D +SY+   +NN  +D N++LG+F+KSRGYSELFQKAY+IP+C SIWSCS EG
Sbjct  121   EIIKFKDDAISYIAMIENNLQIDHNESLGQFLKSRGYSELFQKAYLIPICGSIWSCSYEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             V++FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   VLSFSAFSVLSFCRNHHLLQLFGRPQW  207



>ref|XP_011030435.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
 ref|XP_011030436.1| PREDICTED: uncharacterized protein LOC105129890 isoform X1 [Populus 
euphratica]
Length=869

 Score =  1021 bits (2641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/694 (71%), Positives = 579/694 (83%), Gaps = 6/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +F R    LQLFGRP WL V+R+S SYVNKVRE+LE  GC+IR GC
Sbjct  180   PSEGVMNFSAFSVLSFFRNHHLLQLFGRPPWLRVRRQSRSYVNKVREKLESWGCQIRTGC  239

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV +VST ++  AG  V+    ++  E Y GCIMA HAPD L +LG+QATFDE RILGAF
Sbjct  240   EVQAVSTTDE--AGCAVLCRDGSL--EMYSGCIMAVHAPDALGILGEQATFDETRILGAF  295

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY+YS+I+LHR++ FMP+N AAW AWNFLG+  N+ CLTYWLN LQN+ +T  P+LVTLN
Sbjct  296   QYMYSEIFLHRDKKFMPQNSAAWCAWNFLGSTENKACLTYWLNVLQNIDETGLPFLVTLN  355

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   P+  LL+W+TGHP+PSVAA++AS ELE IQGKRRIWF GAYQGYGFHED LK+GM+
Sbjct  356   PDNAPDHTLLQWSTGHPIPSVAATKASLELEHIQGKRRIWFGGAYQGYGFHEDRLKSGMV  415

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHGLL K C  + NP HMVPS  ETGARL VTRFL   I TG + LLE+GGTVF+FEGT
Sbjct  416   AAHGLLGKSCDIMRNPKHMVPSMLETGARLFVTRFLGHHISTGCLTLLEDGGTVFSFEGT  475

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              KK  LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFVDK EGL+NLF I + NRD 
Sbjct  476   SKKCSLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLINLFMILIVNRDA  535

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               S S+ N KRGWWTPLLFT+ IASAK+FI+H+SR+NTLTQARRNISRHYDLSNELF+LF
Sbjct  536   DNSTSKLNKKRGWWTPLLFTAGIASAKFFIQHVSRKNTLTQARRNISRHYDLSNELFALF  595

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+FK EDEDLK+AQ++KISLLI+KA+++K+H +LEIGCGWG+LAIE V+RT
Sbjct  596   LDETMTYSCALFKKEDEDLKSAQIQKISLLIEKARVNKDHEVLEIGCGWGTLAIEVVQRT  655

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GC+YTGITLSE+QLKYAE KV+EAGLQD+I+F LCDYRQLP   +YDRIISCEM+EAVGH
Sbjct  656   GCRYTGITLSEEQLKYAELKVKEAGLQDSIKFHLCDYRQLPMTHKYDRIISCEMIEAVGH  715

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M EFFG CESVL ENG+ VLQFISIP+ERYD YRQSSDFIKEYIFPGGCLPSL+++TS
Sbjct  716   EYMEEFFGCCESVLDENGLFVLQFISIPEERYDLYRQSSDFIKEYIFPGGCLPSLTKITS  775

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL LGF++KFIRTWEYYFDYCAA
Sbjct  776   AMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAA  835

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLG+YQ+VFSRPGNV A  +PY+G  SAY
Sbjct  836   GFKTHTLGNYQVVFSRPGNVAALSNPYRGFPSAY  869


 Score =   347 bits (890),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             +MRVAVVGAG+SGLVSAYVLA+ GA VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3     RMRVAVVGAGLSGLVSAYVLARAGAEVVLYEKEDYLGGHAKTVRFDGVDLDLGFMVFNRV  62

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             T PNMME FE+LG+DME+SD+SFSVSLD G GYEWGSRNGFSGLFAQKKN+L+PYFW+++
Sbjct  63    TCPNMMEFFENLGIDMELSDVSFSVSLDQGKGYEWGSRNGFSGLFAQKKNVLSPYFWKVL  122

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK+DVLSYLE  +NNP +DRN+TLG+F+KS GYSELFQKAY++P+C SIWSC SE
Sbjct  123   REIVKFKDDVLSYLEVLENNPVVDRNETLGQFVKSGGYSELFQKAYLVPVCGSIWSCPSE  182

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GVM FSA+S+LSF RNHHLLQ F    W
Sbjct  183   GVMNFSAFSVLSFFRNHHLLQLFGRPPW  210



>ref|XP_006296683.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
 gb|EOA29581.1| hypothetical protein CARUB_v10012958mg [Capsella rubella]
Length=867

 Score =  1021 bits (2640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/687 (71%), Positives = 566/687 (82%), Gaps = 9/687 (1%)
 Frame = +2

Query  971   FHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FC     LQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C+V SVST
Sbjct  185   FSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDVKSVST  244

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF+YVYSDI
Sbjct  245   SENG----CVTVTSGDESEEVFDRCILAMHAPDALRLLGEEVTFDETRVLGAFRYVYSDI  300

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +   MPRN AAWS+WNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP +TP++
Sbjct  301   YLHHDIDLMPRNQAAWSSWNFLGSTEKKVCVTYWLNILQNLGENGEPFFVTLNPDQTPKK  360

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKWTTGHPVPSVAA  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM AA GLL 
Sbjct  361   TLLKWTTGHPVPSVAAWTASQELHKIQGKRNLWFCGAYQGYGFHEDGLKAGMAAARGLLG  420

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  + LNNP HMVPS  ETGARL VTRF+  FI TGS+ LLEEGGT+FTF G D    LK
Sbjct  421   KEAALLNNPRHMVPSLTETGARLFVTRFMGQFISTGSVTLLEEGGTMFTFGGKDSTCPLK  480

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNL  I +ANRD  +++++ 
Sbjct  481   SILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLLNLIMILIANRDTKSNLTK-  539

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+TMTY
Sbjct  540   --KRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDDTMTY  597

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S AVFKS+DEDLKTAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V RTGCKYTGI
Sbjct  598   SSAVFKSDDEDLKTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTGCKYTGI  657

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS +QLKYAE KV+EAGLQD+I+F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF
Sbjct  658   TLSIEQLKYAEQKVKEAGLQDHIKFELCDYRQLSDVHKYDRIISCEMLEAVGHEFMEMFF  717

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
              RCE+ LAENG++VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSR
Sbjct  718   SRCEAALAENGLIVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSR  777

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD+KFIRTWEYYFDYCAAGF T TL
Sbjct  778   LCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFDEKFIRTWEYYFDYCAAGFKTLTL  837

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  838   GNYQLVFSRPGNVAAFADSYRGFPSAY  864


 Score =   332 bits (852),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQK N+LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKTNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y+EE + NPD+DRN TLG+F+ +RGYSELFQ AY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLKYIEELEGNPDIDRNQTLGDFLNARGYSELFQNAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV+ FSAYS+LSFC NHHLLQ F    W
Sbjct  181   GVLNFSAYSVLSFCCNHHLLQIFGRPQW  208



>ref|XP_006406021.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
 gb|ESQ47474.1| hypothetical protein EUTSA_v10020039mg [Eutrema salsugineum]
Length=870

 Score =  1020 bits (2637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/694 (70%), Positives = 567/694 (82%), Gaps = 6/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FC     LQ+FGRPQWLTV  RS SYV KVR ELE+ GC+IR  C
Sbjct  178   PSDGVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQSYVAKVRAELERLGCKIRTSC  237

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             ++ SV T E G     V ++  +  QE +D CIMA HAPD L++LG+Q T+DE RILGAF
Sbjct  238   DIKSVLTSEDG----CVTVTSGDGSQEEFDRCIMAMHAPDALRLLGEQVTYDETRILGAF  293

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             +YVYSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+ ++P+ VTLN
Sbjct  294   RYVYSDIYLHHDTDLMPRNRAAWSAWNFLGSTEKKVCVTYWLNILQNLGEDREPFFVTLN  353

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P +TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM 
Sbjct  354   PDQTPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNMWFCGAYQGYGFHEDGLKAGMA  413

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLL K  + LNNP HMVPS  E+GARL VTRF+  FI TGS+ +LEEGGT+FTF G 
Sbjct  414   AARGLLGKEAALLNNPRHMVPSLTESGARLFVTRFMGQFISTGSVTILEEGGTMFTFGGK  473

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             D    LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GL+NL  I +ANRDL
Sbjct  474   DSTCSLKSVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLVNLIMILIANRDL  533

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             S++ S    KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF LF
Sbjct  534   SSTKSNLAKKRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGLF  593

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD+TMTYS AVFKS+DEDLKTAQMRKISLLI+KA+I K H +LEIGCGWG+LAIE V RT
Sbjct  594   LDDTMTYSSAVFKSDDEDLKTAQMRKISLLIEKARIEKNHEVLEIGCGWGTLAIEVVRRT  653

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS +QLKYAE+KV+EAGL+D I+F LCDYRQL D  +YDRIISCEMLEAVGH
Sbjct  654   GCKYTGITLSIEQLKYAEEKVKEAGLEDRIKFELCDYRQLSDTQKYDRIISCEMLEAVGH  713

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM  FF RCE+ LA++G++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTS
Sbjct  714   EFMEMFFSRCEAALAQDGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTS  773

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA+SSRLC+EH+E+IGIHYY+TLR WR NFLERQ  I+ LGFD +FIRTWEYYFDYCAA
Sbjct  774   AMASSSRLCIEHVENIGIHYYKTLRLWRKNFLERQKPIIALGFDDQFIRTWEYYFDYCAA  833

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLG+YQ+VFSRPGN+ AF D YKG  SAY
Sbjct  834   GFKTLTLGNYQVVFSRPGNLAAFADSYKGFPSAY  867


 Score =   337 bits (865),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 159/220 (72%), Positives = 184/220 (84%), Gaps = 1/220 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMM+ FE LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFWQMI
Sbjct  61    TYPNMMDFFEKLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y+EE ++NPD+ RN+TLGEF+ SRGYSELFQKAY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLKYIEELESNPDISRNETLGEFLNSRGYSELFQKAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALWSPTMAHCEAEVS  1059
             GV++FSAYS+LSFC NHHLLQ F    W       ++ V+
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQSYVA  220



>ref|XP_009586642.1| PREDICTED: uncharacterized protein LOC104084479 isoform X3 [Nicotiana 
tomentosiformis]
Length=864

 Score =  1017 bits (2629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/671 (73%), Positives = 567/671 (85%), Gaps = 6/671 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQLFG  Q LTV+  SH+ VNKV+EELEKRGC+IR  CEV+SVSTD +G       I+  
Sbjct  199   LQLFGLSQLLTVRWGSHTSVNKVKEELEKRGCQIRTDCEVNSVSTDGEGCT-----IACN  253

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
             +  +E YDGCIMAAHAPDTL+MLGK+AT DE RILGAFQY YSDI+LHR+++F+PR+ AA
Sbjct  254   DGAKEVYDGCIMAAHAPDTLRMLGKEATCDETRILGAFQYSYSDIFLHRDKTFLPRDPAA  313

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSA NFLGT  NR  +TYWLN +QNLGD+K PYLVT++PP TPE  LLKWTTGH VPSVA
Sbjct  314   WSALNFLGTTKNRGRMTYWLNVIQNLGDSKLPYLVTVDPPHTPEHILLKWTTGHLVPSVA  373

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             AS+AS EL++IQGKR IWFCGAYQGYGFHEDGLK G+ AA G+L++ CS L+N  HMVP+
Sbjct  374   ASKASRELDQIQGKRGIWFCGAYQGYGFHEDGLKVGVAAADGVLRRNCSILDNSKHMVPT  433

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
             WPETGARL+VTRF  SFI TG IIL E GGTVFTF+GT++K  LKV +R+H PQFYWK A
Sbjct  434   WPETGARLVVTRFFRSFIKTGCIILFE-GGTVFTFQGTERKCSLKVSLRIHGPQFYWKTA  492

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             T+A++GLADA+IHGD SFVDK EGLLNL  IFVAN DL ASV+ S+ KRGWWTP LFT+A
Sbjct  493   TEAEIGLADAFIHGDFSFVDKNEGLLNLIMIFVANSDLKASVTSSSKKRGWWTPFLFTAA  552

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
             + SAKYFI+H+  QNTLTQARRNISRHYDLSNELFSLFLD TMTYSCA+FKSEDEDLK A
Sbjct  553   LPSAKYFIQHVLNQNTLTQARRNISRHYDLSNELFSLFLDGTMTYSCAIFKSEDEDLKDA  612

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q+RKIS+LI KAKISKEHHILEIG GWGS A+E V++TGCKYTGITLSEQQL+YA+  V 
Sbjct  613   QLRKISVLIRKAKISKEHHILEIGFGWGSFAVEVVKQTGCKYTGITLSEQQLEYAQLIVE  672

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             +AGLQD I FLLCDYRQ+P+  +Y RIIS EM+E VGHEFM+EFF  CES LAE+G+LV+
Sbjct  673   QAGLQDRITFLLCDYRQMPNKDKYHRIISIEMIEHVGHEFMDEFFTCCESALAEDGLLVV  732

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2809
             QF S+PDERYDEYR S  FIKEYIFPGGCLPSL+RVTSAMA++SRLCV HLE+IGIHYYQ
Sbjct  733   QFTSVPDERYDEYRHSIGFIKEYIFPGGCLPSLNRVTSAMASASRLCVNHLEEIGIHYYQ  792

Query  2810  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  2989
             TLRCWR NFL+ QSQI  LGFD KFIRTWEYYFDYCAAGF T  +G+YQIVFSRPGN+ A
Sbjct  793   TLRCWRDNFLKNQSQIRVLGFDDKFIRTWEYYFDYCAAGFKTRAIGNYQIVFSRPGNIAA  852

Query  2990  FGDPYKGLASA  3022
             FGDPY  + SA
Sbjct  853   FGDPYSAVPSA  863


 Score =   337 bits (864),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLV AY LAK G  VVVYEKEDYLGGHAKTVT+DGV LDLGFM FN+VT
Sbjct  1     MKVAVVGAGISGLVCAYELAKSGVKVVVYEKEDYLGGHAKTVTVDGVHLDLGFMFFNQVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME F  LG D EISDMSFSVSLD+GHG EWG+RNGFS LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFVFLGADTEISDMSFSVSLDHGHGCEWGTRNGFSSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK DV SYLE  DNNPD+D + T+G+FIKS GYSELFQK+Y+IP+C+SIWSC SEG
Sbjct  121   EISKFKQDVTSYLEALDNNPDIDCDKTIGQFIKSHGYSELFQKSYLIPICSSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNF  1008
             VM FSAYSILSF R+HHLLQ F
Sbjct  181   VMGFSAYSILSFFRDHHLLQLF  202



>ref|XP_009586641.1| PREDICTED: uncharacterized protein LOC104084479 isoform X2 [Nicotiana 
tomentosiformis]
Length=864

 Score =  1016 bits (2627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/671 (73%), Positives = 567/671 (85%), Gaps = 6/671 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQLFG  Q LTV+  SH+ VNKV+EELEKRGC+IR  CEV+SVSTD +G       I+  
Sbjct  199   LQLFGLSQLLTVRWGSHTSVNKVKEELEKRGCQIRTDCEVNSVSTDGEGCT-----IACN  253

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
             +  +E YDGCIMAAHAPDTL+MLGK+AT DE RILGAFQY YSDI+LHR+++F+PR+ AA
Sbjct  254   DGAKEVYDGCIMAAHAPDTLRMLGKEATCDETRILGAFQYSYSDIFLHRDKTFLPRDPAA  313

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSA NFLGT  NR  +TYWLN +QNLGD+K PYLVT++PP TPE  LLKWTTGH VPSVA
Sbjct  314   WSALNFLGTTKNRGRMTYWLNVIQNLGDSKLPYLVTVDPPHTPEHILLKWTTGHLVPSVA  373

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             AS+AS EL++IQGKR IWFCGAYQGYGFHEDGLK G+ AA G+L++ CS L+N  HMVP+
Sbjct  374   ASKASRELDQIQGKRGIWFCGAYQGYGFHEDGLKVGVAAADGVLRRNCSILDNSKHMVPT  433

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
             WPETGARL+VTRF  SFI TG IIL E GGTVFTF+GT++K  LKV +R+H PQFYWK A
Sbjct  434   WPETGARLVVTRFFRSFIKTGCIILFE-GGTVFTFQGTERKCSLKVSLRIHGPQFYWKTA  492

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             T+A++GLADA+IHGD SFVDK EGLLNL  IFVAN DL ASV+ S+ KRGWWTP LFT+A
Sbjct  493   TEAEIGLADAFIHGDFSFVDKNEGLLNLIMIFVANSDLKASVTSSSKKRGWWTPFLFTAA  552

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
             + SAKYFI+H+  QNTLTQARRNISRHYDLSNELFSLFLD TMTYSCA+FKSEDEDLK A
Sbjct  553   LPSAKYFIQHVLNQNTLTQARRNISRHYDLSNELFSLFLDGTMTYSCAIFKSEDEDLKDA  612

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q+RKIS+LI KAKISKEHHILEIG GWGS A+E V++TGCKYTGITLSEQQL+YA+  V 
Sbjct  613   QLRKISVLIRKAKISKEHHILEIGFGWGSFAVEVVKQTGCKYTGITLSEQQLEYAQLIVE  672

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             +AGLQD I FLLCDYRQ+P+  +Y RIIS EM+E VGHEFM+EFF  CES LAE+G+LV+
Sbjct  673   QAGLQDRITFLLCDYRQMPNKDKYHRIISIEMIEHVGHEFMDEFFTCCESALAEDGLLVV  732

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2809
             QF S+PDERYDEYR S  FIKEYIFPGGCLPSL+RVTSAMA++SRLCV HLE+IGIHYYQ
Sbjct  733   QFTSVPDERYDEYRHSIGFIKEYIFPGGCLPSLNRVTSAMASASRLCVNHLEEIGIHYYQ  792

Query  2810  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  2989
             TLRCWR NFL+ QSQI  LGFD KFIRTWEYYFDYCAAGF T  +G+YQIVFSRPGN+ A
Sbjct  793   TLRCWRDNFLKNQSQIRVLGFDDKFIRTWEYYFDYCAAGFKTRAIGNYQIVFSRPGNIAA  852

Query  2990  FGDPYKGLASA  3022
             FGDPY  + SA
Sbjct  853   FGDPYSAVPSA  863


 Score =   326 bits (835),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGL+SAY LAK G  VVVYE EDYLGGHAKTVT+D VDLDLGFM+FNRVT
Sbjct  1     MKVAVVGAGISGLISAYELAKSGVKVVVYENEDYLGGHAKTVTVDCVDLDLGFMIFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE LGV+MEIS MSFSV+LD G G EWG+RNG S LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFEFLGVNMEISHMSFSVTLDQGRGCEWGTRNGISSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV+SYLE  DNNPD+D ++TL +FIKS G SELF KAY+IP+C+SIWSC  EG
Sbjct  121   EIIKFKQDVISYLEALDNNPDIDCDETLWQFIKSNGCSELFLKAYLIPICSSIWSCPLEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNF  1008
             VM FSAYSILS  R+HHLLQ F
Sbjct  181   VMGFSAYSILSVFRDHHLLQLF  202



>ref|XP_010670961.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010670962.1| PREDICTED: uncharacterized protein LOC104887889 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=866

 Score =  1016 bits (2626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/690 (71%), Positives = 575/690 (83%), Gaps = 8/690 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +F R    LQLFGRPQWLTVK RSH YV+KVREELE RG +++  C
Sbjct  177   PSDTVMNFSAFSILSFSRNHHLLQLFGRPQWLTVKGRSHCYVSKVREELEVRGVQVKTSC  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV SVST ++G       +S  +   E YD CI+A HAPD +++LGK+AT+DE  ILGAF
Sbjct  237   EVQSVSTSDEGCT-----LSCSDGSNEVYDKCIIAVHAPDAIRILGKEATYDETTILGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDI+LHR+++FMP+N AAWSAWNFLGT+++++CLTYWLN LQN+ +T  PYLVTLN
Sbjct  292   QYVYSDIFLHRDKTFMPQNPAAWSAWNFLGTMDSKLCLTYWLNVLQNIEETDLPYLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP  PE  LLKW TGHPVPSVAA++AS +L  IQG R IWFCGAYQGYGFHEDGLKAGMI
Sbjct  352   PPHQPENVLLKWRTGHPVPSVAATKASLDLGNIQGTRGIWFCGAYQGYGFHEDGLKAGMI  411

Query  1664  AAHGLLKKRCSP-LNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEG  1840
             AA GLL K  +  L NP  MV S  E  A + VTRFL++FI  G + LLEEGGT+ TFEG
Sbjct  412   AARGLLGKSFNNILTNPKQMVASLTEAAACIFVTRFLSNFISAGCLTLLEEGGTILTFEG  471

Query  1841  TDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD  2020
             + K   LKV +R+HSPQFYWKVA +ADLGLADAYI+GD SFVDK EGLLNLF IF+A+RD
Sbjct  472   SSKICPLKVALRIHSPQFYWKVAKEADLGLADAYINGDFSFVDKNEGLLNLFMIFIASRD  531

Query  2021  LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSL  2200
             L+++ +  N KRGWWTP+LFT+ IASAKYF  H+SRQNTLTQARRNISRHYDLSN++FSL
Sbjct  532   LNSTATLVNKKRGWWTPMLFTAGIASAKYFYHHVSRQNTLTQARRNISRHYDLSNDMFSL  591

Query  2201  FLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVER  2380
             FLDETMTYSCAVF+SE+EDLK AQMRKISLL++KA++ K H +LEIGCGWGSLAIE V+R
Sbjct  592   FLDETMTYSCAVFESENEDLKVAQMRKISLLLEKARVEKHHEVLEIGCGWGSLAIEVVKR  651

Query  2381  TGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVG  2560
             TGC+YTGITLSE+QL+YAE++V+EAGLQD IRFLLCDYRQLPD  +Y+RIISCEMLEAVG
Sbjct  652   TGCRYTGITLSEEQLRYAEERVKEAGLQDRIRFLLCDYRQLPDVHKYNRIISCEMLEAVG  711

Query  2561  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  2740
             HE+M EFF  CES+LA NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLP LSRVT
Sbjct  712   HEYMEEFFQCCESLLAANGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPCLSRVT  771

Query  2741  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  2920
             SAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS+I  LGFD+KFIRTWEYYFDYCA
Sbjct  772   SAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQSKIHSLGFDEKFIRTWEYYFDYCA  831

Query  2921  AGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  3010
             AGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  832   AGFKTRTLGNYQIVFSRPGNLASFGGAYAG  861


 Score =   317 bits (811),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 180/216 (83%), Gaps = 2/216 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR+ VVG GISGL +AY LAK G  VV++EKEDYLGGHAKTV  DG+DLDLGFMVFNRVT
Sbjct  1     MRIGVVGGGISGLGAAYELAKAGVNVVLHEKEDYLGGHAKTVHFDGIDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFESLG++ME+SDMSFSVSLD G G EWGSRNG  GLFAQK N +NPYFW+MI+
Sbjct  61    YPNMMELFESLGIEMELSDMSFSVSLDKGRGCEWGSRNGLRGLFAQKANAVNPYFWKMIQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFKN+V+ YLEE +NN D+DR +TLG FIKSRGYSELFQKAY++PMCASIWSC S+ 
Sbjct  121   EIIKFKNEVIMYLEELENNADIDRTETLGHFIKSRGYSELFQKAYLVPMCASIWSCPSDT  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALWSPT--MAHC  1044
             VM FSA+SILSF RNHHLLQ F    W      +HC
Sbjct  181   VMNFSAFSILSFSRNHHLLQLFGRPQWLTVKGRSHC  216



>ref|XP_009586644.1| PREDICTED: uncharacterized protein LOC104084479 isoform X5 [Nicotiana 
tomentosiformis]
 ref|XP_009586645.1| PREDICTED: uncharacterized protein LOC104084479 isoform X5 [Nicotiana 
tomentosiformis]
Length=747

 Score =  1016 bits (2626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/671 (73%), Positives = 567/671 (85%), Gaps = 6/671 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQLFG  Q LTV+  SH+ VNKV+EELEKRGC+IR  CEV+SVSTD +G       I+  
Sbjct  82    LQLFGLSQLLTVRWGSHTSVNKVKEELEKRGCQIRTDCEVNSVSTDGEGCT-----IACN  136

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
             +  +E YDGCIMAAHAPDTL+MLGK+AT DE RILGAFQY YSDI+LHR+++F+PR+ AA
Sbjct  137   DGAKEVYDGCIMAAHAPDTLRMLGKEATCDETRILGAFQYSYSDIFLHRDKTFLPRDPAA  196

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSA NFLGT  NR  +TYWLN +QNLGD+K PYLVT++PP TPE  LLKWTTGH VPSVA
Sbjct  197   WSALNFLGTTKNRGRMTYWLNVIQNLGDSKLPYLVTVDPPHTPEHILLKWTTGHLVPSVA  256

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             AS+AS EL++IQGKR IWFCGAYQGYGFHEDGLK G+ AA G+L++ CS L+N  HMVP+
Sbjct  257   ASKASRELDQIQGKRGIWFCGAYQGYGFHEDGLKVGVAAADGVLRRNCSILDNSKHMVPT  316

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
             WPETGARL+VTRF  SFI TG IIL E GGTVFTF+GT++K  LKV +R+H PQFYWK A
Sbjct  317   WPETGARLVVTRFFRSFIKTGCIILFE-GGTVFTFQGTERKCSLKVSLRIHGPQFYWKTA  375

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             T+A++GLADA+IHGD SFVDK EGLLNL  IFVAN DL ASV+ S+ KRGWWTP LFT+A
Sbjct  376   TEAEIGLADAFIHGDFSFVDKNEGLLNLIMIFVANSDLKASVTSSSKKRGWWTPFLFTAA  435

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
             + SAKYFI+H+  QNTLTQARRNISRHYDLSNELFSLFLD TMTYSCA+FKSEDEDLK A
Sbjct  436   LPSAKYFIQHVLNQNTLTQARRNISRHYDLSNELFSLFLDGTMTYSCAIFKSEDEDLKDA  495

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q+RKIS+LI KAKISKEHHILEIG GWGS A+E V++TGCKYTGITLSEQQL+YA+  V 
Sbjct  496   QLRKISVLIRKAKISKEHHILEIGFGWGSFAVEVVKQTGCKYTGITLSEQQLEYAQLIVE  555

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             +AGLQD I FLLCDYRQ+P+  +Y RIIS EM+E VGHEFM+EFF  CES LAE+G+LV+
Sbjct  556   QAGLQDRITFLLCDYRQMPNKDKYHRIISIEMIEHVGHEFMDEFFTCCESALAEDGLLVV  615

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2809
             QF S+PDERYDEYR S  FIKEYIFPGGCLPSL+RVTSAMA++SRLCV HLE+IGIHYYQ
Sbjct  616   QFTSVPDERYDEYRHSIGFIKEYIFPGGCLPSLNRVTSAMASASRLCVNHLEEIGIHYYQ  675

Query  2810  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  2989
             TLRCWR NFL+ QSQI  LGFD KFIRTWEYYFDYCAAGF T  +G+YQIVFSRPGN+ A
Sbjct  676   TLRCWRDNFLKNQSQIRVLGFDDKFIRTWEYYFDYCAAGFKTRAIGNYQIVFSRPGNIAA  735

Query  2990  FGDPYKGLASA  3022
             FGDPY  + SA
Sbjct  736   FGDPYSAVPSA  746


 Score =   130 bits (326),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MIREI+KFK DV+SYLE  DNNPD+D ++TL +FIKS G SELF KAY+IP+C+SIWSC 
Sbjct  1     MIREIIKFKQDVISYLEALDNNPDIDCDETLWQFIKSNGCSELFLKAYLIPICSSIWSCP  60

Query  934   SEGVMAFSAYSILSFCRNHHLLQNF  1008
              EGVM FSAYSILS  R+HHLLQ F
Sbjct  61    LEGVMGFSAYSILSVFRDHHLLQLF  85



>ref|XP_010670960.1| PREDICTED: uncharacterized protein LOC104887889 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=725

 Score =  1015 bits (2624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/690 (71%), Positives = 575/690 (83%), Gaps = 8/690 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +F R    LQLFGRPQWLTVK RSH YV+KVREELE RG +++  C
Sbjct  36    PSDTVMNFSAFSILSFSRNHHLLQLFGRPQWLTVKGRSHCYVSKVREELEVRGVQVKTSC  95

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV SVST ++G       +S  +   E YD CI+A HAPD +++LGK+AT+DE  ILGAF
Sbjct  96    EVQSVSTSDEGCT-----LSCSDGSNEVYDKCIIAVHAPDAIRILGKEATYDETTILGAF  150

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDI+LHR+++FMP+N AAWSAWNFLGT+++++CLTYWLN LQN+ +T  PYLVTLN
Sbjct  151   QYVYSDIFLHRDKTFMPQNPAAWSAWNFLGTMDSKLCLTYWLNVLQNIEETDLPYLVTLN  210

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP  PE  LLKW TGHPVPSVAA++AS +L  IQG R IWFCGAYQGYGFHEDGLKAGMI
Sbjct  211   PPHQPENVLLKWRTGHPVPSVAATKASLDLGNIQGTRGIWFCGAYQGYGFHEDGLKAGMI  270

Query  1664  AAHGLLKKRCSP-LNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEG  1840
             AA GLL K  +  L NP  MV S  E  A + VTRFL++FI  G + LLEEGGT+ TFEG
Sbjct  271   AARGLLGKSFNNILTNPKQMVASLTEAAACIFVTRFLSNFISAGCLTLLEEGGTILTFEG  330

Query  1841  TDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD  2020
             + K   LKV +R+HSPQFYWKVA +ADLGLADAYI+GD SFVDK EGLLNLF IF+A+RD
Sbjct  331   SSKICPLKVALRIHSPQFYWKVAKEADLGLADAYINGDFSFVDKNEGLLNLFMIFIASRD  390

Query  2021  LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSL  2200
             L+++ +  N KRGWWTP+LFT+ IASAKYF  H+SRQNTLTQARRNISRHYDLSN++FSL
Sbjct  391   LNSTATLVNKKRGWWTPMLFTAGIASAKYFYHHVSRQNTLTQARRNISRHYDLSNDMFSL  450

Query  2201  FLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVER  2380
             FLDETMTYSCAVF+SE+EDLK AQMRKISLL++KA++ K H +LEIGCGWGSLAIE V+R
Sbjct  451   FLDETMTYSCAVFESENEDLKVAQMRKISLLLEKARVEKHHEVLEIGCGWGSLAIEVVKR  510

Query  2381  TGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVG  2560
             TGC+YTGITLSE+QL+YAE++V+EAGLQD IRFLLCDYRQLPD  +Y+RIISCEMLEAVG
Sbjct  511   TGCRYTGITLSEEQLRYAEERVKEAGLQDRIRFLLCDYRQLPDVHKYNRIISCEMLEAVG  570

Query  2561  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  2740
             HE+M EFF  CES+LA NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLP LSRVT
Sbjct  571   HEYMEEFFQCCESLLAANGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPCLSRVT  630

Query  2741  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  2920
             SAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS+I  LGFD+KFIRTWEYYFDYCA
Sbjct  631   SAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQSKIHSLGFDEKFIRTWEYYFDYCA  690

Query  2921  AGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  3010
             AGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  691   AGFKTRTLGNYQIVFSRPGNLASFGGAYAG  720


 Score = 98.6 bits (244),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 55/75 (73%), Gaps = 2/75 (3%)
 Frame = +1

Query  826   MDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQN  1005
             MDR +TL  FI++R +S+LFQK Y++PMCASIWSC S+ VM FSA+SILSF RNHHLLQ 
Sbjct  1     MDRTETLSHFIETRNFSDLFQKGYLVPMCASIWSCPSDTVMNFSAFSILSFSRNHHLLQL  60

Query  1006  FSPALWSPT--MAHC  1044
             F    W      +HC
Sbjct  61    FGRPQWLTVKGRSHC  75



>gb|AAL57657.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAN64525.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
Length=867

 Score =  1014 bits (2623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/694 (70%), Positives = 565/694 (81%), Gaps = 9/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FC     LQ+FGRPQWLTV  RS +YV KVR ELE+ GC IR  C
Sbjct  178   PSDGVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRTELERLGCRIRTSC  237

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             +V SVST E G     V ++G +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF
Sbjct  238   DVKSVSTSENG----CVTVTGGDGSKEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAF  293

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+  +P+ VTLN
Sbjct  294   QYVYSDIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLN  353

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  354   PDETPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNIWFCGAYQGYGFHEDGLKAGMA  413

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLL K  + LNNP HMVPS  ETGARL VTRFL  FI TGS+ +LEEGGT+FTF G 
Sbjct  414   AARGLLGKETALLNNPRHMVPSLTETGARLFVTRFLGQFISTGSVTILEEGGTMFTFGGK  473

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             D    LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +ANRD 
Sbjct  474   DSTCPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNLIMILIANRDT  533

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              +++S+   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  F
Sbjct  534   KSNLSK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFF  590

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD+TMTYS AVFKS+DEDL+TAQMRKISLLIDKA+I K+H +LEIGCGWG+LAIE V RT
Sbjct  591   LDDTMTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCGWGTLAIEVVRRT  650

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDRIISCEMLEAVGH
Sbjct  651   GCKYTGITLSIEQLKYAEEKVKEAGLQDWITFELRDYRQLSDAQKYDRIISCEMLEAVGH  710

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVT+
Sbjct  711   EFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTT  770

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+ LGFD KF+RTWEYYFDYCAA
Sbjct  771   AMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQKQIMALGFDDKFVRTWEYYFDYCAA  830

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  831   GFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864


 Score =   335 bits (860),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DVL Y+EE + NPD+DR +TLGEF+ SRGYSELFQ+AY++P+C SIWSC S+
Sbjct  121   REIVRFKEDVLKYIEELEGNPDIDRKETLGEFLNSRGYSELFQQAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV++FSAYS+LSFC NHHLLQ F    W
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQW  208



>ref|XP_009102608.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
 ref|XP_009102609.1| PREDICTED: uncharacterized protein LOC103828731 [Brassica rapa]
Length=870

 Score =  1014 bits (2622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 480/687 (70%), Positives = 560/687 (82%), Gaps = 6/687 (1%)
 Frame = +2

Query  971   FHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FC     LQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C++ SV T
Sbjct  185   FSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDIKSVLT  244

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G     V ++  +  +E +D CI+A HAPD L++LG+Q TFDE R+LGAF+YVYSDI
Sbjct  245   SDDGR----VTVTSGDGSEEVFDKCILAMHAPDALRLLGEQVTFDETRVLGAFRYVYSDI  300

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+ ++P+ VTLNP +TP++
Sbjct  301   YLHHDTDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGEDREPFFVTLNPDQTPKK  360

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKWTTGHPVPSVAA  AS EL +IQGKR IWFCGAYQGYGFHEDGLKAGM AA GLL 
Sbjct  361   TLLKWTTGHPVPSVAALTASQELHKIQGKRNIWFCGAYQGYGFHEDGLKAGMAAARGLLG  420

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  + LNNP HMVPS  ETGARL VTRFL  FI TG + +LEEGGT+F FEG D    LK
Sbjct  421   KEAALLNNPRHMVPSLTETGARLFVTRFLGQFISTGCVTILEEGGTMFNFEGKDPTCPLK  480

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++++HSPQFYWKV TQADLGLADAYI+GD SFVD+  GLLN   I +ANRDLS+  S  
Sbjct  481   SVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDRDSGLLNFMMILIANRDLSSPKSNL  540

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF LFLD+TMTY
Sbjct  541   AKKRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGLFLDDTMTY  600

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S AVFKS+DEDL+ AQMRKISLLIDKA++ K H +LEIGCGWG+LAIE V RTGC+YTGI
Sbjct  601   SSAVFKSDDEDLRAAQMRKISLLIDKARVEKHHEVLEIGCGWGTLAIEVVRRTGCRYTGI  660

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS +QLKYAE+KV+EAGL+D I F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF
Sbjct  661   TLSIEQLKYAEEKVKEAGLEDRITFKLCDYRQLSDAHKYDRIISCEMLEAVGHEFMEMFF  720

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
              RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSR
Sbjct  721   SRCEAALAENGLMVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSR  780

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EH+E+IGIHYYQTLR WR NFL+RQ  I+ LGFD KFIRTWEYYFDYCAAGF T TL
Sbjct  781   LCIEHVENIGIHYYQTLRMWRKNFLDRQKPIMALGFDDKFIRTWEYYFDYCAAGFKTLTL  840

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQ+VFSRPGNV AF + YKG  SAY
Sbjct  841   GNYQVVFSRPGNVAAFANSYKGFPSAY  867


 Score =   334 bits (857),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   +V+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLATQGVEELVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGVDMEISDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVDMEISDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y+EE + NPD+DR++TLGEF+  RGYSE+FQKAY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLRYIEELEANPDIDRSETLGEFLNGRGYSEMFQKAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV++FSAYS+LSFC NHHLLQ F    W
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQW  208



>ref|XP_002883433.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59692.1| hypothetical protein ARALYDRAFT_898865 [Arabidopsis lyrata subsp. 
lyrata]
Length=867

 Score =  1013 bits (2620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/694 (70%), Positives = 565/694 (81%), Gaps = 9/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FC     LQ+FGRPQWLTV  RS +YV KVR ELE+ GC I+  C
Sbjct  178   PSDGVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCTIKTSC  237

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             ++ SVST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF
Sbjct  238   DIKSVSTSEDG----CVTVTSGDGSEEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAF  293

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             +YVYSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+ ++P+ VTLN
Sbjct  294   RYVYSDIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENREPFFVTLN  353

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM 
Sbjct  354   PDETPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNLWFCGAYQGYGFHEDGLKAGMA  413

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLL K  + LNNP HMVPS  ETGARL VTRFL  FI TGS+ +LEEGGT+FTFEG 
Sbjct  414   AARGLLGKETALLNNPRHMVPSLTETGARLFVTRFLGQFISTGSVTILEEGGTMFTFEGK  473

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             D    LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNL  I +ANRD 
Sbjct  474   DSTCPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLLNLIMILIANRDT  533

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              +++++   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  F
Sbjct  534   KSNLTK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFF  590

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD+TMTYS AVF+S+DEDL+TAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V RT
Sbjct  591   LDDTMTYSSAVFQSDDEDLRTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRT  650

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDRIISCEMLEAVGH
Sbjct  651   GCKYTGITLSIEQLKYAEEKVKEAGLQDRITFELRDYRQLSDAHKYDRIISCEMLEAVGH  710

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTS
Sbjct  711   EFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTS  770

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD KFIRTWEYYFDYCAA
Sbjct  771   AMSSSSRLCIEHVENIGIHYYQTLRVWRKNFLERQKQIMALGFDDKFIRTWEYYFDYCAA  830

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  831   GFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864


 Score =   336 bits (861),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGISGLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DVL Y+EE + NPD+DR +TLGEF+ +RGYSELFQKAY++P+C SIWSC S+
Sbjct  121   REIVRFKEDVLKYIEELEGNPDIDRKETLGEFLNARGYSELFQKAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV++FSAYS+LSFC NHHLLQ F    W
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQW  208



>ref|NP_188993.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 dbj|BAC41919.1| putative cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis 
thaliana]
 gb|AEE76772.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =  1013 bits (2618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 486/694 (70%), Positives = 566/694 (82%), Gaps = 9/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FC     LQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C
Sbjct  178   PSDGVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSC  237

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             +V SVST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF
Sbjct  238   DVKSVSTSENG----CVTVTSGDGSEEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAF  293

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+  +P+ VTLN
Sbjct  294   QYVYSDIYLHHDIDLMPRNKAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLN  353

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TP++ LLKWTTGHPVPSVAAS AS EL +IQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  354   PDETPKKALLKWTTGHPVPSVAASIASQELHQIQGKRNIWFCGAYQGYGFHEDGLKAGMA  413

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLL K  + LNNP HMVPS  ETGARL VTRFL  FI TGS+ +LEEGGT+FTF G 
Sbjct  414   AARGLLGKETALLNNPRHMVPSLTETGARLFVTRFLGQFISTGSVTILEEGGTMFTFGGK  473

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             D    LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +ANRD 
Sbjct  474   DSTCPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNLIMILIANRDT  533

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              +++++   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF LF
Sbjct  534   KSNLTK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGLF  590

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD+TMTYS AVFKS+DEDL+TAQMRKISLLIDKA+I K+H +LEIGCGWG+LAIE V RT
Sbjct  591   LDDTMTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCGWGTLAIEVVRRT  650

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDRIISCEMLEAVGH
Sbjct  651   GCKYTGITLSIEQLKYAEEKVKEAGLQDRITFELRDYRQLSDAHKYDRIISCEMLEAVGH  710

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM  FF RCE+ LAE+G++VLQFIS P+ERY+EYR SSDFIKEYIFPG C+PSL++VTS
Sbjct  711   EFMEMFFSRCEAALAEDGLMVLQFISTPEERYNEYRLSSDFIKEYIFPGACVPSLAKVTS  770

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM++SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD KF+RTWEYYFDYCAA
Sbjct  771   AMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFDDKFVRTWEYYFDYCAA  830

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLGDYQ+VFSRPGNV AF D Y+G  SAY
Sbjct  831   GFKTRTLGDYQLVFSRPGNVAAFADSYRGFPSAY  864


 Score =   332 bits (851),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNM+E FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMIEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DVL+Y+E+ + NPD+DR +TLGEF+ +RGYSELFQ+AY++P+C SIWSC S+
Sbjct  121   REIVRFKEDVLNYIEKLEGNPDIDRKETLGEFLNTRGYSELFQQAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV++FSAYS+LSFC NHHLLQ F    W
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQW  208



>dbj|BAD44154.1| unnamed protein product [Arabidopsis thaliana]
Length=867

 Score =  1012 bits (2616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/694 (70%), Positives = 564/694 (81%), Gaps = 9/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FC     LQ+FGRPQWLTV  RS +YV KVR ELE+ GC IR  C
Sbjct  178   PSDGVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRTELERLGCRIRTSC  237

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             +V SVST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF
Sbjct  238   DVKSVSTSENG----CVTVTSGDGSKEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAF  293

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+  +P+ VTLN
Sbjct  294   QYVYSDIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLN  353

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  354   PDETPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNIWFCGAYQGYGFHEDGLKAGMA  413

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLL K  + LNNP HMVPS  ETGARL VTRFL  FI TGS+ +LEEGGT+FTF G 
Sbjct  414   AARGLLGKETALLNNPRHMVPSLTETGARLFVTRFLGQFISTGSVTILEEGGTMFTFGGK  473

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             D    LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +ANRD 
Sbjct  474   DSTCPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNLIMILIANRDT  533

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              +++S+   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  F
Sbjct  534   KSNLSK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFF  590

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD+TMTYS AVFKS+DEDL+TAQMRKISLLIDKA+I K+H +LEIGCGWG+LAIE V RT
Sbjct  591   LDDTMTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCGWGTLAIEVVRRT  650

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDRIISCEMLEAVGH
Sbjct  651   GCKYTGITLSIEQLKYAEEKVKEAGLQDWITFELRDYRQLSDAQKYDRIISCEMLEAVGH  710

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVT+
Sbjct  711   EFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTT  770

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+ LGFD KF+RTWEYYFDYCAA
Sbjct  771   AMSSSSRLCIEHVENIGIHYYQTLRLWRENFLARQKQIMALGFDDKFVRTWEYYFDYCAA  830

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  831   GFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864


 Score =   335 bits (860),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DVL Y+EE + NPD+DR +TLGEF+ SRGYSELFQ+AY++P+C SIWSC S+
Sbjct  121   REIVRFKEDVLKYIEELEGNPDIDRKETLGEFLNSRGYSELFQQAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV++FSAYS+LSFC NHHLLQ F    W
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQW  208



>ref|NP_188995.2| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAL38380.1| AT3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AAP21152.1| At3g23510/MEE5_5 [Arabidopsis thaliana]
 gb|AEE76773.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=867

 Score =  1012 bits (2616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 487/694 (70%), Positives = 564/694 (81%), Gaps = 9/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FC     LQ+FGRPQWLTV  RS +YV KVR ELE+ GC IR  C
Sbjct  178   PSDGVLSFSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRTELERLGCRIRTSC  237

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             +V SVST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF
Sbjct  238   DVKSVSTSENG----CVTVTSGDGSKEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAF  293

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+  +P+ VTLN
Sbjct  294   QYVYSDIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLN  353

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TP++ LLKWTTGHPVPSVAA  AS EL +IQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  354   PDETPKKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNIWFCGAYQGYGFHEDGLKAGMA  413

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLL K  + LNNP HMVPS  ETGARL VTRFL  FI TGS+ +LEEGGT+FTF G 
Sbjct  414   AARGLLGKETALLNNPRHMVPSLTETGARLFVTRFLGQFISTGSVTILEEGGTMFTFGGK  473

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             D    LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +ANRD 
Sbjct  474   DSTCPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNLIMILIANRDT  533

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              +++S+   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  F
Sbjct  534   KSNLSK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFF  590

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD+TMTYS AVFKS+DEDL+TAQMRKISLLIDKA+I K+H +LEIGCGWG+LAIE V RT
Sbjct  591   LDDTMTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCGWGTLAIEVVRRT  650

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDRIISCEMLEAVGH
Sbjct  651   GCKYTGITLSIEQLKYAEEKVKEAGLQDWITFELRDYRQLSDAQKYDRIISCEMLEAVGH  710

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVT+
Sbjct  711   EFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTT  770

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+ LGFD KF+RTWEYYFDYCAA
Sbjct  771   AMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQKQIMALGFDDKFVRTWEYYFDYCAA  830

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  831   GFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  864


 Score =   335 bits (860),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DVL Y+EE + NPD+DR +TLGEF+ SRGYSELFQ+AY++P+C SIWSC S+
Sbjct  121   REIVRFKEDVLKYIEELEGNPDIDRKETLGEFLNSRGYSELFQQAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV++FSAYS+LSFC NHHLLQ F    W
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQW  208



>ref|XP_010466687.1| PREDICTED: uncharacterized protein LOC104746847 [Camelina sativa]
Length=867

 Score =  1011 bits (2614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/687 (70%), Positives = 563/687 (82%), Gaps = 9/687 (1%)
 Frame = +2

Query  971   FHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FC     LQ+FGRPQWLT+  RS +YV KVR ELE+ GC+IR  C+V SVST
Sbjct  185   FSAYSVLSFCCNHHLLQIFGRPQWLTIAGRSQTYVAKVRAELERLGCKIRTSCDVKSVST  244

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E GS    V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF+YVYSDI
Sbjct  245   SENGS----VTVTSGDGSEEVFDRCILAMHAPDALRLLGEEVTFDETRVLGAFRYVYSDI  300

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +   MPRN AAWS+WNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP   P++
Sbjct  301   YLHHDIDLMPRNQAAWSSWNFLGSTEKKVCVTYWLNILQNLGEKCEPFFVTLNPDYPPKK  360

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKWTTGHPVPSVAA  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM AA  LL 
Sbjct  361   ALLKWTTGHPVPSVAAWTASQELHKIQGKRNLWFCGAYQGYGFHEDGLKAGMAAARSLLG  420

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  + LNNP HMVPS  ETGARL VTRF+  FI TG + +LEEGGT+FTF G D    LK
Sbjct  421   KETALLNNPRHMVPSLTETGARLFVTRFMGQFISTGCVTILEEGGTMFTFGGKDSTCPLK  480

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNL  I +ANRD  +++++ 
Sbjct  481   SILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLLNLIMILIANRDTKSNLTK-  539

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+TMTY
Sbjct  540   --KRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDDTMTY  597

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S AVFKS+DEDLKTAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V+RTGCKYTGI
Sbjct  598   SSAVFKSDDEDLKTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVKRTGCKYTGI  657

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS +QLKYAE+KV+EAGLQD I+F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF
Sbjct  658   TLSIEQLKYAEEKVKEAGLQDRIKFELCDYRQLSDVQKYDRIISCEMLEAVGHEFMEMFF  717

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
              RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSR
Sbjct  718   SRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSR  777

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD KFIRTWEYYFDYCAAGF T TL
Sbjct  778   LCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFDDKFIRTWEYYFDYCAAGFKTLTL  837

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  838   GNYQLVFSRPGNVAAFADSYQGFPSAY  864


 Score =   334 bits (857),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAVVG+GISGL SAYVLA  G   +V+YEKE+ LGGHA+TV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVVGSGISGLGSAYVLANQGVEEIVLYEKEESLGGHARTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE LGV+ME+SDMSFSVSLDNG G EWGSRNG SGLF+QKKN+LNPYFWQMI
Sbjct  61    TYPNMMEFFEKLGVEMEVSDMSFSVSLDNGKGCEWGSRNGVSGLFSQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y++E + NPD+DRN+TLGEF+ +RGYSELFQKAY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLKYIDELEGNPDIDRNETLGEFLNARGYSELFQKAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV+ FSAYS+LSFC NHHLLQ F    W
Sbjct  181   GVLNFSAYSVLSFCCNHHLLQIFGRPQW  208



>gb|KDO50392.1| hypothetical protein CISIN_1g0358701mg, partial [Citrus sinensis]
Length=784

 Score =  1011 bits (2613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/671 (73%), Positives = 564/671 (84%), Gaps = 7/671 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RSHSYVNKVR++LE  GC+IR   
Sbjct  119   PSEGVTSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHSYVNKVRKQLESWGCQIRTSS  178

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV SV   ++G      I+ G    +E Y+ C+MA HAPD LK+LG QATFDE RILGAF
Sbjct  179   EVCSVLPADKG----CTIVCGDG-SREFYNSCVMALHAPDALKILGNQATFDETRILGAF  233

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDI+LHR++ FMP+N AAWSAWNFL + +++VCLTYWLN LQNLG+T  P+LVTLN
Sbjct  234   QYVYSDIFLHRDKRFMPQNPAAWSAWNFLESFDSKVCLTYWLNVLQNLGETSLPFLVTLN  293

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   PE  LLKW+TGHPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  294   PDHVPEHTLLKWSTGHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMT  353

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHG+L K C+  +NP HM+PS  ETGARL V RFL  +I TGS+ILLEEGGT+FTFEGT
Sbjct  354   AAHGVLGKSCTLSSNPRHMIPSLKETGARLFVARFLGQYISTGSMILLEEGGTIFTFEGT  413

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K   LK ++R+HSPQFYWKV TQADLGLADAYI+GD SFVDK EGLLNLF I +ANRDL
Sbjct  414   RKNCHLKTVLRIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNLFMILIANRDL  473

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              +SVS+   KRGWW+P+LFT+ IASAKYF RHISRQNTLTQARRNISRHYDLSNELFSLF
Sbjct  474   DSSVSKLKQKRGWWSPMLFTAGIASAKYFFRHISRQNTLTQARRNISRHYDLSNELFSLF  533

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDE+MTYSCAVFKSEDEDLK AQMRK+SLLI+KA++SK   +LEIGCGWG+LAIE V+RT
Sbjct  534   LDESMTYSCAVFKSEDEDLKAAQMRKVSLLIEKARVSKGQEVLEIGCGWGTLAIEIVKRT  593

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYAE KV+EAGLQD IR  LCDYRQL    +YDRIISCEM+EAVGH
Sbjct  594   GCKYTGITLSEEQLKYAEMKVKEAGLQDLIRLYLCDYRQLAKANKYDRIISCEMIEAVGH  653

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM EFFG CES+LAE+G+LVLQFISIPDERY+EYR SSDFIKEYIFPGGCLPSLSR+TS
Sbjct  654   EFMEEFFGCCESLLAEDGLLVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPSLSRITS  713

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+ +SRLCVE +E+IGIHYYQTLRCWR NF+E+QS+IL LGF+ KFIRTWEYYFDYCAA
Sbjct  714   AMSVASRLCVEQVENIGIHYYQTLRCWRKNFMEKQSKILALGFNDKFIRTWEYYFDYCAA  773

Query  2924  GFHTCTLGDYQ  2956
             GF + TLG+YQ
Sbjct  774   GFKSYTLGNYQ  784


 Score =   257 bits (657),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 133/149 (89%), Gaps = 0/149 (0%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNMME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFWQM
Sbjct  1     VTYPNMMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFWQM  60

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             +REI+KFK+DVL YLEE ++NPD+DR++TLG+F+ SRGYSELFQKAY+IP+C SIWSC S
Sbjct  61    LREIIKFKDDVLGYLEELESNPDIDRSETLGQFVNSRGYSELFQKAYLIPICGSIWSCPS  120

Query  937   EGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             EGV +FSA+S+LSFCRNHHLLQ F    W
Sbjct  121   EGVTSFSAFSVLSFCRNHHLLQLFGRPQW  149



>ref|XP_010512493.1| PREDICTED: uncharacterized protein LOC104788434 isoform X1 [Camelina 
sativa]
Length=867

 Score =  1010 bits (2611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/687 (70%), Positives = 563/687 (82%), Gaps = 9/687 (1%)
 Frame = +2

Query  971   FHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FC     LQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C+V SVST
Sbjct  185   FSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDVKSVST  244

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E GS    V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF+YVYSDI
Sbjct  245   SENGS----VTVTSGDGSEEVFDRCILAMHAPDALRLLGEEVTFDETRVLGAFRYVYSDI  300

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +   MPRN AAWS+WNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP   P++
Sbjct  301   YLHHDIDLMPRNQAAWSSWNFLGSTEKKVCVTYWLNILQNLGEKCEPFFVTLNPDHPPKK  360

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKWTTGHPVPSV+A  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM AA GLL 
Sbjct  361   ALLKWTTGHPVPSVSAWTASQELHKIQGKRNLWFCGAYQGYGFHEDGLKAGMAAARGLLG  420

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  + LNNP HMVPS  ETGARL VTRF+  FI TG + +LEEGGT+FTF G D    LK
Sbjct  421   KETALLNNPRHMVPSLTETGARLFVTRFMGQFISTGCVTILEEGGTMFTFGGKDSTFPLK  480

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNL  I +ANRD  +++++ 
Sbjct  481   SVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLLNLIMILIANRDTKSNLTK-  539

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+TMTY
Sbjct  540   --KRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDDTMTY  597

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S AVFKS+DEDLKTAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V+RTGCKYTGI
Sbjct  598   SSAVFKSDDEDLKTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVKRTGCKYTGI  657

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS +QLKYAE+KV+ AGLQD+I+F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF
Sbjct  658   TLSIEQLKYAEEKVKVAGLQDSIKFELCDYRQLSDVQKYDRIISCEMLEAVGHEFMEMFF  717

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
              RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSR
Sbjct  718   SRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSR  777

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LG D KFIRTWEYYFDYCAAGF T TL
Sbjct  778   LCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGIDDKFIRTWEYYFDYCAAGFKTLTL  837

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  838   GNYQLVFSRPGNVAAFADSYQGFPSAY  864


 Score =   333 bits (854),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHA+TV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHARTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW+MI
Sbjct  61    TYPNMMEFFEKLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWRMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y++E + NPD+DRN+TLGEF+ +RGYSELFQ+AY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLKYIKELEGNPDIDRNETLGEFLNARGYSELFQQAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV+ FSAYS+LSFC NHHLLQ F    W
Sbjct  181   GVLNFSAYSVLSFCCNHHLLQIFGRPQW  208



>ref|XP_010490069.1| PREDICTED: uncharacterized protein LOC104767788, partial [Camelina 
sativa]
Length=862

 Score =  1009 bits (2610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/687 (70%), Positives = 565/687 (82%), Gaps = 9/687 (1%)
 Frame = +2

Query  971   FHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FC     LQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C+V SVST
Sbjct  180   FSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDVKSVST  239

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E G     V ++  +  +E ++ CI+A HAPD +++LG++ TFDE R+LGAF+YVYSDI
Sbjct  240   SENG----CVTVTSGDGTEEVFERCILALHAPDAMRLLGEEVTFDETRVLGAFRYVYSDI  295

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +   MPRN AAWS+WNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP + P++
Sbjct  296   YLHHDIDLMPRNQAAWSSWNFLGSTEKKVCVTYWLNILQNLGEKCEPFFVTLNPDQPPKK  355

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKWTTGHPVPSVAA +AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM AA GLL 
Sbjct  356   ALLKWTTGHPVPSVAAWKASQELHKIQGKRNLWFCGAYQGYGFHEDGLKAGMAAARGLLG  415

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  + LNNP HMVPS  ETGARL VTRF+  FI TG + +LEEGGT+FTF G D    LK
Sbjct  416   KETALLNNPRHMVPSLTETGARLFVTRFMGQFISTGCVTILEEGGTMFTFGGKDSTCPLK  475

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNL  I +ANRD  +++++ 
Sbjct  476   SILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLLNLIMILIANRDTKSNLTK-  534

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+TMTY
Sbjct  535   --KRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDDTMTY  592

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S AVFKS+DEDLKTAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V+RTGCKYTGI
Sbjct  593   SSAVFKSDDEDLKTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVKRTGCKYTGI  652

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS +QLKYAE+KV+EAGLQD I+F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF
Sbjct  653   TLSIEQLKYAEEKVKEAGLQDRIKFELCDYRQLSDVQKYDRIISCEMLEAVGHEFMEMFF  712

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
              RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSR
Sbjct  713   SRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSR  772

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD KFIRTWEYYFDYCAAGF T TL
Sbjct  773   LCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFDDKFIRTWEYYFDYCAAGFKTLTL  832

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  833   GNYQLVFSRPGNVAAFADSYQGFPSAY  859


 Score =   323 bits (829),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 174/203 (86%), Gaps = 1/203 (0%)
 Frame = +1

Query  418   VGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNM  594
             +G+GISGL SAYVLA  G   VV+YEKE+ LGGHA+TV  DGVDLDLGFMVFNRVTYPNM
Sbjct  1     IGSGISGLGSAYVLANQGVEEVVLYEKEESLGGHARTVRFDGVDLDLGFMVFNRVTYPNM  60

Query  595   MELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILK  774
             ME FE L VDME+SDMSF+VSLDNG G EWGSRNG SGLFAQ+KN+LNPYFW+MIREI+K
Sbjct  61    MEFFEKLAVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQRKNVLNPYFWRMIREIVK  120

Query  775   FKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAF  954
             FK DVL Y+EE + NPD+DRN+TLGEF+ +RGYSELFQ+AY++P+C SIWSC S+GV+ F
Sbjct  121   FKEDVLKYIEELEGNPDIDRNETLGEFLNARGYSELFQQAYLVPICGSIWSCPSDGVLNF  180

Query  955   SAYSILSFCRNHHLLQNFSPALW  1023
             SAYS+LSFC NHHLLQ F    W
Sbjct  181   SAYSVLSFCCNHHLLQIFGRPQW  203



>ref|XP_006606354.1| PREDICTED: uncharacterized protein LOC100815937 isoform X1 [Glycine 
max]
Length=861

 Score =  1009 bits (2609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/681 (72%), Positives = 571/681 (84%), Gaps = 6/681 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV+ RS +YVNKV++ELE+ G +I    EVH VST
Sbjct  184   FSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSQTYVNKVKQELEREGSQIITNREVHLVST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
               +       ++   +  QE YDGCIMA HAPD L++LG +AT+DE RILGAFQY YSDI
Sbjct  244   TSEKGC----VVYCNDGSQEMYDGCIMAVHAPDALRLLGDEATYDERRILGAFQYAYSDI  299

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++ MP+N AAWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   PE 
Sbjct  300   FLHRDKNLMPQNPAAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHIPEN  359

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAYQGYGFHEDG KAGMIAAHG+L 
Sbjct  360   TLLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYQGYGFHEDGFKAGMIAAHGILG  419

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
               C+   NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K   LK
Sbjct  420   SCCALQTNPKHMVPSWKELGARIFVTRFLSCYITTGCLMLLEEGGTMFTFEGTGKNCGLK  479

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++RVH PQFYWKV TQADLGLADAYI+GD SFVDK EGLLNL  I +ANRD +AS S+ 
Sbjct  480   SVLRVHDPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNLILILIANRDSNASNSKL  539

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
                RGWWTP+ FTSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSN+LF+ FLDETMTY
Sbjct  540   KKNRGWWTPVFFTSALTSAKFFMDHVSRRNTLTQARRNISRHYDLSNDLFATFLDETMTY  599

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKYTGI
Sbjct  600   SCAVFKNKDEDLKDAQKRKISLLIEKARIDKTHEILEIGCGWGSLAIEVVKQTGCKYTGI  659

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLK AE +V++AGLQD I F+LCDYRQLP   +YDRIISCEM+EAVGHE+M EFF
Sbjct  660   TLSEEQLKLAEQRVKDAGLQDRINFVLCDYRQLPKTYKYDRIISCEMIEAVGHEYMEEFF  719

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SR
Sbjct  720   GCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSR  779

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH+E+IGIHYYQTLRCWR NFL+RQ++IL LGF++KFIRTWEYYFDYC AGF + TL
Sbjct  780   LCVEHVENIGIHYYQTLRCWRKNFLKRQNEILALGFNEKFIRTWEYYFDYCGAGFKSLTL  839

Query  2945  GDYQIVFSRPGNVTAFGDPYK  3007
             G+YQ+VFSRPGNV A GDPYK
Sbjct  840   GNYQVVFSRPGNVPALGDPYK  860


 Score =   353 bits (906),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG+GISGL SAY+LAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNRVT
Sbjct  1     MRVAVVGSGISGLASAYLLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDVDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM++ FE+LGVDME SDMSFSVSLD G G EWGSRNG S LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMLDFFENLGVDMESSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV+SYL+  +NNPD+DRN+ LGEFIKSRGYSELFQKAY+IP+C SIWSCSSEG
Sbjct  121   EIVKFKDDVISYLDMLENNPDIDRNEPLGEFIKSRGYSELFQKAYLIPICGSIWSCSSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM+FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQW  207



>gb|KHG28467.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=833

 Score =  1009 bits (2608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/681 (71%), Positives = 571/681 (84%), Gaps = 7/681 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FC+    LQLFGRPQW+TV+ RS  YVNK+REELE RGC IR GCEVHSV +
Sbjct  152   FSAFSILSFCQNHHLLQLFGRPQWMTVRWRSRQYVNKIREELENRGCIIRTGCEVHSVLS  211

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
             D++G      ++ G +  QE++ GCI+A HAPD L++LG Q T+DELR+LGAFQYVYSDI
Sbjct  212   DDEG----CTVLCG-DESQESFQGCILAIHAPDALRLLGSQVTYDELRVLGAFQYVYSDI  266

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LH + +FMP+N AAWSAWNFLG+ + +VCLTYWLN LQNLG+T  P+LVTLNP  TP  
Sbjct  267   FLHHDTTFMPKNPAAWSAWNFLGSTDKKVCLTYWLNVLQNLGETSLPFLVTLNPDYTPRH  326

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              L KW TGHPVPS+AA++AS EL++IQGKR IWFCGAYQGYGFHEDGLKAGM AA+G+L 
Sbjct  327   TLFKWRTGHPVPSIAATKASLELDQIQGKRGIWFCGAYQGYGFHEDGLKAGMSAANGVLG  386

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  S L+NP  MVPS  ETGAR  VTRFL+ FI T  +ILLEEGGT+FTFEGT KK  LK
Sbjct  387   KSYSVLSNPKQMVPSLMETGARSFVTRFLSHFISTSCVILLEEGGTMFTFEGTSKKCNLK  446

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++RVH P FYWKV T+ADLGLADAYI+GD +FVDK +GLLNL  I +ANRDL +S S+ 
Sbjct  447   TVIRVHYPHFYWKVMTEADLGLADAYINGDFTFVDKNDGLLNLIMILIANRDLISSNSKL  506

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + KRGWWTP LFT+ + SAKYF +H+ RQNTLTQARRNISRHYDLSN+L++LFLDETMTY
Sbjct  507   SKKRGWWTPFLFTAGLTSAKYFFKHVLRQNTLTQARRNISRHYDLSNDLYALFLDETMTY  566

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFKSE+E LK AQ RKISLLI+KA+I   H ILEIGCGWGSLAIE V+RTGCKYTGI
Sbjct  567   SCAVFKSENEALKDAQQRKISLLIEKARIDGNHEILEIGCGWGSLAIEVVKRTGCKYTGI  626

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS++QLK+AE +V+EAGLQDNI F LCDYRQLP   +YDRIISCEM+EAVGHE+M+EFF
Sbjct  627   TLSKEQLKFAEMRVKEAGLQDNITFQLCDYRQLPSTYKYDRIISCEMIEAVGHEYMDEFF  686

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLAE+G+ VLQFISIP+ERY+ YR+SSDFIKEYIFPGGCLPS +R+TSAM+A+SR
Sbjct  687   GCCESVLAEDGLFVLQFISIPEERYNGYRRSSDFIKEYIFPGGCLPSFTRITSAMSATSR  746

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH+E+IG+HYYQTLR WR NFLE QS+I+ LGF+ KFIRTWEYYFDYCAAGF + TL
Sbjct  747   LCVEHVENIGLHYYQTLRYWRRNFLENQSKIMSLGFNDKFIRTWEYYFDYCAAGFKSNTL  806

Query  2945  GDYQIVFSRPGNVTAFGDPYK  3007
             G+YQ+VFSRPGNV A G+PYK
Sbjct  807   GNYQVVFSRPGNVAALGNPYK  827


 Score =   249 bits (636),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 145/207 (70%), Gaps = 32/207 (15%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M++AV+G GISGL+SAYVL K G  VV                                T
Sbjct  1     MKIAVIGGGISGLISAYVLVKAGVNVV--------------------------------T  28

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFE LGVDME SDMSFSVSL++G+G EWGSRNG S LF QK+NL N YFWQMIR
Sbjct  29    YPNMMELFERLGVDMEPSDMSFSVSLNHGNGIEWGSRNGISSLFVQKRNLFNLYFWQMIR  88

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFKNDV+ YL+  ++NPD DRN+TLG+F+ SRGYSELF KAY++P+C  IWS  +E 
Sbjct  89    EIIKFKNDVICYLKVLESNPDFDRNETLGQFVDSRGYSELFLKAYLVPICGLIWSSPTER  148

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             +M FSA+SILSFC+NHHLLQ F    W
Sbjct  149   IMEFSAFSILSFCQNHHLLQLFGRPQW  175



>gb|KHN01041.1| Putative fatty acid methyltransferase [Glycine soja]
Length=794

 Score =  1008 bits (2606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 488/681 (72%), Positives = 570/681 (84%), Gaps = 6/681 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV+ RS +YVNKV++ELE+ G +I    EVH VST
Sbjct  117   FSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSQTYVNKVKQELEREGSQIITNREVHLVST  176

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
               +       ++   +  QE YDGCIMA HAPD L++LG +AT+DE RILGAFQY YSDI
Sbjct  177   TSEKGC----VVYCNDGSQEMYDGCIMAVHAPDALRLLGDEATYDERRILGAFQYAYSDI  232

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++ MP+N AAWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   PE 
Sbjct  233   FLHRDKNLMPQNPAAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHIPEN  292

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAYQGYGFHEDG KAGMIAAHG+L 
Sbjct  293   TLLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYQGYGFHEDGFKAGMIAAHGILG  352

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
               C    NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K   LK
Sbjct  353   SCCVLQTNPKHMVPSWKELGARIFVTRFLSCYITTGCLMLLEEGGTMFTFEGTGKNCGLK  412

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++RVH PQFYWKV TQADLGLADAYI+GD SFVDK EGLLNL  I +ANRD +AS S+ 
Sbjct  413   SVLRVHDPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNLILILIANRDSNASNSKL  472

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
                RGWWTP+ FTSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSN+LF+ FLDETMTY
Sbjct  473   KKNRGWWTPVFFTSALTSAKFFMDHVSRRNTLTQARRNISRHYDLSNDLFATFLDETMTY  532

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKYTGI
Sbjct  533   SCAVFKNKDEDLKDAQKRKISLLIEKARIEKTHEILEIGCGWGSLAIEVVKQTGCKYTGI  592

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLK AE +V++AGLQD I F+LCDYRQLP   +YDRIISCEM+EAVGHE+M EFF
Sbjct  593   TLSEEQLKLAEQRVKDAGLQDRINFVLCDYRQLPKTYKYDRIISCEMIEAVGHEYMEEFF  652

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SR
Sbjct  653   GCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSR  712

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH+E+IGIHYYQTLRCWR NFL+RQ++IL LGF++KFIRTWEYYFDYC AGF + TL
Sbjct  713   LCVEHVENIGIHYYQTLRCWRKNFLKRQNEILALGFNEKFIRTWEYYFDYCGAGFKSLTL  772

Query  2945  GDYQIVFSRPGNVTAFGDPYK  3007
             G+YQ+VFSRPGNV A GDPYK
Sbjct  773   GNYQVVFSRPGNVPALGDPYK  793


 Score =   160 bits (405),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 112/207 (54%), Gaps = 67/207 (32%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG GISGL SAY+LAKGG  VV+YEKED                    + FN   
Sbjct  1     MRVAVVGGGISGLASAYLLAKGGVKVVLYEKEDRWE-----------------ISFN---  40

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
                    F  L ++ E++   F V ++  +                              
Sbjct  41    -------FSGLNIEFELNSKKFKVVMNTNY------------------------------  63

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
                       +YL+  +NNPD+DRN+ LGEFIKSRGYSELFQKAY+IP+C SIWSCSSEG
Sbjct  64    ----------NYLDMLENNPDIDRNEPLGEFIKSRGYSELFQKAYLIPICGSIWSCSSEG  113

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM+FSA+S+LSFCRNHHLLQ F    W
Sbjct  114   VMSFSAFSVLSFCRNHHLLQLFGRPQW  140



>ref|XP_010512500.1| PREDICTED: uncharacterized protein LOC104788434 isoform X2 [Camelina 
sativa]
Length=803

 Score =  1008 bits (2606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/687 (70%), Positives = 563/687 (82%), Gaps = 9/687 (1%)
 Frame = +2

Query  971   FHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FC     LQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C+V SVST
Sbjct  121   FSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDVKSVST  180

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E GS    V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAF+YVYSDI
Sbjct  181   SENGS----VTVTSGDGSEEVFDRCILAMHAPDALRLLGEEVTFDETRVLGAFRYVYSDI  236

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +   MPRN AAWS+WNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP   P++
Sbjct  237   YLHHDIDLMPRNQAAWSSWNFLGSTEKKVCVTYWLNILQNLGEKCEPFFVTLNPDHPPKK  296

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKWTTGHPVPSV+A  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAGM AA GLL 
Sbjct  297   ALLKWTTGHPVPSVSAWTASQELHKIQGKRNLWFCGAYQGYGFHEDGLKAGMAAARGLLG  356

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  + LNNP HMVPS  ETGARL VTRF+  FI TG + +LEEGGT+FTF G D    LK
Sbjct  357   KETALLNNPRHMVPSLTETGARLFVTRFMGQFISTGCVTILEEGGTMFTFGGKDSTFPLK  416

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK  GLLNL  I +ANRD  +++++ 
Sbjct  417   SVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKDSGLLNLIMILIANRDTKSNLTK-  475

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF  FLD+TMTY
Sbjct  476   --KRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGFFLDDTMTY  533

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S AVFKS+DEDLKTAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V+RTGCKYTGI
Sbjct  534   SSAVFKSDDEDLKTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVKRTGCKYTGI  593

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS +QLKYAE+KV+ AGLQD+I+F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF
Sbjct  594   TLSIEQLKYAEEKVKVAGLQDSIKFELCDYRQLSDVQKYDRIISCEMLEAVGHEFMEMFF  653

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
              RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSR
Sbjct  654   SRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSR  713

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LG D KFIRTWEYYFDYCAAGF T TL
Sbjct  714   LCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGIDDKFIRTWEYYFDYCAAGFKTLTL  773

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  774   GNYQLVFSRPGNVAAFADSYQGFPSAY  800


 Score =   239 bits (611),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FE LGVDME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFW+MIREI+
Sbjct  1     MMEFFEKLGVDMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWRMIREIV  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK DVL Y++E + NPD+DRN+TLGEF+ +RGYSELFQ+AY++P+C SIWSC S+GV+ 
Sbjct  61    KFKEDVLKYIKELEGNPDIDRNETLGEFLNARGYSELFQQAYLVPICGSIWSCPSDGVLN  120

Query  952   FSAYSILSFCRNHHLLQNFSPALW  1023
             FSAYS+LSFC NHHLLQ F    W
Sbjct  121   FSAYSVLSFCCNHHLLQIFGRPQW  144



>ref|XP_006350407.1| PREDICTED: uncharacterized protein LOC102579763 isoform X1 [Solanum 
tuberosum]
Length=866

 Score =  1003 bits (2594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/695 (70%), Positives = 574/695 (83%), Gaps = 9/695 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    +QLFG PQ LT++RRSH+YVNKV+EELEKRGC+IR GC
Sbjct  178   PSEGVMGFSAYSILSFCRDHHLMQLFGLPQLLTIRRRSHAYVNKVKEELEKRGCQIRTGC  237

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+SV T+EQG       I   +   E YDGCI+A H+PDTLKMLGK+AT+DE RILGAF
Sbjct  238   EVNSVLTNEQGCT-----IYCNDGSTEVYDGCIIAVHSPDTLKMLGKEATYDETRILGAF  292

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
              YVYSD +LH++++F+P + AAWSA NFLGT+N+R C TYWLN +QNLGD++ PYLVT +
Sbjct  293   HYVYSDTFLHQDKTFLPHDPAAWSACNFLGTMNDRGCATYWLNVIQNLGDSELPYLVTFD  352

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP TPE  L+KW T HPVPSVAAS+AS +L +IQGKR IWFCG YQGYGFHE+GLKAG+I
Sbjct  353   PPHTPEHTLVKWRTSHPVPSVAASKASCKLHQIQGKRGIWFCGPYQGYGFHENGLKAGVI  412

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA G+L++ CS L N  ++VP+WPETGARLLVTRF  S+I TG IILLE GGT+FTF+G 
Sbjct  413   AADGMLRRNCSILYNHKYLVPTWPETGARLLVTRFFKSYIQTGCIILLE-GGTIFTFQGR  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             D+K  LKV + V S QFYWKVATQADLGLADA+IHGD SFVDK EGLLNL  IF+AN +L
Sbjct  472   DRKCSLKVSLTVRSMQFYWKVATQADLGLADAFIHGDFSFVDKNEGLLNLITIFIANGEL  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               SV  ++ KRGWWTP+LFT+A++SAKYF RH+S QNTLTQARRNISRHYD+SNELFSLF
Sbjct  532   KESVKPTSKKRGWWTPVLFTAALSSAKYFYRHVSNQNTLTQARRNISRHYDVSNELFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+FKSEDEDLK AQ+RKI +LI KAK+ KEHHILEIG GWGS A+E V++T
Sbjct  592   LDETMTYSCAIFKSEDEDLKDAQLRKIYVLIRKAKVRKEHHILEIGFGWGSFAMEVVKQT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSEQQL+YA+ +V++AGLQD I F+LCDYRQ+P   +YDRIIS  M+E VGH
Sbjct  652   GCKYTGITLSEQQLEYAQLRVKQAGLQDQITFILCDYRQIPSKDKYDRIISIGMIEHVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             ++M EFF  CES L E+G+L LQFIS+PD RYDEYR S+ FIKEYIFPGGCLPSLSRVTS
Sbjct  712   DYMEEFFTCCESALTEDGLLALQFISMPDGRYDEYRHSTGFIKEYIFPGGCLPSLSRVTS  771

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAA+SRLCV HLE+IGIHYYQTLRCWR NF + +SQI  LGFD KFIRTWEYYFDYCAA
Sbjct  772   AMAATSRLCVVHLEEIGIHYYQTLRCWRKNFQKNKSQIHALGFDDKFIRTWEYYFDYCAA  831

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKG-LASAY  3025
             GF TCT+GDYQIVFSRPGNV  FGDPY   + SAY
Sbjct  832   GFKTCTIGDYQIVFSRPGNVATFGDPYNDTMPSAY  866


 Score =   324 bits (831),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 176/203 (87%), Gaps = 1/203 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  579
             M++AVVGAGISGLVSAY LAK G  VVVYEKE+Y+  HA KTV +D +DL L FM+F++V
Sbjct  1     MKLAVVGAGISGLVSAYELAKAGVKVVVYEKENYISCHANKTVIVDDIDLSLDFMIFDQV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPN+ME FE LGVDMEIS MSFSVSLD G G EWG+RNGFS LFAQKKN+LNPYFWQMI
Sbjct  61    TYPNLMEFFEFLGVDMEISYMSFSVSLDQGRGCEWGTRNGFSSLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DV+SYLEE DNNPD+DRN TLG+FI+S  YSELFQKAY++P+CASIW C SE
Sbjct  121   REIIRFKQDVISYLEELDNNPDIDRNKTLGQFIESHVYSELFQKAYLVPICASIWFCPSE  180

Query  940   GVMAFSAYSILSFCRNHHLLQNF  1008
             GVM FSAYSILSFCR+HHL+Q F
Sbjct  181   GVMGFSAYSILSFCRDHHLMQLF  203



>ref|XP_007144121.1| hypothetical protein PHAVU_007G1305000g, partial [Phaseolus vulgaris]
 gb|ESW16115.1| hypothetical protein PHAVU_007G1305000g, partial [Phaseolus vulgaris]
Length=694

 Score =  1001 bits (2589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 482/681 (71%), Positives = 572/681 (84%), Gaps = 7/681 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV+ RS +YV KV EEL++ G +I    EVH VST
Sbjct  18    FSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSQNYVKKVVEELQREGSQIITNREVHFVST  77

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E+G      ++  K+  QE YDGC+++ HAPD L++LG +AT+DE RILGAFQY YSDI
Sbjct  78    TEKG-----CVVYCKDGSQEVYDGCVLSVHAPDALRLLGDEATYDEHRILGAFQYAYSDI  132

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++ MP+N AAWSAWNFLG+ NN+VC+TYWLN LQN+ +T  P+LVTLNP   PE 
Sbjct  133   FLHRDKNLMPQNPAAWSAWNFLGSNNNKVCVTYWLNILQNIKETSLPFLVTLNPDHIPEN  192

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              L+KW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAYQG GFHEDG KAGMIAAHG+L 
Sbjct  193   TLVKWSTGHPVPSVAAFKASLELDYIQGKRKIWFSGAYQGNGFHEDGFKAGMIAAHGILG  252

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             KRC    NP HMVPSW E GAR+ VTRFL+ ++ TG + LLEEGGT+FTFEGT +  +LK
Sbjct  253   KRCVLQTNPKHMVPSWKELGARIFVTRFLSCYVNTGCLTLLEEGGTMFTFEGTGENGILK  312

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++R+HSPQFYWKV  QADLGLADAYI+GD SFVDK EGLLNL  I +ANRD +AS S  
Sbjct  313   SVLRIHSPQFYWKVMAQADLGLADAYINGDFSFVDKDEGLLNLILILIANRDSNASNSHL  372

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
                RGWWTP+ FTSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSNELF++FLDETMTY
Sbjct  373   KKNRGWWTPVFFTSALTSAKFFMDHVSRRNTLTQARRNISRHYDLSNELFAIFLDETMTY  432

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK++DEDLK AQ RKISLLI KAKI K H ILEIGCGWGSLAIE V++TGC+YTGI
Sbjct  433   SCAVFKNKDEDLKDAQRRKISLLIQKAKIDKTHEILEIGCGWGSLAIEVVKQTGCRYTGI  492

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS++QLK+AE +V++AGLQD I+FLLCDYRQLP   ++DRIISCEM+EAVGHE+M EFF
Sbjct  493   TLSKEQLKFAEQRVKDAGLQDYIKFLLCDYRQLPKTYKFDRIISCEMIEAVGHEYMEEFF  552

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMA +SR
Sbjct  553   GCCESVLAQNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMATTSR  612

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH+E++GIHYYQTLRCWR NF+ERQ++IL LGF++KFIRTWEYYFDYC AGF + TL
Sbjct  613   LCVEHVENLGIHYYQTLRCWRKNFMERQNEILALGFNEKFIRTWEYYFDYCGAGFKSLTL  672

Query  2945  GDYQIVFSRPGNVTAFGDPYK  3007
             G+YQ+VFSRPGNV AFGDPYK
Sbjct  673   GNYQVVFSRPGNVAAFGDPYK  693


 Score = 72.8 bits (177),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +1

Query  901   IPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             IP+C SIWSCSSEGV++FSA+S+LSFCRNHHLLQ F    W
Sbjct  1     IPICGSIWSCSSEGVLSFSAFSVLSFCRNHHLLQLFGRPQW  41



>gb|KGN61574.1| hypothetical protein Csa_2G171950 [Cucumis sativus]
Length=865

 Score =  1000 bits (2585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/687 (69%), Positives = 563/687 (82%), Gaps = 7/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQL GRPQWLTVK RSHSYV KV+E LE +GC+IR  CEV+S+ST
Sbjct  184   FSAFSVLSFCRNHHLLQLVGRPQWLTVKGRSHSYVKKVQEVLESQGCQIRTSCEVNSIST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
               +G       +S  + +QE +D CI+A HAPDTL++LG +AT DELR+LGAFQY YSDI
Sbjct  244   LVKGCK-----VSYGDDLQEMFDACIIATHAPDTLRILGNEATSDELRVLGAFQYAYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR++S MP+N AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLNP + P  
Sbjct  299   FLHRDKSLMPQNPAAWSAWNFLGNTDKKVCLTYWLNVLQNLGETGPPFLVTLNPDKEPTN  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGHP+PS AAS+AS+EL  IQGKRRIWFCGAYQGYGFHEDGLK G+IAA  +L 
Sbjct  359   ILLKWSTGHPIPSGAASKASNELHSIQGKRRIWFCGAYQGYGFHEDGLKGGIIAAQNMLG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
              R + L+NP HMVPS  +TGARL VTRFL  FI +GS+ L+EEGGT+FTFEGTDKK LLK
Sbjct  419   NRFTLLSNPKHMVPSLADTGARLFVTRFLRQFITSGSLTLMEEGGTIFTFEGTDKKCLLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V ++VH+PQFYWK+ T+AD+GLADAYI+GD SFVDK EGLLN F I VA R+ + S+++ 
Sbjct  479   VALKVHNPQFYWKITTRADIGLADAYINGDFSFVDKDEGLLNFFMIIVACRETNFSIAKL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               K GWWTP L TS IASAKYF  H SR+NTLTQARRNISRHYDLSNELFSLF+D+TM Y
Sbjct  539   KKKGGWWTPPLLTSCIASAKYFFHHTSRRNTLTQARRNISRHYDLSNELFSLFMDDTMQY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FKSE+EDLK AQMRK+SLLI KA+I+K HH+LEIGCGWGSLAIE V++TGC+YTGI
Sbjct  599   SCAIFKSENEDLKVAQMRKMSLLIKKARINKSHHVLEIGCGWGSLAIEIVKQTGCRYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSEQQLKYAE KV++A LQD I  LLCDYR +P   +YDRIISCEM+EAVGHEFM +FF
Sbjct  659   TLSEQQLKYAEKKVKDANLQDRINLLLCDYRNVPSTKKYDRIISCEMIEAVGHEFMEDFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLAENGI V QF ++PD RYD YR SS+FIKEYIFPGGCLP LSRVT+AM  +SR
Sbjct  719   GTCESVLAENGIFVQQFTAMPDARYDAYRLSSEFIKEYIFPGGCLPCLSRVTTAMTKASR  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
              C+EHLE+IGIHY+QTLR WR +FLE +S+IL LGFD+ FIRTWEYYFDYCAAGF + TL
Sbjct  779   FCIEHLENIGIHYHQTLRYWRKDFLENKSKILQLGFDESFIRTWEYYFDYCAAGFKSRTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
              +YQIV+SRPGNV  F +PY+G  SAY
Sbjct  839   NNYQIVYSRPGNVAVFNNPYQGFPSAY  865


 Score =   333 bits (855),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 177/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVG GISGLVSAYVLAK G  VV+ EKEDY+GGH+KTV   G DLDLGFMVFN VT
Sbjct  1     MKVAVVGGGISGLVSAYVLAKAGVEVVLLEKEDYVGGHSKTVHFHGFDLDLGFMVFNHVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LFAQKKNLLNPYFWQMIR
Sbjct  61    YPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFAQKKNLLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV++YLE  +NN D+DRN+TLG+FI S GYSELFQ AY++PMC SIWSCSSE 
Sbjct  121   EIVKFKDDVINYLEVLENNSDVDRNETLGQFINSNGYSELFQNAYLVPMCGSIWSCSSEK  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             V++FSA+S+LSFCRNHHLLQ      W
Sbjct  181   VLSFSAFSVLSFCRNHHLLQLVGRPQW  207



>ref|XP_006589307.1| PREDICTED: uncharacterized protein LOC100801659 isoform X1 [Glycine 
max]
Length=860

 Score =  1000 bits (2585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/681 (71%), Positives = 568/681 (83%), Gaps = 7/681 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FC     LQLFGRPQWLTV+ RS +YVNKV+EELE+ G +I    EV  VST
Sbjct  184   FSAFSVLSFCHNHHLLQLFGRPQWLTVRWRSQTYVNKVKEELEREGSQIITNREVQLVST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E+       ++  K+  +E YDGCIMA HAPD L++LG +ATFDE RILGAFQY YSDI
Sbjct  244   SEKE-----CVVHCKDGSEEMYDGCIMAVHAPDALRLLGDEATFDERRILGAFQYAYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++ MP+N AAWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   PE 
Sbjct  299   FLHRDKNLMPQNPAAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHIPEN  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAY GYGFHEDG KAGMIAAHGLL 
Sbjct  359   TLLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYLGYGFHEDGFKAGMIAAHGLLG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
               C    NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K   LK
Sbjct  419   SCCVLQTNPKHMVPSWKELGARIFVTRFLSYYINTGCLMLLEEGGTMFTFEGTGKNCGLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++RVH+PQFYWKV TQADLGLADAYI+GD SFVDK EGLL L  I +ANRD +AS  + 
Sbjct  479   SVLRVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLILILILIANRDSNASNLKL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
                RGWWTP+  TSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSNELF++FLDETMTY
Sbjct  539   KKNRGWWTPVFLTSALTSAKFFMEHVSRRNTLTQARRNISRHYDLSNELFAIFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKYTGI
Sbjct  599   SCALFKNKDEDLKDAQKRKISLLIEKARIDKTHEILEIGCGWGSLAIEVVKQTGCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS++QLK AE +V++AGLQD I+FLLCDYRQLP   +YDRIISCEM+EAVGHE+M EFF
Sbjct  659   TLSKEQLKLAEQRVKDAGLQDRIKFLLCDYRQLPKAYKYDRIISCEMIEAVGHEYMEEFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SR
Sbjct  719   GCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSR  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC EH+E+IGIHYYQTLRCWR NFLERQ++I+ LGF++KFIRTWEYYFDYC AGF + TL
Sbjct  779   LCGEHVENIGIHYYQTLRCWRKNFLERQNEIMALGFNEKFIRTWEYYFDYCGAGFKSLTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYK  3007
             G+YQ+VFSRPGNV A GDPYK
Sbjct  839   GNYQVVFSRPGNVAALGDPYK  859


 Score =   353 bits (906),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGL SAYVLAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNRVT
Sbjct  1     MRVAVVGAGISGLASAYVLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDIDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM++ FE+LGVDME+SDMSFSVSLD G G EWGSRNG + LFAQK+N+LNPYFWQMIR
Sbjct  61    YPNMLDFFENLGVDMELSDMSFSVSLDKGRGCEWGSRNGLTSLFAQKRNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV+SYL+  +NNPD+DRN+ LGEFIKSRGYSELFQKAY+IP+C SIWSCSSEG
Sbjct  121   EIVKFKDDVISYLDMLENNPDIDRNEPLGEFIKSRGYSELFQKAYLIPICGSIWSCSSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM+FSA+S+LSFC NHHLLQ F    W
Sbjct  181   VMSFSAFSVLSFCHNHHLLQLFGRPQW  207



>gb|KHN30725.1| Putative fatty acid methyltransferase [Glycine soja]
Length=787

 Score =   999 bits (2584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 485/681 (71%), Positives = 568/681 (83%), Gaps = 7/681 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FC     LQLFGRPQWLTV+ RS +YVNKV+EELE+ G +I    EV  VST
Sbjct  111   FSAFSVLSFCHNHHLLQLFGRPQWLTVRWRSQTYVNKVKEELEREGSQIITNREVQLVST  170

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E+       ++  K+  +E YDGCIMA HAPD L++LG +ATFDE RILGAFQY YSDI
Sbjct  171   SEKE-----CVVHCKDGSEEMYDGCIMAVHAPDALRLLGDEATFDERRILGAFQYAYSDI  225

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++ MP+N AAWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   PE 
Sbjct  226   FLHRDKNLMPQNPAAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHIPEN  285

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAY GYGFHEDG KAGMIAAHGLL 
Sbjct  286   TLLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYLGYGFHEDGFKAGMIAAHGLLG  345

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
               C    NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K   LK
Sbjct  346   SCCVLQTNPKHMVPSWKELGARIFVTRFLSYYINTGCLMLLEEGGTMFTFEGTGKNCGLK  405

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++RVH+PQFYWKV TQADLGLADAYI+GD SFVDK EGLL L  I +ANRD +AS  + 
Sbjct  406   SVLRVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLILILILIANRDSNASNLKL  465

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
                RGWWTP+  TSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSNELF++FLDETMTY
Sbjct  466   KKNRGWWTPVFLTSALTSAKFFMEHVSRRNTLTQARRNISRHYDLSNELFAIFLDETMTY  525

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKYTGI
Sbjct  526   SCALFKNKDEDLKDAQKRKISLLIEKARIDKTHEILEIGCGWGSLAIEVVKQTGCKYTGI  585

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS++QLK AE +V++AGLQD I+FLLCDYRQLP   +YDRIISCEM+EAVGHE+M EFF
Sbjct  586   TLSKEQLKLAEQRVKDAGLQDRIKFLLCDYRQLPKAYKYDRIISCEMIEAVGHEYMEEFF  645

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SR
Sbjct  646   GCCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSR  705

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC EH+E+IGIHYYQTLRCWR NFLERQ++I+ LGF++KFIRTWEYYFDYC AGF + TL
Sbjct  706   LCGEHVENIGIHYYQTLRCWRKNFLERQNEIMALGFNEKFIRTWEYYFDYCGAGFKSLTL  765

Query  2945  GDYQIVFSRPGNVTAFGDPYK  3007
             G+YQ+VFSRPGNV A GDPYK
Sbjct  766   GNYQVVFSRPGNVAALGDPYK  786


 Score =   130 bits (327),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = +1

Query  796   YLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILS  975
             YL+  +NNPD+DRN+ LGEFIKSRGYSELFQKAY+IP+C SIWSCSSEGVM+FSA+S+LS
Sbjct  59    YLDMLENNPDIDRNEPLGEFIKSRGYSELFQKAYLIPICGSIWSCSSEGVMSFSAFSVLS  118

Query  976   FCRNHHLLQNFSPALW  1023
             FC NHHLLQ F    W
Sbjct  119   FCHNHHLLQLFGRPQW  134


 Score =   105 bits (261),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 58/66 (88%), Gaps = 2/66 (3%)
 Frame = +1

Query  403  MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
            MRVAVVGAGISGL SAYVLAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNR  
Sbjct  1    MRVAVVGAGISGLASAYVLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDIDLGFMVFNR--  58

Query  583  YPNMME  600
            Y +M+E
Sbjct  59   YLDMLE  64



>gb|KCW60262.1| hypothetical protein EUGRSUZ_H02971, partial [Eucalyptus grandis]
Length=807

 Score =   989 bits (2557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/687 (69%), Positives = 563/687 (82%), Gaps = 7/687 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQ+ GRPQWLTV+RRSHSYVNKVR+ LE +GCEIR  C
Sbjct  119   PSEEVMSFSAFSILSFCRNHHLLQVVGRPQWLTVRRRSHSYVNKVRDVLESKGCEIRPSC  178

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV S+ST ++G     ++++G    +E YD CI+A HAPD L+MLG QAT+DE R+LGAF
Sbjct  179   EVRSISTSDEG----CIVLTGDG-SEEVYDKCIVAVHAPDALRMLGDQATYDETRVLGAF  233

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             +Y YS+IYLH +++FMP+N AAWSAWNFLG+  N+VCLTYWLN LQNL     PYLVTLN
Sbjct  234   KYAYSEIYLHHDKTFMPKNSAAWSAWNFLGSAENKVCLTYWLNVLQNLDQKDFPYLVTLN  293

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   PE  LLKW TGHP+PSVAAS+A  +L  IQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  294   PSHEPEHTLLKWCTGHPIPSVAASKALLQLHEIQGKRGIWFCGAYQGYGFHEDGLKAGMS  353

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHG++ +    L+NP HMVPS  E GAR  VT FL  +I TG + LLEEGGT+FTFEGT
Sbjct  354   AAHGVMGQSHFLLDNPRHMVPSLKEIGARFFVTGFLRRYISTGLVTLLEEGGTMFTFEGT  413

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K+  L V +R+HSP+FYWKV TQADLGLADAYI+GD S VDK +GLLNLF+I +ANRD 
Sbjct  414   TKRCPLTVTLRIHSPEFYWKVMTQADLGLADAYINGDFSCVDKNKGLLNLFQILIANRDS  473

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               ++S+ + +RGWW P+L T+ IASAKYF +H+SRQNTLTQARRNIS+HYDLSNELFSLF
Sbjct  474   DVAISKLSKRRGWWAPMLLTAGIASAKYFFKHVSRQNTLTQARRNISQHYDLSNELFSLF  533

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+F+   EDLK AQMRKISLLI KAKI K H +LEIGCGWG+LAIE V +T
Sbjct  534   LDETMTYSCALFEMAGEDLKAAQMRKISLLIKKAKIEKTHEVLEIGCGWGNLAIEVVRQT  593

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS++QLKYA+ +V+EAGLQD+I+ +LCDYRQLP   RYDRIISCEM+EAVGH
Sbjct  594   GCKYTGITLSKEQLKYAKSRVKEAGLQDSIKLILCDYRQLPSAYRYDRIISCEMIEAVGH  653

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M EFFG CESVLA++G+ VLQFISIPDERY+EYR+SSDFIKEYIFPGGCLPSLSRVTS
Sbjct  654   EYMEEFFGCCESVLAKDGLFVLQFISIPDERYEEYRRSSDFIKEYIFPGGCLPSLSRVTS  713

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA++SRL VEH+++IGIHY+QTLRCWR NF+E+Q +IL  GF++KFIRTW+YYFDYCAA
Sbjct  714   AMASASRLSVEHVDNIGIHYHQTLRCWRKNFMEKQRKILAPGFNEKFIRTWQYYFDYCAA  773

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPY  3004
             GF + TLG+YQIVF RPGN  AF D Y
Sbjct  774   GFKSHTLGNYQIVFLRPGNDAAFTDLY  800


 Score =   250 bits (638),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 130/149 (87%), Gaps = 0/149 (0%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNMMELFESLGV+MEISDMSFSVSLD G G EWGSRNG   LFAQK N+LNPYFWQM
Sbjct  1     VTYPNMMELFESLGVEMEISDMSFSVSLDEGRGCEWGSRNGLLSLFAQKTNVLNPYFWQM  60

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             +REI+KFK DVLSYLE  ++NPD++R++TLG+FIKSRGYSELFQKAY+IP+C SIWSC S
Sbjct  61    LREIIKFKEDVLSYLEGLESNPDINRSETLGQFIKSRGYSELFQKAYLIPICGSIWSCPS  120

Query  937   EGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             E VM+FSA+SILSFCRNHHLLQ      W
Sbjct  121   EEVMSFSAFSILSFCRNHHLLQVVGRPQW  149



>ref|XP_011030437.1| PREDICTED: uncharacterized protein LOC105129890 isoform X2 [Populus 
euphratica]
Length=869

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 476/672 (71%), Positives = 562/672 (84%), Gaps = 6/672 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +F R    LQLFGRP WL V+R+S SYVNKVRE+LE  GC+IR GC
Sbjct  180   PSEGVMNFSAFSVLSFFRNHHLLQLFGRPPWLRVRRQSRSYVNKVREKLESWGCQIRTGC  239

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV +VST ++  AG  V+    ++  E Y GCIMA HAPD L +LG+QATFDE RILGAF
Sbjct  240   EVQAVSTTDE--AGCAVLCRDGSL--EMYSGCIMAVHAPDALGILGEQATFDETRILGAF  295

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY+YS+I+LHR++ FMP+N AAW AWNFLG+  N+ CLTYWLN LQN+ +T  P+LVTLN
Sbjct  296   QYMYSEIFLHRDKKFMPQNSAAWCAWNFLGSTENKACLTYWLNVLQNIDETGLPFLVTLN  355

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   P+  LL+W+TGHP+PSVAA++AS ELE IQGKRRIWF GAYQGYGFHED LK+GM+
Sbjct  356   PDNAPDHTLLQWSTGHPIPSVAATKASLELEHIQGKRRIWFGGAYQGYGFHEDRLKSGMV  415

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHGLL K C  + NP HMVPS  ETGARL VTRFL   I TG + LLE+GGTVF+FEGT
Sbjct  416   AAHGLLGKSCDIMRNPKHMVPSMLETGARLFVTRFLGHHISTGCLTLLEDGGTVFSFEGT  475

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              KK  LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFVDK EGL+NLF I + NRD 
Sbjct  476   SKKCSLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLINLFMILIVNRDA  535

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               S S+ N KRGWWTPLLFT+ IASAK+FI+H+SR+NTLTQARRNISRHYDLSNELF+LF
Sbjct  536   DNSTSKLNKKRGWWTPLLFTAGIASAKFFIQHVSRKNTLTQARRNISRHYDLSNELFALF  595

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+FK EDEDLK+AQ++KISLLI+KA+++K+H +LEIGCGWG+LAIE V+RT
Sbjct  596   LDETMTYSCALFKKEDEDLKSAQIQKISLLIEKARVNKDHEVLEIGCGWGTLAIEVVQRT  655

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GC+YTGITLSE+QLKYAE KV+EAGLQD+I+F LCDYRQLP   +YDRIISCEM+EAVGH
Sbjct  656   GCRYTGITLSEEQLKYAELKVKEAGLQDSIKFHLCDYRQLPMTHKYDRIISCEMIEAVGH  715

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M EFFG CESVL ENG+ VLQFISIP+ERYD YRQSSDFIKEYIFPGGCLPSL+++TS
Sbjct  716   EYMEEFFGCCESVLDENGLFVLQFISIPEERYDLYRQSSDFIKEYIFPGGCLPSLTKITS  775

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA+SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL LGF++KFIRTWEYYFDYCAA
Sbjct  776   AMASSSRLCVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAA  835

Query  2924  GFHTCTLGDYQI  2959
             GF T TLG+YQ+
Sbjct  836   GFKTHTLGNYQV  847


 Score =   347 bits (891),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             +MRVAVVGAG+SGLVSAYVLA+ GA VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  3     RMRVAVVGAGLSGLVSAYVLARAGAEVVLYEKEDYLGGHAKTVRFDGVDLDLGFMVFNRV  62

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             T PNMME FE+LG+DME+SD+SFSVSLD G GYEWGSRNGFSGLFAQKKN+L+PYFW+++
Sbjct  63    TCPNMMEFFENLGIDMELSDVSFSVSLDQGKGYEWGSRNGFSGLFAQKKNVLSPYFWKVL  122

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK+DVLSYLE  +NNP +DRN+TLG+F+KS GYSELFQKAY++P+C SIWSC SE
Sbjct  123   REIVKFKDDVLSYLEVLENNPVVDRNETLGQFVKSGGYSELFQKAYLVPVCGSIWSCPSE  182

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GVM FSA+S+LSF RNHHLLQ F    W
Sbjct  183   GVMNFSAFSVLSFFRNHHLLQLFGRPPW  210



>ref|XP_010023866.1| PREDICTED: uncharacterized protein LOC104414443 [Eucalyptus grandis]
Length=865

 Score =   984 bits (2543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 473/687 (69%), Positives = 560/687 (82%), Gaps = 7/687 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQ+FGRPQWLT++RRSHSYVNKVR+ LE +GCEIR  C
Sbjct  177   PSEGVMSFSAFSVLSFCRNHHLLQVFGRPQWLTLRRRSHSYVNKVRDVLESKGCEIRSSC  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV  +ST ++G     ++++G    +E YD CI+A HAPD L+MLG QAT+DE R+LGAF
Sbjct  237   EVRFISTSDEG----CIVLTGDGS-EEVYDKCIVAVHAPDALRMLGDQATYDETRVLGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             +Y YSDIYLH +++FMP+N AAWSAWN LG   N+VCLTYWLN LQNL     P+LVTLN
Sbjct  292   KYAYSDIYLHHDKTFMPKNSAAWSAWNVLGCAENKVCLTYWLNVLQNLDQKDFPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   PE  LLKW TG P+PSVAAS+A  +L  IQGKR IWFCGAYQGYGFHEDGLK GM 
Sbjct  352   PSHEPEHTLLKWCTGSPIPSVAASKALLQLHEIQGKRGIWFCGAYQGYGFHEDGLKGGMA  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHG++ +    L+NP HMVPS  E GAR  VT FL  +I TG I LLEEGGT+FTFEGT
Sbjct  412   AAHGVIGQSHFLLDNPQHMVPSLKEIGARFFVTGFLRRYISTGLITLLEEGGTMFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K+  L V +R+HSP+FYWKV TQADLGLADAYI+GD S VDK +GLLNLF+I +ANRD 
Sbjct  472   TKRCPLTVTLRIHSPEFYWKVMTQADLGLADAYINGDFSCVDKNKGLLNLFQILIANRDS  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               ++S+ + +RGWWTP+L T+ IASAKYF +HI RQNTLTQARRNIS+HYDLSNELFSLF
Sbjct  532   DITMSKLSKRRGWWTPMLSTAGIASAKYFFKHILRQNTLTQARRNISQHYDLSNELFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCAVF+   EDLK AQMRKISLLI KA+I K H +LEIGCGWGSLAIE V +T
Sbjct  592   LDETMTYSCAVFEMAGEDLKAAQMRKISLLIKKARIEKTHEVLEIGCGWGSLAIEVVRQT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS++QLKYA+ +V+EAGLQD+I+F+LCDYRQLP   +YDRIISCEM+EAVGH
Sbjct  652   GCKYTGITLSKEQLKYAKSRVKEAGLQDSIKFILCDYRQLPSAYKYDRIISCEMIEAVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M EFF  CESVLA++G+LVLQF SIPDERY+EYRQSSDFIKEYIFPG C+PSLSR+TS
Sbjct  712   EYMEEFFSCCESVLAKDGLLVLQFTSIPDERYEEYRQSSDFIKEYIFPGCCVPSLSRITS  771

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA++SRL VEH+++IGIH+YQTLRCWR NF+E+Q +IL LGF++KFIRTWEYYFDYCAA
Sbjct  772   AMASASRLSVEHVDNIGIHFYQTLRCWRKNFMEKQRKILALGFNEKFIRTWEYYFDYCAA  831

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPY  3004
             GF + TLG+YQIVFSRPGN  AF D Y
Sbjct  832   GFKSHTLGNYQIVFSRPGNEAAFTDLY  858


 Score =   352 bits (903),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+V V+G G+SGLV+AY  A+GGA VVVYEKEDYLGGHAKTV+++GVDLDLGFMVFNRVT
Sbjct  1     MKVGVIGGGMSGLVAAYEAARGGAKVVVYEKEDYLGGHAKTVSVNGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFESLGV+MEISDMS SVSLD G GYEWGSRNG   LFAQK NLLNPYFWQM+R
Sbjct  61    YPNMMELFESLGVEMEISDMSISVSLDEGQGYEWGSRNGLLSLFAQKTNLLNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK DVLSYLE  ++NPD+DR++TLG+FIKSRGYSELFQKAY+IP+C SIWSC SEG
Sbjct  121   EVIKFKEDVLSYLEGLESNPDIDRSETLGQFIKSRGYSELFQKAYLIPICGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM+FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   VMSFSAFSVLSFCRNHHLLQVFGRPQW  207



>ref|XP_006857466.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
 gb|ERN18933.1| hypothetical protein AMTR_s00067p00185740 [Amborella trichopoda]
Length=866

 Score =   984 bits (2543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/681 (69%), Positives = 564/681 (83%), Gaps = 7/681 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTVK RSH+YV +V+EELE+ GCEIR  C + S+S 
Sbjct  184   FSAFSVLSFCRNHHLLQLFGRPQWLTVKCRSHTYVKRVKEELERHGCEIRTSCPLQSISP  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E    GG  +       ++ YDGCI+  HAPD L++LG+ ATF+E R+LGAFQYVYSD+
Sbjct  244   TE----GGWSVFDACG-AKDDYDGCILGVHAPDALEILGQHATFEESRVLGAFQYVYSDV  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLHR++S MP+N AAWSAWNFLGT  NRVCLTYWLN LQNLGDT  P+LV+LNP   P+ 
Sbjct  299   YLHRDKSLMPQNPAAWSAWNFLGTKGNRVCLTYWLNVLQNLGDTSLPFLVSLNPTSLPQH  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
               LKW+T HPVPSVAAS+A  EL++IQG R IWFCGAYQG+GFHEDGLKAGM+AAHG+L+
Sbjct  359   NALKWSTSHPVPSVAASKAICELDKIQGNRGIWFCGAYQGWGFHEDGLKAGMVAAHGVLQ  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             ++C  L N  HMV S  E GAR ++T FL  FI TG++ LLE+GGTVF FEG ++K  LK
Sbjct  419   EKCVLLQNKRHMVLSLMELGARSVITEFLNRFISTGNLCLLEDGGTVFYFEGANRKCYLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++R+H P FYWKVA QADLGLADAYI+GD SFVDK+EGLLN+F IF+ANRD+  S  + 
Sbjct  479   SVLRIHHPSFYWKVAAQADLGLADAYINGDFSFVDKEEGLLNMFLIFIANRDMMNSSRQQ  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
              +KRGWWTP+L+T+ + SAKYF+RHISRQNTLTQ+RRNISRHYDLSN+LF+LFLDETMTY
Sbjct  539   GNKRGWWTPVLYTAGLQSAKYFLRHISRQNTLTQSRRNISRHYDLSNDLFALFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S A+F+ EDEDLK AQ+RKI LLI+KA++  +H ILEIGCGWGSLA+E V++T CKYTGI
Sbjct  599   SSAIFEHEDEDLKAAQLRKIYLLIEKARVDSDHEILEIGCGWGSLALEVVKQTRCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLKYA+ KV+EAGL++ I  LLCDYRQLP + +YDRIISCEM+EAVGHE++ EF 
Sbjct  659   TLSEEQLKYAQSKVKEAGLEERITLLLCDYRQLPASHKYDRIISCEMIEAVGHEYIEEFL  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
              RC+S LAENGILVLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPS SR+TSAMAA S+
Sbjct  719   MRCDSHLAENGILVLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSFSRLTSAMAAVSK  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH+E+IGIHYYQTL  WR NF+  +S+I++LGFD+KFIRTWEYYF YCAAGF +CTL
Sbjct  779   LCVEHVENIGIHYYQTLIKWRDNFMANKSKIMELGFDEKFIRTWEYYFIYCAAGFKSCTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYK  3007
              DYQ+VFSRPGNV AFG+PYK
Sbjct  839   EDYQVVFSRPGNVNAFGNPYK  859


 Score =   346 bits (888),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAV+G GISGLVS+YVLAK G  V +YEKEDYLGGHA+TV LDGVDLDLGFMVFNRVT
Sbjct  1     MKVAVIGGGISGLVSSYVLAKAGVSVTLYEKEDYLGGHARTVKLDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLG+DMEISDMSFSVSLD G GYEWGSR+G +GLFAQK N LNP+FW+M+R
Sbjct  61    YPNMMEFFESLGIDMEISDMSFSVSLDGGQGYEWGSRSGLAGLFAQKSNALNPHFWRMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++ FK DVL Y+EE +NNPD+DRN+TLG FIKS GYS LFQ AY++P+CASIWSCSSE 
Sbjct  121   ELIVFKEDVLKYIEELENNPDLDRNETLGHFIKSHGYSRLFQDAYLVPVCASIWSCSSET  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   VMTFSAFSVLSFCRNHHLLQLFGRPQW  207



>gb|KHG28468.1| putative fatty acid methyltransferase [Gossypium arboreum]
Length=828

 Score =   983 bits (2540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/681 (70%), Positives = 564/681 (83%), Gaps = 12/681 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FC+    LQLFGRPQW+TV+ RS  YVNK+REELE RGC IR GCEVHSV +
Sbjct  152   FSAFSILSFCQNHHLLQLFGRPQWMTVRWRSRQYVNKIREELENRGCIIRTGCEVHSVLS  211

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
             D++G      ++ G +  QE++ GCI+A HAPD L++LG Q T+DELR+LGAFQYVYSDI
Sbjct  212   DDEG----CTVLCG-DESQESFQGCILAIHAPDALRLLGSQVTYDELRVLGAFQYVYSDI  266

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LH + +FMP+N AAWSAWNFLG+ + +VCLTYWLN LQNLG+T  P+LVTLNP  TP  
Sbjct  267   FLHHDTTFMPKNPAAWSAWNFLGSTDKKVCLTYWLNVLQNLGETSLPFLVTLNPDYTPRH  326

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              L KW TGHPVPS+AA++AS EL++IQGKR IWFCGAYQGYGFHEDGLKAGM AA+G+L 
Sbjct  327   TLFKWRTGHPVPSIAATKASLELDQIQGKRGIWFCGAYQGYGFHEDGLKAGMSAANGVLG  386

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  S L+NP  MVPS  ETGAR  VTRFL+ FI T  +ILLEEGGT+FTFEGT KK  LK
Sbjct  387   KSYSVLSNPKQMVPSLMETGARSFVTRFLSHFISTSCVILLEEGGTMFTFEGTSKKCNLK  446

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++RVH P FYWKV T+ADLGLADAYI+GD +FVDK +GLLNL  I +ANRDL +S S+ 
Sbjct  447   TVIRVHYPHFYWKVMTEADLGLADAYINGDFTFVDKNDGLLNLIMILIANRDLISSNSKL  506

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + KR        ++ + SAKYF +H+ RQNTLTQARRNISRHYDLSN+L++LFLDETMTY
Sbjct  507   SKKR-----YTVSAGLTSAKYFFKHVLRQNTLTQARRNISRHYDLSNDLYALFLDETMTY  561

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFKSE+E LK AQ RKISLLI+KA+I   H ILEIGCGWGSLAIE V+RTGCKYTGI
Sbjct  562   SCAVFKSENEALKDAQQRKISLLIEKARIDGNHEILEIGCGWGSLAIEVVKRTGCKYTGI  621

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS++QLK+AE +V+EAGLQDNI F LCDYRQLP   +YDRIISCEM+EAVGHE+M+EFF
Sbjct  622   TLSKEQLKFAEMRVKEAGLQDNITFQLCDYRQLPSTYKYDRIISCEMIEAVGHEYMDEFF  681

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CESVLAE+G+ VLQFISIP+ERY+ YR+SSDFIKEYIFPGGCLPS +R+TSAM+A+SR
Sbjct  682   GCCESVLAEDGLFVLQFISIPEERYNGYRRSSDFIKEYIFPGGCLPSFTRITSAMSATSR  741

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH+E+IG+HYYQTLR WR NFLE QS+I+ LGF+ KFIRTWEYYFDYCAAGF + TL
Sbjct  742   LCVEHVENIGLHYYQTLRYWRRNFLENQSKIMSLGFNDKFIRTWEYYFDYCAAGFKSNTL  801

Query  2945  GDYQIVFSRPGNVTAFGDPYK  3007
             G+YQ+VFSRPGNV A G+PYK
Sbjct  802   GNYQVVFSRPGNVAALGNPYK  822


 Score =   249 bits (637),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 145/207 (70%), Gaps = 32/207 (15%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M++AV+G GISGL+SAYVL K G  VV                                T
Sbjct  1     MKIAVIGGGISGLISAYVLVKAGVNVV--------------------------------T  28

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFE LGVDME SDMSFSVSL++G+G EWGSRNG S LF QK+NL N YFWQMIR
Sbjct  29    YPNMMELFERLGVDMEPSDMSFSVSLNHGNGIEWGSRNGISSLFVQKRNLFNLYFWQMIR  88

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFKNDV+ YL+  ++NPD DRN+TLG+F+ SRGYSELF KAY++P+C  IWS  +E 
Sbjct  89    EIIKFKNDVICYLKVLESNPDFDRNETLGQFVDSRGYSELFLKAYLVPICGLIWSSPTER  148

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             +M FSA+SILSFC+NHHLLQ F    W
Sbjct  149   IMEFSAFSILSFCQNHHLLQLFGRPQW  175



>ref|XP_010529627.1| PREDICTED: uncharacterized protein LOC104806424 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010529635.1| PREDICTED: uncharacterized protein LOC104806424 isoform X2 [Tarenaya 
hassleriana]
Length=873

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/693 (68%), Positives = 556/693 (80%), Gaps = 7/693 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCR--ISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR   + QLFGRPQWLTV  RSHSYV KVR ELE+RG  IR  C
Sbjct  177   PSDRVLTFPAFSVLSFCRNHQAFQLFGRPQWLTVAGRSHSYVAKVRTELERRGGRIRTSC  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             +V  VST + G     V +   +  +EA+D CI+A HAPD L+++G+QATFDE RILGAF
Sbjct  237   DVQLVSTSDNG-----VTVRNGDGSEEAFDRCILATHAPDALRLVGEQATFDERRILGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYV SDIYLHR++ FMPRN  AW AWNFLG+  N+VCLTYWLN +QNLG+  + + VTLN
Sbjct  292   QYVDSDIYLHRDKDFMPRNPTAWGAWNFLGSTENKVCLTYWLNLIQNLGENSELFFVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TP++ LLKWTT HP PSV+A  AS EL +IQGKR +WFCGAYQGYGFHEDGLKAG+ 
Sbjct  352   PDHTPKKTLLKWTTSHPFPSVSAWTASQELYKIQGKRGLWFCGAYQGYGFHEDGLKAGIA  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA G+L K  + L+NP  MVPS+ ETGARL VTRF+  FI TG +ILLE+GGTVF F G 
Sbjct  412   AAQGMLGKDAALLSNPKQMVPSFSETGARLFVTRFMGQFISTGCVILLEDGGTVFKFGGK  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
               K  LK +V++HSP+FYWKV T+ADLG +DAYI+GD+SFVDK  GLLN+  I +ANRDL
Sbjct  472   HPKCSLKSVVKIHSPKFYWKVMTEADLGFSDAYINGDLSFVDKDNGLLNMIMILIANRDL  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S S    KRGWWTP+ FT+ ++SAKYF++H+SR NTLTQARRNIS HYDLSNE F++F
Sbjct  532   NSSKSNIPKKRGWWTPMFFTAGLSSAKYFLKHVSRMNTLTQARRNISHHYDLSNEFFAMF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYS A+FKS++EDL+TAQMRKI LLIDKA+I K H +LEIG GWG+ AIE V +T
Sbjct  592   LDETMTYSSAIFKSDNEDLRTAQMRKIYLLIDKARIGKNHEVLEIGFGWGTFAIEVVRQT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS +QLKYAE KV+EAGL+D I F LCDYRQL D+ +YDRIIS EMLE VGH
Sbjct  652   GCKYTGITLSVEQLKYAEAKVKEAGLEDRITFQLCDYRQLSDSRKYDRIISIEMLEEVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EF+  FF RCESVLAE+G+LVLQ ISIP+ERYDEYR SSDFIKEYIFPGGC+ SL+R+TS
Sbjct  712   EFIETFFNRCESVLAEDGLLVLQTISIPEERYDEYRLSSDFIKEYIFPGGCILSLARITS  771

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA+SSRLC+E +E+IGIHYY+TLRCWR N LERQ +I+DLGFD+KFIRTWEYYFDY AA
Sbjct  772   AMASSSRLCIEQVENIGIHYYRTLRCWRQNLLERQKRIVDLGFDEKFIRTWEYYFDYSAA  831

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             GF T TLGDYQ+VFSRPGN   FGDPY+G  SA
Sbjct  832   GFKTLTLGDYQMVFSRPGNAALFGDPYRGFPSA  864


 Score =   308 bits (788),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 170/207 (82%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG GISGL SAYVLA+ G  VV+YE+++ LGGHAKTV  DG D+DLGFM+FNRVT
Sbjct  1     MRVAVVGGGISGLGSAYVLAREGVEVVLYERDENLGGHAKTVRFDGADVDLGFMIFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMMELFE LGVDME+SDMSFSVSL+NG G EWGSRNGFS LFAQK N+ N +FWQMIR
Sbjct  61    YPNMMELFEDLGVDMEVSDMSFSVSLENGGGLEWGSRNGFSSLFAQKSNVFNTHFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KF +DV  Y++  ++NP++DR +TLG+F+ S GYSELF+KAY++P+C SIWSC S+ 
Sbjct  121   EIVKFPDDVSRYIDPLESNPNLDRTETLGQFLNSHGYSELFRKAYLVPICGSIWSCPSDR  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             V+ F A+S+LSFCRNH   Q F    W
Sbjct  181   VLTFPAFSVLSFCRNHQAFQLFGRPQW  207



>ref|XP_006489661.1| PREDICTED: uncharacterized protein LOC102611924 [Citrus sinensis]
Length=864

 Score =   979 bits (2531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/684 (70%), Positives = 568/684 (83%), Gaps = 7/684 (1%)
 Frame = +2

Query  977   SVATTTFCRI--SLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDE  1150
             + +  +FCR   +LQ+FGRPQWLTV+ RS SYV+KV E LE  GC+I+ GCEV SV    
Sbjct  186   AFSVLSFCRNHHALQIFGRPQWLTVRSRSRSYVDKVIELLESLGCQIKTGCEVRSVLQYG  245

Query  1151  QGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYL  1330
             +G     + I G +  Q  YDGCIMA HAPD L+MLG QATF+E R+LGAFQYVYSDI+L
Sbjct  246   EGR----IEIRGDDF-QRVYDGCIMAVHAPDALRMLGNQATFEEKRVLGAFQYVYSDIFL  300

Query  1331  HREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCL  1510
             HR+++FMPRN AAWSAWNFLG+ + +VCLTYWLN +QN+ +T+ P+LVTLNP  TPE  L
Sbjct  301   HRDKNFMPRNPAAWSAWNFLGSTDGKVCLTYWLNVVQNIEETRLPFLVTLNPDHTPEHTL  360

Query  1511  LKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKR  1690
              KW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGMIAAHG+L K 
Sbjct  361   FKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMIAAHGMLGKS  420

Query  1691  CSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVL  1870
             C+ L NP HM PS  E GAR+ V RFL  FI TG +I LEEGGT+FTFEG  K   LK +
Sbjct  421   CAILANPKHMEPSLMEKGARIFVARFLRQFISTGCLIFLEEGGTIFTFEGAQKNCPLKTV  480

Query  1871  VRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNS  2050
             +R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK EGLLNLF I +AN+DL +S S+   
Sbjct  481   LRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKDEGLLNLFLIVLANQDLDSSTSKLKQ  540

Query  2051  KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSC  2230
             KRGWW+P+ FT++IASAKYF RHISR+NTLTQARRNISRHYDLSNELFSLFLD++M YSC
Sbjct  541   KRGWWSPMFFTASIASAKYFFRHISRKNTLTQARRNISRHYDLSNELFSLFLDKSMLYSC  600

Query  2231  AVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITL  2410
             A+FKSE EDL+ AQMRK+SLLI KA++SK H +LEIGCGWG+LAIE V++TGCKYTGITL
Sbjct  601   AIFKSEHEDLEVAQMRKVSLLIQKARVSKGHEVLEIGCGWGTLAIEIVKQTGCKYTGITL  660

Query  2411  SEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGR  2590
             SE+QLKYAE KV+EAGLQD+IR  LCDYRQLP + +YDRIISCEM+EAVGH++M EFFG 
Sbjct  661   SEEQLKYAEMKVKEAGLQDHIRLYLCDYRQLPKSNKYDRIISCEMIEAVGHDYMEEFFGC  720

Query  2591  CESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC  2770
             CES+LAE+G+L+LQFIS+PD+ YDE+R S  FIKEYIFPGGCLPSL+R+TSAM +SSRLC
Sbjct  721   CESLLAEHGLLLLQFISVPDQCYDEHRLSPGFIKEYIFPGGCLPSLNRITSAMTSSSRLC  780

Query  2771  VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGD  2950
             VE LE+IGIHY+QTLRCWR NFLE+QS+I  LGF +KFIRTWEYYFDYCAAGF + TLGD
Sbjct  781   VEDLENIGIHYFQTLRCWRKNFLEKQSKIRALGFSEKFIRTWEYYFDYCAAGFKSRTLGD  840

Query  2951  YQIVFSRPGNVTAFGDPYKGLASA  3022
             YQIVFSRP NV AF + ++   SA
Sbjct  841   YQIVFSRPSNVAAFRNQHESFPSA  864


 Score =   348 bits (894),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+G GISGLVSAYVLAK G  VV+YEKED LGGHAKTVT+DGVDLDL FMVFNRVT
Sbjct  1     MRAAVIGGGISGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDLCFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD G G EW SRNG SGLFAQKKNLLNPYFWQM+R
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDKGQGCEWSSRNGMSGLFAQKKNLLNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KF +DVLSYLE+ +NN D+DRN+TLG+F++SRGYSELFQKAY++P+C SIWSCSSE 
Sbjct  121   EIIKFNDDVLSYLEDLENNADIDRNETLGQFVESRGYSELFQKAYLVPVCGSIWSCSSEK  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM+ SA+S+LSFCRNHH LQ F    W
Sbjct  181   VMSCSAFSVLSFCRNHHALQIFGRPQW  207



>ref|XP_006489662.1| PREDICTED: uncharacterized protein LOC102612222 isoform X1 [Citrus 
sinensis]
Length=871

 Score =   978 bits (2528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/694 (68%), Positives = 562/694 (81%), Gaps = 7/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    L+LFG PQWLT + RSHSYVNKV  +L+  GC+IR  C
Sbjct  181   PSERAMSFSAFSVLSFCRNHHLLELFGHPQWLTFRNRSHSYVNKVTGQLQSWGCQIRTSC  240

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+SV   ++G    VV   G    QE Y  C+MA HAPD L++LG QAT DE RILGAF
Sbjct  241   EVYSVYPADEGCT--VVSSDGS---QENYSCCVMAVHAPDALRILGNQATLDETRILGAF  295

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             +YVYSDI+LHR+ +FMP+N AAWSAWNFLG+ + ++CLTYWLN LQN+G+T  P+L TLN
Sbjct  296   RYVYSDIFLHRDTNFMPQNTAAWSAWNFLGSTDGKICLTYWLNVLQNIGETGVPFLATLN  355

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TPE   LKW+T + VPSVAAS+AS  ++ IQGKR IWFCGAYQGYGF EDGLKAGMI
Sbjct  356   PDHTPENTSLKWSTSYQVPSVAASKASLAVDLIQGKRGIWFCGAYQGYGFQEDGLKAGMI  415

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
              AHG+L K C+ L+NP HMVPS  E GARL V RFL  +I TG +ILLEEGGT+FTFEGT
Sbjct  416   TAHGVLGKNCAVLSNPKHMVPSLLEKGARLFVARFLRRYISTGCLILLEEGGTIFTFEGT  475

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              + + LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK EGLLNLF I +AN+D 
Sbjct  476   LRNSPLKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKDEGLLNLFLIVIANQDF  535

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              +S S+   KRGWW+P+ FT++IASAKYF R+ISR+N+LTQARRN+SRHYDL+NELFSLF
Sbjct  536   DSSTSKLKKKRGWWSPMFFTASIASAKYFFRNISRKNSLTQARRNVSRHYDLNNELFSLF  595

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD++MTYSCA+FKSE EDL+  QMRK+S+LI+KA++SK   +L+IGCGWG+LAIE V++T
Sbjct  596   LDKSMTYSCAIFKSEHEDLEVGQMRKVSVLIEKARVSKGQEVLDIGCGWGTLAIEIVKQT  655

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYAE KVREAGLQD+IRF LCDYRQLP   +YDRIISC M+E VGH
Sbjct  656   GCKYTGITLSEEQLKYAEIKVREAGLQDHIRFYLCDYRQLPKANKYDRIISCGMIEHVGH  715

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             ++M EFFG CES+LA +G+LVLQFIS PD+ YDEYR S  FIKEYIFPGGCLPSL RVTS
Sbjct  716   DYMEEFFGCCESLLATHGLLVLQFISAPDQCYDEYRLSPGFIKEYIFPGGCLPSLGRVTS  775

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL LGF++KFIRTWEYYFDYCAA
Sbjct  776   AMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEILALGFNEKFIRTWEYYFDYCAA  835

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
              F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  836   SFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  869


 Score =   325 bits (832),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KM+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  
Sbjct  4     KMQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHA  63

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             T PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKNLLNPYFWQM+
Sbjct  64    TSPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNLLNPYFWQML  123

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
              EI +FK+D L Y+EE +NNPD++RN+TLG+F+K RGYSELFQK+Y+IP+C S+WSC SE
Sbjct  124   WEINQFKDDALRYIEELENNPDINRNETLGQFLKLRGYSELFQKSYLIPLCDSVWSCPSE  183

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
               M+FSA+S+LSFCRNHHLL+ F    W
Sbjct  184   RAMSFSAFSVLSFCRNHHLLELFGHPQW  211



>emb|CDX85109.1| BnaC07g07970D [Brassica napus]
Length=868

 Score =   976 bits (2523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 467/687 (68%), Positives = 549/687 (80%), Gaps = 8/687 (1%)
 Frame = +2

Query  971   FHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FC     LQ+FGRPQWL+V  RS +YV KVR ELE+ GC+IR  C++ SV T
Sbjct  185   FSAYSVLSFCCNHHLLQIFGRPQWLSVAGRSQTYVAKVRAELERLGCKIRTSCDIKSVLT  244

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G     V ++  +  +E +D CI+A HAPD L++LG+Q TFDE R+LGAF+YVYSDI
Sbjct  245   SDDGR----VTVTSGDGSEEVFDKCILAMHAPDALRLLGEQVTFDETRVLGAFRYVYSDI  300

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+ ++P+ VTLNP +TP++
Sbjct  301   YLHHDTDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGEDREPFFVTLNPDQTPKK  360

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKWTTGHPVPSVAA  AS EL +IQGKR IWFCGAYQ         +AGM AA GLL 
Sbjct  361   TLLKWTTGHPVPSVAALTASQELHKIQGKRNIWFCGAYQVLLIFV--FQAGMAAARGLLG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  + L+NP HMVPS  ETGARL VTRFL  FI TG + +LEEGGT+F  +G D    LK
Sbjct  419   KEAALLDNPRHMVPSLTETGARLFVTRFLGQFISTGCVTILEEGGTMFNLKGKDPTCPLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++++HSPQFYWKV TQADLGLADAYI+GD SFVD+  GLLN   I +ANRDLS+  S  
Sbjct  479   SVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDRDSGLLNFMMILIANRDLSSPKSNL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF LFLD+TMTY
Sbjct  539   AKKRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGLFLDDTMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S AVFKS+DE L+ AQMRKISLLIDKA++ K H +LEIGCGWG+LAIE V RTGC+YTGI
Sbjct  599   SSAVFKSDDEILRAAQMRKISLLIDKARVEKHHEVLEIGCGWGTLAIEVVRRTGCRYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS +QLKYAEDKV+EAGL+D I F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF
Sbjct  659   TLSIEQLKYAEDKVKEAGLEDRITFKLCDYRQLSDAHKYDRIISCEMLEAVGHEFMEMFF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
              RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSR
Sbjct  719   SRCEAALAENGLMVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSR  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EH+E+IGIHYYQTLR WR NFL+RQ  I+ LGFD KFIRTWEYYFDYCAAGF T TL
Sbjct  779   LCIEHVENIGIHYYQTLRMWRKNFLDRQKPIMALGFDDKFIRTWEYYFDYCAAGFKTLTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQ+VFSRPGNV AF D YKG  SAY
Sbjct  839   GNYQVVFSRPGNVAAFADSYKGFPSAY  865


 Score =   335 bits (860),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   +V+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLATQGVEELVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGVDMEISDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVDMEISDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y+EE + NPD+DR++TLGEF+ +RGYSE+FQKAY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLRYIEELEANPDIDRSETLGEFLNARGYSEMFQKAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV++FSAYS+LSFC NHHLLQ F    W
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQW  208



>ref|XP_004147184.1| PREDICTED: uncharacterized protein LOC101213850 [Cucumis sativus]
Length=1611

 Score =   969 bits (2506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/694 (68%), Positives = 557/694 (80%), Gaps = 34/694 (5%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTVK RSHSYV KV+E LE  GC+IR   
Sbjct  950   PSEGVLSFSAFSVLSFCRNHHLLQLFGRPQWLTVKGRSHSYVKKVQEVLESHGCQIRTSS  1009

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+S+ST ++G       +S  + +QE +D CI+A HAPDTL++LG +AT DELR+LGAF
Sbjct  1010  EVNSISTMDKGCK-----VSYGDGLQEMFDACIIATHAPDTLRILGNEATSDELRVLGAF  1064

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY YSDI+LHR+++ MP+N AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLN
Sbjct  1065  QYAYSDIFLHRDKNLMPQNPAAWSAWNFLGNTDKKVCLTYWLNVLQNLGETGPPFLVTLN  1124

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P + P+  LLKW+TGHP+PSVAAS+AS+E   IQG RRIWFCGAYQGYGFHEDGLKAG++
Sbjct  1125  PDKEPKNILLKWSTGHPIPSVAASKASNEFHSIQGNRRIWFCGAYQGYGFHEDGLKAGIV  1184

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA  LL    + L+NP HM PS  +TGARL VTRFL  +I +GS+ L+EEGGT+FTFEGT
Sbjct  1185  AAQNLLGNSLTLLSNPKHMAPSLVDTGARLFVTRFLGQYITSGSLTLIEEGGTIFTFEGT  1244

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             DKK L KV+V+VHSPQFYWK+ T+ADLGLADAYI+GD SFVDK EGLLN F I +A+RD 
Sbjct  1245  DKKCLPKVVVKVHSPQFYWKIMTRADLGLADAYINGDFSFVDKDEGLLNFFLIIIASRDT  1304

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S+++   KRGWWTP LFT+ IASAKYF +H SRQNTLTQARRNISRHYDLSNELFSLF
Sbjct  1305  NSSIAKQKKKRGWWTPPLFTACIASAKYFFQHASRQNTLTQARRNISRHYDLSNELFSLF  1364

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD+TMTYSCA+FK E+EDLK AQMRKISLLI+KA+I+K HH+LEIGCGWGSLAIE V++T
Sbjct  1365  LDDTMTYSCAIFKGENEDLKVAQMRKISLLIEKARINKNHHVLEIGCGWGSLAIEIVKKT  1424

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GC YTGITLSE+QLKYAE +V++A LQD IRFLLCDYR+LP   +YDRIISCEM+EAVGH
Sbjct  1425  GCHYTGITLSEEQLKYAEKRVKDANLQDRIRFLLCDYRKLPSTEKYDRIISCEMIEAVGH  1484

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM +FFG CESVLAENG+ VLQFISIPDERY+EYR SSDFIKEYIFPGGCLP LSR+T+
Sbjct  1485  EFMEDFFGSCESVLAENGLFVLQFISIPDERYNEYRLSSDFIKEYIFPGGCLPCLSRLTT  1544

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA +SRLC                           +IL LGFD+ FIRTWEYYFDYCAA
Sbjct  1545  AMANASRLC---------------------------KILQLGFDESFIRTWEYYFDYCAA  1577

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF + TLG+YQIV+SRPGNV AF +PY+G+ SAY
Sbjct  1578  GFKSHTLGNYQIVYSRPGNVAAFTNPYQGIPSAY  1611


 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/574 (68%), Positives = 457/574 (80%), Gaps = 25/574 (4%)
 Frame = +2

Query  1316  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1495
             SDI+LHR++S MP+N AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLNP + 
Sbjct  238   SDIFLHRDKSLMPQNPAAWSAWNFLGNTDKKVCLTYWLNVLQNLGETGPPFLVTLNPDKE  297

Query  1496  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1675
             P   LLKW+TGHP+PSVAAS+AS+EL  IQGKRRIWFCGAYQGYGFHEDGLK G+IAA  
Sbjct  298   PTNILLKWSTGHPIPSVAASKASNELHSIQGKRRIWFCGAYQGYGFHEDGLKGGIIAAQN  357

Query  1676  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1855
             +L  R + L+NP HMVPS  +TGARL VTRFL  FI +GS+ L+EEGGT+FTFEGTDKK 
Sbjct  358   MLGNRFTLLSNPKHMVPSLADTGARLFVTRFLRQFITSGSLTLMEEGGTIFTFEGTDKKC  417

Query  1856  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2035
             LLKV ++VH+PQFYWK+ T+AD+GLADAYI+GD SFVDK EGLLN F I VA R+ + S+
Sbjct  418   LLKVALKVHNPQFYWKITTRADIGLADAYINGDFSFVDKDEGLLNFFMIIVACRETNFSI  477

Query  2036  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2215
             ++   K GWWTP L TS IASAKYF  H SR+NTLTQARRNISRHYDL            
Sbjct  478   AKLKKKGGWWTPPLLTSCIASAKYFFHHTSRRNTLTQARRNISRHYDL------------  525

Query  2216  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2395
                      SE+EDLK AQMRK+SLLI KA+I+K HH+LEIGCGWGSLAIE V++TGC+Y
Sbjct  526   ---------SENEDLKVAQMRKMSLLIKKARINKSHHVLEIGCGWGSLAIEIVKQTGCRY  576

Query  2396  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2575
             TGITLSEQQLKYAE KV++A LQD I  LLCDYR +P   +YDRIISCEM+EAVGHEFM 
Sbjct  577   TGITLSEQQLKYAEKKVKDANLQDRINLLLCDYRNVPSTKKYDRIISCEMIEAVGHEFME  636

Query  2576  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2755
             +FFG CESVLAENGI V QF ++PD RYD YR SS+FIKEYIFPGGCLP LSRVT+AM  
Sbjct  637   DFFGSCESVLAENGIFVQQFTAMPDARYDAYRLSSEFIKEYIFPGGCLPCLSRVTTAMTK  696

Query  2756  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2935
             +SR C+EHLE+IGIHY+QTLR WR +FLE +S+IL LGFD+ FIRTWEYYFDYCAAGF +
Sbjct  697   ASRFCIEHLENIGIHYHQTLRYWRKDFLENKSKILQLGFDESFIRTWEYYFDYCAAGFKS  756

Query  2936  CTLGDYQIVFSRPGN----VTAFGDPYKGLASAY  3025
              TL +YQIV+SRPGN    V   G    GL SA+
Sbjct  757   RTLNNYQIVYSRPGNVAMKVAVVGGGISGLVSAF  790


 Score =   338 bits (867),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 181/209 (87%), Gaps = 0/209 (0%)
 Frame = +1

Query  397   LKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             + M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN 
Sbjct  772   VAMKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNT  831

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNMME FE+LGV+MEISDMSFSVSLD G G EWGSRNG S LF+QKKNLLNPYFWQM
Sbjct  832   VTYPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSRNGLSSLFSQKKNLLNPYFWQM  891

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IREI+KFK+DV +YLE  +NN D+DRN+TLG+FIKS GYSELFQ  Y+IPMC SIWSC S
Sbjct  892   IREIVKFKDDVTNYLEVLENNSDIDRNETLGQFIKSMGYSELFQNGYLIPMCGSIWSCPS  951

Query  937   EGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             EGV++FSA+S+LSFCRNHHLLQ F    W
Sbjct  952   EGVLSFSAFSVLSFCRNHHLLQLFGRPQW  980


 Score =   318 bits (816),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 177/223 (79%), Gaps = 23/223 (10%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFN---  573
             M+VAVVG GISGLVSAYVLAK G  VV+ EKEDY+GGH+KTV   G DLDLGFMVFN   
Sbjct  1     MKVAVVGGGISGLVSAYVLAKAGVEVVLLEKEDYVGGHSKTVHFHGFDLDLGFMVFNHVL  60

Query  574   --------------------RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  693
                                 +VTYPNMME FE+LGV+MEISDMSFSVSLD G G EWGSR
Sbjct  61    PLHFHLSLSLYDYEYSFGFEQVTYPNMMEFFENLGVEMEISDMSFSVSLDRGRGCEWGSR  120

Query  694   NGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGY  873
             NG S LF+QKKNLLNPYFWQMIREI+KFK+DV++YLE  +NN D+DRN+TLG+FI S GY
Sbjct  121   NGLSSLFSQKKNLLNPYFWQMIREIVKFKDDVINYLEVLENNSDVDRNETLGQFINSNGY  180

Query  874   SELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQ  1002
             SELFQ AY++PMC SIWSCSSE V++FSA+S+LSFCRNHHLLQ
Sbjct  181   SELFQNAYLVPMCGSIWSCSSEKVLSFSAFSVLSFCRNHHLLQ  223



>ref|XP_008796355.1| PREDICTED: uncharacterized protein LOC103711840 isoform X2 [Phoenix 
dactylifera]
Length=864

 Score =   968 bits (2502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/693 (68%), Positives = 564/693 (81%), Gaps = 8/693 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +   FCR    LQLFGRPQWLTVK+RSH YV KVR ELE R C+IR GC
Sbjct  177   PSEGVMSFSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHCYVRKVRGELESRCCQIRTGC  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
              V SV   + G       + G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+
Sbjct  237   AVKSVLNIDGGCH-----VVGEDQSEETYDGCIISTHAPDALKILGTQATYEESRLLGAY  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLN
Sbjct  292   QYVYSDIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNLPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   P+  LLKW+T HP+PSVAAS+AS E+ +IQGKRRIWFCGAYQG+GFHEDGLKAG++
Sbjct  352   PRFVPKHTLLKWSTSHPIPSVAASKASLEIGKIQGKRRIWFCGAYQGFGFHEDGLKAGIV  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA+ +L   C  L NP  MVPS  ETGARL+VTRFL  +I TG + LLEEGGT+F FEGT
Sbjct  412   AANSVLGMDCVLLRNPRQMVPSLVETGARLIVTRFLEKYISTGCLTLLEEGGTIFVFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             +KK+ +K ++++H P FYWKVAT+ADLGLADAYI+   SFVD++EGLLNLF I + NRD 
Sbjct  472   NKKSCIKSILKIHDPLFYWKVATEADLGLADAYINRYFSFVDEQEGLLNLFMILIVNRDQ  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S S+S + RGWWTP+LFT+ + SA+YF+RHISRQNT+ QA +NIS HYDLSNE FSLF
Sbjct  532   NSS-SKSKTTRGWWTPILFTAGLQSARYFLRHISRQNTVAQAPKNISHHYDLSNEFFSLF  590

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYS A+FK E+EDLK AQ+ KISLLI+KA+I  +H ILEIGCGWGSLAIE V++T
Sbjct  591   LDETMTYSGAIFKMENEDLKVAQLHKISLLIEKARIEAKHEILEIGCGWGSLAIEVVKQT  650

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLK+A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGH
Sbjct  651   GCKYTGITLSEEQLKFAKRRAKEACLEDRITFLLCDYRQLPCYRKYDRIISCEMIEGVGH  710

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TS
Sbjct  711   EYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITS  770

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAA
Sbjct  771   AMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAA  830

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             GF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  831   GFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  863


 Score =   343 bits (879),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 184/216 (85%), Gaps = 2/216 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGL SAYVLAK G  VV+YEKED LGGHAKTV  DGV+LDLGFMVFN VT
Sbjct  1     MRVAVVGAGISGLASAYVLAKAGVDVVLYEKEDCLGGHAKTVNFDGVNLDLGFMVFNGVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSF+VSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61    YPNMMEFFESLGVDMEISDMSFAVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV+ YLE+++NNPD+DRN+TLG FIKS GYS+LFQKAY++P+CA IWSC SEG
Sbjct  121   EIVKFKHDVIRYLEKYENNPDLDRNETLGHFIKSHGYSQLFQKAYLVPICACIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW--SPTMAHC  1044
             VM+FSA+S+L+FCRNHHLLQ F    W      +HC
Sbjct  181   VMSFSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHC  216



>ref|XP_008796358.1| PREDICTED: uncharacterized protein LOC103711840 isoform X5 [Phoenix 
dactylifera]
Length=683

 Score =   967 bits (2501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/686 (68%), Positives = 564/686 (82%), Gaps = 8/686 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +   FCR    LQLFGRPQWLTVK+RSH YV KVR ELE R C+IR GC V SV  
Sbjct  3     FSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHCYVRKVRGELESRCCQIRTGCAVKSVLN  62

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              +    GG  ++ G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+QYVYSDI
Sbjct  63    ID----GGCHVV-GEDQSEETYDGCIISTHAPDALKILGTQATYEESRLLGAYQYVYSDI  117

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP   P+ 
Sbjct  118   YLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNLPFLVTLNPRFVPKH  177

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+T HP+PSVAAS+AS E+ +IQGKRRIWFCGAYQG+GFHEDGLKAG++AA+ +L 
Sbjct  178   TLLKWSTSHPIPSVAASKASLEIGKIQGKRRIWFCGAYQGFGFHEDGLKAGIVAANSVLG  237

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
               C  L NP  MVPS  ETGARL+VTRFL  +I TG + LLEEGGT+F FEGT+KK+ +K
Sbjct  238   MDCVLLRNPRQMVPSLVETGARLIVTRFLEKYISTGCLTLLEEGGTIFVFEGTNKKSCIK  297

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++++H P FYWKVAT+ADLGLADAYI+   SFVD++EGLLNLF I + NRD ++S S+S
Sbjct  298   SILKIHDPLFYWKVATEADLGLADAYINRYFSFVDEQEGLLNLFMILIVNRDQNSS-SKS  356

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
              + RGWWTP+LFT+ + SA+YF+RHISRQNT+ QA +NIS HYDLSNE FSLFLDETMTY
Sbjct  357   KTTRGWWTPILFTAGLQSARYFLRHISRQNTVAQAPKNISHHYDLSNEFFSLFLDETMTY  416

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S A+FK E+EDLK AQ+ KISLLI+KA+I  +H ILEIGCGWGSLAIE V++TGCKYTGI
Sbjct  417   SGAIFKMENEDLKVAQLHKISLLIEKARIEAKHEILEIGCGWGSLAIEVVKQTGCKYTGI  476

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLK+A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGHE+M EFF
Sbjct  477   TLSEEQLKFAKRRAKEACLEDRITFLLCDYRQLPCYRKYDRIISCEMIEGVGHEYMEEFF  536

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR
Sbjct  537   GCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAAASR  596

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
              CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF + TL
Sbjct  597   FCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRTL  656

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASA  3022
             G+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  657   GNYQMVFSRPGNSTAFSNPYDGVPSA  682



>emb|CDX77504.1| BnaA07g06420D [Brassica napus]
Length=861

 Score =   967 bits (2499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/687 (68%), Positives = 546/687 (79%), Gaps = 15/687 (2%)
 Frame = +2

Query  971   FHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FC     LQ+FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C++ SV T
Sbjct  185   FSAYSVLSFCCNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDIKSVLT  244

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G     V ++  +  +E +D CI+A HAPD L++LG+Q TFDE R+LGAF+YVYSDI
Sbjct  245   SDDGR----VTVTSGDGSEEVFDKCILAMHAPDALRLLGEQVTFDETRVLGAFRYVYSDI  300

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLGD ++P+ VTLNP +TP++
Sbjct  301   YLHHDTDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGDDREPFFVTLNPDQTPKK  360

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKWTTGHPVPSVAA  AS EL +IQGKR I  C     +       +AGM AA GLL 
Sbjct  361   TLLKWTTGHPVPSVAAFTASQELHKIQGKRNI--CSVDMCF-------QAGMAAARGLLG  411

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  + LNNP HMVPS  ETGARL VTRFL  FI TG + +LEEGGT+F FEG D    LK
Sbjct  412   KEAALLNNPRHMVPSLTETGARLFVTRFLGQFISTGCVTILEEGGTMFNFEGKDPTCPLK  471

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++++HSPQFYWKV TQADLGLADAYI+GD SFVD+  GLLN   I +ANRDL++  S  
Sbjct  472   SVLKIHSPQFYWKVMTQADLGLADAYINGDFSFVDRDSGLLNFMMILIANRDLASPKSNL  531

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF LFLD+TMTY
Sbjct  532   AKKRGWWTPMFLTAGVASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGLFLDDTMTY  591

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S AVFKS+DEDLK AQMRKISLLIDKA++ K H +LEIGCGWG+LAIE V RTGC+YTGI
Sbjct  592   SSAVFKSDDEDLKAAQMRKISLLIDKARVEKHHEVLEIGCGWGTLAIEVVRRTGCRYTGI  651

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS +QLKYAE+KV+EAGL+D I F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF
Sbjct  652   TLSIEQLKYAEEKVKEAGLEDRITFKLCDYRQLSDAHKYDRIISCEMLEAVGHEFMEMFF  711

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
              RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFPGGCLPSL+RVTSAM++SSR
Sbjct  712   SRCEAALAENGLMVLQFISIPEERYNEYRLSSDFIKEYIFPGGCLPSLARVTSAMSSSSR  771

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EH+E+IGIHYYQTLR WR NFL+RQ  I+ LGFD KFIRTWEYYFDYCAAGF T TL
Sbjct  772   LCIEHVENIGIHYYQTLRMWRKNFLDRQKPIMALGFDDKFIRTWEYYFDYCAAGFKTLTL  831

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             G+YQ+VFSRPGNV AF D YKG  SAY
Sbjct  832   GNYQVVFSRPGNVAAFADSYKGFPSAY  858


 Score =   334 bits (857),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             M+VAV+G+GISGL SAYVLA  G   +V+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1     MKVAVIGSGISGLGSAYVLATQGVEELVLYEKEESLGGHAKTVRCDGVDLDLGFMVFNRV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMME FE+LGVDMEISDMSF+VSLDNG G EWGSRNG SGLFAQKKN LNPYFWQMI
Sbjct  61    TYPNMMEFFENLGVDMEISDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNALNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK DVL Y+EE + NPD+DR++TLGEF+  RGYSE+FQKAY++P+C SIWSC S+
Sbjct  121   REIVKFKEDVLRYIEELEANPDIDRSETLGEFLNGRGYSEMFQKAYLVPICGSIWSCPSD  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             GV++FSAYS+LSFC NHHLLQ F    W
Sbjct  181   GVLSFSAYSVLSFCCNHHLLQIFGRPQW  208



>ref|XP_006420314.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
 gb|ESR33554.1| hypothetical protein CICLE_v10007034mg [Citrus clementina]
Length=810

 Score =   966 bits (2497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/693 (69%), Positives = 566/693 (82%), Gaps = 16/693 (2%)
 Frame = +2

Query  977   SVATTTFCRI--SLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDE  1150
             + +  +FCR   +LQ+FGRPQWLTV+ RS SY++KV E LE  GC+I+ GCEV SV    
Sbjct  123   AFSVLSFCRNHHALQIFGRPQWLTVRSRSRSYIDKVIELLESWGCQIKTGCEVRSVLQYG  182

Query  1151  QGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYL  1330
             +G     + I G +  Q  YDGCIMA HAPD L+MLG QATF+E R+LGAFQYVYSDI+L
Sbjct  183   EGR----IEIRGDDF-QRVYDGCIMAVHAPDALRMLGNQATFEEKRVLGAFQYVYSDIFL  237

Query  1331  HREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCL  1510
             HR+++F+PRN AAWSAWNFLG+   +VCLTYWLN +QN+ +T+ P+LVTLNP  TPE  L
Sbjct  238   HRDKNFLPRNPAAWSAWNFLGSTGGKVCLTYWLNVVQNIEETRLPFLVTLNPDHTPEHTL  297

Query  1511  LKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLK---------AGMI  1663
              KW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLK         AGMI
Sbjct  298   FKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKVPCNSAPLQAGMI  357

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHG+L K C+ L NP HM PS  E GAR+ V RFL  FI TG +I LEEGGT+FTFEG 
Sbjct  358   AAHGMLGKSCAILANPKHMEPSLMEKGARIFVARFLRQFISTGCLIFLEEGGTIFTFEGA  417

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K   LK ++R+H+PQFY KV T+ADLGLAD+YI+GD SFVDK EGLLNLF I +AN+DL
Sbjct  418   QKNCPLKTVLRIHNPQFYRKVMTEADLGLADSYINGDFSFVDKDEGLLNLFLIVLANQDL  477

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              +S S+   KRGWW+P+ FT++IASAKYF RHISR+NTLTQARRNISRHYDLSNELFSLF
Sbjct  478   DSSTSKLKQKRGWWSPMFFTASIASAKYFFRHISRKNTLTQARRNISRHYDLSNELFSLF  537

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD++M YSCA+FKSE EDL+ AQMRK+SLLI KA++SK H +LEIGCGWG+LAIE V++T
Sbjct  538   LDKSMLYSCAIFKSEHEDLEVAQMRKVSLLIQKARVSKGHEVLEIGCGWGTLAIEIVKQT  597

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYAE KV+EAGLQD+IR  LCDYRQLP   +YDRIISCEM+EAVGH
Sbjct  598   GCKYTGITLSEEQLKYAEMKVKEAGLQDHIRLYLCDYRQLPKANKYDRIISCEMIEAVGH  657

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             ++M EFFG CES+LAE+G+L+LQFIS+PD+ YDE+R S  FIKEYIFPGGCLPSL+R+TS
Sbjct  658   DYMEEFFGCCESLLAEHGLLLLQFISVPDQCYDEHRLSPGFIKEYIFPGGCLPSLNRITS  717

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM +SSRLCVE LE+IGIHYYQTLRCWR NFLE+QS+IL LGF +KFIRTWEYYFDYCAA
Sbjct  718   AMTSSSRLCVEDLENIGIHYYQTLRCWRKNFLEKQSKILALGFSEKFIRTWEYYFDYCAA  777

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             GF + TLGDYQIVFSRP NV AF + ++   SA
Sbjct  778   GFKSRTLGDYQIVFSRPSNVAAFRNQHESFPSA  810


 Score =   237 bits (604),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FESLGVDMEISDMSFSVSLD G G EW SRNG SGLFAQKKNLLN YFWQM+REI+
Sbjct  1     MMEFFESLGVDMEISDMSFSVSLDKGQGCEWSSRNGMSGLFAQKKNLLNLYFWQMLREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KF +DVLSYLE+ +NN D+DRN+TLG+F++SRGYSELFQKAY++P+C SIWSCSSE VM+
Sbjct  61    KFNDDVLSYLEDLENNADIDRNETLGQFVESRGYSELFQKAYLVPVCGSIWSCSSEKVMS  120

Query  952   FSAYSILSFCRNHHLLQNFSPALW  1023
              SA+S+LSFCRNHH LQ F    W
Sbjct  121   CSAFSVLSFCRNHHALQIFGRPQW  144



>ref|XP_008796354.1| PREDICTED: uncharacterized protein LOC103711840 isoform X1 [Phoenix 
dactylifera]
Length=865

 Score =   963 bits (2490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/694 (68%), Positives = 564/694 (81%), Gaps = 9/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNK-VREELEKRGCEIRCG  1120
             PS     F + +   FCR    LQLFGRPQWLTVK+RSH YV K VR ELE R C+IR G
Sbjct  177   PSEGVMSFSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHCYVRKQVRGELESRCCQIRTG  236

Query  1121  CEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGA  1300
             C V SV   + G       + G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA
Sbjct  237   CAVKSVLNIDGGCH-----VVGEDQSEETYDGCIISTHAPDALKILGTQATYEESRLLGA  291

Query  1301  FQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTL  1480
             +QYVYSDIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTL
Sbjct  292   YQYVYSDIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNLPFLVTL  351

Query  1481  NPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGM  1660
             NP   P+  LLKW+T HP+PSVAAS+AS E+ +IQGKRRIWFCGAYQG+GFHEDGLKAG+
Sbjct  352   NPRFVPKHTLLKWSTSHPIPSVAASKASLEIGKIQGKRRIWFCGAYQGFGFHEDGLKAGI  411

Query  1661  IAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEG  1840
             +AA+ +L   C  L NP  MVPS  ETGARL+VTRFL  +I TG + LLEEGGT+F FEG
Sbjct  412   VAANSVLGMDCVLLRNPRQMVPSLVETGARLIVTRFLEKYISTGCLTLLEEGGTIFVFEG  471

Query  1841  TDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD  2020
             T+KK+ +K ++++H P FYWKVAT+ADLGLADAYI+   SFVD++EGLLNLF I + NRD
Sbjct  472   TNKKSCIKSILKIHDPLFYWKVATEADLGLADAYINRYFSFVDEQEGLLNLFMILIVNRD  531

Query  2021  LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSL  2200
              ++S S+S + RGWWTP+LFT+ + SA+YF+RHISRQNT+ QA +NIS HYDLSNE FSL
Sbjct  532   QNSS-SKSKTTRGWWTPILFTAGLQSARYFLRHISRQNTVAQAPKNISHHYDLSNEFFSL  590

Query  2201  FLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVER  2380
             FLDETMTYS A+FK E+EDLK AQ+ KISLLI+KA+I  +H ILEIGCGWGSLAIE V++
Sbjct  591   FLDETMTYSGAIFKMENEDLKVAQLHKISLLIEKARIEAKHEILEIGCGWGSLAIEVVKQ  650

Query  2381  TGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVG  2560
             TGCKYTGITLSE+QLK+A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VG
Sbjct  651   TGCKYTGITLSEEQLKFAKRRAKEACLEDRITFLLCDYRQLPCYRKYDRIISCEMIEGVG  710

Query  2561  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  2740
             HE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+T
Sbjct  711   HEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRIT  770

Query  2741  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  2920
             SAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCA
Sbjct  771   SAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCA  830

Query  2921  AGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             AGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  831   AGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  864


 Score =   343 bits (880),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 184/216 (85%), Gaps = 2/216 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGL SAYVLAK G  VV+YEKED LGGHAKTV  DGV+LDLGFMVFN VT
Sbjct  1     MRVAVVGAGISGLASAYVLAKAGVDVVLYEKEDCLGGHAKTVNFDGVNLDLGFMVFNGVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSF+VSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61    YPNMMEFFESLGVDMEISDMSFAVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV+ YLE+++NNPD+DRN+TLG FIKS GYS+LFQKAY++P+CA IWSC SEG
Sbjct  121   EIVKFKHDVIRYLEKYENNPDLDRNETLGHFIKSHGYSQLFQKAYLVPICACIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW--SPTMAHC  1044
             VM+FSA+S+L+FCRNHHLLQ F    W      +HC
Sbjct  181   VMSFSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHC  216



>ref|XP_008796357.1| PREDICTED: uncharacterized protein LOC103711840 isoform X4 [Phoenix 
dactylifera]
Length=684

 Score =   962 bits (2488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 468/687 (68%), Positives = 564/687 (82%), Gaps = 9/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNK-VREELEKRGCEIRCGCEVHSVS  1141
             F + +   FCR    LQLFGRPQWLTVK+RSH YV K VR ELE R C+IR GC V SV 
Sbjct  3     FSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHCYVRKQVRGELESRCCQIRTGCAVKSVL  62

Query  1142  TDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSD  1321
               +    GG  ++ G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+QYVYSD
Sbjct  63    NID----GGCHVV-GEDQSEETYDGCIISTHAPDALKILGTQATYEESRLLGAYQYVYSD  117

Query  1322  IYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPE  1501
             IYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP   P+
Sbjct  118   IYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNLPFLVTLNPRFVPK  177

Query  1502  QCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLL  1681
               LLKW+T HP+PSVAAS+AS E+ +IQGKRRIWFCGAYQG+GFHEDGLKAG++AA+ +L
Sbjct  178   HTLLKWSTSHPIPSVAASKASLEIGKIQGKRRIWFCGAYQGFGFHEDGLKAGIVAANSVL  237

Query  1682  KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLL  1861
                C  L NP  MVPS  ETGARL+VTRFL  +I TG + LLEEGGT+F FEGT+KK+ +
Sbjct  238   GMDCVLLRNPRQMVPSLVETGARLIVTRFLEKYISTGCLTLLEEGGTIFVFEGTNKKSCI  297

Query  1862  KVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSR  2041
             K ++++H P FYWKVAT+ADLGLADAYI+   SFVD++EGLLNLF I + NRD ++S S+
Sbjct  298   KSILKIHDPLFYWKVATEADLGLADAYINRYFSFVDEQEGLLNLFMILIVNRDQNSS-SK  356

Query  2042  SNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMT  2221
             S + RGWWTP+LFT+ + SA+YF+RHISRQNT+ QA +NIS HYDLSNE FSLFLDETMT
Sbjct  357   SKTTRGWWTPILFTAGLQSARYFLRHISRQNTVAQAPKNISHHYDLSNEFFSLFLDETMT  416

Query  2222  YSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTG  2401
             YS A+FK E+EDLK AQ+ KISLLI+KA+I  +H ILEIGCGWGSLAIE V++TGCKYTG
Sbjct  417   YSGAIFKMENEDLKVAQLHKISLLIEKARIEAKHEILEIGCGWGSLAIEVVKQTGCKYTG  476

Query  2402  ITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEF  2581
             ITLSE+QLK+A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGHE+M EF
Sbjct  477   ITLSEEQLKFAKRRAKEACLEDRITFLLCDYRQLPCYRKYDRIISCEMIEGVGHEYMEEF  536

Query  2582  FGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASS  2761
             FG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA+S
Sbjct  537   FGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAAAS  596

Query  2762  RLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCT  2941
             R CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF + T
Sbjct  597   RFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRT  656

Query  2942  LGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             LG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  657   LGNYQMVFSRPGNSTAFSNPYDGVPSA  683



>ref|XP_009763752.1| PREDICTED: uncharacterized protein LOC104215602 isoform X2 [Nicotiana 
sylvestris]
Length=566

 Score =   960 bits (2481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 462/566 (82%), Positives = 508/566 (90%), Gaps = 0/566 (0%)
 Frame = +2

Query  1328  LHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQC  1507
             + +E   +     AWSAWNFLGT+NN+VC+TYWLN LQNLG+T++PY VTLNPP TPE  
Sbjct  1     MKQEYLVLSNMFIAWSAWNFLGTMNNKVCVTYWLNILQNLGETERPYCVTLNPPHTPEHT  60

Query  1508  LLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKK  1687
             LLKWTTGHPVPSVAAS ASSEL++IQGKR IWFCGAYQGYGFHEDGLKAG+IAA GLLK+
Sbjct  61    LLKWTTGHPVPSVAASIASSELDQIQGKRGIWFCGAYQGYGFHEDGLKAGVIAAQGLLKR  120

Query  1688  RCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKV  1867
               S L NP HMVP+WPETGARLLVTRFL SFI TG IILLE+GGT+FTFEGT+ K+ LKV
Sbjct  121   NYSVLKNPKHMVPTWPETGARLLVTRFLKSFITTGCIILLEDGGTMFTFEGTENKSSLKV  180

Query  1868  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2047
              +RVHSPQFYWKVATQ DLGLADA+I GD SFVDK EGLLNLF IFV NRDL ASV+RS+
Sbjct  181   SLRVHSPQFYWKVATQGDLGLADAFIQGDFSFVDKNEGLLNLFMIFVNNRDLKASVTRSS  240

Query  2048  SKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  2227
              KRGWWTPLLFT+A++SAKYFIRH+S QNTLT+ARRNISRHYDLSNELFSLFLD+TMTYS
Sbjct  241   KKRGWWTPLLFTAAVSSAKYFIRHVSNQNTLTRARRNISRHYDLSNELFSLFLDQTMTYS  300

Query  2228  CAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGIT  2407
             CA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RTGCKYTGIT
Sbjct  301   CAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRTGCKYTGIT  360

Query  2408  LSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFG  2587
             LSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGHEFM EFF 
Sbjct  361   LSEQQLKYAQKRVQQAGLQDHIIFLLCDYRQLPNMSRYDRIISCEMLEAVGHEFMEEFFT  420

Query  2588  RCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL  2767
               ES LAE+G+LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA+SRL
Sbjct  421   CSESALAEDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAAASRL  480

Query  2768  CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLG  2947
             CVEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLG
Sbjct  481   CVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLG  540

Query  2948  DYQIVFSRPGNVTAFGDPYKGLASAY  3025
             DYQIVFSRPGNV AFGDPY G+ S Y
Sbjct  541   DYQIVFSRPGNVAAFGDPYHGVPSTY  566



>ref|XP_009625539.1| PREDICTED: uncharacterized protein LOC104116392 isoform X5 [Nicotiana 
tomentosiformis]
Length=556

 Score =   958 bits (2476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/553 (83%), Positives = 505/553 (91%), Gaps = 0/553 (0%)
 Frame = +2

Query  1367  AWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsv  1546
             AWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPPRTPE  LLKWTTGHPVPSV
Sbjct  4     AWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPRTPEHTLLKWTTGHPVPSV  63

Query  1547  aasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVP  1726
             AAS ASSEL++IQG+R IWFCGAYQGYGFHEDG+KAG IAA GLLK+  S LNNP HMVP
Sbjct  64    AASIASSELDQIQGERGIWFCGAYQGYGFHEDGVKAGAIAAQGLLKRNYSVLNNPKHMVP  123

Query  1727  SWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKV  1906
             +WPETGARLLVTRFL SFI T  IILLEEGGT+FTFEGT+ K+ LKV +RVHSPQFYWKV
Sbjct  124   TWPETGARLLVTRFLKSFISTECIILLEEGGTMFTFEGTENKSSLKVSLRVHSPQFYWKV  183

Query  1907  ATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTS  2086
             ATQ DLGLADA+I GD SFVDK +GLLNLF IFV NRDL ASV+RS+ KRGWWTPLLFT+
Sbjct  184   ATQGDLGLADAFIQGDFSFVDKNDGLLNLFMIFVNNRDLKASVTRSSKKRGWWTPLLFTA  243

Query  2087  AIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKT  2266
             A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLFLDETMTYSCA+FKSE+EDLK 
Sbjct  244   AVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAIFKSEEEDLKV  303

Query  2267  AQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKV  2446
             AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RTGCKYTGITLSEQQLKYA+ +V
Sbjct  304   AQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRTGCKYTGITLSEQQLKYAQIRV  363

Query  2447  REAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILV  2626
             ++AGLQD+I F+LCDYRQLP+  RYDRIISCEMLEAVGHEFM+EFF  CES LAE G+LV
Sbjct  364   QQAGLQDHITFILCDYRQLPNMSRYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLV  423

Query  2627  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  2806
             LQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYY
Sbjct  424   LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYY  483

Query  2807  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  2986
             QTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV 
Sbjct  484   QTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVA  543

Query  2987  AFGDPYKGLASAY  3025
             AFGDPY G+ S Y
Sbjct  544   AFGDPYNGVPSTY  556



>ref|XP_009625540.1| PREDICTED: uncharacterized protein LOC104116392 isoform X6 [Nicotiana 
tomentosiformis]
Length=556

 Score =   956 bits (2472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/553 (83%), Positives = 504/553 (91%), Gaps = 0/553 (0%)
 Frame = +2

Query  1367  AWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsv  1546
             AWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPP TPE  +LKWTTGHP+PSV
Sbjct  4     AWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPHTPEHTMLKWTTGHPIPSV  63

Query  1547  aasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVP  1726
             AAS ASSEL++IQGKR IWFCGAYQGYGFHEDG+KAG IAA GLLK+  S LNNP HMVP
Sbjct  64    AASIASSELDQIQGKRGIWFCGAYQGYGFHEDGVKAGAIAAQGLLKRNYSVLNNPKHMVP  123

Query  1727  SWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKV  1906
             +WPETGARLLVTRFL SFI T  IILLEEGGT+FTFEGT+ K+ LKV +RVHSPQFYWKV
Sbjct  124   TWPETGARLLVTRFLKSFISTECIILLEEGGTMFTFEGTENKSSLKVSLRVHSPQFYWKV  183

Query  1907  ATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTS  2086
             ATQ DLGLADA+I GD SFVDK +GLLNLF IFV NRDL ASV+RS+ KRGWWTPLLFT+
Sbjct  184   ATQGDLGLADAFIQGDFSFVDKNDGLLNLFMIFVNNRDLKASVTRSSKKRGWWTPLLFTA  243

Query  2087  AIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKT  2266
             A++SAKYFIRH+S QNTLTQARRNISRHYDLSNELFSLFLDETMTYSCA+FKSE+EDLK 
Sbjct  244   AVSSAKYFIRHVSNQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAIFKSEEEDLKV  303

Query  2267  AQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKV  2446
             AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E V+RTGCKYTGITLSEQQLKYA+ +V
Sbjct  304   AQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVVKRTGCKYTGITLSEQQLKYAQIRV  363

Query  2447  REAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILV  2626
             ++AGLQD+I F+LCDYRQLP+  RYDRIISCEMLEAVGHEFM+EFF  CES LAE G+LV
Sbjct  364   QQAGLQDHITFILCDYRQLPNMSRYDRIISCEMLEAVGHEFMDEFFTCCESALAEYGLLV  423

Query  2627  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  2806
             LQFISIPDERYDEYRQSSDFIKEYIFPGGCLP+LSRVTSAMAA+SRLCVEHLEDIGIHYY
Sbjct  424   LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPALSRVTSAMAAASRLCVEHLEDIGIHYY  483

Query  2807  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  2986
             QTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV 
Sbjct  484   QTLRCWRKNFLQKQSQIHALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVA  543

Query  2987  AFGDPYKGLASAY  3025
             AFGDPY G+ S Y
Sbjct  544   AFGDPYNGVPSTY  556



>ref|XP_010532680.1| PREDICTED: uncharacterized protein LOC104808649 [Tarenaya hassleriana]
Length=868

 Score =   954 bits (2465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/681 (68%), Positives = 543/681 (80%), Gaps = 14/681 (2%)
 Frame = +2

Query  995   FCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGG  1168
             FCR    LQLFGRPQ LTV   SH+YV KVR EL+KRGC+IR   EV SV+T + G    
Sbjct  192   FCRDHHLLQLFGRPQLLTVAGHSHTYVAKVRTELQKRGCKIRTSREVQSVTTTDNG----  247

Query  1169  VVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSF  1348
              V +  ++  +E +D CI+A HAP  L++LG+QATFDE R+LGAFQYVYSDIYLHR+  F
Sbjct  248   -VTVRNEDGSEEVFDRCILAMHAPHALRLLGEQATFDERRVLGAFQYVYSDIYLHRDTDF  306

Query  1349  MPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTG  1528
             MPRN  AWSAWNFLGT  N+VC+TYWLNT+QNLG+  +P+ VTLNP   P++ LLKWTTG
Sbjct  307   MPRNPTAWSAWNFLGTTENKVCVTYWLNTIQNLGEKSEPFFVTLNPDYNPKKTLLKWTTG  366

Query  1529  HpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCS---P  1699
             HP+PSVAA  AS EL ++QGKR +WFCG YQGYGFHEDGLKA MI     +K  CS    
Sbjct  367   HPIPSVAALTASRELSKVQGKRGLWFCGGYQGYGFHEDGLKA-MI---NFIKTSCSFIAL  422

Query  1700  LNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRV  1879
             ++N  HMVPS+ E  AR+ VTRF+  FI  G + LLE+GGTVF F G   K  LK ++++
Sbjct  423   VSNLKHMVPSFAEAAARVFVTRFMGQFISMGYVALLEDGGTVFKFGGKHPKCTLKSVIKI  482

Query  1880  HSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRG  2059
             HSPQFYWKV T+ADLGLADAYI+GDISFVDK EGLLN+  I +ANRDL++S S    KRG
Sbjct  483   HSPQFYWKVMTEADLGLADAYINGDISFVDKDEGLLNMIMILIANRDLNSSKSNLAKKRG  542

Query  2060  WWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVF  2239
             WWTP+LFT+++ASAKYF++H+ R+NTLTQ+ RN+S HYDLSNELF+LF+DETM YSCAVF
Sbjct  543   WWTPMLFTASLASAKYFLKHVYRKNTLTQSCRNVSFHYDLSNELFALFMDETMQYSCAVF  602

Query  2240  KSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQ  2419
             KS+DEDL+T QMRKISLLIDKA+I K H +LEIGCGWG  AIE V RTGCKYTGITLS +
Sbjct  603   KSDDEDLRTGQMRKISLLIDKARIEKHHKVLEIGCGWGIFAIEVVRRTGCKYTGITLSVE  662

Query  2420  QLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCES  2599
             QLKYAE KV+EAGLQD I F LCDYRQL D+ +YDRII+C M+EAVGHEFM  FF RCE 
Sbjct  663   QLKYAEAKVKEAGLQDRITFELCDYRQLSDSRKYDRIIACGMIEAVGHEFMEIFFNRCEV  722

Query  2600  VLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  2779
             VLAE+G+LVLQFI++PD RYDE R S  FI EYIFPGGCLPSL+RVTSAMA+SSRLC+EH
Sbjct  723   VLAEDGLLVLQFITVPDSRYDEIRLSPGFITEYIFPGGCLPSLTRVTSAMASSSRLCIEH  782

Query  2780  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  2959
             +E+IGIHYY+TLRCWR NF ERQ +I  +GFD+KFIR WEYYFDYCAAGF T T+GDYQ+
Sbjct  783   VENIGIHYYKTLRCWRQNFKERQEEIKAIGFDEKFIRKWEYYFDYCAAGFKTLTVGDYQV  842

Query  2960  VFSRPGNVTAFGDPYKGLASA  3022
             VFSRPGN   FGDPY    SA
Sbjct  843   VFSRPGNTATFGDPYMNFPSA  863


 Score =   311 bits (798),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+G GISGL +A+VLA+ G  VV+YEKE+ LGGHA+TV  DGVD+D+GFMVFNRVT
Sbjct  1     MRVAVIGGGISGLGAAHVLARDGVEVVLYEKEENLGGHARTVRFDGVDVDIGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE LGVD+E+SD SFSVSLD+G G EWGSRNG S LFAQK N+ NP+FWQMIR
Sbjct  61    YPNMMEFFEDLGVDLEVSDASFSVSLDSGRGIEWGSRNGLSSLFAQKSNVFNPHFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK+DVL Y+EE ++NP++DR +TLG+F+KS GYSELFQKAY++P+C SIWSC  + 
Sbjct  121   EMVKFKDDVLRYIEELESNPNLDRTETLGQFLKSHGYSELFQKAYVVPLCCSIWSCPYDR  180

Query  943   VMAFSAYSILSFCRNHHLLQNF  1008
             V++ SA+++L FCR+HHLLQ F
Sbjct  181   VLSSSAFTVLYFCRDHHLLQLF  202



>ref|XP_010936014.1| PREDICTED: uncharacterized protein LOC105055750 isoform X1 [Elaeis 
guineensis]
Length=864

 Score =   953 bits (2463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/687 (67%), Positives = 558/687 (81%), Gaps = 8/687 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTVK+RSH YV KV  ELE R C+IR G 
Sbjct  177   PSEGVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVKQRSHCYVRKVTGELESRYCQIRTGY  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
              V SV + +    GG  ++ G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+
Sbjct  237   AVQSVLSID----GGCCVV-GEDQSKETYDGCIISIHAPDALKILGTQATYEESRLLGAY  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLN
Sbjct  292   QYVYSDIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNMPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   PE  LLKWTT HP+PSVAAS+AS ELE+IQGKR IWFCGAYQG+GFHEDG+K G++
Sbjct  352   PYFVPEHILLKWTTSHPIPSVAASKASLELEKIQGKRGIWFCGAYQGFGFHEDGVKTGIV  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA+ +L K C  L NP HMVPS  ETGARL+VTRFL  ++ TG + LLEEGGT+F FEGT
Sbjct  412   AANSVLGKDCVILRNPRHMVPSLVETGARLIVTRFLEKYVATGCLTLLEEGGTIFVFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             +KK+ +K ++++H P FYWKVAT+ADLGLA AYI+   S VD++EGLL+LF I + NRDL
Sbjct  472   NKKSCVKSILKIHDPLFYWKVATEADLGLAYAYINRYFSVVDEQEGLLDLFMILIVNRDL  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             + S  +S ++RGWWTP+LFT+ + SA+YF+RHISR N + Q  +NISRHYDLSNE FSLF
Sbjct  532   NYSC-KSKTRRGWWTPILFTAGLQSARYFLRHISRHNAVAQTPKNISRHYDLSNEFFSLF  590

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+FK E+EDLK AQ+RKISLLI+KA+I  +H IL+IGCGWGSLAIE   +T
Sbjct  591   LDETMTYSCAIFKMENEDLKVAQLRKISLLIEKARIKAKHEILDIGCGWGSLAIEVARQT  650

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLK+A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGH
Sbjct  651   GCKYTGITLSEEQLKFAKRRAQEACLEDRITFLLCDYRQLPCYQKYDRIISCEMIEGVGH  710

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M EFFG CE +LAE+G+ VLQFISIPDERYDEYR+SSDFIKEY+FPGGC+PSLSR+TS
Sbjct  711   EYMEEFFGCCELLLAEDGLFVLQFISIPDERYDEYRRSSDFIKEYVFPGGCIPSLSRITS  770

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMAA+SR CVEH+E+IGIHYY+TLRCWR N ++ + +IL LGFD+KFIRTWEYYF YCAA
Sbjct  771   AMAATSRFCVEHVENIGIHYYETLRCWRNNLMQNKCKILALGFDEKFIRTWEYYFIYCAA  830

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPY  3004
             GF + TLG+YQ+VFSRPGN+TA G  Y
Sbjct  831   GFRSRTLGNYQMVFSRPGNLTALGSLY  857


 Score =   344 bits (883),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 183/216 (85%), Gaps = 2/216 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVA+VGAGISGLVSAYVLAK G  VV+YEKEDYLGGHA+TV  DGV LDLGFMVFNRVT
Sbjct  1     MRVAIVGAGISGLVSAYVLAKAGVDVVLYEKEDYLGGHARTVNFDGVHLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+DV+ YL+E +NNPD+D ++TL  FIKS GYS+LFQKAY++P+CASIWSC SEG
Sbjct  121   EIFKFKHDVIKYLDEHENNPDLDHDETLEHFIKSHGYSQLFQKAYLVPICASIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW--SPTMAHC  1044
             VM+FSA+S+LSFCRNHHLLQ F    W      +HC
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVKQRSHC  216



>ref|XP_010936015.1| PREDICTED: uncharacterized protein LOC105055750 isoform X2 [Elaeis 
guineensis]
Length=683

 Score =   952 bits (2460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/680 (67%), Positives = 556/680 (82%), Gaps = 8/680 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTVK+RSH YV KV  ELE R C+IR G  V SV +
Sbjct  3     FSAFSVLSFCRNHHLLQLFGRPQWLTVKQRSHCYVRKVTGELESRYCQIRTGYAVQSVLS  62

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              +    GG  ++ G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+QYVYSDI
Sbjct  63    ID----GGCCVV-GEDQSKETYDGCIISIHAPDALKILGTQATYEESRLLGAYQYVYSDI  117

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP   PE 
Sbjct  118   YLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNMPFLVTLNPYFVPEH  177

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKWTT HP+PSVAAS+AS ELE+IQGKR IWFCGAYQG+GFHEDG+K G++AA+ +L 
Sbjct  178   ILLKWTTSHPIPSVAASKASLELEKIQGKRGIWFCGAYQGFGFHEDGVKTGIVAANSVLG  237

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C  L NP HMVPS  ETGARL+VTRFL  ++ TG + LLEEGGT+F FEGT+KK+ +K
Sbjct  238   KDCVILRNPRHMVPSLVETGARLIVTRFLEKYVATGCLTLLEEGGTIFVFEGTNKKSCVK  297

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++++H P FYWKVAT+ADLGLA AYI+   S VD++EGLL+LF I + NRDL+ S  +S
Sbjct  298   SILKIHDPLFYWKVATEADLGLAYAYINRYFSVVDEQEGLLDLFMILIVNRDLNYSC-KS  356

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
              ++RGWWTP+LFT+ + SA+YF+RHISR N + Q  +NISRHYDLSNE FSLFLDETMTY
Sbjct  357   KTRRGWWTPILFTAGLQSARYFLRHISRHNAVAQTPKNISRHYDLSNEFFSLFLDETMTY  416

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FK E+EDLK AQ+RKISLLI+KA+I  +H IL+IGCGWGSLAIE   +TGCKYTGI
Sbjct  417   SCAIFKMENEDLKVAQLRKISLLIEKARIKAKHEILDIGCGWGSLAIEVARQTGCKYTGI  476

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLK+A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGHE+M EFF
Sbjct  477   TLSEEQLKFAKRRAQEACLEDRITFLLCDYRQLPCYQKYDRIISCEMIEGVGHEYMEEFF  536

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CE +LAE+G+ VLQFISIPDERYDEYR+SSDFIKEY+FPGGC+PSLSR+TSAMAA+SR
Sbjct  537   GCCELLLAEDGLFVLQFISIPDERYDEYRRSSDFIKEYVFPGGCIPSLSRITSAMAATSR  596

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
              CVEH+E+IGIHYY+TLRCWR N ++ + +IL LGFD+KFIRTWEYYF YCAAGF + TL
Sbjct  597   FCVEHVENIGIHYYETLRCWRNNLMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRTL  656

Query  2945  GDYQIVFSRPGNVTAFGDPY  3004
             G+YQ+VFSRPGN+TA G  Y
Sbjct  657   GNYQMVFSRPGNLTALGSLY  676



>ref|XP_009135859.1| PREDICTED: uncharacterized protein LOC103860003 [Brassica rapa]
Length=870

 Score =   951 bits (2458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/680 (67%), Positives = 540/680 (79%), Gaps = 7/680 (1%)
 Frame = +2

Query  992   TFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAG  1165
             +FCR    LQLFGRP+ LTV  RS ++V KVR ELEKRGC+I   C V SV+T E G   
Sbjct  193   SFCRNHHLLQLFGRPEGLTVAGRSQTFVAKVRAELEKRGCKIITNCNVQSVATSENG---  249

Query  1166  GVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQS  1345
               VI++ ++  Q+ +D CI+A HAPD LK+LG + T++E R+LGAFQY  SD+YLHR+  
Sbjct  250   -CVIVTTEDGSQQIFDSCILAVHAPDALKLLGDKVTYEETRVLGAFQYTDSDLYLHRDTD  308

Query  1346  FMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTT  1525
              MPR   AWSAWNFLG+  N+  +TYWLN +Q LG+   P+ +T+NP  TP++ L KWTT
Sbjct  309   LMPRKTGAWSAWNFLGSSENKASVTYWLNIIQKLGEEHDPFFITVNPEYTPKKTLFKWTT  368

Query  1526  GHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLL-KKRCSPL  1702
              HPVPSV+  +AS EL +IQGKR IWFCGAYQGYGFHE+GLKAGM A+  LL K   +  
Sbjct  369   SHPVPSVSTWKASQELYQIQGKRGIWFCGAYQGYGFHEEGLKAGMAASQCLLGKDMVTTF  428

Query  1703  NNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVH  1882
              NP HMVPS  E GAR   T+FL +FI TG I + EEGGTVFTFEG D    LK ++ VH
Sbjct  429   TNPKHMVPSVTEKGARFFFTKFLRNFISTGCITIHEEGGTVFTFEGKDSSCHLKSILEVH  488

Query  1883  SPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGW  2062
             SPQFYWKV TQADLGLADAYI+GD SF DK+ GLL+L  I +AN++L++  S+   KRGW
Sbjct  489   SPQFYWKVMTQADLGLADAYINGDFSFSDKERGLLDLIMILIANKELNSKNSKLAKKRGW  548

Query  2063  WTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK  2242
             WTP+  T+++ASA  F++H SRQNTLTQARRNISRHYDLSNELF+LFLD+TMTYS AVFK
Sbjct  549   WTPMFLTASLASANNFLKHFSRQNTLTQARRNISRHYDLSNELFALFLDDTMTYSSAVFK  608

Query  2243  SEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQ  2422
               DEDL+TAQMRKI LLIDKA+I K H +LEIGCGWG+LAIE V+RTGCKYTGITLS +Q
Sbjct  609   WVDEDLRTAQMRKIYLLIDKARIEKNHEVLEIGCGWGTLAIEVVKRTGCKYTGITLSIEQ  668

Query  2423  LKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESV  2602
             LKYAE+KV+EAGL+D I+F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF  CE+ 
Sbjct  669   LKYAEEKVKEAGLEDRIKFKLCDYRQLSDAHKYDRIISCEMLEAVGHEFMETFFRHCEAA  728

Query  2603  LAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  2782
             LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E++
Sbjct  729   LAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIENV  788

Query  2783  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  2962
             E+IGIHYYQTLR WR  FLERQ QI DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+V
Sbjct  789   ENIGIHYYQTLRLWRKTFLERQKQINDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVV  848

Query  2963  FSRPGNVTAFGDPYKGLASA  3022
             FSRPGNV A GDP++   SA
Sbjct  849   FSRPGNVAALGDPFRSFPSA  868


 Score =   296 bits (757),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/204 (69%), Positives = 166/204 (81%), Gaps = 2/204 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGA--GVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             MRVAV+G G+SGL SAYVLA+  A   +V++EKED LGGHA+T+  DGVDLDLGF VFN 
Sbjct  1     MRVAVIGGGVSGLGSAYVLARDDAVKELVLFEKEDSLGGHARTMRFDGVDLDLGFTVFNS  60

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT+PNMM   ++L VDME SDMSFSVSLDNG GYEWG R+G S LFAQK+N+LNPYFWQM
Sbjct  61    VTHPNMMGFLKNLEVDMEDSDMSFSVSLDNGRGYEWGCRHGLSSLFAQKRNILNPYFWQM  120

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IRE  KFK DV  YLE+ + N D+DR DTLGEF+KS GYS++FQKAY++P+C  IWS SS
Sbjct  121   IRETKKFKEDVQKYLEDLERNLDVDRTDTLGEFLKSHGYSDVFQKAYLVPVCGLIWSGSS  180

Query  937   EGVMAFSAYSILSFCRNHHLLQNF  1008
             E V+  SAYS+LSFCRNHHLLQ F
Sbjct  181   ESVLNLSAYSVLSFCRNHHLLQLF  204



>ref|XP_007035221.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
 gb|EOY06147.1| Cyclopropane-fatty-acyl-phospholipid synthase [Theobroma cacao]
Length=858

 Score =   951 bits (2457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/671 (68%), Positives = 547/671 (82%), Gaps = 10/671 (1%)
 Frame = +2

Query  1013  QLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKN  1192
             QL GRPQ LTV R S+ + NKVRE LE RGC+IR GCE+ SV TD+ GS     I+ G  
Sbjct  198   QLLGRPQLLTVSRHSY-FANKVREMLESRGCQIRTGCEIRSVQTDDDGSN----IVFGDG  252

Query  1193  MVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAW  1372
               QE Y+GCIMA  AP  LK+LG QATFDELR+LGAFQYVYSDI+ HR+  FMP+N + W
Sbjct  253   F-QEKYNGCIMAVDAPAALKLLGNQATFDELRLLGAFQYVYSDIFFHRDVKFMPKNSSTW  311

Query  1373  SAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaa  1552
             SA NF+    N+ CLTY L+ LQ++G+T  P+LVT+NP +TP+Q L KW+TGHP+ SVAA
Sbjct  312   SALNFVKGAENKACLTYLLDVLQDVGETSVPFLVTINPDQTPKQTLHKWSTGHPIASVAA  371

Query  1553  srassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSW  1732
             S+AS +L +IQGKR IWFCG    YGFHED LKA M+ A+ LL K+CS LN P H+VPS+
Sbjct  372   SKASLQLNQIQGKRGIWFCG----YGFHEDKLKAAMVTANNLLGKQCSALNQPKHIVPSF  427

Query  1733  PETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVAT  1912
              ETGARL VTRFL  +I TG I +LEEGGTVFTF+G+ +K  +K +++VH+PQFYWKV T
Sbjct  428   METGARLFVTRFLGQYISTGCITILEEGGTVFTFKGSMRKCSVKTVLKVHNPQFYWKVMT  487

Query  1913  QADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAI  2092
             +A LGLADA+I+GD SF DK+EGLLNLF I +AN D ++S +R N KRGWWTP  FT++I
Sbjct  488   EAGLGLADAFINGDFSFTDKEEGLLNLFIILIANGDSNSSATRLNKKRGWWTPSFFTASI  547

Query  2093  ASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQ  2272
             ASAKYF +H  RQN++TQARRNISRHYDLSNELF+LFLDETM YS  +FK+EDEDLK AQ
Sbjct  548   ASAKYFFKHALRQNSVTQARRNISRHYDLSNELFALFLDETMQYSSGIFKNEDEDLKVAQ  607

Query  2273  MRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVRE  2452
             +RK+S LIDKA+I K H +L+IGCGWG  AIE V RTGCKYTGITLSE+QLK+AE KV+E
Sbjct  608   LRKMSSLIDKARIEKHHEVLDIGCGWGRFAIEVVRRTGCKYTGITLSEEQLKFAEAKVKE  667

Query  2453  AGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQ  2632
             AGLQDNIRFLLCDYRQLPD  +YDRIISCEM+E +G E++ +FF  CES LAE+G+LVLQ
Sbjct  668   AGLQDNIRFLLCDYRQLPDTRKYDRIISCEMIEHLGDEYVEQFFRCCESALAEDGLLVLQ  727

Query  2633  FISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQT  2812
             FISIP+ER++EYR+SSDFIKEYIFPGGCLPSL+R+ + MAA+SRLCVEH+E+IG++YY T
Sbjct  728   FISIPEERFEEYRRSSDFIKEYIFPGGCLPSLNRIVTGMAAASRLCVEHVENIGMNYYLT  787

Query  2813  LRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAF  2992
             LRCWR NFLE QS+IL LGFD+KF+RTWEYYFDYCAAGF T TLGDYQ+VFSRPGN  A 
Sbjct  788   LRCWRKNFLENQSKILALGFDEKFMRTWEYYFDYCAAGFRTYTLGDYQVVFSRPGNYKAL  847

Query  2993  GDPYKGLASAY  3025
             G PY+G  SAY
Sbjct  848   GYPYQGFPSAY  858


 Score =   265 bits (678),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 162/200 (81%), Gaps = 2/200 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAV+G GI GLVSA VLAK GA VVVYEKE+ +GG AKT   +G+DLDLGF+ FN   
Sbjct  1     MKVAVIGGGIGGLVSACVLAKAGANVVVYEKEEQVGGQAKT--FNGIDLDLGFITFNPAM  58

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
              P+ +ELF+SLGVD+E  +MSFSVSLDNG  YEWG+RNGFS LFAQK+N+LNPYFW+M+R
Sbjct  59    NPSTLELFDSLGVDVEACNMSFSVSLDNGQDYEWGTRNGFSSLFAQKQNVLNPYFWKMLR  118

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK+DV+SYL+  +NNPD+D  +TLG+FIK R YSE FQKAY+IP+C SIW C+ E 
Sbjct  119   ELIKFKDDVISYLQMLENNPDIDGYETLGQFIKLRDYSEPFQKAYLIPICCSIWCCTVEQ  178

Query  943   VMAFSAYSILSFCRNHHLLQ  1002
             VM+FSA+  LS  R +HL Q
Sbjct  179   VMSFSAFYTLSIFRRYHLHQ  198



>emb|CDX92987.1| BnaA03g37090D [Brassica napus]
Length=876

 Score =   950 bits (2455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/686 (66%), Positives = 541/686 (79%), Gaps = 13/686 (2%)
 Frame = +2

Query  992   TFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAG  1165
             +FCR    LQLFGRP+ LTV  RS ++V KVR ELEKRGC+I   C V SV+T E G   
Sbjct  193   SFCRNHHLLQLFGRPEGLTVPGRSQTFVAKVRAELEKRGCKIITNCNVQSVATSENG---  249

Query  1166  GVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQS  1345
               VI++ ++  Q+ +D CI+A HAPD LK+LG + T++E R+LGAFQY  SD+YLHR+  
Sbjct  250   -CVIVTTEDGSQQIFDSCILAVHAPDALKLLGDKVTYEETRVLGAFQYTDSDLYLHRDTD  308

Query  1346  FMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTT  1525
              MPR   AWSAWNFLG+  N+  +TYWLN +QNLG+   P+ +T+NP  TP++ L KWTT
Sbjct  309   LMPRKTGAWSAWNFLGSSENKASVTYWLNIIQNLGEEHDPFFITVNPEYTPKKTLFKWTT  368

Query  1526  GHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRC----  1693
              HPVPSV+  +AS EL +IQGKR IWFCGAYQGYGFHE+GLKA +I+  G+   +C    
Sbjct  369   SHPVPSVSTWKASQELYQIQGKRGIWFCGAYQGYGFHEEGLKALIISIAGMAASQCLLGK  428

Query  1694  ---SPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
                + L NP HMVPS  E GAR   T+FL +FI TG I + EEGGTVFTFEG D    LK
Sbjct  429   DMVTTLTNPKHMVPSVTEKGARFFFTKFLRNFISTGCITIHEEGGTVFTFEGKDSSCHLK  488

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++ VHSPQFYWKV TQADLGLADAYI+GD SF DK+ GLL+L  I +AN++L++  S+ 
Sbjct  489   SILEVHSPQFYWKVMTQADLGLADAYINGDFSFSDKERGLLDLIMILIANKELNSKNSKL  548

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWWTP+  T+++ASA  F++H SRQNTLTQARRNISRHYDLSNELF+LFLD+TMTY
Sbjct  549   AKKRGWWTPMFLTASLASANNFLKHFSRQNTLTQARRNISRHYDLSNELFALFLDDTMTY  608

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S AVFKS DEDL+TAQMRKI LLIDKA+I K H +LEIGCGWG+LAIE V RTGC+YTGI
Sbjct  609   SSAVFKSADEDLRTAQMRKIYLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTGCRYTGI  668

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS +QLKYAE+KV++AGL+D I F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF
Sbjct  669   TLSIEQLKYAEEKVKQAGLEDRITFKLCDYRQLSDAHKYDRIISCEMLEAVGHEFMETFF  728

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               CE+ LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSAMA+SSR
Sbjct  729   RHCEAALAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMASSSR  788

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+E++E+IGIHYYQTLR WR  FLERQ QI DLGFD KFIRTWEYYFDYCAAGF T TL
Sbjct  789   LCIENVENIGIHYYQTLRLWRKTFLERQKQINDLGFDDKFIRTWEYYFDYCAAGFKTLTL  848

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASA  3022
             G+YQ+VFSRPGNV A GDP++   SA
Sbjct  849   GNYQVVFSRPGNVAALGDPFRSFPSA  874


 Score =   293 bits (749),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 165/204 (81%), Gaps = 2/204 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGA--GVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             MRVAV+G G+SGL SAYVLA+  A   +V++EKED LGGHA+T+  DGVDLDLGF VFN 
Sbjct  1     MRVAVIGGGVSGLGSAYVLARDDAVKELVLFEKEDSLGGHARTMRFDGVDLDLGFTVFNS  60

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT+PNMM   ++L VDME SDMSFSVSLDNG GYEWG R+G S LFAQK+N+LNPYFWQM
Sbjct  61    VTHPNMMGFLKNLEVDMEDSDMSFSVSLDNGRGYEWGCRHGLSSLFAQKRNILNPYFWQM  120

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IRE  +FK DV  YLE+ + N D+DR +TLGEF+KS GYS +FQKAY++P+C  IWS SS
Sbjct  121   IRETKRFKEDVQKYLEDLERNLDVDRTETLGEFLKSHGYSNVFQKAYLVPVCGLIWSGSS  180

Query  937   EGVMAFSAYSILSFCRNHHLLQNF  1008
             E V+  SAYS+LSFCRNHHLLQ F
Sbjct  181   ESVLNLSAYSVLSFCRNHHLLQLF  204



>ref|XP_009102616.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
 ref|XP_009102617.1| PREDICTED: uncharacterized protein LOC103828740 isoform X1 [Brassica 
rapa]
Length=871

 Score =   949 bits (2454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/688 (66%), Positives = 546/688 (79%), Gaps = 7/688 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQ+F RPQWLTV  RS +Y  KVR ELE+RGC+IR  C V SVST
Sbjct  187   FSAYSVLSFCRNHHLLQIFERPQWLTVAGRSETYAAKVRAELEQRGCKIRTSCNVQSVST  246

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E G     ++++ ++  QE +D CI+A +APD L++LG+ AT DE R+LGAFQY YSDI
Sbjct  247   SEDG----YILVTTEDGSQEVFDRCILAVNAPDALRLLGEDATPDETRVLGAFQYAYSDI  302

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLHR+   MPRN  AWSAWNFL +  N+  LT+WLN +QNL +    Y +TLNP  +P++
Sbjct  303   YLHRDTDLMPRNRVAWSAWNFLTSSENKASLTHWLNIIQNLDEEHDSYFLTLNPEVSPKK  362

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              L KWT+G P+PSV+A +AS EL +IQGKR IWFCGAYQG GFHEDGLKAGM AA  LL 
Sbjct  363   TLYKWTSGRPLPSVSAWKASQELNKIQGKRGIWFCGAYQGSGFHEDGLKAGMGAAQSLLG  422

Query  1685  KRCSPL-NNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLL  1861
             K   PL +NP HMVPS  E GAR L TRFL  FI TG + + EEGGT+FTF+G D +  L
Sbjct  423   KDMVPLLSNPKHMVPSLTEKGARFLFTRFLRHFISTGCVTVYEEGGTMFTFKGKDLRCNL  482

Query  1862  KVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSR  2041
             + ++++ SP FYWKV TQADLGLADAYI+GD SFV+K+ GLLNL  I +ANR+L++    
Sbjct  483   ESVIKIRSPHFYWKVMTQADLGLADAYINGDFSFVNKETGLLNLIMILIANRELNSKNLN  542

Query  2042  SNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMT  2221
                KRGWWTP+  T+ + SA  F+RH SRQNTLT+ARRNISRHYDLSNELF+LFLD+TM+
Sbjct  543   LAKKRGWWTPMFMTAGLTSATQFLRHFSRQNTLTKARRNISRHYDLSNELFALFLDDTMS  602

Query  2222  YSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTG  2401
             YS AVFKS+DEDLKTAQMRKI+LLIDKA+I K+H +LEIGCGWG+LAIE V++TGCKYTG
Sbjct  603   YSTAVFKSDDEDLKTAQMRKINLLIDKARIEKDHEVLEIGCGWGTLAIEVVKKTGCKYTG  662

Query  2402  ITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEF  2581
             ITLS +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRIISCEM+E VGHEFM+ F
Sbjct  663   ITLSIEQLKYAEEKVKEAGLQDRITFELCDYRQLSDARKYDRIISCEMIEHVGHEFMDTF  722

Query  2582  FGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASS  2761
             F  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV SAMA+SS
Sbjct  723   FSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVISAMASSS  782

Query  2762  RLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCT  2941
             RL VE++E+IGIHYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDYCAAGF T T
Sbjct  783   RLSVENVENIGIHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLT  842

Query  2942  LGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             L DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  843   LEDYQVVFSRPGNVAAFGDPFRNFPSAH  870


 Score =   293 bits (751),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 169/210 (80%), Gaps = 3/210 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKED-YLGGHAKTVTLDGVDLDLGFMVFN  573
             M+VAV+G G+SGL SA+ LA+  G   VV++EKE+ + GGH KT+  +GVDLD+GF+VFN
Sbjct  1     MKVAVIGGGVSGLGSAHDLAREDGIKEVVLFEKEESFFGGHGKTMRFEGVDLDIGFIVFN  60

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  753
              VT PNMMELF++LGVD+E+SDMSFSVSL+NG GYEWG+RNG S LFAQK+N+LNPYFW 
Sbjct  61    PVTCPNMMELFKNLGVDIEVSDMSFSVSLNNGRGYEWGTRNGLSSLFAQKRNILNPYFWH  120

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MI E  KFK D L+Y+EE + NPD DRN+TL EF+KS GYS LFQKAY++P C+SIW+C 
Sbjct  121   MITEFNKFKEDALNYIEEMERNPDTDRNETLREFVKSHGYSALFQKAYLVPACSSIWTCP  180

Query  934   SEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
              +  + FSAYS+LSFCRNHHLLQ F    W
Sbjct  181   IDSALNFSAYSVLSFCRNHHLLQIFERPQW  210



>ref|XP_009617895.1| PREDICTED: uncharacterized protein LOC104110155 isoform X5 [Nicotiana 
tomentosiformis]
Length=566

 Score =   949 bits (2453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/566 (81%), Positives = 503/566 (89%), Gaps = 0/566 (0%)
 Frame = +2

Query  1328  LHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQC  1507
             + +E   +     AWSAWNFLGT+N++VC+TYWLN LQNLG+T++PY VTLNPP TPE  
Sbjct  1     MKQEYLVLSNMFIAWSAWNFLGTMNDKVCVTYWLNILQNLGETERPYCVTLNPPHTPEHT  60

Query  1508  LLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKK  1687
             +LKWTTGHPVPSVAAS ASSEL +IQGKR IWFCGAYQGYGFHEDGLKAG IAA GLLK+
Sbjct  61    MLKWTTGHPVPSVAASIASSELHQIQGKRGIWFCGAYQGYGFHEDGLKAGAIAAQGLLKR  120

Query  1688  RCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKV  1867
               S LNNP HMVP+W ETGARLLVTRFL SFI TG IILLEEGGT+FTFEGT+ K+ LKV
Sbjct  121   NYSVLNNPKHMVPTWKETGARLLVTRFLKSFISTGCIILLEEGGTMFTFEGTENKSSLKV  180

Query  1868  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2047
              +RVHSP+FYWKVATQ DLGLADA+I GD SFVDK EGLLNLF IFV NRDL ASV+RS+
Sbjct  181   SLRVHSPRFYWKVATQGDLGLADAFIQGDFSFVDKNEGLLNLFMIFVNNRDLKASVTRSS  240

Query  2048  SKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  2227
              KRGWWTPLLFT+A++SAKYF+RH+S QNTLTQARRNISRHYDLSNELFSLFLDETMTYS
Sbjct  241   KKRGWWTPLLFTAAVSSAKYFVRHVSNQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  300

Query  2228  CAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGIT  2407
             CA+FKSE+EDLK AQ RKISLLI+KAK+SKEHHILEIGCGWGSLA+E  +RTGCKYTGIT
Sbjct  301   CAIFKSEEEDLKVAQERKISLLIEKAKVSKEHHILEIGCGWGSLAVEVAKRTGCKYTGIT  360

Query  2408  LSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFG  2587
             LSEQQLKYA+ +V++AGLQD+I FLLCDYRQLP+  RYDRIISCEMLEAVGHEFM EFF 
Sbjct  361   LSEQQLKYAQLRVQQAGLQDHITFLLCDYRQLPNMSRYDRIISCEMLEAVGHEFMEEFFT  420

Query  2588  RCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL  2767
              CES LA +G+LVLQFISIPDERYDEYRQSSDFIKEYIFPG CLP+LSRVTSAMAA+SRL
Sbjct  421   CCESALAGDGLLVLQFISIPDERYDEYRQSSDFIKEYIFPGACLPALSRVTSAMAAASRL  480

Query  2768  CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLG  2947
              VEHLEDIGIHYYQTLRCWR NFL++QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLG
Sbjct  481   SVEHLEDIGIHYYQTLRCWRKNFLQKQSQIHALGFDNKFIRTWEYYFDYCAAGFKTCTLG  540

Query  2948  DYQIVFSRPGNVTAFGDPYKGLASAY  3025
             DYQIVFSRPGN+ AFGDPY  + SAY
Sbjct  541   DYQIVFSRPGNIAAFGDPYSAVPSAY  566



>ref|XP_010532681.1| PREDICTED: uncharacterized protein LOC104808651 [Tarenaya hassleriana]
Length=871

 Score =   946 bits (2445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/679 (68%), Positives = 540/679 (80%), Gaps = 7/679 (1%)
 Frame = +2

Query  995   FCRIS--LQLF-GRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAG  1165
             FCR    LQLF GRPQ LTV   SH+YV KVR ELEKRGC+IR   EV SV+T E     
Sbjct  192   FCRDHHLLQLFVGRPQLLTVAGHSHTYVAKVRTELEKRGCKIRTSREVQSVTTSEDN---  248

Query  1166  GVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQS  1345
             GV + +G    +E +D CI+A HAPD L++LG+QAT DE R+LGAFQY YS IYLHR+  
Sbjct  249   GVTVRNGDGS-EEVFDRCILAMHAPDALRLLGEQATSDERRVLGAFQYDYSHIYLHRDTD  307

Query  1346  FMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTT  1525
             FMPRN   WSA NFLG   N+VC+TYWLN +QNLG+ ++ +  TLNP  TP++ LLKWTT
Sbjct  308   FMPRNPTVWSACNFLGNTENKVCVTYWLNAIQNLGEKRELFFATLNPDHTPKKALLKWTT  367

Query  1526  GHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLN  1705
             GHPVPSVAA  AS EL ++QGKR +WFCGAYQGYGFHEDGLK G+ AA  LL K  +  +
Sbjct  368   GHPVPSVAALTASHELSKVQGKRGLWFCGAYQGYGFHEDGLKGGIAAAQDLLGKNITFPS  427

Query  1706  NPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHS  1885
             NP H+VPS+ ET AR+ VTRF+  +I TG + LLE+GG+VF F G   K  LK ++++H+
Sbjct  428   NPKHIVPSFAETTARVFVTRFMGQYISTGYVTLLEDGGSVFKFGGKHPKCTLKSVMKIHN  487

Query  1886  PQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWW  2065
             PQFYWKV T+ADLGLADAYI+GDISFVDK EGLLN+  I +ANRDL++S S    KRGWW
Sbjct  488   PQFYWKVMTEADLGLADAYINGDISFVDKDEGLLNMIMILIANRDLNSSKSNLAKKRGWW  547

Query  2066  TPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKS  2245
             TP+ FT+ +ASAKYF++H  R+NTL QARRNIS HYDLSNELF+LFLDETMTYSCAVFKS
Sbjct  548   TPMFFTAGLASAKYFLKHAYRKNTLIQARRNISDHYDLSNELFALFLDETMTYSCAVFKS  607

Query  2246  EDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQL  2425
             +DEDL+TAQMRK+SLLIDKA+I K H +L+IGCGWG+LA+EAV RTGCKYTGITLS +QL
Sbjct  608   DDEDLRTAQMRKVSLLIDKARIEKNHEVLDIGCGWGTLAVEAVRRTGCKYTGITLSVEQL  667

Query  2426  KYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVL  2605
             KYAE K +EAGL+D I F L DY QL D+ +YDRIISC M+E VGHEFM  FF RCES L
Sbjct  668   KYAEAKAKEAGLEDRITFELRDYHQLSDSRKYDRIISCGMIEHVGHEFMEAFFNRCESAL  727

Query  2606  AENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE  2785
             AE G+LVLQF+SIPD RYDE R SSDFIKE+IFPGGCLPSL+RVTSAMA+SSRLC+EH+E
Sbjct  728   AEEGLLVLQFVSIPDSRYDENRLSSDFIKEHIFPGGCLPSLARVTSAMASSSRLCIEHVE  787

Query  2786  DIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVF  2965
             +IGI+YY+TLRCWR NFLERQ Q+  LGFD+KFIR WEYY DY AAGF T TLGDYQ+VF
Sbjct  788   NIGINYYKTLRCWRHNFLERQEQVKALGFDEKFIRKWEYYLDYFAAGFKTLTLGDYQVVF  847

Query  2966  SRPGNVTAFGDPYKGLASA  3022
             SRPGN   FGDPY    SA
Sbjct  848   SRPGNTAVFGDPYMSFPSA  866


 Score =   311 bits (798),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 141/202 (70%), Positives = 172/202 (85%), Gaps = 0/202 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+G G SGL +A+VLA+ G  VV+YEKE+ LGGHAKTV  DGVD+D+GFMVFNRV 
Sbjct  1     MRVAVIGGGTSGLGAAHVLARDGVEVVLYEKEENLGGHAKTVRFDGVDVDIGFMVFNRVM  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE LGVDME+SD SFSVSLD+G G EWGSRNG S LFAQK N+LNP+FWQMIR
Sbjct  61    YPNMMEFFEDLGVDMEVSDASFSVSLDSGRGIEWGSRNGLSSLFAQKSNVLNPHFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK+DVL Y+E  ++NP++DR +TLG+FIKS GYSELFQKAY++PMC SIWSC  + 
Sbjct  121   EMVKFKDDVLRYIEALESNPNLDRTETLGQFIKSHGYSELFQKAYVVPMCCSIWSCPYDR  180

Query  943   VMAFSAYSILSFCRNHHLLQNF  1008
             V++ SA+++L FCR+HHLLQ F
Sbjct  181   VLSSSAFTVLYFCRDHHLLQLF  202



>emb|CDY09021.1| BnaC01g30700D [Brassica napus]
Length=804

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 459/701 (65%), Positives = 544/701 (78%), Gaps = 35/701 (5%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQ+FGRPQWLTV  RS +YV KVR ELE+RGC+IR  C+V SV+T
Sbjct  120   FSAYSVLSFCRNHHLLQIFGRPQWLTVAGRSQTYVAKVRAELEQRGCKIRTSCKVESVAT  179

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E G     VI++ +   QE YD CI+A HAPD LK+LG+Q +               D+
Sbjct  180   SEDG----CVIVTTEEGSQEVYDKCILAVHAPDALKLLGEQGS--------------RDL  221

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH +   MPRN +AWSAWNFLG   N+  LTYWLN +QNLG+ + P+ +T+NP  TP++
Sbjct  222   YLHGDTDLMPRNTSAWSAWNFLGDSENKASLTYWLNIIQNLGEERDPFFLTINPEHTPKE  281

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKA---------G  1657
                KWTTGHP+PSV+  +AS EL  IQGKR IWFCGAYQGYGFHEDGLKA         G
Sbjct  282   TFFKWTTGHPLPSVSTWKASQELHNIQGKRGIWFCGAYQGYGFHEDGLKALLSYIINTAG  341

Query  1658  MIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1834
             M AA GLL K+  +PL+NP HMVPS  E GAR   TRFL +FI TG + +LEEGG+V+TF
Sbjct  342   MAAAQGLLGKQMVTPLSNPKHMVPSLTEKGARFFFTRFLRNFISTGCVTILEEGGSVYTF  401

Query  1835  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2014
                + +  LK ++ +HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLL+L  I +AN
Sbjct  402   ASKNSRCQLKSVLVIHSPQFYWKVMTQADLGLADAYINGDFSFVDKERGLLDLLMILIAN  461

Query  2015  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2194
             ++L+++ S    +RGWWTP+  T+++ASAK+F++H+SRQNTLTQARRNISRHYDLSNELF
Sbjct  462   KELNSNNSNHAKRRGWWTPMFLTASLASAKHFLKHVSRQNTLTQARRNISRHYDLSNELF  521

Query  2195  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDK-----AKISKEHHILEIGCGWGSL  2359
             +LFLD+TMTYS AVFKS DEDL+TAQMRKISLLIDK     A+I K H +LEIGCGWG+L
Sbjct  522   ALFLDDTMTYSSAVFKSNDEDLRTAQMRKISLLIDKSGKFQARIEKNHEVLEIGCGWGTL  581

Query  2360  AIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISC  2539
             AIE V RTGCKYTG+TLS +QLKYAE KV+EAGL+D I+F L DYRQL D  +YDRIISC
Sbjct  582   AIEVVRRTGCKYTGVTLSIEQLKYAEQKVKEAGLEDRIKFELYDYRQLSDAHKYDRIISC  641

Query  2540  EMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCL  2719
             EMLEAVGHEFM  FF  CE+ LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCL
Sbjct  642   EMLEAVGHEFMETFFTHCEAALAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCL  701

Query  2720  PSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWE  2899
             PSL RVTSAMA+SSRLCVE++E+IGIHYYQTLRCWR NFLERQ QI+DLGFD KFIRTWE
Sbjct  702   PSLGRVTSAMASSSRLCVENVENIGIHYYQTLRCWRKNFLERQKQIIDLGFDDKFIRTWE  761

Query  2900  YYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             YYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP+    SA
Sbjct  762   YYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPFHCFPSA  802


 Score =   207 bits (528),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 117/144 (81%), Gaps = 1/144 (1%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             M+E F++LGVDME+SDMSFSVSLD+G G EWG R+  S LFAQK+N+ +PYFW+MI EI 
Sbjct  1     MIEFFKNLGVDMEVSDMSFSVSLDSGRGCEWGCRS-LSSLFAQKRNIFSPYFWKMITEIK  59

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK DVL YLE+ + N DMDR  TLG F+KSRGYS+LFQKAY++P+C+ IWSC ++ V+ 
Sbjct  60    KFKEDVLKYLEDRERNLDMDRTKTLGGFLKSRGYSDLFQKAYLVPVCSLIWSCPADSVLN  119

Query  952   FSAYSILSFCRNHHLLQNFSPALW  1023
             FSAYS+LSFCRNHHLLQ F    W
Sbjct  120   FSAYSVLSFCRNHHLLQIFGRPQW  143



>dbj|BAJ93367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   942 bits (2436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/695 (66%), Positives = 554/695 (80%), Gaps = 9/695 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +    +FCR    LQ+FGRPQWLTVK RSH+YVNKVREELE  GC+I+  C
Sbjct  183   PSQGVLGFSAFFVLSFCRNHHLLQIFGRPQWLTVKGRSHTYVNKVREELESMGCQIKASC  242

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             +V SVS+ + G    V+ + G    +E YD  I  AHAP+ L+MLG +AT +ELRILGAF
Sbjct  243   QVKSVSSFDGGYK--VLEVGGS---EEVYDKIIFGAHAPEVLRMLGGEATHEELRILGAF  297

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYV+SDIYLHR+ + MP+N +AWSAWNFLGT ++ V +TYWLN LQN+  T +P+LVTLN
Sbjct  298   QYVHSDIYLHRDDTLMPQNPSAWSAWNFLGTTSSGVSVTYWLNLLQNIESTGRPFLVTLN  357

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP  P+  LLKW TGHPVPSVAA++AS EL++IQG R IWFCGAYQGYGFHEDG KAG  
Sbjct  358   PPHVPDHVLLKWNTGHPVPSVAAAKASLELQQIQGNRGIWFCGAYQGYGFHEDGHKAGKS  417

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLL ++ S L NP  MVPSW ETGARLLVTRFL  ++  G++ +LEEGGT+++F   
Sbjct  418   AAQGLLGQKSSLLLNPKQMVPSWTETGARLLVTRFLNQYVTIGNMTILEEGGTMYSFGEV  477

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             DKK L+K ++RVH P FYWKVAT+ADLG+ADAYI+G  SFVDK+EGLLNLF I +ANRD 
Sbjct  478   DKKCLVKTVLRVHDPLFYWKVATEADLGMADAYINGYFSFVDKREGLLNLFLILIANRDA  537

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               S + + SKRGWWTP+L T+ IASAKYF+RHISR+NT+TQ RRNIS+HYDLSN+ FSLF
Sbjct  538   QKSNNSAASKRGWWTPMLLTAGIASAKYFLRHISRKNTVTQTRRNISQHYDLSNDFFSLF  597

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD +MTYSCAVFK EDE L+ AQ RK++LLI KAK+ + HH+LEIG GWGSLA++ V++T
Sbjct  598   LDPSMTYSCAVFKVEDESLEVAQRRKVNLLIKKAKVERNHHVLEIGSGWGSLAMQVVKQT  657

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYAE KV+EAGL+D I FLLCDYRQ+P   +YDRIISCEM+E VGH
Sbjct  658   GCKYTGITLSEEQLKYAEMKVKEAGLEDRITFLLCDYRQIPSRSKYDRIISCEMIEGVGH  717

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TS
Sbjct  718   EFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITS  777

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL LGFD KFIR WEYYF YCAA
Sbjct  778   AMSAASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAILALGFDDKFIRVWEYYFIYCAA  837

Query  2924  GFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  3022
             GF + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  838   GFKSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  872


 Score =   304 bits (779),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 169/209 (81%), Gaps = 2/209 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAG+SGL +A+ LA+G A V VYE E+ LGGHA+T  +DGV LDLGFMVFNRVT
Sbjct  5     MRVAVVGAGVSGLAAAHELARGAARVTVYEAEEALGGHARTADVDGVHLDLGFMVFNRVT  64

Query  583   YPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             YPNM+E FE LGV+MEISDMS SVS  L  G   EWGSRNG SGL AQK N + P FW M
Sbjct  65    YPNMLEWFEELGVEMEISDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNAVRPAFWHM  124

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IREILKFK D L YLE+ ++NPD+DR++TLG+FIK+ GYS+LFQ+AY+IP+CASIWSC S
Sbjct  125   IREILKFKEDALKYLEDHESNPDLDRHETLGQFIKTHGYSQLFQEAYLIPICASIWSCPS  184

Query  937   EGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             +GV+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  185   QGVLGFSAFFVLSFCRNHHLLQIFGRPQW  213



>ref|NP_001147782.1| cyclopropane fatty acid synthase [Zea mays]
 gb|ACG28704.1| cyclopropane fatty acid synthase [Zea mays]
 tpg|DAA40492.1| TPA: cyclopropane fatty acid synthase [Zea mays]
Length=877

 Score =   942 bits (2434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/679 (66%), Positives = 546/679 (80%), Gaps = 7/679 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +    +FCR    LQLFGRPQWLTVK RSHSYV+KVREELE  GC+I+  C
Sbjct  187   PSQGVLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHSYVHKVREELESMGCQIKTSC  246

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             E+ SVS+ E G    V +  G    +E YD  I   HAPD LK+LG +AT +ELRILGAF
Sbjct  247   EIKSVSSSEGGFR--VTVFDGS---EETYDRIIFGVHAPDALKILGAEATHEELRILGAF  301

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH ++S MPR+L+AWS+WNFLGT +  VC+TYWLN LQN+  T +P+LVTLN
Sbjct  302   QYVYSDIYLHSDKSLMPRSLSAWSSWNFLGTTSKGVCVTYWLNLLQNIESTSRPFLVTLN  361

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP  P+   LKW T HPVPSVAA++AS EL  IQG R IWFCGAYQGYGFHEDGLKAG  
Sbjct  362   PPHVPDHVFLKWYTSHPVPSVAAAKASLELHHIQGNRGIWFCGAYQGYGFHEDGLKAGKA  421

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA  LL K    L NP  M+PSW E GARLLVTRFL  ++  G+++LLEEGGT+F+F   
Sbjct  422   AAQDLLGKESDLLVNPKQMIPSWSEAGARLLVTRFLGQYVSVGNLVLLEEGGTMFSFGEV  481

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              KK  +K ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDK+EGLLNLF I +ANRD 
Sbjct  482   GKKCHVKSVLRVHDPMFYWKVATEADLGLADAYINGYFSFVDKREGLLNLFLILIANRDA  541

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             + S S +  KRGWWTPLL T+ +ASAKYF+RHI+R+N+++Q R+NIS+HYDLSNE FSLF
Sbjct  542   NKSSSSAAGKRGWWTPLLLTAGVASAKYFLRHIARRNSVSQTRQNISQHYDLSNEFFSLF  601

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD +MTYSCA+FK+ED+ L+ AQ++K+ LLIDKAK+ ++HH+LEIGCGWGSLAI+ V++T
Sbjct  602   LDPSMTYSCAIFKTEDQSLEAAQLQKVCLLIDKAKVERDHHVLEIGCGWGSLAIQLVKQT  661

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS +QLKYA+ KV+EAGL+D+I F+LCDYRQ+P   +YDRIISCEM+E VGH
Sbjct  662   GCKYTGITLSVEQLKYAQRKVKEAGLEDHISFMLCDYRQIPTQRKYDRIISCEMIEGVGH  721

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M++FFG CES+LA++GI VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TS
Sbjct  722   EYMDDFFGCCESLLAQDGIFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITS  781

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  IL LGFD+KFIR WEYYF YCAA
Sbjct  782   AMSAASRLCIEHLENIGYHYYPTLIQWRDNFMANKDAILALGFDEKFIRIWEYYFIYCAA  841

Query  2924  GFHTCTLGDYQIVFSRPGN  2980
             GF + TLG+YQIVFSRPGN
Sbjct  842   GFKSRTLGNYQIVFSRPGN  860


 Score =   304 bits (779),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 174/217 (80%), Gaps = 10/217 (5%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDGVD------LDLGF  561
             MRVAVVGAG+SGL +A+ LA+ GG+ V VYEKEDYLGGHA+TV ++  D      LDLGF
Sbjct  1     MRVAVVGAGVSGLAAAHELARSGGSRVTVYEKEDYLGGHARTVAVEDADAASTVQLDLGF  60

Query  562   MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLD---NGHGYEWGSRNGFSGLFAQKKNL  732
             MVFNRVTYPNM+E FE LGV+MEISDMSFSVS +   +G   EWGSRNG SGL AQK N 
Sbjct  61    MVFNRVTYPNMLEWFEGLGVEMEISDMSFSVSTELGASGSRCEWGSRNGISGLLAQKSNA  120

Query  733   LNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMC  912
             L+P FW+MIREILKFKND L YLE+ +NNPDMDRN+TLG+FI+S GYS+ FQ+AY+ P+C
Sbjct  121   LSPSFWRMIREILKFKNDALRYLEDHENNPDMDRNETLGQFIRSHGYSQFFQEAYLTPIC  180

Query  913   ASIWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             A IWSC S+GV+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  181   ACIWSCPSQGVLGFSAFFVLSFCRNHHLLQLFGRPQW  217



>gb|EMS55075.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=826

 Score =   941 bits (2432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/695 (66%), Positives = 552/695 (79%), Gaps = 16/695 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F +    +FCR    LQ+FGRPQWLTVK RSH+YVNKVREELE  GC+I+  C+V SVS 
Sbjct  137   FSAFFVLSFCRNHHLLQIFGRPQWLTVKGRSHTYVNKVREELESMGCQIKTSCQVKSVSN  196

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E G    V+ +SG    +E YD  I  AHAPD L+MLG +AT +ELRILGAFQYV+SDI
Sbjct  197   FEGGYK--VLEVSGS---EEVYDKIIFGAHAPDVLRMLGDEATHEELRILGAFQYVHSDI  251

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLHR+ + MP+N +AWSAWNFL T ++ V +TYWLN LQN+  T +P+LVTLNPP  P+ 
Sbjct  252   YLHRDDTLMPQNPSAWSAWNFLRTTSSGVSVTYWLNLLQNIESTGRPFLVTLNPPHVPDH  311

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQG-------YGFHEDGLKAGMI  1663
              LLKW TGHPVPSVAA++AS EL++IQG R IWFCGAYQG       YGFHEDGLKAG  
Sbjct  312   VLLKWNTGHPVPSVAAAKASLELQQIQGNRGIWFCGAYQGNSFDYTGYGFHEDGLKAGKS  371

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLL ++ S L NP  MVPSW E GARLLVTRFL  ++  G++ +LEEGGT+F+F   
Sbjct  372   AAQGLLGQKSSLLLNPKQMVPSWTECGARLLVTRFLNQYVTIGNMTILEEGGTMFSFGEV  431

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             DKK L+K ++RVH P FYWKVAT+ADLG+ADAYI+G  SFVDK+EGLLNLF I +ANRD 
Sbjct  432   DKKCLVKTVLRVHDPLFYWKVATEADLGMADAYINGYFSFVDKREGLLNLFLILIANRDA  491

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               S + + SKRGWWTP+L T+ IASAKYF+RHISR+NT+TQ RRNIS+HYDLSN+ FS+F
Sbjct  492   QKSSNSAASKRGWWTPMLLTAGIASAKYFLRHISRKNTVTQTRRNISQHYDLSNDFFSIF  551

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD +MTYSCAVFK EDE L+ AQ RK++LLI KAK+ + HH+LEIG GWGSLA+E V++T
Sbjct  552   LDPSMTYSCAVFKVEDESLEVAQQRKVNLLIKKAKVERNHHVLEIGSGWGSLAMEVVKQT  611

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYA+ KV+EAGL+D I FLLCDYRQ+P  C+YDRIISCEM+E VGH
Sbjct  612   GCKYTGITLSEEQLKYAQKKVKEAGLEDRITFLLCDYRQIPGRCKYDRIISCEMIEGVGH  671

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TS
Sbjct  672   EFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITS  731

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL LGFD KFIR WEYYF YCAA
Sbjct  732   AMSAASRLCIEQVENIGYHYYSTLIRWRDNFMANKDAILALGFDDKFIRVWEYYFIYCAA  791

Query  2924  GFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  3022
             GF + TLG YQIVFSRPGN  +    +PY  L +A
Sbjct  792   GFKSRTLGTYQIVFSRPGNDKLACADNPYASLPAA  826


 Score =   219 bits (557),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 121/152 (80%), Gaps = 2/152 (1%)
 Frame = +1

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  747
             +VTYPNM+E FE LGV+MEISDMS SVS  L  G   EWGSRNG SGL AQK N L P F
Sbjct  9     QVTYPNMLEWFEELGVEMEISDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALRPAF  68

Query  748   WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWS  927
             W MIREILKFK D L YLE+ ++NPD+DR++TLG+FI++ GYS+LFQ+AY+IP+CASIWS
Sbjct  69    WHMIREILKFKEDALKYLEDHESNPDLDRHETLGQFIQTHGYSQLFQEAYLIPICASIWS  128

Query  928   CSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             C  +GV+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  129   CPLQGVLGFSAFFVLSFCRNHHLLQIFGRPQW  160



>ref|XP_006406026.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
 gb|ESQ47479.1| hypothetical protein EUTSA_v10020049mg [Eutrema salsugineum]
Length=855

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/687 (66%), Positives = 535/687 (78%), Gaps = 24/687 (3%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWL V  RS +YV KV  EL+++GC+IR GC V SVST
Sbjct  188   FSAYSVLSFCRNHQLLQLFGRPQWLAVAGRSQAYVAKVTAELKQQGCKIRTGCNVQSVST  247

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E G     V ++ ++  QE +D                 ++T DE RILGAFQY YSD+
Sbjct  248   SEDG----CVRVTTEDGSQEVFD-----------------KSTSDETRILGAFQYAYSDL  286

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLHR+   MPRNL AWS WNFL +  N+  LTYWLN +QNLG+   P+ +T NP  TP++
Sbjct  287   YLHRDTDLMPRNLVAWSVWNFLTSSGNKASLTYWLNIIQNLGEEHDPFFLTFNPEVTPKK  346

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLL-  1681
              L KWTT HP+PSV+A +AS E+ +IQGK  +WFCGAYQGYG HED LKAGM AA GLL 
Sbjct  347   TLFKWTTAHPLPSVSAWKASQEMNKIQGKHGLWFCGAYQGYGLHEDKLKAGMAAAQGLLG  406

Query  1682  KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLL  1861
             K   +PL+NP HMVPS  E GAR   TRFL  FI TG I +LEEGG+V TFEG D +  L
Sbjct  407   KDMVTPLSNPKHMVPSLTEKGARFFFTRFLRHFISTGCITILEEGGSVSTFEGKDSRCHL  466

Query  1862  KVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSR  2041
             K ++ +HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +AN+++++  S 
Sbjct  467   KSVLEIHSPQFYWKVMTQADLGLADAYINGDFSFVDKETGLLNLIMILIANKEMNSKNSN  526

Query  2042  SNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMT  2221
                KRGWWTP+  T+ IAS K+F++H+SRQNTLTQARRNISRHYDLSNELF+LFLD+TMT
Sbjct  527   GAKKRGWWTPMFLTAGIASTKHFLKHVSRQNTLTQARRNISRHYDLSNELFALFLDDTMT  586

Query  2222  YSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTG  2401
             YS AV+KS DEDL+TAQMRKISLLIDKA+I K H +LEIGCGWG+LAIE V RTGCKYTG
Sbjct  587   YSSAVYKSNDEDLRTAQMRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTGCKYTG  646

Query  2402  ITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEF  2581
             ITLS +QLKYAE+KV+EAGL+D I+F LCDYRQL +  +YDRIISCEMLEAVGHEFM  F
Sbjct  647   ITLSIEQLKYAEEKVKEAGLEDRIKFELCDYRQLSNAHKYDRIISCEMLEAVGHEFMETF  706

Query  2582  FGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASS  2761
             F  CE+ LAE+GI VLQFISIP+ERYDEYR SSDFIKEYIFPGGCLPSL+RVTSAMA+SS
Sbjct  707   FTHCEAALAEDGIFVLQFISIPEERYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMASSS  766

Query  2762  RLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCT  2941
             RLC+E++E+IGIHYYQTLR WR  FLER+ QI+DLGFD KFIRTWEYYFDYCAAGF T T
Sbjct  767   RLCIENVENIGIHYYQTLRSWRKTFLEREKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLT  826

Query  2942  LGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             LG+YQ+VFSRPGNV A GDP+    SA
Sbjct  827   LGNYQVVFSRPGNVAALGDPFHSFPSA  853


 Score =   300 bits (769),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 175/223 (78%), Gaps = 4/223 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKEDYLGGHAKTVTLDGVDLDL--GFMVF  570
             M+VAV+G GISGLVSA+VLA+  G   +V++EKE+ LGGHAKTV  DGVDLDL  GF+ F
Sbjct  1     MKVAVIGGGISGLVSAFVLAREDGVEELVLFEKEETLGGHAKTVRFDGVDLDLDLGFIAF  60

Query  571   NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  750
             NR+TYP+MME F++LGVD+E+ DMSFSVSLD+G G EWGSRNG S LFAQKKN+LNPYFW
Sbjct  61    NRITYPSMMEFFKNLGVDLEVLDMSFSVSLDSGKGCEWGSRNGLSSLFAQKKNILNPYFW  120

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSC  930
             +MI E +KFK DV  Y+EE ++NPD+DR +TLGEF+KS  YS +FQKAY++P C SIW C
Sbjct  121   KMITENMKFKKDVEKYIEELEHNPDIDRKETLGEFVKSHRYSNMFQKAYLVPACCSIWPC  180

Query  931   SSEGVMAFSAYSILSFCRNHHLLQNFSPALWSPTMAHCEAEVS  1059
             S + V+ FSAYS+LSFCRNH LLQ F    W       +A V+
Sbjct  181   SPDRVLNFSAYSVLSFCRNHQLLQLFGRPQWLAVAGRSQAYVA  223



>dbj|BAJ95828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=749

 Score =   939 bits (2428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/695 (66%), Positives = 554/695 (80%), Gaps = 9/695 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +    +FCR    LQ+FGRPQWLTVK RSH+YVNKVREELE  GC+I+  C
Sbjct  60    PSQGVLGFSAFFVLSFCRNHHLLQIFGRPQWLTVKGRSHTYVNKVREELESMGCQIKTSC  119

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             +V SVS+ + G    V+ + G    +E YD  I  AHAP+ L+MLG +AT +ELRILGAF
Sbjct  120   QVKSVSSFDGGYK--VLEVGGS---EEVYDKIIFGAHAPEVLRMLGGEATHEELRILGAF  174

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYV+SDIYLHR+ + MP+N +AWSAWNFLGT ++ V +TYWLN LQN+  T +P+LVTLN
Sbjct  175   QYVHSDIYLHRDDTLMPQNPSAWSAWNFLGTTSSGVSVTYWLNLLQNIESTGRPFLVTLN  234

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP  P+  LLKW TGHPVPSVAA++AS EL++IQG R IWFCGAYQGYGFHEDG KAG  
Sbjct  235   PPHVPDHVLLKWNTGHPVPSVAAAKASLELQQIQGNRGIWFCGAYQGYGFHEDGHKAGKS  294

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLL ++ S L NP  MVPSW ETGARLLVTRFL  ++  G++ +LEEGGT+++F   
Sbjct  295   AAQGLLGQKSSLLLNPKQMVPSWTETGARLLVTRFLNQYVTIGNMTILEEGGTMYSFGEV  354

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             DKK L+K ++RVH P FYWKVAT+ADLG+ADAYI+G  SFVDK+EGLLNLF I +ANRD 
Sbjct  355   DKKCLVKTVLRVHDPLFYWKVATEADLGMADAYINGYFSFVDKREGLLNLFLILIANRDA  414

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               S + + SKRGWWTP+L T+ IASAKYF+RHISR+NT+TQ RRNIS+HYDLSN+ FSLF
Sbjct  415   QKSNNSAASKRGWWTPMLLTAGIASAKYFLRHISRKNTVTQTRRNISQHYDLSNDFFSLF  474

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD +MTYSCAVFK EDE L+ AQ RK++LLI KAK+ + HH+LEIG GWGSLA++ V++T
Sbjct  475   LDPSMTYSCAVFKVEDESLEVAQRRKVNLLIKKAKVERNHHVLEIGSGWGSLAMQVVKQT  534

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYAE KV+EAGL+D I FLLCDYRQ+P   +YDRIISCEM+E VGH
Sbjct  535   GCKYTGITLSEEQLKYAEMKVKEAGLEDRITFLLCDYRQIPSRSKYDRIISCEMIEGVGH  594

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TS
Sbjct  595   EFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITS  654

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLC+E +E+IG HYY TL  WR NF+  +  IL LGFD KFIR WEYYF YCAA
Sbjct  655   AMSAASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAILALGFDDKFIRVWEYYFIYCAA  714

Query  2924  GFHTCTLGDYQIVFSRPGN--VTAFGDPYKGLASA  3022
             GF + TLG YQIVFSRPGN  +    +P+  L +A
Sbjct  715   GFKSRTLGTYQIVFSRPGNDKLANTDNPFASLPAA  749


 Score =   143 bits (360),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +1

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MIREILKFK D L YLE+ ++NPD+DR++TLG+FIK+ GYS+LFQ+AY+IP+CASIWSC 
Sbjct  1     MIREILKFKEDALKYLEDHESNPDLDRHETLGQFIKTHGYSQLFQEAYLIPICASIWSCP  60

Query  934   SEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             S+GV+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  61    SQGVLGFSAFFVLSFCRNHHLLQIFGRPQW  90



>ref|XP_008667917.1| PREDICTED: cyclopropane fatty acid synthase isoform X1 [Zea mays]
Length=807

 Score =   939 bits (2427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/679 (66%), Positives = 546/679 (80%), Gaps = 7/679 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +    +FCR    LQLFGRPQWLTVK RSHSYV+KVREELE  GC+I+  C
Sbjct  117   PSQGVLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHSYVHKVREELESMGCQIKTSC  176

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             E+ SVS+ E G    V +  G    +E YD  I   HAPD LK+LG +AT +ELRILGAF
Sbjct  177   EIKSVSSSEGGFR--VTVFDGS---EETYDRIIFGVHAPDALKILGAEATHEELRILGAF  231

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH ++S MPR+L+AWS+WNFLGT +  VC+TYWLN LQN+  T +P+LVTLN
Sbjct  232   QYVYSDIYLHSDKSLMPRSLSAWSSWNFLGTTSKGVCVTYWLNLLQNIESTSRPFLVTLN  291

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP  P+   LKW T HPVPSVAA++AS EL  IQG R IWFCGAYQGYGFHEDGLKAG  
Sbjct  292   PPHVPDHVFLKWYTSHPVPSVAAAKASLELHHIQGNRGIWFCGAYQGYGFHEDGLKAGKA  351

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA  LL K    L NP  M+PSW E GARLLVTRFL  ++  G+++LLEEGGT+F+F   
Sbjct  352   AAQDLLGKESDLLVNPKQMIPSWSEAGARLLVTRFLGQYVSVGNLVLLEEGGTMFSFGEV  411

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              KK  +K ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDK+EGLLNLF I +ANRD 
Sbjct  412   GKKCHVKSVLRVHDPMFYWKVATEADLGLADAYINGYFSFVDKREGLLNLFLILIANRDA  471

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             + S S +  KRGWWTPLL T+ +ASAKYF+RHI+R+N+++Q R+NIS+HYDLSNE FSLF
Sbjct  472   NKSSSSAAGKRGWWTPLLLTAGVASAKYFLRHIARRNSVSQTRQNISQHYDLSNEFFSLF  531

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD +MTYSCA+FK+ED+ L+ AQ++K+ LLIDKAK+ ++HH+LEIGCGWGSLAI+ V++T
Sbjct  532   LDPSMTYSCAIFKTEDQSLEAAQLQKVCLLIDKAKVERDHHVLEIGCGWGSLAIQLVKQT  591

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS +QLKYA+ KV+EAGL+D+I F+LCDYRQ+P   +YDRIISCEM+E VGH
Sbjct  592   GCKYTGITLSVEQLKYAQRKVKEAGLEDHISFMLCDYRQIPTQRKYDRIISCEMIEGVGH  651

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M++FFG CES+LA++GI VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TS
Sbjct  652   EYMDDFFGCCESLLAQDGIFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITS  711

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  IL LGFD+KFIR WEYYF YCAA
Sbjct  712   AMSAASRLCIEHLENIGYHYYPTLIQWRDNFMANKDAILALGFDEKFIRIWEYYFIYCAA  771

Query  2924  GFHTCTLGDYQIVFSRPGN  2980
             GF + TLG+YQIVFSRPGN
Sbjct  772   GFKSRTLGNYQIVFSRPGN  790


 Score =   214 bits (545),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 118/147 (80%), Gaps = 3/147 (2%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLD---NGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             M+E FE LGV+MEISDMSFSVS +   +G   EWGSRNG SGL AQK N L+P FW+MIR
Sbjct  1     MLEWFEGLGVEMEISDMSFSVSTELGASGSRCEWGSRNGISGLLAQKSNALSPSFWRMIR  60

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EILKFKND L YLE+ +NNPDMDRN+TLG+FI+S GYS+ FQ+AY+ P+CA IWSC S+G
Sbjct  61    EILKFKNDALRYLEDHENNPDMDRNETLGQFIRSHGYSQFFQEAYLTPICACIWSCPSQG  120

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             V+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  121   VLGFSAFFVLSFCRNHHLLQLFGRPQW  147



>ref|XP_006406025.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
 gb|ESQ47478.1| hypothetical protein EUTSA_v10020040mg [Eutrema salsugineum]
Length=869

 Score =   936 bits (2419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/687 (65%), Positives = 544/687 (79%), Gaps = 8/687 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQL+GRPQWL V   S +YV+KVR ELE+RGC+IR  C V SVST
Sbjct  186   FSAYSVLSFCRNYQLLQLYGRPQWLNVAGHSKTYVSKVRVELEQRGCKIRTSCIVKSVST  245

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E G     V ++ ++  QE +D CI+A HAPD L++LG+QAT DE R+LGAFQY YSD+
Sbjct  246   SEDG----YVTVTTEDGSQEVFDRCILAVHAPDALRLLGEQATTDETRVLGAFQYNYSDL  301

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLHR+   MPRNL AWSAWNFL +  N+  LTYWLN +QNLGD   P+ +T NP  TP+ 
Sbjct  302   YLHRDTDLMPRNLVAWSAWNFLSS-QNKANLTYWLNLMQNLGDEHDPFFLTFNPEVTPKN  360

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLL-  1681
              LLKWTTGHP+PSV+A +AS E+ +IQGKR +WFCG+YQGYGFHEDGLKAG+ AAH LL 
Sbjct  361   TLLKWTTGHPMPSVSAWKASQEMIKIQGKRSVWFCGSYQGYGFHEDGLKAGIAAAHSLLG  420

Query  1682  KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLL  1861
             K   +PL NP HMV S  E GAR   TRFL  FI TG + ++EEGG V+TFEG D +  L
Sbjct  421   KDMVTPLRNPKHMVLSLTEKGARFFFTRFLRHFISTGCLQIIEEGGLVYTFEGKDSRCHL  480

Query  1862  KVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSR  2041
             K ++ +HSP+FYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +AN++L++  S 
Sbjct  481   KSVLEIHSPEFYWKVMTQADLGLADAYINGDFSFVDKETGLLNLIMILIANKELNSKNST  540

Query  2042  SNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMT  2221
                KRGWW P+   + IAS K+F++H+S+QNTLTQARRNISRHYDLSNELF+LFLD+TM+
Sbjct  541   FAKKRGWWPPMFLIAGIASTKHFLKHVSKQNTLTQARRNISRHYDLSNELFALFLDDTMS  600

Query  2222  YSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTG  2401
             YS AV+KS+DEDL+TAQ+RKISLLIDKA+I K H +LEIG GWG+ AIE V +TGCKYTG
Sbjct  601   YSSAVYKSDDEDLRTAQLRKISLLIDKARIEKNHEVLEIGFGWGTFAIEVVRKTGCKYTG  660

Query  2402  ITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEF  2581
             ITLS +QLKYA++KV+EAGL+D I+F LCDYRQL +  +YDRIISCEM+E +GHEFM  F
Sbjct  661   ITLSVEQLKYAKEKVKEAGLEDRIKFELCDYRQLSNAHKYDRIISCEMMEHIGHEFMETF  720

Query  2582  FGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASS  2761
             F  CE+ LAE+GI+V QFI+IP+ERY+EYR +SDF++EYIFPGGCLPSL+RVTSAMA+SS
Sbjct  721   FSHCEAALAEDGIIVHQFIAIPEERYNEYRLNSDFVREYIFPGGCLPSLARVTSAMASSS  780

Query  2762  RLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCT  2941
             RLCVE++E+IG HYY+TLR WR NFLE + QI+DLGFD KFIRTWEYYFDY AA   T T
Sbjct  781   RLCVENVENIGNHYYKTLRSWRKNFLENEKQIMDLGFDDKFIRTWEYYFDYSAAALKTLT  840

Query  2942  LGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             + DYQ+VFSRPGNV A GDP++   SA
Sbjct  841   IADYQVVFSRPGNVAALGDPFRSFPSA  867


 Score =   298 bits (763),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 173/221 (78%), Gaps = 2/221 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             MRVAV+G+GISGL SAYVLAK  G   +V++EKE+ LGGHAKT+  DGVDLDLGF VFN 
Sbjct  1     MRVAVIGSGISGLGSAYVLAKEDGIEELVLFEKENSLGGHAKTMRFDGVDLDLGFTVFNP  60

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT PNMME F++LGVD+E+S+MS SVSLDNG G EWGSRNG S LFAQKKN+LNPYFW+M
Sbjct  61    VTSPNMMEFFKNLGVDLEVSEMSLSVSLDNGTGCEWGSRNGLSSLFAQKKNVLNPYFWKM  120

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             + E  KFK DV  Y+EE +  PD+DRN+TLGEF+KS GYS++FQKAY++P C SIW CS 
Sbjct  121   LIENNKFKEDVEKYIEELERKPDIDRNETLGEFLKSHGYSDMFQKAYLVPACCSIWPCSP  180

Query  937   EGVMAFSAYSILSFCRNHHLLQNFSPALWSPTMAHCEAEVS  1059
             + V+ FSAYS+LSFCRN+ LLQ +    W     H +  VS
Sbjct  181   DRVLNFSAYSVLSFCRNYQLLQLYGRPQWLNVAGHSKTYVS  221



>ref|XP_010670959.1| PREDICTED: uncharacterized protein LOC104887889 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=877

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/690 (65%), Positives = 548/690 (79%), Gaps = 11/690 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  ++CR    LQL G PQWLTV+     YVNK+REELE RGC+IR  CEV SV T
Sbjct  189   FSAFSVLSYCRNHHLLQLSGCPQWLTVRGGFQHYVNKLREELEVRGCQIRNNCEVPSVYT  248

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
             D++G    +V   G    ++AYDGCI+A  APD +K+LGK+AT DELRILGAFQY+YSD+
Sbjct  249   DDRGCT--LVFGDGS---EDAYDGCILAVPAPDAIKILGKEATHDELRILGAFQYIYSDL  303

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLH ++SF+P+N A WSA NF+ T  N +CLTYWLN L N+  TKQ  LVT NPP  P++
Sbjct  304   YLHHDKSFLPQNSATWSALNFMETTENNMCLTYWLNVLLNIAKTKQHLLVTCNPPHLPKE  363

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TG  VPSVAA RAS EL  IQGKR IWFCGAY GYGFHEDGLKAG++AAH +LK
Sbjct  364   FLLKWSTGQYVPSVAALRASFELGNIQGKRGIWFCGAYHGYGFHEDGLKAGLVAAHAILK  423

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             +  +PL NP  M+ SW E  AR  + +FL  FI  G IILLEEGG V TFEG+DK+   K
Sbjct  424   RNFTPLTNPKQMILSWTEAAARRFLIKFLEGFISVGCIILLEEGGAVLTFEGSDKRYTWK  483

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++RVH+PQFYWKVAT+AD G ADAYI+GDISFVDK EGLLNLF+I +AN+ LS S + +
Sbjct  484   TVLRVHNPQFYWKVATEADFGFADAYINGDISFVDKDEGLLNLFRIILANQYLSPSAAMA  543

Query  2045  NSK----RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2212
             + K    +GWWTP+LFT+ IASAKYF +H+ R+NT+T AR+NI+ HYDLSNE+FSLFLDE
Sbjct  544   DKKSLDFKGWWTPMLFTAGIASAKYFYKHVCRRNTVTAARQNIASHYDLSNEMFSLFLDE  603

Query  2213  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2392
             TMTYSCA+FKSE+EDLK AQ+RK+ LLI KA++ + H +L+IGCGWGSLAIE V +TGCK
Sbjct  604   TMTYSCAIFKSENEDLKVAQLRKLHLLIKKARVEQHHEVLDIGCGWGSLAIEVVRKTGCK  663

Query  2393  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2572
             YTGITL+E+QLK AE +V+EAGLQDNI+FLLCDYRQLP  C+YDRIISC M+E VGHE+ 
Sbjct  664   YTGITLAEEQLKLAEQRVKEAGLQDNIQFLLCDYRQLPAACKYDRIISCGMIEHVGHEYY  723

Query  2573  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2752
              +FF  CESVLA+NG+LVLQFIS+PDE YD +R+SS F+ EYIFPGGCLPSLSR+TSAM 
Sbjct  724   EDFFRTCESVLADNGLLVLQFISVPDELYDGFRRSSGFVYEYIFPGGCLPSLSRITSAMV  783

Query  2753  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2932
             ++SRLCVEH+E+IGIHY QTLRCWR NFLE  S+I  LGFD+KF+R WEYYFDY A+ F 
Sbjct  784   SASRLCVEHVENIGIHYGQTLRCWRKNFLENHSKIRSLGFDEKFMRAWEYYFDYTASAFK  843

Query  2933  TCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             T  LGDYQIVFSR GN+ AF DPY+ ++S+
Sbjct  844   TRALGDYQIVFSRLGNLVAFSDPYETISSS  873


 Score =   255 bits (652),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGA-GVVVYEKEDYLG--GHAKTVTLDGVDLD--LGFMV  567
             MR+AV+G GI G+  A+ LAK G   VV+Y+K+DYLG   H KTV +DGVDLD  LGFM 
Sbjct  1     MRIAVIGGGICGVGVAFELAKAGIHQVVLYDKDDYLGETTHTKTVNIDGVDLDIDLGFMF  60

Query  568   FNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  747
             FNRV+YPN+ EL +SLG+D+  SDMSFSVSL+ G G EWG+RNG   L+AQK N L P +
Sbjct  61    FNRVSYPNLTELMDSLGIDIVASDMSFSVSLNKGQGCEWGNRNGLRSLYAQKSNALKPSY  120

Query  748   WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWS  927
             W M++EI KF++DV+ YLE  ++NPDMDR +TL  FI++R +S+LFQK Y++PMCASIWS
Sbjct  121   WGMLQEIKKFEDDVILYLEGLESNPDMDRTETLSHFIETRNFSDLFQKGYLVPMCASIWS  180

Query  928   CSSEGVMAFSAYSILSFCRNHHLLQ  1002
             CS+E VM FSA+S+LS+CRNHHLLQ
Sbjct  181   CSAEKVMEFSAFSVLSYCRNHHLLQ  205



>ref|XP_006489664.1| PREDICTED: uncharacterized protein LOC102612222 isoform X3 [Citrus 
sinensis]
Length=674

 Score =   935 bits (2416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/651 (69%), Positives = 534/651 (82%), Gaps = 5/651 (1%)
 Frame = +2

Query  1073  KVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLK  1252
              V  +L+  GC+IR  CEV+SV   ++G    VV   G    QE Y  C+MA HAPD L+
Sbjct  27    NVTGQLQSWGCQIRTSCEVYSVYPADEGCT--VVSSDGS---QENYSCCVMAVHAPDALR  81

Query  1253  MLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLN  1432
             +LG QAT DE RILGAF+YVYSDI+LHR+ +FMP+N AAWSAWNFLG+ + ++CLTYWLN
Sbjct  82    ILGNQATLDETRILGAFRYVYSDIFLHRDTNFMPQNTAAWSAWNFLGSTDGKICLTYWLN  141

Query  1433  TLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCG  1612
              LQN+G+T  P+L TLNP  TPE   LKW+T + VPSVAAS+AS  ++ IQGKR IWFCG
Sbjct  142   VLQNIGETGVPFLATLNPDHTPENTSLKWSTSYQVPSVAASKASLAVDLIQGKRGIWFCG  201

Query  1613  AYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTG  1792
             AYQGYGF EDGLKAGMI AHG+L K C+ L+NP HMVPS  E GARL V RFL  +I TG
Sbjct  202   AYQGYGFQEDGLKAGMITAHGVLGKNCAVLSNPKHMVPSLLEKGARLFVARFLRRYISTG  261

Query  1793  SIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDK  1972
              +ILLEEGGT+FTFEGT + + LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK
Sbjct  262   CLILLEEGGTIFTFEGTLRNSPLKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDK  321

Query  1973  KEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQAR  2152
              EGLLNLF I +AN+D  +S S+   KRGWW+P+ FT++IASAKYF R+ISR+N+LTQAR
Sbjct  322   DEGLLNLFLIVIANQDFDSSTSKLKKKRGWWSPMFFTASIASAKYFFRNISRKNSLTQAR  381

Query  2153  RNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHIL  2332
             RN+SRHYDL+NELFSLFLD++MTYSCA+FKSE EDL+  QMRK+S+LI+KA++SK   +L
Sbjct  382   RNVSRHYDLNNELFSLFLDKSMTYSCAIFKSEHEDLEVGQMRKVSVLIEKARVSKGQEVL  441

Query  2333  EIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDN  2512
             +IGCGWG+LAIE V++TGCKYTGITLSE+QLKYAE KVREAGLQD+IRF LCDYRQLP  
Sbjct  442   DIGCGWGTLAIEIVKQTGCKYTGITLSEEQLKYAEIKVREAGLQDHIRFYLCDYRQLPKA  501

Query  2513  CRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIK  2692
              +YDRIISC M+E VGH++M EFFG CES+LA +G+LVLQFIS PD+ YDEYR S  FIK
Sbjct  502   NKYDRIISCGMIEHVGHDYMEEFFGCCESLLATHGLLVLQFISAPDQCYDEYRLSPGFIK  561

Query  2693  EYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGF  2872
             EYIFPGGCLPSL RVTSAM +SS LCVEHLE+IGIHYYQTLRCWR NF+ +QS+IL LGF
Sbjct  562   EYIFPGGCLPSLGRVTSAMTSSSGLCVEHLENIGIHYYQTLRCWRKNFMGKQSEILALGF  621

Query  2873  DKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             ++KFIRTWEYYFDYCAA F +  +GDYQIVFSRPG V AF DPY+G  SAY
Sbjct  622   NEKFIRTWEYYFDYCAASFKSRIIGDYQIVFSRPGKVAAFRDPYEGFPSAY  672



>ref|XP_004957293.1| PREDICTED: uncharacterized protein LOC101772901 [Setaria italica]
Length=880

 Score =   934 bits (2414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 454/694 (65%), Positives = 544/694 (78%), Gaps = 8/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +    +FCR    LQLFGRPQWLTVK RSH+YV KVREELE  GC I+  C
Sbjct  187   PSQGVLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHTYVQKVREELESLGCLIKTSC  246

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             E+ SVS+ + G    V  + G    +E YD  I   HAPD LK+LG +AT +ELRILGAF
Sbjct  247   EIKSVSSSDGGLR--VTTVDGS---EETYDRVIFGVHAPDALKLLGAEATHEELRILGAF  301

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH ++S MPR+ +AWS+WNFLGT +  VC+TYWLN LQN+  T +P+LVTLN
Sbjct  302   QYVYSDIYLHCDKSMMPRSSSAWSSWNFLGTTSKGVCVTYWLNLLQNIESTDRPFLVTLN  361

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP  P+  LLKW T HPVPSVAA++AS EL  IQG R IWFCGAYQGYGFHEDGLKAG  
Sbjct  362   PPHVPDHVLLKWYTSHPVPSVAAAKASLELHHIQGNRGIWFCGAYQGYGFHEDGLKAGKS  421

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA  LL  +   L NP  M+PSW E GARLLV RFL  +I  G+++LLEEGGT+F+F   
Sbjct  422   AAQDLLGNKKGLLENPKQMIPSWTEAGARLLVARFLGQYISVGNLVLLEEGGTMFSFGEA  481

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              KK   K ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDK+EGLLNLF I +ANRD 
Sbjct  482   GKKCHAKSVLRVHDPMFYWKVATEADLGLADAYINGYFSFVDKREGLLNLFLILIANRDA  541

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             + S S   SKRGWWTPLL T+ +ASAKYF+RHISR+N++TQ R+NIS+HYDLSNE FSLF
Sbjct  542   NKSTSSGTSKRGWWTPLLLTAGVASAKYFLRHISRKNSVTQTRQNISQHYDLSNEFFSLF  601

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD +MTYSCA+FK+EDE L+ AQ RKI LLIDKAK+ ++HH+LEIGCGWGSLAI+ V++T
Sbjct  602   LDPSMTYSCAIFKTEDESLEAAQRRKIGLLIDKAKVERDHHVLEIGCGWGSLAIQLVKQT  661

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS +QL+YA+ KV+EAGL+D+I F+LCDYRQ+P   +YDRIISCEM+E VGH
Sbjct  662   GCKYTGITLSVEQLQYAQKKVKEAGLEDHISFMLCDYRQIPTRRKYDRIISCEMIEGVGH  721

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TS
Sbjct  722   EYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITS  781

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLC+EHLE+IG HYY TL  WR NF+  +  I  LGFD KFIR WEYYF YCAA
Sbjct  782   AMSAASRLCIEHLENIGYHYYPTLIRWRDNFMANKDAISALGFDDKFIRIWEYYFIYCAA  841

Query  2924  GFHTCTLGDYQIVFSRPGN-VTAFGDPYKGLASA  3022
             GF + TLG+YQIVFSRPGN      DPY    +A
Sbjct  842   GFKSRTLGNYQIVFSRPGNDKLGDNDPYASFPAA  875


 Score =   299 bits (766),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 147/217 (68%), Positives = 172/217 (79%), Gaps = 10/217 (5%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAG--VVVYEKEDYLGGHAKTVTLD-----GVDLDLGF  561
             MRVAVVGAG+SGL +A+ LA+ GAG  V VYEKED LGGHA+TV ++      V LDLGF
Sbjct  1     MRVAVVGAGVSGLAAAHELARSGAGARVTVYEKEDCLGGHARTVAVEDAAAGTVHLDLGF  60

Query  562   MVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHG---YEWGSRNGFSGLFAQKKNL  732
             MVFNRVTYPNM+E FE LGV+MEISDMSFSVS   G G    EWGSRNG SGL AQK N 
Sbjct  61    MVFNRVTYPNMLEWFEGLGVEMEISDMSFSVSTQLGTGGSRCEWGSRNGISGLLAQKSNA  120

Query  733   LNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMC  912
             ++P FW MIREILKFK+D L YLE+ +NNPDMDRN+TLG+FI+S GYS+ FQ+AY+IP+C
Sbjct  121   ISPSFWCMIREILKFKDDALKYLEDRENNPDMDRNETLGQFIQSHGYSQFFQEAYLIPIC  180

Query  913   ASIWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             A IWSC S+GV+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  181   ACIWSCPSQGVLGFSAFFVLSFCRNHHLLQLFGRPQW  217



>ref|XP_003581006.1| PREDICTED: uncharacterized protein LOC100842201 isoform X1 [Brachypodium 
distachyon]
Length=876

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/695 (66%), Positives = 553/695 (80%), Gaps = 9/695 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +    +FCR    LQ+FGRPQWLT+K RSHSYVNKVREELE  GC I+  C
Sbjct  187   PSQGVLGFSAFFVLSFCRNHHLLQIFGRPQWLTIKGRSHSYVNKVREELESMGCRIKTNC  246

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             +V SVS+ E G    V+ + G    +E YD  I  AHAPD L+ML  +AT +ELRILGAF
Sbjct  247   QVKSVSSFEGGHR--VLEVDGS---EEVYDKIIFGAHAPDALRMLRDEATHEELRILGAF  301

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLHR++S MPRN +AWSAWNFLGT ++ V +TYWLN LQN+    +P+LVTLN
Sbjct  302   QYVYSDIYLHRDKSLMPRNSSAWSAWNFLGTTSSGVSVTYWLNLLQNIESKGRPFLVTLN  361

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP  P+  LLKW T HPVPSVAA++AS EL +IQGKR IWFCGAYQGYGFHEDG KAG  
Sbjct  362   PPHVPDHVLLKWNTSHPVPSVAAAKASLELNQIQGKRGIWFCGAYQGYGFHEDGSKAGKS  421

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLL K+   L NP  MVPSW E GARLLVTRFL  +I  G++ +LE+GGT+F+F   
Sbjct  422   AAQGLLGKKIDLLLNPKQMVPSWTEAGARLLVTRFLNQYITIGNLTILEQGGTMFSFGEV  481

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             DKK L+K ++RVH P FYWKVAT+ADLGLADAY++G  SFVDK+EGLLNLF I +ANRD 
Sbjct  482   DKKCLVKSVLRVHDPLFYWKVATEADLGLADAYVNGYFSFVDKREGLLNLFLILIANRDT  541

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               S S + SKRGWWTPLL T+ IASAKYF+RH+SR+NT+TQ R+NIS+HYDLSN+ FSLF
Sbjct  542   QKSSSSAASKRGWWTPLLLTAGIASAKYFLRHVSRKNTVTQTRQNISQHYDLSNDFFSLF  601

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD +MTYSCA+FK EDE L+ AQ+RK++LLIDKAK+ ++HH+LEIG GWG LA++ V++T
Sbjct  602   LDPSMTYSCAIFKVEDESLEVAQLRKVNLLIDKAKVERDHHVLEIGSGWGCLAMQVVKQT  661

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYA+ KV+EAGL+D I FLLCDYRQ+P   +YDRIISCEM+E VGH
Sbjct  662   GCKYTGITLSEEQLKYAQMKVKEAGLEDRITFLLCDYRQIPILRKYDRIISCEMIEGVGH  721

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM++FFG CES+LA++G+LVLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TS
Sbjct  722   EFMDDFFGCCESLLAQDGLLVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITS  781

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLC+E +E+IG HYY TL  WR NF   +  I  LGFD KFIR WEYYF YCAA
Sbjct  782   AMSAASRLCIEQVENIGYHYYPTLVRWRDNFFANKYAISALGFDDKFIRIWEYYFMYCAA  841

Query  2924  GFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  3022
             GF + TLG+YQIVFSRPGN   A+ D PY  L +A
Sbjct  842   GFKSRTLGNYQIVFSRPGNDKLAYADNPYASLPAA  876


 Score =   295 bits (754),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 163/211 (77%), Gaps = 5/211 (2%)
 Frame = +1

Query  406   RVAVVGAGISGLVSAYVLAKGGAG---VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             RVAVVGAG+SGL +A+ L + G     V VYE E+ LGGHA+T  +DGV LDLGFMVFNR
Sbjct  7     RVAVVGAGVSGLAAAHELCRAGGNGVRVTVYEAEERLGGHARTADVDGVQLDLGFMVFNR  66

Query  577   VTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  750
             VTYPNM+E FE LGV+ME SDMS SVS  L  G   EWGSRNG SGL AQK N L P FW
Sbjct  67    VTYPNMLEWFEGLGVEMETSDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALRPGFW  126

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSC  930
              MIREILKFK DVLSYL   +NNPD+DRN+TLGEFIK  GYS+LFQ+AY+IP+CA IWSC
Sbjct  127   HMIREILKFKEDVLSYLSNHENNPDLDRNETLGEFIKMHGYSQLFQEAYLIPICACIWSC  186

Query  931   SSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
              S+GV+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  187   PSQGVLGFSAFFVLSFCRNHHLLQIFGRPQW  217



>ref|XP_006489666.1| PREDICTED: uncharacterized protein LOC102613225 isoform X1 [Citrus 
sinensis]
Length=674

 Score =   931 bits (2405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/651 (68%), Positives = 535/651 (82%), Gaps = 5/651 (1%)
 Frame = +2

Query  1073  KVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLK  1252
              V  +L+  GC+IR  CEV+SV   ++G    VV   G    QE Y  C+MA HAPD L+
Sbjct  27    NVTGQLQSWGCQIRTSCEVYSVYPADEGCT--VVSSDGS---QENYSCCVMAVHAPDALR  81

Query  1253  MLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLN  1432
             +LG QAT DE RILGAF+YVYSDI+LHR+++FMP+N AAWSAWNFLG+ + ++CLTYWLN
Sbjct  82    ILGNQATLDETRILGAFRYVYSDIFLHRDKNFMPQNTAAWSAWNFLGSTDGKICLTYWLN  141

Query  1433  TLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCG  1612
              LQN G+T  P+L TLNP  TPE  LLKW+T +  PSVAAS+AS  ++ IQGKR IWFCG
Sbjct  142   VLQNNGETGVPFLATLNPDHTPENTLLKWSTSNQAPSVAASKASLAVDLIQGKRGIWFCG  201

Query  1613  AYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTG  1792
             AYQGYGF EDGLKAGMI AHG+L K C+ L+ P HMVPS  E GARL V  F   +I TG
Sbjct  202   AYQGYGFQEDGLKAGMITAHGVLGKNCAVLSKPKHMVPSLLEKGARLFVAGFFRRYISTG  261

Query  1793  SIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDK  1972
              +ILLEEGGT+FTFEG  + + LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK
Sbjct  262   CLILLEEGGTIFTFEGALRNSPLKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDK  321

Query  1973  KEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQAR  2152
              EGLLNLF I +AN+DL++S S+   KRGWW+P+ FT++IASAK F RHISR+NTLTQAR
Sbjct  322   DEGLLNLFLILIANQDLNSSASKLKQKRGWWSPMFFTASIASAKCFFRHISRKNTLTQAR  381

Query  2153  RNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHIL  2332
             RN+SRHYDLSNELFSLFLD++MTYSCA+FKSE EDL+  QMRKIS+LI+KA++SK   +L
Sbjct  382   RNVSRHYDLSNELFSLFLDKSMTYSCAIFKSEHEDLEVGQMRKISVLIEKARVSKGQEVL  441

Query  2333  EIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDN  2512
             +IGCGWG+LAIE V++TGCKYTGITLS++QLKYA+ KVREAGLQD+IRF LCDYRQLP  
Sbjct  442   DIGCGWGTLAIEIVKQTGCKYTGITLSKEQLKYAQIKVREAGLQDHIRFYLCDYRQLPKA  501

Query  2513  CRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIK  2692
              +YDRIISCEM+E VGH++M EFF  CES+LA++G+LVLQF S PD+ YDEYR S  F+ 
Sbjct  502   NKYDRIISCEMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYDEYRLSPGFLN  561

Query  2693  EYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGF  2872
             EYIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS+IL LGF
Sbjct  562   EYIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQSEILALGF  621

Query  2873  DKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             ++KFIRTWEYYFDYCAA F +  +G+YQIVFSRPGNV AF +PY+GL SAY
Sbjct  622   NEKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGNVAAFSNPYEGLPSAY  672



>ref|XP_010239672.1| PREDICTED: uncharacterized protein LOC100842201 isoform X2 [Brachypodium 
distachyon]
Length=821

 Score =   929 bits (2401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 460/695 (66%), Positives = 553/695 (80%), Gaps = 9/695 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +    +FCR    LQ+FGRPQWLT+K RSHSYVNKVREELE  GC I+  C
Sbjct  132   PSQGVLGFSAFFVLSFCRNHHLLQIFGRPQWLTIKGRSHSYVNKVREELESMGCRIKTNC  191

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             +V SVS+ E G    V+ + G    +E YD  I  AHAPD L+ML  +AT +ELRILGAF
Sbjct  192   QVKSVSSFEGGHR--VLEVDGS---EEVYDKIIFGAHAPDALRMLRDEATHEELRILGAF  246

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLHR++S MPRN +AWSAWNFLGT ++ V +TYWLN LQN+    +P+LVTLN
Sbjct  247   QYVYSDIYLHRDKSLMPRNSSAWSAWNFLGTTSSGVSVTYWLNLLQNIESKGRPFLVTLN  306

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP  P+  LLKW T HPVPSVAA++AS EL +IQGKR IWFCGAYQGYGFHEDG KAG  
Sbjct  307   PPHVPDHVLLKWNTSHPVPSVAAAKASLELNQIQGKRGIWFCGAYQGYGFHEDGSKAGKS  366

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA GLL K+   L NP  MVPSW E GARLLVTRFL  +I  G++ +LE+GGT+F+F   
Sbjct  367   AAQGLLGKKIDLLLNPKQMVPSWTEAGARLLVTRFLNQYITIGNLTILEQGGTMFSFGEV  426

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             DKK L+K ++RVH P FYWKVAT+ADLGLADAY++G  SFVDK+EGLLNLF I +ANRD 
Sbjct  427   DKKCLVKSVLRVHDPLFYWKVATEADLGLADAYVNGYFSFVDKREGLLNLFLILIANRDT  486

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               S S + SKRGWWTPLL T+ IASAKYF+RH+SR+NT+TQ R+NIS+HYDLSN+ FSLF
Sbjct  487   QKSSSSAASKRGWWTPLLLTAGIASAKYFLRHVSRKNTVTQTRQNISQHYDLSNDFFSLF  546

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD +MTYSCA+FK EDE L+ AQ+RK++LLIDKAK+ ++HH+LEIG GWG LA++ V++T
Sbjct  547   LDPSMTYSCAIFKVEDESLEVAQLRKVNLLIDKAKVERDHHVLEIGSGWGCLAMQVVKQT  606

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLKYA+ KV+EAGL+D I FLLCDYRQ+P   +YDRIISCEM+E VGH
Sbjct  607   GCKYTGITLSEEQLKYAQMKVKEAGLEDRITFLLCDYRQIPILRKYDRIISCEMIEGVGH  666

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM++FFG CES+LA++G+LVLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R+TS
Sbjct  667   EFMDDFFGCCESLLAQDGLLVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLARITS  726

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLC+E +E+IG HYY TL  WR NF   +  I  LGFD KFIR WEYYF YCAA
Sbjct  727   AMSAASRLCIEQVENIGYHYYPTLVRWRDNFFANKYAISALGFDDKFIRIWEYYFMYCAA  786

Query  2924  GFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  3022
             GF + TLG+YQIVFSRPGN   A+ D PY  L +A
Sbjct  787   GFKSRTLGNYQIVFSRPGNDKLAYADNPYASLPAA  821


 Score =   222 bits (566),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 121/155 (78%), Gaps = 3/155 (2%)
 Frame = +1

Query  565   VFNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLN  738
             +FN VTYPNM+E FE LGV+ME SDMS SVS  L  G   EWGSRNG SGL AQK N L 
Sbjct  9     IFN-VTYPNMLEWFEGLGVEMETSDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALR  67

Query  739   PYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCAS  918
             P FW MIREILKFK DVLSYL   +NNPD+DRN+TLGEFIK  GYS+LFQ+AY+IP+CA 
Sbjct  68    PGFWHMIREILKFKEDVLSYLSNHENNPDLDRNETLGEFIKMHGYSQLFQEAYLIPICAC  127

Query  919   IWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             IWSC S+GV+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  128   IWSCPSQGVLGFSAFFVLSFCRNHHLLQIFGRPQW  162



>gb|EMT03310.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=829

 Score =   929 bits (2401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/698 (66%), Positives = 552/698 (79%), Gaps = 19/698 (3%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F +    +FCR    LQ+FGRPQWLTVK RSH+YVNKVREELE  GC+I+  C+V SVS+
Sbjct  137   FSAFFVLSFCRNHHLLQIFGRPQWLTVKGRSHTYVNKVREELESMGCQIKTSCQVKSVSS  196

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              E G    V+ + G    +E YD  I  AHAPD L+MLG +AT +ELRILGAFQYV+SDI
Sbjct  197   VEGGYK--VLEVGGS---EEVYDKIIFGAHAPDVLRMLGDEATHEELRILGAFQYVHSDI  251

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLHR+ + MP+N +AWSAWNFLGT ++ V +TYWLN LQN+  T +P+LVTLNPP  P+ 
Sbjct  252   YLHRDDTLMPQNPSAWSAWNFLGTTSSGVSVTYWLNLLQNIESTGKPFLVTLNPPHVPDH  311

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              +LKW TGHPVPSVAA++AS EL++IQG R IWFCGAYQGYGFHEDGLKAG  AA  LL 
Sbjct  312   VVLKWNTGHPVPSVAAAKASLELQQIQGNRGIWFCGAYQGYGFHEDGLKAGKSAAQSLLG  371

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             ++ S L NP  MVPSW ETGARLLVTRFL  ++  G++ +LEEGGT+F+F   DKK L+K
Sbjct  372   QKSSLLLNPKQMVPSWTETGARLLVTRFLNQYVTIGNMTILEEGGTMFSFGEVDKKCLVK  431

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++RVH P FYWKVAT+ADLG+ADAYI+G  SFVDK+EGLLNLF I +ANRD   S S +
Sbjct  432   TVLRVHDPLFYWKVATEADLGMADAYINGYFSFVDKREGLLNLFLILIANRDAQKSSSSA  491

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
              SKRGWWTP+L T+ IASAKYF+RHISR+NT+TQ RRNIS+HYDLSN+ FS+FLD +MTY
Sbjct  492   ASKRGWWTPMLLTAGIASAKYFLRHISRKNTVTQTRRNISQHYDLSNDFFSIFLDPSMTY  551

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK EDE L+ AQ RK++LLI KAK+ + HH+LEIG GWGSLA+E V++TGCKYTGI
Sbjct  552   SCAVFKVEDESLEVAQQRKVNLLIKKAKVERNHHVLEIGSGWGSLAMEVVKQTGCKYTGI  611

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIIS----------CEMLEA  2554
             TLSE+QLKYA+ KV+EAGL+D I FLLCDYRQ+P  C+YDRIIS           EM+E 
Sbjct  612   TLSEEQLKYAQMKVKEAGLEDRITFLLCDYRQIPSRCKYDRIISWKYLPLVDTHSEMIEG  671

Query  2555  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2734
             VGHEFM++FFG CES+LA +G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSL+R
Sbjct  672   VGHEFMDDFFGCCESLLAPDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLAR  731

Query  2735  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2914
             +TSAM+ +SRLC+E +E+IG HYY TL  WR NF+  +  IL LGFD KFIR WEYYF Y
Sbjct  732   ITSAMSTASRLCIEQVENIGYHYYPTLIRWRDNFMANKDAILALGFDDKFIRVWEYYFIY  791

Query  2915  CAAGFHTCTLGDYQIVFSRPGN-VTAFGD-PYKGLASA  3022
             CAAGF + TLG YQIVFSRPGN   A+ D PY  L +A
Sbjct  792   CAAGFKSRTLGTYQIVFSRPGNDKLAYADNPYASLPAA  829


 Score =   219 bits (559),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 122/152 (80%), Gaps = 2/152 (1%)
 Frame = +1

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVS--LDNGHGYEWGSRNGFSGLFAQKKNLLNPYF  747
             +VTYPNM+E FE LGV+MEISDMS SVS  L  G   EWGSRNG SGL AQK N L P F
Sbjct  9     QVTYPNMLEWFEELGVEMEISDMSLSVSTQLSGGGRCEWGSRNGLSGLLAQKSNALRPAF  68

Query  748   WQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWS  927
             W MIREILKFK D L YLE+ ++NPD++R++TLG+FI++ GYS+LFQ+AY+IP+CASIWS
Sbjct  69    WHMIREILKFKEDALKYLEDHESNPDLNRHETLGQFIQTHGYSQLFQEAYLIPICASIWS  128

Query  928   CSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             C S+GV+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  129   CPSQGVLGFSAFFVLSFCRNHHLLQIFGRPQW  160



>ref|XP_010532685.1| PREDICTED: uncharacterized protein LOC104808653 isoform X1 [Tarenaya 
hassleriana]
Length=887

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 449/694 (65%), Positives = 541/694 (78%), Gaps = 6/694 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +++  +F R +  LQ+FGRPQWLTV  RS +YV K+R ELE+RGC+IR   
Sbjct  183   PSDDVSSFSALSVLSFFRNNHLLQIFGRPQWLTVAGRSRTYVAKIRTELEQRGCKIRTRR  242

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV  V+T    S    V I   +  +E +D C++A +A D L++LG QATFDE R+LGAF
Sbjct  243   EVQWVTT----SVNNGVTIRNGDGSEEIFDRCLLAMNAQDALRLLGDQATFDERRVLGAF  298

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYV+SDIYLHR+  FMP   AAWSA NFL +  ++  +TYWLN LQNLG+ ++P+ VTLN
Sbjct  299   QYVHSDIYLHRDTDFMPHKTAAWSACNFLESTEHKGSITYWLNILQNLGEKQEPFFVTLN  358

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P R P++ LLKWTT   VPSVAA  AS +L++IQG+  +WFC + QGYGFHEDGLKAG+ 
Sbjct  359   PDRVPKKTLLKWTTARTVPSVAALTASQDLDKIQGQHGLWFCESCQGYGFHEDGLKAGIA  418

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA  LL+K    L NP  MV S  ETGARL VTRF+  FI TGSI LLEEGGT+F F G 
Sbjct  419   AARNLLRKDIGNLKNPKCMVLSLSETGARLFVTRFMEQFISTGSITLLEEGGTMFRFGGK  478

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
               K  L+ ++ +HSPQFYWKV T+ADLGLADAYI+GD SFVDK  GLLN+  I +ANRD+
Sbjct  479   HPKCNLRSVLTIHSPQFYWKVMTRADLGLADAYINGDFSFVDKDNGLLNMLMILIANRDM  538

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++  S    KRGWWTP+  T+ +AS  YF++H+SRQNTLTQARRNISRHYDLSNELF++F
Sbjct  539   NSLKSNLAKKRGWWTPMFLTAGLASVNYFLKHVSRQNTLTQARRNISRHYDLSNELFAMF  598

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETM YS A+F SEDEDLKTAQMRKISLLI+KA+I K H +LEIGCGWG+LAIE V RT
Sbjct  599   LDETMMYSAALFSSEDEDLKTAQMRKISLLIEKARIEKNHEVLEIGCGWGTLAIEVVRRT  658

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GC+YTGITLS +QLKYAE K REAGLQD I F LCDYRQL D+  YDRIISCEMLEAVGH
Sbjct  659   GCRYTGITLSVEQLKYAEAKAREAGLQDQITFQLCDYRQLSDSRVYDRIISCEMLEAVGH  718

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM  FF  CE+ LAE+G+LV+QF  IPD+RYDEYR SSDFIKEYIF GGCLPSL+R+TS
Sbjct  719   EFMETFFRSCEAALAEDGLLVMQFAWIPDQRYDEYRLSSDFIKEYIFHGGCLPSLARLTS  778

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA+SSRL ++ +E+IG+HYYQT+RCWR NF ER+ QI+DLGFD+KFIRTWEYYFDYC+A
Sbjct  779   AMASSSRLYIQQVENIGVHYYQTIRCWRKNFTERRRQIMDLGFDEKFIRTWEYYFDYCSA  838

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             GF T TLG+YQ+VFSR G+ +AFGDPY+   SAY
Sbjct  839   GFRTFTLGNYQMVFSRLGSTSAFGDPYRSFPSAY  872


 Score =   267 bits (682),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 164/210 (78%), Gaps = 2/210 (1%)
 Frame = +1

Query  400   KMRVAVVGAGIS-GLVSAYVLAKGGAGVVVYEKEDYLGGHAK-TVTLDGVDLDLGFMVFN  573
             +MRVAV+G G S GL SAYVLA+ G GVV+YE+E  LGG+A  T+ +DG D+DLG ++FN
Sbjct  4     EMRVAVIGGGTSTGLASAYVLAREGLGVVLYEEEHCLGGNANDTIRVDGADVDLGLILFN  63

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  753
                 PNMME FE LG+DME+SDMS SVSLD+G G EWG+ NGFS LFAQK N+LNP+FW+
Sbjct  64    PAICPNMMEFFEDLGLDMEVSDMSLSVSLDSGGGTEWGTLNGFSSLFAQKSNVLNPFFWK  123

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MIREI KFK+D   Y++E + + D+DR +TLG+F++S GYSELFQKAY++P+C SIWS  
Sbjct  124   MIREIAKFKDDASIYVDERERDRDLDRTETLGQFLRSYGYSELFQKAYLVPICGSIWSRP  183

Query  934   SEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             S+ V +FSA S+LSF RN+HLLQ F    W
Sbjct  184   SDDVSSFSALSVLSFFRNNHLLQIFGRPQW  213



>emb|CDX94854.1| BnaC03g43340D [Brassica napus]
Length=892

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 461/723 (64%), Positives = 544/723 (75%), Gaps = 37/723 (5%)
 Frame = +2

Query  947   WP----SLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNK-----------  1075
             WP    S+L    +SV   +FCR    LQLFGRP+ LTV  RS ++V K           
Sbjct  176   WPGSSESVLNLSAYSV--LSFCRNHHLLQLFGRPEGLTVAGRSQTFVAKCERIYYNAFIR  233

Query  1076  -------VREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAH  1234
                    VR ELEKRGC+I   C+V SV+T    S  G V ++ ++  Q+ +D CI+A H
Sbjct  234   DILLADQVRAELEKRGCKIITNCKVQSVAT----SGNGCVRVTTEDGSQQVFDKCILAVH  289

Query  1235  APDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVC  1414
             A D L+ LG + T+DE R+LGAFQY  SD+YLHR+   MPR   AWSAWNFLG+  N+  
Sbjct  290   AQDALRFLGDKVTYDETRVLGAFQYTDSDLYLHRDTDLMPRKTGAWSAWNFLGSSENKAS  349

Query  1415  LTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKR  1594
             +TYWLN +Q LG+   P+ +T+NP  TP++ L KWTT HPVPSV+  +AS E+ +IQGKR
Sbjct  350   VTYWLNIIQKLGEEHDPFFITVNPEYTPKRTLFKWTTSHPVPSVSTWKASQEIYQIQGKR  409

Query  1595  RIWFCGAYQGYGFHEDGLKA------GMIAAHGLLKKRCSP-LNNPNHMVPSWPETGARL  1753
              IWFCGAYQGYGFHE+GLKA      GM A+ GLL K   P L N  HMVPS  E GAR 
Sbjct  410   GIWFCGAYQGYGFHEEGLKALIISIAGMAASQGLLGKDMVPTLTNLKHMVPSVTEKGARF  469

Query  1754  LVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLA  1933
               T+FL +FI TG I + EEG TV TFEG D    LK ++ VH PQFYWKV TQADLGLA
Sbjct  470   FFTKFLRNFISTGCITIHEEGDTVLTFEGKDSSCHLKSILEVHKPQFYWKVMTQADLGLA  529

Query  1934  DAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFI  2113
             DAYI+GD SF DK+ GLL+L  I +AN++L++  S+   KRGWWTP+  T+++ASA  F+
Sbjct  530   DAYINGDFSFADKERGLLDLIMILIANKELNSKNSKLAKKRGWWTPMFLTASLASANNFL  589

Query  2114  RHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLL  2293
             +H+SRQNTLTQARRNISRHYDLSNELF+LFLD+TMTYS AVFKS DEDL+TAQMRKI LL
Sbjct  590   KHVSRQNTLTQARRNISRHYDLSNELFALFLDDTMTYSSAVFKSADEDLRTAQMRKIYLL  649

Query  2294  IDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNI  2473
             IDKA+I K H +LEIGCGWG+LAIE V+RTGCKYTGITLS +QLKYAE+KV+EAGL+D I
Sbjct  650   IDKARIEKNHEVLEIGCGWGTLAIEVVKRTGCKYTGITLSIEQLKYAEEKVKEAGLEDRI  709

Query  2474  RFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDE  2653
              F LCDYRQL D  +YDRIISCEMLEAVGHEFM  FF  CE+ LAE+GI VLQFISIP+E
Sbjct  710   TFKLCDYRQLSDAHKYDRIISCEMLEAVGHEFMETFFRHCEAALAEDGIFVLQFISIPEE  769

Query  2654  RYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRAN  2833
             RYDEYR SSDFIKEYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+IGIHYYQTLR WR  
Sbjct  770   RYDEYRLSSDFIKEYIFPGGCLPSLARVTSAMASSSRLCIENVENIGIHYYQTLRLWRKT  829

Query  2834  FLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGL  3013
             FLERQ QI DLGFD KFIRTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV A GDP +  
Sbjct  830   FLERQKQINDLGFDDKFIRTWEYYFDYCAAGFKTLTLGNYQVVFSRPGNVAALGDPSRSF  889

Query  3014  ASA  3022
              SA
Sbjct  890   PSA  892


 Score =   289 bits (739),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 164/204 (80%), Gaps = 2/204 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGA--GVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNR  576
             MRVAV+G G+SGL SAYVLA+  A   +V++EKED LGGHA+T+  DGVDLDLGF VFN 
Sbjct  1     MRVAVIGGGVSGLGSAYVLARDDAVKELVLFEKEDSLGGHARTMRFDGVDLDLGFTVFNS  60

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT+PNMM   ++L VDME SDMSFSVSLDNG GYEWG R+G S LFAQK+N+LNP+FWQM
Sbjct  61    VTHPNMMGFLKNLEVDMEDSDMSFSVSLDNGRGYEWGCRHGLSSLFAQKRNILNPFFWQM  120

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IRE  KFK DV  YLE+ + N D+DR +TLGEF++S GYS +FQKAY++P+C  IW  SS
Sbjct  121   IRETKKFKEDVQKYLEDLERNLDVDRTETLGEFLESHGYSNVFQKAYLVPVCGLIWPGSS  180

Query  937   EGVMAFSAYSILSFCRNHHLLQNF  1008
             E V+  SAYS+LSFCRNHHLLQ F
Sbjct  181   ESVLNLSAYSVLSFCRNHHLLQLF  204



>ref|XP_009586643.1| PREDICTED: uncharacterized protein LOC104084479 isoform X4 [Nicotiana 
tomentosiformis]
Length=824

 Score =   920 bits (2378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/588 (76%), Positives = 516/588 (88%), Gaps = 5/588 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQLF  PQ LTV+ +S++YVNKV+E+LEKRGC+IR GCEV+ VST+E+G       I+  
Sbjct  199   LQLFSLPQLLTVRWKSYAYVNKVKEDLEKRGCQIRTGCEVNFVSTNEEGCT-----IACN  253

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
             +  +E YDGC+MA HAPDTLKMLGK+AT+DE RILGAFQY+ SDI+LHR+++F+PR+ AA
Sbjct  254   DGAKEVYDGCVMAGHAPDTLKMLGKEATYDETRILGAFQYICSDIFLHRDKTFLPRDPAA  313

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSA NFLGT+N+R  +TYWLN +QNLG T+QPY VTLNPP TPE  +LKWTTGHPVPSVA
Sbjct  314   WSALNFLGTMNSRGSMTYWLNIIQNLGGTEQPYCVTLNPPHTPEHTMLKWTTGHPVPSVA  373

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             AS ASSEL +IQGKR IWFCGAYQGYG HEDGLKAG+ AA G+L++ CS L+NP HMVP+
Sbjct  374   ASIASSELHQIQGKRGIWFCGAYQGYGLHEDGLKAGVTAADGVLRRNCSILDNPKHMVPT  433

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
             WPETGARLLVTRFL SFI TG IILLE GGT+FTF+GTDKK  LKV +RVHS QFYWKVA
Sbjct  434   WPETGARLLVTRFLKSFIETGCIILLENGGTIFTFQGTDKKCSLKVSLRVHSTQFYWKVA  493

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             TQ DLGLADA+IHGD SFVDK EGLLNLF IFVANRDL ASV+RS+ KRGWWTPLL T+A
Sbjct  494   TQGDLGLADAFIHGDFSFVDKNEGLLNLFMIFVANRDLKASVTRSSKKRGWWTPLLSTAA  553

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
             ++SAKYFI+H+S QNTLT+ARRNISRHYDLSNELFSLFLDETMTYSCA+FKSE+EDLK A
Sbjct  554   LSSAKYFIQHVSNQNTLTKARRNISRHYDLSNELFSLFLDETMTYSCAIFKSENEDLKVA  613

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q+RKISLLI KAKISKEHHILEIG GWGSLA+E V++TGCKYTG+TLSEQQLKYA+  V+
Sbjct  614   QLRKISLLIKKAKISKEHHILEIGFGWGSLAVEVVKQTGCKYTGVTLSEQQLKYAQSIVQ  673

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             +AGLQD I FLLCDYRQ+P+N +YDRIISC MLE VGH+F+ EFF  CE+ LAE+G+LV+
Sbjct  674   QAGLQDQITFLLCDYRQMPNNYKYDRIISCGMLEHVGHDFIGEFFSCCETALAEDGLLVV  733

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCV  2773
             QFISIPDERY+EYR+SSDFIKEYIFPGGCLP+L+RVTSAMAA+SRLC 
Sbjct  734   QFISIPDERYEEYRRSSDFIKEYIFPGGCLPALNRVTSAMAAASRLCA  781


 Score =   340 bits (871),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 179/207 (86%), Gaps = 1/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGLV AY LAK G  VVVYEKEDYLGGHAKTVT+DGV LDLGFM FN+VT
Sbjct  1     MKVAVVGAGISGLVCAYELAKSGVKVVVYEKEDYLGGHAKTVTVDGVHLDLGFMFFNQVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME F  LG D EISDMSFSVSLD+GHG EWG+RNGFS LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFVFLGADTEISDMSFSVSLDHGHGCEWGTRNGFSSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK DV SYLE  DNNPD+D + T+G+FIKS GYSELFQK+Y+IP+C+SIWSC SEG
Sbjct  121   EISKFKQDVTSYLEALDNNPDIDCDKTIGQFIKSHGYSELFQKSYLIPICSSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFS-PAL  1020
             VM FSAYSILSF R+HHLLQ FS P L
Sbjct  181   VMGFSAYSILSFFRDHHLLQLFSLPQL  207



>ref|XP_011091265.1| PREDICTED: uncharacterized protein LOC105171752 isoform X1 [Sesamum 
indicum]
Length=867

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/667 (66%), Positives = 543/667 (81%), Gaps = 7/667 (1%)
 Frame = +2

Query  1007  SLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISG  1186
             +LQL GRP  LT +  S SYV++V++ELE RGC IR   EV+S+ T+++G A    IIS 
Sbjct  200   ALQLIGRPHRLTPRWCSQSYVDRVKKELESRGCHIRTNSEVYSILTNDEGCA----IIS-  254

Query  1187  KNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLA  1366
             K+ ++E YDGCI+A +APD LK+LGKQAT+DE RILGAFQY YSD++LH + + MP+N A
Sbjct  255   KDGLEEVYDGCIIAVNAPDALKVLGKQATYDESRILGAFQYAYSDLFLHHDNNLMPKNPA  314

Query  1367  AWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsv  1546
              WS+ NF GT+ N+  +TYWLN LQN+G+T  P+ +TLNPP+TP+  L KW+T  P+PSV
Sbjct  315   VWSSRNFRGTIKNKAYITYWLNNLQNVGET-VPFFLTLNPPKTPKLTLFKWSTSQPIPSV  373

Query  1547  aasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVP  1726
             AAS+A  +L  IQGKRR+WFCGAYQGYGF EDG+KAG++AA+GLL+K  +   +  H+VP
Sbjct  374   AASKALHQLNVIQGKRRMWFCGAYQGYGFPEDGVKAGIVAANGLLRKSYTVQKHSKHLVP  433

Query  1727  SWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKV  1906
             S  E+GARLLVTRFL  FI TG +ILLEEGGT+FTFEGT KK+ LKV +RVH+P FYWKV
Sbjct  434   SSLESGARLLVTRFLERFITTGCLILLEEGGTIFTFEGTRKKSTLKVTLRVHNPAFYWKV  493

Query  1907  ATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTS  2086
             AT+ADLG ADAYI GD SF+DK EGLLN F+IF+AN + +  +S+   KRGWWTPLL+TS
Sbjct  494   ATKADLGFADAYIDGDFSFIDKNEGLLNFFQIFIANAEFNTYISKLGKKRGWWTPLLYTS  553

Query  2087  AIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKT  2266
              IASAK F++H+ RQNT+ QARRNIS HYDLSNELFSLF+DETM+YSCA+F++ +EDLK 
Sbjct  554   MIASAKSFLKHVLRQNTIDQARRNISDHYDLSNELFSLFMDETMSYSCAIFRTPNEDLKN  613

Query  2267  AQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKV  2446
             AQ+RKI  LI+KA+ISKEHH+LEIGCGWG LAIE V+RTGC+YTGITLS++QL+Y E KV
Sbjct  614   AQLRKIHTLIEKARISKEHHVLEIGCGWGGLAIEVVKRTGCRYTGITLSQEQLQYTESKV  673

Query  2447  REAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILV  2626
             +EAGLQD +  LLCDYRQLP NC+YDRIISCEM+EAVGHE++ EFF  CES L ENGILV
Sbjct  674   KEAGLQDQVELLLCDYRQLPKNCKYDRIISCEMIEAVGHEYIEEFFRCCESALTENGILV  733

Query  2627  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  2806
             LQFI+I DE+YDE+  S+ FIKEYIFPG  L SLSR+TSAMAA+SRL V HLE+ G+HY+
Sbjct  734   LQFIAIADEKYDEFTHSAGFIKEYIFPGSWLASLSRLTSAMAAASRLSVVHLEERGLHYF  793

Query  2807  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  2986
             QTL CWR N L  QS+IL+LGFD+KF+RTW YYFDYCAAG     +G YQ+VF+RPG++ 
Sbjct  794   QTLECWRENLLRNQSKILELGFDEKFMRTWIYYFDYCAAGLKYGVVGSYQVVFTRPGDIA  853

Query  2987  AFGD-PY  3004
             AFG+ PY
Sbjct  854   AFGNKPY  860


 Score =   306 bits (784),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 170/201 (85%), Gaps = 1/201 (0%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             +MR+AVVG G+SGL +AYVLAK GA VVVYEKED LGG AKT T+DG  LDLGFMVF+RV
Sbjct  3     RMRMAVVGGGVSGLAAAYVLAKDGAEVVVYEKEDRLGGQAKTATIDGTPLDLGFMVFSRV  62

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
              YP+ MELFE+LGVD E+SD+SFSVSLD G G EWG+RNG S LFAQKKN+LNPYFW MI
Sbjct  63    IYPDTMELFENLGVDRELSDLSFSVSLDEGQGCEWGTRNGLSSLFAQKKNVLNPYFWNMI  122

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KFK D  +Y+EE +NNPD+DRN+TL ++I+SRGYSELFQKA++IP CASIWSCSS 
Sbjct  123   REIIKFKGDASAYVEELENNPDIDRNETLEDYIRSRGYSELFQKAFLIPTCASIWSCSS-  181

Query  940   GVMAFSAYSILSFCRNHHLLQ  1002
             G+M+FSAYS+LS   N   LQ
Sbjct  182   GMMSFSAYSVLSLLHNDPALQ  202



>dbj|BAB01742.1| unnamed protein product [Arabidopsis thaliana]
Length=793

 Score =   918 bits (2373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/690 (65%), Positives = 531/690 (77%), Gaps = 49/690 (7%)
 Frame = +2

Query  959   LTPFFHSVATTTFCRISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSV  1138
             L  F ++   +   + +  +FGRPQWLTV  RS +YV KVR ELE+ GC+IR  C+V SV
Sbjct  149   LGEFLNTRGYSELFQQAYLIFGRPQWLTVAGRSQTYVAKVRAELERLGCKIRTSCDVKSV  208

Query  1139  STDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYS  1318
             ST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAFQYVYS
Sbjct  209   STSENG----CVTVTSGDGSEEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAFQYVYS  264

Query  1319  DIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTP  1498
             DIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP  TP
Sbjct  265   DIYLHHDIDLMPRNKAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLNPDETP  324

Query  1499  EQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQG-YGFHEDGLKAGMIAAHG  1675
             ++ LLKWTTGHPVPSVAAS AS EL +IQGKR IWFCGAYQG YG               
Sbjct  325   KKALLKWTTGHPVPSVAASIASQELHQIQGKRNIWFCGAYQGRYG---------------  369

Query  1676  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1855
                  C                      TRFL  FI TGS+ +LEEGGT+FTF G D   
Sbjct  370   ----GC----------------------TRFLGQFISTGSVTILEEGGTMFTFGGKDSTC  403

Query  1856  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2035
              LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I +ANRD  +++
Sbjct  404   PLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNLIMILIANRDTKSNL  463

Query  2036  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2215
             ++   KRGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISRHYDLSNELF LFLD+T
Sbjct  464   TK---KRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISRHYDLSNELFGLFLDDT  520

Query  2216  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2395
             MTYS AVFKS+DEDL+TAQMRKISLLIDKA+I K+H +LEIGCGWG+LAIE V RTGCKY
Sbjct  521   MTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCGWGTLAIEVVRRTGCKY  580

Query  2396  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2575
             TGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDRIISCEMLEAVGHEFM 
Sbjct  581   TGITLSIEQLKYAEEKVKEAGLQDRITFELRDYRQLSDAHKYDRIISCEMLEAVGHEFME  640

Query  2576  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2755
              FF RCE+ LAE+G++VLQFIS P+ERY+EYR SSDFIKEYIFPG C+PSL++VTSAM++
Sbjct  641   MFFSRCEAALAEDGLMVLQFISTPEERYNEYRLSSDFIKEYIFPGACVPSLAKVTSAMSS  700

Query  2756  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2935
             SSRLC+EH+E+IGIHYYQTLR WR NFLERQ QI+ LGFD KF+RTWEYYFDYCAAGF T
Sbjct  701   SSRLCIEHVENIGIHYYQTLRLWRKNFLERQKQIMALGFDDKFVRTWEYYFDYCAAGFKT  760

Query  2936  CTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
              TLGDYQ+VFSRPGNV AF D Y+G  SAY
Sbjct  761   RTLGDYQLVFSRPGNVAAFADSYRGFPSAY  790


 Score =   270 bits (690),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 150/168 (89%), Gaps = 1/168 (1%)
 Frame = +1

Query  403  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
            TYPNM+E FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61   TYPNMIEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  760  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYII  903
            REI++FK DVL+Y+E+ + NPD+DR +TLGEF+ +RGYSELFQ+AY+I
Sbjct  121  REIVRFKEDVLNYIEKLEGNPDIDRKETLGEFLNTRGYSELFQQAYLI  168



>ref|XP_010650131.1| PREDICTED: (S)-coclaurine N-methyltransferase isoform X4 [Vitis 
vinifera]
Length=556

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/553 (79%), Positives = 495/553 (90%), Gaps = 0/553 (0%)
 Frame = +2

Query  1367  AWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsv  1546
             AWSAWNFLGT++N+VCLTYWLN LQN+  T +P+LVTLNPP TP+  LLKW+T HP PSV
Sbjct  4     AWSAWNFLGTIDNKVCLTYWLNVLQNIDQTSRPFLVTLNPPHTPDHTLLKWSTSHPFPSV  63

Query  1547  aasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVP  1726
             AAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAHG+L K C+ LNNP HMVP
Sbjct  64    AASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHGMLGKGCAVLNNPKHMVP  123

Query  1727  SWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKV  1906
             S  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK LLKV +++H+PQFYWK+
Sbjct  124   SLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSRKKCLLKVSLKIHNPQFYWKI  183

Query  1907  ATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTS  2086
             ATQADLGLADAYI+GD S VDK EGL NLF IF+ANRDL +S+SR N+KRGWWTPL FT+
Sbjct  184   ATQADLGLADAYINGDFSLVDKDEGLQNLFMIFIANRDLDSSLSRLNNKRGWWTPLFFTA  243

Query  2087  AIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKT  2266
              IASA+YF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK+E EDLK 
Sbjct  244   GIASARYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKTEGEDLKV  303

Query  2267  AQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKV  2446
             AQ+RKISLLI+K +I K+H +LEIGCGWGSLAIE V+RTGCKYTGITLSE+QLK+AE KV
Sbjct  304   AQLRKISLLIEKVRIDKKHEVLEIGCGWGSLAIEVVKRTGCKYTGITLSEEQLKFAEMKV  363

Query  2447  REAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILV  2626
             +EAGLQDNIRFLLCDYRQL D+ +YDRIISCEMLEAVGHE+M EFFG CESVLAE+G+LV
Sbjct  364   KEAGLQDNIRFLLCDYRQLSDSYKYDRIISCEMLEAVGHEYMEEFFGCCESVLAEDGLLV  423

Query  2627  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  2806
             LQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSRVT+AMAASSRLC+EHLE+IGIHYY
Sbjct  424   LQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRVTTAMAASSRLCMEHLENIGIHYY  483

Query  2807  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  2986
             QTLR WR NFLE QS+I++LGF++KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGN  
Sbjct  484   QTLRHWRKNFLENQSKIIELGFNEKFIRTWEYYFDYCAAGFKTHTLGNYQIVFSRPGNAA  543

Query  2987  AFGDPYKGLASAY  3025
             AF +PY+ + S Y
Sbjct  544   AFSNPYESVVSTY  556



>ref|XP_011091266.1| PREDICTED: uncharacterized protein LOC105171752 isoform X2 [Sesamum 
indicum]
Length=813

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/672 (65%), Positives = 543/672 (81%), Gaps = 7/672 (1%)
 Frame = +2

Query  1007  SLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISG  1186
             +LQL GRP  LT +  S SYV++V++ELE RGC IR   EV+S+ T+++G A     I  
Sbjct  146   ALQLIGRPHRLTPRWCSQSYVDRVKKELESRGCHIRTNSEVYSILTNDEGCA-----IIS  200

Query  1187  KNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLA  1366
             K+ ++E YDGCI+A +APD LK+LGKQAT+DE RILGAFQY YSD++LH + + MP+N A
Sbjct  201   KDGLEEVYDGCIIAVNAPDALKVLGKQATYDESRILGAFQYAYSDLFLHHDNNLMPKNPA  260

Query  1367  AWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsv  1546
              WS+ NF GT+ N+  +TYWLN LQN+G+T  P+ +TLNPP+TP+  L KW+T  P+PSV
Sbjct  261   VWSSRNFRGTIKNKAYITYWLNNLQNVGET-VPFFLTLNPPKTPKLTLFKWSTSQPIPSV  319

Query  1547  aasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVP  1726
             AAS+A  +L  IQGKRR+WFCGAYQGYGF EDG+KAG++AA+GLL+K  +   +  H+VP
Sbjct  320   AASKALHQLNVIQGKRRMWFCGAYQGYGFPEDGVKAGIVAANGLLRKSYTVQKHSKHLVP  379

Query  1727  SWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKV  1906
             S  E+GARLLVTRFL  FI TG +ILLEEGGT+FTFEGT KK+ LKV +RVH+P FYWKV
Sbjct  380   SSLESGARLLVTRFLERFITTGCLILLEEGGTIFTFEGTRKKSTLKVTLRVHNPAFYWKV  439

Query  1907  ATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTS  2086
             AT+ADLG ADAYI GD SF+DK EGLLN F+IF+AN + +  +S+   KRGWWTPLL+TS
Sbjct  440   ATKADLGFADAYIDGDFSFIDKNEGLLNFFQIFIANAEFNTYISKLGKKRGWWTPLLYTS  499

Query  2087  AIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKT  2266
              IASAK F++H+ RQNT+ QARRNIS HYDLSNELFSLF+DETM+YSCA+F++ +EDLK 
Sbjct  500   MIASAKSFLKHVLRQNTIDQARRNISDHYDLSNELFSLFMDETMSYSCAIFRTPNEDLKN  559

Query  2267  AQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKV  2446
             AQ+RKI  LI+KA+ISKEHH+LEIGCGWG LAIE V+RTGC+YTGITLS++QL+Y E KV
Sbjct  560   AQLRKIHTLIEKARISKEHHVLEIGCGWGGLAIEVVKRTGCRYTGITLSQEQLQYTESKV  619

Query  2447  REAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILV  2626
             +EAGLQD +  LLCDYRQLP NC+YDRIISCEM+EAVGHE++ EFF  CES L ENGILV
Sbjct  620   KEAGLQDQVELLLCDYRQLPKNCKYDRIISCEMIEAVGHEYIEEFFRCCESALTENGILV  679

Query  2627  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  2806
             LQFI+I DE+YDE+  S+ FIKEYIFPG  L SLSR+TSAMAA+SRL V HLE+ G+HY+
Sbjct  680   LQFIAIADEKYDEFTHSAGFIKEYIFPGSWLASLSRLTSAMAAASRLSVVHLEERGLHYF  739

Query  2807  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  2986
             QTL CWR N L  QS+IL+LGFD+KF+RTW YYFDYCAAG     +G YQ+VF+RPG++ 
Sbjct  740   QTLECWRENLLRNQSKILELGFDEKFMRTWIYYFDYCAAGLKYGVVGSYQVVFTRPGDIA  799

Query  2987  AFGD-PYKGLAS  3019
             AFG+ PY  + +
Sbjct  800   AFGNKPYNPVPA  811


 Score =   217 bits (553),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 120/142 (85%), Gaps = 1/142 (1%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             V YP+ MELFE+LGVD E+SD+SFSVSLD G G EWG+RNG S LFAQKKN+LNPYFW M
Sbjct  8     VIYPDTMELFENLGVDRELSDLSFSVSLDEGQGCEWGTRNGLSSLFAQKKNVLNPYFWNM  67

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IREI+KFK D  +Y+EE +NNPD+DRN+TL ++I+SRGYSELFQKA++IP CASIWSCSS
Sbjct  68    IREIIKFKGDASAYVEELENNPDIDRNETLEDYIRSRGYSELFQKAFLIPTCASIWSCSS  127

Query  937   EGVMAFSAYSILSFCRNHHLLQ  1002
              G+M+FSAYS+LS   N   LQ
Sbjct  128   -GMMSFSAYSVLSLLHNDPALQ  148



>ref|XP_009102765.1| PREDICTED: uncharacterized protein LOC103828879 [Brassica rapa]
Length=862

 Score =   917 bits (2371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 448/700 (64%), Positives = 539/700 (77%), Gaps = 22/700 (3%)
 Frame = +2

Query  947   WP----SLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCE  1108
             WP    S+L   F + +  +FCR    LQ+F RPQWLTV  RS +Y  KVR ELE+RGC+
Sbjct  177   WPCPPDSILN--FSAYSVLSFCRNHHLLQIFERPQWLTVAGRSETYAAKVRAELERRGCK  234

Query  1109  IRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELR  1288
             IR  C V SVST E G     ++++ ++  QE +D CI+A +APD L++LG+ AT DE R
Sbjct  235   IRMNCNVQSVSTSEDG----CILVTTEDGSQEVFDRCILAVNAPDALRLLGEDATSDEAR  290

Query  1289  ILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPY  1468
             +LGAF Y YSDIYLHR+   MPRN  AWSAWNFL +  N+  LTYWLN +QNLG+   P+
Sbjct  291   VLGAFHYAYSDIYLHRDTDLMPRNRVAWSAWNFLTSSGNKASLTYWLNIIQNLGEEHDPF  350

Query  1469  LVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGL  1648
              +T NP  TP+  L KWT+GHP+PSV+A +AS EL  IQGKR         GYG HED +
Sbjct  351   FLTFNPEVTPKMTLFKWTSGHPLPSVSAWKASQELNNIQGKR---------GYGCHEDEI  401

Query  1649  KAGMIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTV  1825
             KAGM AA  LL K+  SP +NP HM PS  E GAR L TRFL  FI TG + + EEGGT+
Sbjct  402   KAGMAAAQSLLGKEMVSPPSNPKHMAPSITEKGARFLFTRFLRHFISTGCLTVDEEGGTM  461

Query  1826  FTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIF  2005
             FTF+G D +  L+ ++++HSP FYWKV TQADLGLADAYI+GD SF DK  GLLNL  I 
Sbjct  462   FTFKGNDLRCNLESVIKIHSPHFYWKVMTQADLGLADAYINGDFSFADKDSGLLNLIMIL  521

Query  2006  VANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSN  2185
             +AN++L++   + + KRGWWTP+  T+ + SA  F+++ SRQNTLT+ARRNISRHYDLSN
Sbjct  522   IANKELNSKNLKLSKKRGWWTPMFMTAGLTSATQFLKNFSRQNTLTKARRNISRHYDLSN  581

Query  2186  ELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAI  2365
             ELF+LFLD+TM+YS AVFKS+DEDLKTAQMRKI+LLIDKA+I K H +LEIGCGWG+LAI
Sbjct  582   ELFALFLDDTMSYSTAVFKSDDEDLKTAQMRKINLLIDKARIEKNHEVLEIGCGWGTLAI  641

Query  2366  EAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEM  2545
             E V++TGCKYTGITLS +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRIISCEM
Sbjct  642   EVVKKTGCKYTGITLSIEQLKYAEEKVKEAGLQDRITFELCDYRQLSDARKYDRIISCEM  701

Query  2546  LEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPS  2725
             +E VGHEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPS
Sbjct  702   IEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPS  761

Query  2726  LSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYY  2905
             L+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYY
Sbjct  762   LARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYY  821

Query  2906  FDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             FDYCAAGF T TL DYQ+VFSRPGNV AFGDP+     A+
Sbjct  822   FDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFHSFPYAH  861


 Score =   300 bits (767),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 166/210 (79%), Gaps = 3/210 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK--GGAGVVVYEKED-YLGGHAKTVTLDGVDLDLGFMVFN  573
             MRVAV+G G+ GL SAYVLA+  G   VV++EKE+  LGGHAKT+ LDGVDLD+GF+V N
Sbjct  1     MRVAVIGGGVCGLGSAYVLAREDGIEEVVLFEKEESVLGGHAKTMRLDGVDLDVGFIVCN  60

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  753
              VT+PNMME F++LGV ME+SDMSFSVSLDNG G EWGSRNG S LFAQK+N+ NPYFWQ
Sbjct  61    PVTHPNMMEFFKNLGVKMEVSDMSFSVSLDNGRGCEWGSRNGLSSLFAQKRNIFNPYFWQ  120

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MI E  KF  D L Y+EE + NPD DRN+TLGEF+KS GYS LFQKAY++P C SIW C 
Sbjct  121   MITEFYKFNKDALKYIEEMERNPDTDRNETLGEFLKSHGYSALFQKAYLVPACRSIWPCP  180

Query  934   SEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
              + ++ FSAYS+LSFCRNHHLLQ F    W
Sbjct  181   PDSILNFSAYSVLSFCRNHHLLQIFERPQW  210



>ref|XP_006489756.1| PREDICTED: uncharacterized protein LOC102615557 [Citrus sinensis]
Length=875

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/679 (65%), Positives = 547/679 (81%), Gaps = 6/679 (1%)
 Frame = +2

Query  971   FHSVATTTFCRISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDE  1150
             F + +  +FCR+  QLFG PQ +TV+R SHS ++KV E+L+  G +IR  CEV+SV   +
Sbjct  188   FSAFSVLSFCRL-FQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVYSVFPAD  246

Query  1151  QGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYL  1330
             +G +     I  +N  QE Y+GC+MA HAPD L++LG QATFDE RILGAF+YVY D++L
Sbjct  247   EGCS-----IVCENGSQEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVYRDVFL  301

Query  1331  HREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCL  1510
             HR+++FMP+N AAWSAWNF+G+ N ++CLTY LN LQ +G+T  P+L TLNP RTP+  L
Sbjct  302   HRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQKIGETSMPFLATLNPDRTPQNTL  361

Query  1511  LKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKR  1690
             LKW+TGH VPSVAAS+AS EL RIQGKR IW+ G YQGYGF EDGLK GMIAAHG+L K 
Sbjct  362   LKWSTGHSVPSVAASKASLELHRIQGKRGIWYSGVYQGYGFPEDGLKVGMIAAHGVLGKS  421

Query  1691  CSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVL  1870
             C+ L NP  MVPS  E GARL V RFL  FI TG  ILLEEGG  FTFEG      LK  
Sbjct  422   CAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNCPLKSD  481

Query  1871  VRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNS  2050
             +R+ +PQFYWKV TQADLGLA++YI+GD+SF+DK EGLLNLF I +AN+ L AS S+ N 
Sbjct  482   LRIQNPQFYWKVMTQADLGLANSYINGDLSFIDKDEGLLNLFLIVIANQGLDASTSKLNL  541

Query  2051  KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSC  2230
             +R  W+P+ +T++IASAKY+ RHISR+NTL QARRNIS HYD+SNELFSLFL ++M YSC
Sbjct  542   RRYLWSPMFYTASIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSC  601

Query  2231  AVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITL  2410
             A+FKSE EDL  AQMRK+SLLI+KA+++K   +LEIGCGWG+LAIE V++TGCKYTGITL
Sbjct  602   AIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITL  661

Query  2411  SEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGR  2590
             SE+QLKY E KV+EAGLQD+IR  LCDYRQ+P+  +YD IISCEM+E VGHE++ EFFG 
Sbjct  662   SEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGC  721

Query  2591  CESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC  2770
             CES+LAE+G+L+LQF S+PD+ YD +R S  FI EY+FPGGCLPSL+R+TSAM +SSRLC
Sbjct  722   CESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLC  781

Query  2771  VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGD  2950
             VEHLE+IGIH+YQTLRCWR N +E+QS+IL LGF++KFIRTWEYYFDYCAAGF + TLG+
Sbjct  782   VEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGN  841

Query  2951  YQIVFSRPGNVTAFGDPYK  3007
             YQIVFSRP NV AF +P++
Sbjct  842   YQIVFSRPSNVAAFSNPHE  860


 Score =   330 bits (846),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 184/225 (82%), Gaps = 3/225 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KMRVAV+G G+SGLVSAYVLAK G  VV+YEKED LGGHAKTVT+DGVDLD+GFM+FN V
Sbjct  4     KMRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHV  63

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
              YPNMME  ESLGVDM  SDMSFSVSLD G GYEWG+RNG S LFAQKKN+LNPYFWQM+
Sbjct  64    EYPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQML  123

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             RE++KFK+DVLSY+EE +NNPD+DRN+TLG FIKSRGYSELF KAY+IP+C+S+WSC S+
Sbjct  124   REMMKFKDDVLSYVEELENNPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSD  183

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALWSPTMAHCEAEVS*LCKQ  1074
             G M FSA+S+LSFCR   L Q F          H  +++  + +Q
Sbjct  184   GAMRFSAFSVLSFCR---LFQLFGHPQCVTVRRHSHSQIDKVSEQ  225



>ref|XP_002531842.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF30540.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=868

 Score =   907 bits (2343),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/672 (64%), Positives = 534/672 (79%), Gaps = 5/672 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQ+FG   WL VKR+S  ++NKVRE LE  GC+IR GC+V+ VST ++G      ++S  
Sbjct  199   LQIFGCSNWLIVKRQSQHFINKVRELLESWGCQIRTGCKVNFVSTSDKG-----CLVSCG  253

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
             N+ +E Y+GCI+  HAP++LK+LGKQATFDE RILGAFQY  SDI LH ++S+MP+N AA
Sbjct  254   NVSEEMYNGCIINVHAPNSLKLLGKQATFDERRILGAFQYECSDIVLHHDKSYMPKNPAA  313

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             W AWNFLG+ + + CLTYWLN L+N+G    P  +T+NP    +  LLKW+T HP+ S+A
Sbjct  314   WCAWNFLGSTDTKGCLTYWLNVLENVGKISSPLFLTMNPDHELKNTLLKWSTSHPILSIA  373

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             +S+A  E + IQGKR IWFC  YQG+G + DGLK GM+AAH LL   C+ L+   HM+PS
Sbjct  374   SSKAFLEFDSIQGKRGIWFCEPYQGFGCYGDGLKDGMVAAHNLLGDSCATLSKLKHMLPS  433

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
               E GAR  V R L   I TGSI+LLE+GGT+FT EG  K   LK +++VH+ QFYWK+ 
Sbjct  434   LLEFGARYFVIRLLGHIISTGSIVLLEDGGTIFTIEGASKNCSLKTILKVHNFQFYWKIM  493

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             T+A++GLA+AYI+GD SF+DK+EGLLNLF IFVANRD +  VS+   KRG W P L T+ 
Sbjct  494   TRAEIGLAEAYINGDFSFIDKEEGLLNLFMIFVANRDATNPVSKFWEKRGRWIPFLLTAC  553

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
             I SA YF  HI RQNTL QA RNIS HY++SNE F++FLDETMTYSCAVFK++DEDLK A
Sbjct  554   IPSAIYFFGHILRQNTLVQAPRNISHHYNVSNEFFAMFLDETMTYSCAVFKTQDEDLKVA  613

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q+RKISLLI+KA+I K+H +LEIGCGWGSLAIE V++TGCKYTGITLSE+QLK AEDKV+
Sbjct  614   QLRKISLLIEKARIDKKHEVLEIGCGWGSLAIEVVKKTGCKYTGITLSEEQLKIAEDKVK  673

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             +AGLQDNI+FLLCDYR+LP++ +YDRIISC M+E VGHE+M EFF  CESVLAE+G+LVL
Sbjct  674   QAGLQDNIKFLLCDYRELPESYKYDRIISCGMIEHVGHEYMEEFFDCCESVLAEDGLLVL  733

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2809
             QFI+IPD+RYDE R+S DF+KEYIFPGGCLPSL R+TSAM  +SRLC+EH+E+IG +YY 
Sbjct  734   QFIAIPDKRYDEVRKSIDFLKEYIFPGGCLPSLYRITSAMRTASRLCMEHVENIGSNYYL  793

Query  2810  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  2989
             TL+CWR NFL+ + +IL +GFD+KFIRTWEYYFDYCAAGF + TL DYQIVFSRPGN+ A
Sbjct  794   TLKCWRKNFLKNKEKILAMGFDEKFIRTWEYYFDYCAAGFKSYTLLDYQIVFSRPGNIAA  853

Query  2990  FGDPYKGLASAY  3025
              G+PYKG  SAY
Sbjct  854   LGNPYKGFPSAY  865


 Score =   300 bits (767),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 169/208 (81%), Gaps = 2/208 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  579
             MRVAV+G GISGL SAYVLAK GA VVVYEKED LGGHA KTV   GVD+DLGF+ FN  
Sbjct  1     MRVAVIGGGISGLASAYVLAKAGAEVVVYEKEDCLGGHANKTVNYKGVDVDLGFLAFNPA  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             +YPNM E FES+GVDME+SDMSFSVS+D G GYEWGSR G S LFAQKKN  NPYFWQM+
Sbjct  61    SYPNM-EFFESIGVDMELSDMSFSVSIDKGKGYEWGSRKGLSSLFAQKKNSFNPYFWQML  119

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             R+I KFK+D LSYLE+ +NN D++ N+ LG+FI SRGYSE+FQKAY++P+C SIWSC  E
Sbjct  120   RDINKFKHDALSYLEQIENNTDINENERLGQFIDSRGYSEVFQKAYLLPICRSIWSCPLE  179

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             G+M FSA+++LSF   HHLLQ F  + W
Sbjct  180   GIMNFSAFAVLSFFHKHHLLQIFGCSNW  207



>ref|XP_011091264.1| PREDICTED: uncharacterized protein LOC105171751 [Sesamum indicum]
Length=866

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 444/674 (66%), Positives = 531/674 (79%), Gaps = 6/674 (1%)
 Frame = +2

Query  1007  SLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISG  1186
             +LQL GR Q LT   RS SYV+KV++ELE RGC+IR   E+ SV  +++G A     I+ 
Sbjct  198   TLQLIGRSQRLTPTWRSESYVDKVKKELESRGCQIRTNSEICSVFANDEGCA-----ITC  252

Query  1187  KNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLA  1366
             K+  +E YDGCI+A  APD LKMLGK AT DELRILGAFQY  SD +LHR+   MP+N A
Sbjct  253   KDGSKEGYDGCIIATDAPDALKMLGKHATHDELRILGAFQYACSDTFLHRDNDLMPKNPA  312

Query  1367  AWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsv  1546
              WS+ NFLGT++ +  +TYWLN +QN+ DT   +  TLNPP TP+  L KW+T HP+PSV
Sbjct  313   LWSSRNFLGTIDKKAYITYWLNNMQNINDTVLLFFFTLNPPHTPKSTLFKWSTRHPIPSV  372

Query  1547  aasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVP  1726
             AAS+A  +L  IQGKRR+WF GAYQGYGF EDG+KAG+ AA+ LL+K  +   N  H +P
Sbjct  373   AASKALRQLNLIQGKRRLWFYGAYQGYGFPEDGIKAGISAANDLLRKSYTVQYNRKHTIP  432

Query  1727  SWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKV  1906
             SW E GAR LVTRFL  FI TG I LLEEGGT FTFEGT +K+ LKV +RVH+PQFYWKV
Sbjct  433   SWLEIGARGLVTRFLERFIATGCITLLEEGGTAFTFEGTRRKSNLKVTLRVHTPQFYWKV  492

Query  1907  ATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTS  2086
             AT+ADLG ADAYI+GD SF+DK EGLLNLF I +A+ +L+  +++ N KRGWWTPLL+TS
Sbjct  493   ATEADLGFADAYINGDFSFIDKDEGLLNLFLICIASTELNTYMTKLNKKRGWWTPLLYTS  552

Query  2087  AIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKT  2266
              ++SAKYF +H +R+NTLTQARRNIS+HYDLSNELFSLFLDETMTYSCA+FK+ DEDLK 
Sbjct  553   IVSSAKYFFKHAARKNTLTQARRNISQHYDLSNELFSLFLDETMTYSCAMFKTPDEDLKN  612

Query  2267  AQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKV  2446
             AQ+RK   LI+KA+ISKEHHILEIGCGWGSLA+EAV+RTGCKYTGITLSE+QL+YA+ KV
Sbjct  613   AQLRKTHTLIEKARISKEHHILEIGCGWGSLALEAVKRTGCKYTGITLSEKQLQYAQLKV  672

Query  2447  REAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILV  2626
             +EAGLQD I  LLCDYRQLP + +YDRIISC M+E VGHE M EFF  CES LAENG+LV
Sbjct  673   KEAGLQDRIELLLCDYRQLPKSYKYDRIISCGMIEHVGHEVMEEFFRCCESALAENGLLV  732

Query  2627  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  2806
             LQFI+  DE+YDE R+S  F+KEYIFPGGC PSLS V S MAA+SRL   HLE+IG HY+
Sbjct  733   LQFIASADEKYDESRRSPGFVKEYIFPGGCTPSLSHVISCMAAASRLSAVHLEEIGCHYF  792

Query  2807  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  2986
              TLR WR N L+  S+IL +GF++KFIRTWEYYFDYCAAGF  C LGDYQIVFSRPG+V 
Sbjct  793   HTLRRWRENLLKNHSKILAMGFNEKFIRTWEYYFDYCAAGFKYCILGDYQIVFSRPGDVA  852

Query  2987  AFGD-PYKGLASAY  3025
             AF + PY  +   Y
Sbjct  853   AFSNKPYNAVPGDY  866


 Score =   261 bits (668),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 159/201 (79%), Gaps = 2/201 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG G+SGL +AYVLAK G  VVVYEKED LGG AKTV + G  LDLGF VF RV 
Sbjct  1     MRVAVVGGGVSGLAAAYVLAKDGVEVVVYEKEDALGGRAKTVDIGGTLLDLGFTVFTRVM  60

Query  583   YPNMMELFESLGVDMEISDMS-FSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             +P  +EL ESLGVD E+ DMS FSVSLD G G EWG+RNG S LFA+K N LNPYFW MI
Sbjct  61    HPETIELLESLGVDRELCDMSSFSVSLDEGQGCEWGTRNGVSSLFARKTNALNPYFWNMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             RE++KFKND  SY+EE ++NPD+DRN+TL  FI+S GYSELFQKA+++P CASIWSCSS 
Sbjct  121   REMVKFKNDASSYVEELESNPDIDRNETLEHFIQSCGYSELFQKAFLVPTCASIWSCSS-  179

Query  940   GVMAFSAYSILSFCRNHHLLQ  1002
             GVM FSAYS+LS  RN   LQ
Sbjct  180   GVMNFSAYSVLSVLRNDPTLQ  200



>ref|XP_006489667.1| PREDICTED: uncharacterized protein LOC102613225 isoform X2 [Citrus 
sinensis]
Length=603

 Score =   903 bits (2334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/601 (70%), Positives = 509/601 (85%), Gaps = 0/601 (0%)
 Frame = +2

Query  1223  MAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVN  1402
             MA HAPD L++LG QAT DE RILGAF+YVYSDI+LHR+++FMP+N AAWSAWNFLG+ +
Sbjct  1     MAVHAPDALRILGNQATLDETRILGAFRYVYSDIFLHRDKNFMPQNTAAWSAWNFLGSTD  60

Query  1403  NRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERI  1582
              ++CLTYWLN LQN G+T  P+L TLNP  TPE  LLKW+T +  PSVAAS+AS  ++ I
Sbjct  61    GKICLTYWLNVLQNNGETGVPFLATLNPDHTPENTLLKWSTSNQAPSVAASKASLAVDLI  120

Query  1583  QGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVT  1762
             QGKR IWFCGAYQGYGF EDGLKAGMI AHG+L K C+ L+ P HMVPS  E GARL V 
Sbjct  121   QGKRGIWFCGAYQGYGFQEDGLKAGMITAHGVLGKNCAVLSKPKHMVPSLLEKGARLFVA  180

Query  1763  RFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAY  1942
              F   +I TG +ILLEEGGT+FTFEG  + + LK ++R+H+PQFYWKV T+ADLGLAD+Y
Sbjct  181   GFFRRYISTGCLILLEEGGTIFTFEGALRNSPLKTVLRIHNPQFYWKVMTEADLGLADSY  240

Query  1943  IHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHI  2122
             I+GD SFVDK EGLLNLF I +AN+DL++S S+   KRGWW+P+ FT++IASAK F RHI
Sbjct  241   INGDFSFVDKDEGLLNLFLILIANQDLNSSASKLKQKRGWWSPMFFTASIASAKCFFRHI  300

Query  2123  SRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDK  2302
             SR+NTLTQARRN+SRHYDLSNELFSLFLD++MTYSCA+FKSE EDL+  QMRKIS+LI+K
Sbjct  301   SRKNTLTQARRNVSRHYDLSNELFSLFLDKSMTYSCAIFKSEHEDLEVGQMRKISVLIEK  360

Query  2303  AKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFL  2482
             A++SK   +L+IGCGWG+LAIE V++TGCKYTGITLS++QLKYA+ KVREAGLQD+IRF 
Sbjct  361   ARVSKGQEVLDIGCGWGTLAIEIVKQTGCKYTGITLSKEQLKYAQIKVREAGLQDHIRFY  420

Query  2483  LCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYD  2662
             LCDYRQLP   +YDRIISCEM+E VGH++M EFF  CES+LA++G+LVLQF S PD+ YD
Sbjct  421   LCDYRQLPKANKYDRIISCEMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYD  480

Query  2663  EYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLE  2842
             EYR S  F+ EYIFPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E
Sbjct  481   EYRLSPGFLNEYIFPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFME  540

Query  2843  RQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             +QS+IL LGF++KFIRTWEYYFDYCAA F +  +G+YQIVFSRPGNV AF +PY+GL SA
Sbjct  541   KQSEILALGFNEKFIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGNVAAFSNPYEGLPSA  600

Query  3023  Y  3025
             Y
Sbjct  601   Y  601



>ref|XP_011029775.1| PREDICTED: uncharacterized protein LOC105129420 isoform X4 [Populus 
euphratica]
Length=566

 Score =   898 bits (2321),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/566 (76%), Positives = 490/566 (87%), Gaps = 0/566 (0%)
 Frame = +2

Query  1328  LHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQC  1507
             + RE   +     AWSAWNFLG+ +N+VCLTYWLN LQN+ +T  P+LVTLNP   P+  
Sbjct  1     MRREYLVLSNICIAWSAWNFLGSTDNKVCLTYWLNVLQNIDETGLPFLVTLNPDHVPDHT  60

Query  1508  LLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKK  1687
             L+KW+TGHPVPSVAA++AS EL+ IQGKRRIWFCGAYQGYGFHEDGLK+GM+AAHGLL  
Sbjct  61    LVKWSTGHPVPSVAATKASLELDHIQGKRRIWFCGAYQGYGFHEDGLKSGMVAAHGLLGN  120

Query  1688  RCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKV  1867
             RC+ L+NP HM PS  ETGARL VTRFL  +I TG +ILLEEGGTVF+FEGT KK  LK 
Sbjct  121   RCAILSNPKHMAPSMLETGARLFVTRFLGHYISTGCLILLEEGGTVFSFEGTSKKCSLKT  180

Query  1868  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2047
             +++VH+PQFYWK+ TQADLGLADAYI+GD SFV+K EGLLNL  I + NRD++ S S+ N
Sbjct  181   VLKVHNPQFYWKIMTQADLGLADAYINGDFSFVNKDEGLLNLLMILIVNRDVNKSASKLN  240

Query  2048  SKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  2227
              KRGWWTPLLFT+ IASAK+FI+H+SRQNTLTQARRNISRHYDLSNELF+LFLDETMTYS
Sbjct  241   KKRGWWTPLLFTAGIASAKFFIQHVSRQNTLTQARRNISRHYDLSNELFALFLDETMTYS  300

Query  2228  CAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGIT  2407
             C VFK+EDEDLK AQMRKISLLI+KA ISK+H ILEIGCGWG+LAIEAV+RTGCKYTGIT
Sbjct  301   CGVFKTEDEDLKDAQMRKISLLIEKAGISKDHEILEIGCGWGTLAIEAVQRTGCKYTGIT  360

Query  2408  LSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFG  2587
             LSE+QLK+AE KV+EAGLQD I F LCDYRQLP   +YDRIISCEM+EAVGHE+M EFFG
Sbjct  361   LSEEQLKHAEMKVKEAGLQDRIAFHLCDYRQLPKTHKYDRIISCEMIEAVGHEYMEEFFG  420

Query  2588  RCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL  2767
              CESVLAENG+LVLQFISIP+ERYDEYRQSSDFIKEYIFPGGCLPSL+R+TSAMA SSRL
Sbjct  421   CCESVLAENGLLVLQFISIPEERYDEYRQSSDFIKEYIFPGGCLPSLTRITSAMATSSRL  480

Query  2768  CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLG  2947
             CVEH+E+IGIHYYQTL+ WR NFLE+Q +IL LGF++KFIRTWEYYFDY AAGF T TLG
Sbjct  481   CVEHVENIGIHYYQTLKYWRKNFLEKQRKILALGFNEKFIRTWEYYFDYSAAGFKTHTLG  540

Query  2948  DYQIVFSRPGNVTAFGDPYKGLASAY  3025
             +YQ+VFSRPGNV A  +PYK   SAY
Sbjct  541   NYQVVFSRPGNVVALSNPYKSFPSAY  566



>ref|XP_004169247.1| PREDICTED: uncharacterized protein LOC101225338, partial [Cucumis 
sativus]
Length=800

 Score =   897 bits (2319),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/673 (63%), Positives = 532/673 (79%), Gaps = 7/673 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQLFG PQWLTVK  S+SY+ K+++ LE  GC+IR   +V+S+ST ++G      I+S  
Sbjct  129   LQLFGHPQWLTVKSSSNSYLKKLQKALESAGCQIRTCSKVNSISTTKEG-----CIVSYG  183

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
                +E +D C++A +A D L +LG +AT +E R+LGAF YV+SD+ LH ++SFMP+NL A
Sbjct  184   VHFEEIFDQCVIATNATDALSILGNEATQEEKRVLGAFHYVFSDMILHHDKSFMPQNLNA  243

Query  1370  WSAWNFLGT-VNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsv  1546
             WSA NFLG   NN  C+TYW+N +QN    K P+ VT NP + P+  L+K + GHP+PS+
Sbjct  244   WSALNFLGNNTNNEACMTYWINAIQNNLGEKSPFFVTSNPEQEPKNILVKSSIGHPIPSL  303

Query  1547  aasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPL-NNPNHMV  1723
             +A +A +EL+ IQGKR+IWFCG Y G G HEDGLKAG I AH +L K  + L NNPNHMV
Sbjct  304   SAFKALNELDSIQGKRQIWFCGPYLGSGSHEDGLKAGTIVAHKILGKSITILSNNPNHMV  363

Query  1724  PSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWK  1903
             PS  E GAR +VT+F A +I  GS+ ++EEGG +FTF+G D K L  V+++VH+P FYWK
Sbjct  364   PSLVEIGARYVVTKFFARYISIGSLTIMEEGGRLFTFKGMDNKFLPNVVLKVHNPNFYWK  423

Query  1904  VATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFT  2083
             + T+AD+GLADAYI+ D SFVDK EGL NL +I +AN+D ++SV++ N KRGWWTP L+T
Sbjct  424   IMTRADIGLADAYINADFSFVDKNEGLFNLVQILIANKDANSSVAKLNKKRGWWTPPLYT  483

Query  2084  SAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLK  2263
             + IA AKYF +H  RQNT+TQAR NISRHYDLSNELFSLFLD+TMTYSCA+FK EDEDL+
Sbjct  484   AGIAYAKYFFQHTLRQNTITQARTNISRHYDLSNELFSLFLDDTMTYSCAIFKREDEDLR  543

Query  2264  TAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDK  2443
              AQ+RKIS LI KA+I K HH+L+IGCGWGSLAIE V++TGC  T ITLSE+QLKYAE K
Sbjct  544   VAQLRKISHLIKKARIDKNHHVLDIGCGWGSLAIELVKQTGCHCTAITLSEEQLKYAERK  603

Query  2444  VREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGIL  2623
             V+  GLQDNI+F LCDYRQLP+  +YDRIISC MLE VGHEFM +FFG CES L ENG+L
Sbjct  604   VKVLGLQDNIKFHLCDYRQLPNTPKYDRIISCGMLECVGHEFMEDFFGSCESALVENGLL  663

Query  2624  VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHY  2803
             VLQFIS+PD++YDE+R SS F++EYIFPGGCLPSL+RVT+AMA +SR CVEHLE+IGIHY
Sbjct  664   VLQFISMPDDQYDEHRLSSGFMREYIFPGGCLPSLNRVTTAMAKASRFCVEHLENIGIHY  723

Query  2804  YQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  2983
             YQTL+CWR NF+  + +I++LGFD+ FIRTWEYYFDYCAAGF +  +GDYQIVFSR GNV
Sbjct  724   YQTLKCWRKNFVMNKRKIIELGFDESFIRTWEYYFDYCAAGFKSRIIGDYQIVFSRAGNV  783

Query  2984  TAFGDPYKGLASA  3022
             T F +PY+G+ SA
Sbjct  784   TTFNNPYQGIPSA  796


 Score =   167 bits (424),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = +1

Query  613   LGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVL  792
             L V++E S+MSFS+S+D G GYEWG+RNG S LFAQK N+L+P FWQMIREI KF +DV 
Sbjct  1     LEVEIEESNMSFSISIDKGRGYEWGTRNGVSSLFAQKNNILDPSFWQMIREITKFNHDVT  60

Query  793   SYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSIL  972
              YL   +N   +D+N+TLG+F+ SR YS++FQ AY++PMC SIWS   E V+ FSA S+ 
Sbjct  61    DYLTAMENKQVLDQNETLGQFLNSRDYSDVFQTAYLLPMCGSIWSNPIEKVVNFSAVSVF  120

Query  973   SFCRNHHLLQNFSPALW  1023
             S+ ++H LLQ F    W
Sbjct  121   SYLQDHCLLQLFGHPQW  137



>gb|KDO54097.1| hypothetical protein CISIN_1g0029283mg, partial [Citrus sinensis]
Length=748

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/626 (70%), Positives = 521/626 (83%), Gaps = 7/626 (1%)
 Frame = +2

Query  977   SVATTTFCRI--SLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDE  1150
             + +  +FCR   +LQ+FGRPQWLTV+ RS SYV+KV E LE  GC+I+ GCEV SV    
Sbjct  128   AFSVLSFCRNHHALQIFGRPQWLTVRSRSRSYVDKVIELLESLGCQIKTGCEVRSVLQYG  187

Query  1151  QGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYL  1330
             +G     + I G +  Q  YDGCIMA HAPD L+MLG QATF+E R+LGAFQYVYSDI+L
Sbjct  188   EGR----IEIRGDDF-QRVYDGCIMAVHAPDALRMLGNQATFEEKRVLGAFQYVYSDIFL  242

Query  1331  HREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCL  1510
             HR+++FMPRN AAWSAWNFLG+   +VCLTYWLN +QN+ +T+ P+LVTLNP  TPE  L
Sbjct  243   HRDKNFMPRNPAAWSAWNFLGSTGGKVCLTYWLNVVQNIEETRLPFLVTLNPDHTPEHTL  302

Query  1511  LKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKR  1690
              KW+T HPVPSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGMIAAHG+L K 
Sbjct  303   FKWSTSHPVPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMIAAHGMLGKS  362

Query  1691  CSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVL  1870
             C+ L NP HM PS  E GAR+ V RFL  FI TG +I LEEGGT+FTFEG  K   LK +
Sbjct  363   CAILANPKHMEPSLMEKGARIFVARFLRQFISTGCLIFLEEGGTIFTFEGAQKNCPLKTV  422

Query  1871  VRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNS  2050
             +R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK EGLLNLF I +AN+DL +S S+   
Sbjct  423   LRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKDEGLLNLFLIVLANQDLDSSTSKLKQ  482

Query  2051  KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSC  2230
             KRGWW+P+ FT++IASAKYF RHISR+NTLTQARRNISRHYDLSNELFSLFLD++M YSC
Sbjct  483   KRGWWSPMFFTASIASAKYFFRHISRKNTLTQARRNISRHYDLSNELFSLFLDKSMLYSC  542

Query  2231  AVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITL  2410
             A+FKSE EDL+ AQMRK+SLLI KA++SK H +LEIGCGWG+LAIE V++TGCKYTGITL
Sbjct  543   AIFKSEHEDLEVAQMRKVSLLIQKARVSKGHEVLEIGCGWGTLAIEIVKQTGCKYTGITL  602

Query  2411  SEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGR  2590
             SE+QLKYAE KV+EAGLQD+IR  LCDYRQLP + +YDRIISCEM+EAVGH++M EFFG 
Sbjct  603   SEEQLKYAEMKVKEAGLQDHIRLYLCDYRQLPKSNKYDRIISCEMIEAVGHDYMEEFFGC  662

Query  2591  CESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC  2770
             CES+LAE+G+L+LQFIS+PD+ YDE+R S  FIKEYIFPGGCLPSL+R+TSAM +SSRLC
Sbjct  663   CESLLAEHGLLLLQFISVPDQCYDEHRLSPGFIKEYIFPGGCLPSLNRITSAMTSSSRLC  722

Query  2771  VEHLEDIGIHYYQTLRCWRANFLERQ  2848
             VE LE+IGIHYYQTLRCWR NFLE+Q
Sbjct  723   VEDLENIGIHYYQTLRCWRKNFLEKQ  748


 Score =   252 bits (644),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VTYPNMME FESLGVDMEISDMSFSVSLD G G EW SRNG SGLFAQKKNLLNPYFWQM
Sbjct  1     VTYPNMMEFFESLGVDMEISDMSFSVSLDKGQGCEWSSRNGMSGLFAQKKNLLNPYFWQM  60

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             +REI+KF +DVLSYLE+ +NN D+DRN+TLG+F+++RGYSELFQKAY++P+C SIWSCSS
Sbjct  61    LREIIKFNDDVLSYLEDLENNADIDRNETLGQFVETRGYSELFQKAYLVPVCGSIWSCSS  120

Query  937   EGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             E VM+ SA+S+LSFCRNHH LQ F    W
Sbjct  121   EKVMSCSAFSVLSFCRNHHALQIFGRPQW  149



>gb|EEC82010.1| hypothetical protein OsI_25960 [Oryza sativa Indica Group]
Length=890

 Score =   895 bits (2314),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/709 (64%), Positives = 550/709 (78%), Gaps = 24/709 (3%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +    +FCR    LQLFGRPQWLTVK RSH+YVN+VREELE  GC+I+ GC
Sbjct  188   PSQGVLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHTYVNRVREELESLGCQIKTGC  247

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV SVS  E G  G  V+ +G    +EAYD  I A HAPD L +LG +AT DE RILGAF
Sbjct  248   EVQSVSALEGG--GYRVVEAGG--TEEAYDSIIFAVHAPDALNILGDEATHDERRILGAF  303

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNL----GDTKQPYL  1471
             QYVYSDIYLH ++S MPRN +AWS+WNFLGT  + VC+TYWLN LQN+    G  ++P+L
Sbjct  304   QYVYSDIYLHCDKSLMPRNPSAWSSWNFLGTTTSGVCVTYWLNLLQNIEESAGRGRRPFL  363

Query  1472  VTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLK  1651
             VTLNPPR P+  LL W T HPVPSVAA+ A+ EL R+QG R +WFCGAYQGYGFHEDGLK
Sbjct  364   VTLNPPRVPDHVLLAWKTSHPVPSVAAAAAAGELRRVQGCRGLWFCGAYQGYGFHEDGLK  423

Query  1652  AGMIAAH--------GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILL  1807
             AGM AA         G  ++R   L NP  MVPSW E GARLLVTRFLA ++  G++ LL
Sbjct  424   AGMAAARGLLLAANGGAGERRL--LANPRQMVPSWTEAGARLLVTRFLAGYVSVGNLTLL  481

Query  1808  EEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLL  1987
             EEGGT+F+F    KK   K ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDKK+GLL
Sbjct  482   EEGGTMFSFGEAGKKCQAKCVMRVHDPLFYWKVATEADLGLADAYINGYCSFVDKKQGLL  541

Query  1988  NLFKIFVANRDLSASVSRSNSK-RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNIS  2164
             NL  I +ANRD +   S S S+ RGWWTP+L T+ +ASAKYF+RH+SR+NT+TQ R+NIS
Sbjct  542   NLLLILIANRDANKQSSTSTSRIRGWWTPMLLTAGVASAKYFLRHVSRKNTVTQTRQNIS  601

Query  2165  RHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGC  2344
             +HYDLSN+ FSLFLD +MTYSCAVFK EDE L+ AQ RK+SLLI KA++ ++HH+LEIG 
Sbjct  602   QHYDLSNDFFSLFLDPSMTYSCAVFKDEDESLEAAQQRKVSLLIHKARVERDHHVLEIGS  661

Query  2345  GWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYD  2524
             GWGSLAI+ V++TGCKYTG+TLSE+QLKY + KV+EAGL+D++ FLLCDYRQ+P   +YD
Sbjct  662   GWGSLAIQVVKQTGCKYTGVTLSEEQLKYCQRKVKEAGLEDHMTFLLCDYRQIPTVRKYD  721

Query  2525  RIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIF  2704
             RIISCEM+E VGHE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIF
Sbjct  722   RIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFIKEYIF  781

Query  2705  PGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKF  2884
             PGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + +I  LGFD KF
Sbjct  782   PGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANREEIKSLGFDDKF  841

Query  2885  IRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  3022
             IR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  842   IRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  890


 Score =   301 bits (770),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 174/216 (81%), Gaps = 10/216 (5%)
 Frame = +1

Query  406   RVAVVGAGISGLVSAYVLAKGGAGVVV--YEKEDYLGGHAKTVTLDG----VDLDLGFMV  567
             RVAVVGAG+SGL +A+  A+GG GV V  YE+ED LGGHA+TV +DG    VDLDLGFMV
Sbjct  3     RVAVVGAGVSGLAAAHEAARGGGGVRVTLYEREDSLGGHARTVAVDGDAGPVDLDLGFMV  62

Query  568   FNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNG--HGYEWGSRNGFSGLFAQKKNLL  735
             FNRVTYPNMME FE LGV+ME+SDMSFSVS  L +G     EWGSRNG +GL AQK N +
Sbjct  63    FNRVTYPNMMEWFEELGVEMELSDMSFSVSAQLQDGDEQTMEWGSRNGLAGLLAQKTNAV  122

Query  736   NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             +P FW+MIREILKFK+DVL+YLEE D NPD+DRN+TLG F++S GYS LFQ+AY++P+CA
Sbjct  123   SPAFWRMIREILKFKDDVLTYLEEHDKNPDLDRNETLGHFVQSHGYSRLFQQAYLVPICA  182

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
              IWSC S+GV+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  183   CIWSCPSQGVLGFSAFFVLSFCRNHHLLQLFGRPQW  218



>ref|XP_009780643.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 [Nicotiana sylvestris]
Length=543

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/543 (79%), Positives = 482/543 (89%), Gaps = 0/543 (0%)
 Frame = +2

Query  1397  VNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELE  1576
             +NNR C+TYWLN +QNL DTK PYLVT++PP TP+  LLKWTT H VPSVAAS+AS EL+
Sbjct  1     MNNRGCMTYWLNIIQNLVDTKLPYLVTIDPPHTPDHTLLKWTTCHLVPSVAASKASRELD  60

Query  1577  RIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLL  1756
             +IQGKR IWFCGAYQGYGFHED LKAG+ AA  +L+++C+ L+NP HMVP+WPETGARLL
Sbjct  61    QIQGKRGIWFCGAYQGYGFHEDELKAGVAAADDILRRKCTILDNPKHMVPTWPETGARLL  120

Query  1757  VTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLAD  1936
             VTRFL SFI TG IILLE+GGT+FTF+ TD+K  LKV +RVHS QFYWKVATQ DLGLAD
Sbjct  121   VTRFLKSFIATGCIILLEDGGTIFTFQVTDRKCTLKVSLRVHSTQFYWKVATQGDLGLAD  180

Query  1937  AYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIR  2116
             A+IHGD SFVDK EGLLNLF IFVANRDL ASV+RS++KRGWWTPLL T+A++SAKYFI+
Sbjct  181   AFIHGDFSFVDKNEGLLNLFMIFVANRDLKASVTRSSNKRGWWTPLLSTAALSSAKYFIQ  240

Query  2117  HISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLI  2296
             H+S QNTLT+ARRNISRHYDLSNELFSLFLDETMTYSCA+FKSEDEDLKTAQ+RKISLLI
Sbjct  241   HVSNQNTLTKARRNISRHYDLSNELFSLFLDETMTYSCAIFKSEDEDLKTAQLRKISLLI  300

Query  2297  DKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIR  2476
              KAKISKEHHILEIG GWGSLA+E V++TGCKYTG+TLSEQQL YA+  V +AGLQD I 
Sbjct  301   KKAKISKEHHILEIGFGWGSLAVEVVKQTGCKYTGVTLSEQQLTYAQLIVEQAGLQDQIT  360

Query  2477  FLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDER  2656
             FLLCDYRQ+P+  +YDRIISC MLE VGH+FM EFF  CES LAE+G+LV+QFISIPDER
Sbjct  361   FLLCDYRQMPNKDKYDRIISCGMLEHVGHDFMGEFFSCCESALAEDGLLVVQFISIPDER  420

Query  2657  YDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANF  2836
             YDEYRQSSDFIKEYIFPGGCLP+L+RVTSAMAA+SRLCV HLE+IGIHYYQTLRCWR  F
Sbjct  421   YDEYRQSSDFIKEYIFPGGCLPALNRVTSAMAAASRLCVVHLEEIGIHYYQTLRCWREKF  480

Query  2837  LERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLA  3016
             L+ QSQI  LGFD KFIRTWEYYFDYCAAGF TCTLGDYQIVFSRPGNV  FGDPY G+ 
Sbjct  481   LKNQSQIRALGFDDKFIRTWEYYFDYCAAGFKTCTLGDYQIVFSRPGNVAVFGDPYNGVP  540

Query  3017  SAY  3025
             SAY
Sbjct  541   SAY  543



>dbj|BAB02771.1| mycolic acid methyl transferase-like protein [Arabidopsis thaliana]
Length=842

 Score =   891 bits (2303),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/706 (64%), Positives = 532/706 (75%), Gaps = 32/706 (5%)
 Frame = +2

Query  959   LTPFFHSVATTTFCRISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSV  1138
             L  F +S   +   + +  +FGRPQWLTV  RS +YV KVR ELE+ GC IR  C+V SV
Sbjct  149   LGEFLNSRGYSELFQQAYLIFGRPQWLTVAGRSQTYVAKVRTELERLGCRIRTSCDVKSV  208

Query  1139  STDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYS  1318
             ST E G     V ++  +  +E +D CI+A HAPD L++LG++ TFDE R+LGAFQYVYS
Sbjct  209   STSENG----CVTVTSGDGSKEVFDRCILAMHAPDALRLLGEEVTFDESRVLGAFQYVYS  264

Query  1319  DIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTP  1498
             DIYLH +   MPRN AAWSAWNFLG+   +VC+TYWLN LQNLG+  +P+ VTLNP  TP
Sbjct  265   DIYLHHDIDLMPRNQAAWSAWNFLGSTEKKVCVTYWLNILQNLGENSEPFFVTLNPDETP  324

Query  1499  EQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQG-YG-----FHEDGLKAGM  1660
             ++ LLKWTTGHPVPSVAA  AS EL +IQGKR IWFCGAYQG YG       +    +  
Sbjct  325   KKTLLKWTTGHPVPSVAAWTASQELHKIQGKRNIWFCGAYQGWYGCCTRFVRQRNCSSEQ  384

Query  1661  IAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVT---GSIILLEEGGTVFT  1831
              A +G       P  + N       +    + + RF    I+T   G   +LEEGGT+FT
Sbjct  385   SATYG-------PFLDRNRSSAFRYKILGTIHINRFCN--IITYRYGLNRILEEGGTMFT  435

Query  1832  FEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVA  2011
             F G D    LK ++++HSPQFYWKV TQADLGLADAYI+GD SFVDK+ GLLNL  I V 
Sbjct  436   FGGKDSTCPLKSILKIHSPQFYWKVMTQADLGLADAYINGDFSFVDKESGLLNL--IMVK  493

Query  2012  NRDLSA--------SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISR  2167
               + SA        S    NS+RGWWTP+  T+ +ASAKYF++H+SRQNTLTQARRNISR
Sbjct  494   ALNFSALRIGMQALSPKLFNSRRGWWTPMFLTAGLASAKYFLKHVSRQNTLTQARRNISR  553

Query  2168  HYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCG  2347
             HYDLSNELF  FLD+TMTYS AVFKS+DEDL+TAQMRKISLLIDKA+I K+H +LEIGCG
Sbjct  554   HYDLSNELFGFFLDDTMTYSSAVFKSDDEDLRTAQMRKISLLIDKARIEKDHEVLEIGCG  613

Query  2348  WGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDR  2527
             WG+LAIE V RTGCKYTGITLS +QLKYAE+KV+EAGLQD I F L DYRQL D  +YDR
Sbjct  614   WGTLAIEVVRRTGCKYTGITLSIEQLKYAEEKVKEAGLQDWITFELRDYRQLSDAQKYDR  673

Query  2528  IISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFP  2707
             IISCEMLEAVGHEFM  FF RCE+ LAENG++VLQFISIP+ERY+EYR SSDFIKEYIFP
Sbjct  674   IISCEMLEAVGHEFMEMFFSRCEAALAENGLIVLQFISIPEERYNEYRLSSDFIKEYIFP  733

Query  2708  GGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFI  2887
             GGCLPSL+RVT+AM++SSRLC+EH+E+IGIHYYQTLR WR NFL RQ QI+ LGFD KF+
Sbjct  734   GGCLPSLARVTTAMSSSSRLCIEHVENIGIHYYQTLRLWRKNFLARQKQIMALGFDDKFV  793

Query  2888  RTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             RTWEYYFDYCAAGF T TLG+YQ+VFSRPGNV AF D Y+G  SAY
Sbjct  794   RTWEYYFDYCAAGFKTLTLGNYQLVFSRPGNVAAFADSYRGFPSAY  839


 Score =   274 bits (700),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/168 (77%), Positives = 149/168 (89%), Gaps = 1/168 (1%)
 Frame = +1

Query  403  MRVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
            M+VAV+G+GISGL SAYVLA  G   VV+YEKE+ LGGHAKTV  DGVDLDLGFMVFNRV
Sbjct  1    MKVAVIGSGISGLGSAYVLANQGVKEVVLYEKEESLGGHAKTVRFDGVDLDLGFMVFNRV  60

Query  580  TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
            TYPNMME FE+LGV+ME+SDMSF+VSLDNG G EWGSRNG SGLFAQKKN+LNPYFWQMI
Sbjct  61   TYPNMMEFFENLGVEMEVSDMSFAVSLDNGKGCEWGSRNGVSGLFAQKKNVLNPYFWQMI  120

Query  760  REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYII  903
            REI++FK DVL Y+EE + NPD+DR +TLGEF+ SRGYSELFQ+AY+I
Sbjct  121  REIVRFKEDVLKYIEELEGNPDIDRKETLGEFLNSRGYSELFQQAYLI  168



>ref|XP_010670924.1| PREDICTED: uncharacterized protein LOC104887860 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=872

 Score =   889 bits (2298),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/691 (63%), Positives = 539/691 (78%), Gaps = 11/691 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    L+L G PQWL+V   S  YVNK+REELE RG +IR  CEV+ VST
Sbjct  184   FSAFSVLSFCRNHHLLELSGGPQWLSVSGGSQQYVNKLREELEVRGSQIRTSCEVNFVST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              ++G A    +  G    ++ YDGCI+A  AP+ LK+LGK+ T DE RILGA QYV  DI
Sbjct  244   SDKGCA----LFYGDGS-EDLYDGCIIAVPAPNALKILGKEVTDDETRILGALQYVGRDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR++ FMP+N AAWSA NF G+ +N VCLTYW+N LQN+  T QP L+T+NPP  PE 
Sbjct  299   FLHRDKKFMPQNPAAWSALNFQGSTDNTVCLTYWINVLQNISKTDQPLLLTINPPHPPEN  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLK +TG  VPSVA+ +AS EL  IQGKR IWFCG   G GFHEDGLKAG+IAA+ +LK
Sbjct  359   FLLKRSTGVLVPSVASMKASLELRNIQGKRGIWFCGTRHGNGFHEDGLKAGLIAANDVLK  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             +   PL NP  M  SW E  AR  + R+L SFI  G +ILLE+GGTV  FEG+DK+   K
Sbjct  419   RTFLPLPNPKKMALSWTEATARRYIIRYLKSFISAGCLILLEDGGTVLKFEGSDKRCTWK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
               +RVH+PQFYWKVA +ADLGLADA+I+GDIS VDK +GLL+LF+IF+AN  L   VS  
Sbjct  479   TAIRVHNPQFYWKVALEADLGLADAFINGDISIVDKDDGLLDLFRIFLANMYLYRCVSMD  538

Query  2045  NSK----RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2212
               K    +GWWTP+ FT+ IASAKYF +H+SR+N++T ARRNI+RHYDLSNE+FSLFLD+
Sbjct  539   EKKSFDFKGWWTPMFFTAGIASAKYFYQHLSRKNSVTLARRNIARHYDLSNEMFSLFLDD  598

Query  2213  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2392
             TMTYSCAVFKS+DEDLK AQ+RK+ LLI+KA++ K+H +L+IGCGWGSLAIE V++TGC+
Sbjct  599   TMTYSCAVFKSKDEDLKVAQLRKLHLLIEKARVEKQHEVLDIGCGWGSLAIEIVKKTGCR  658

Query  2393  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2572
             YTGITL+E+QLK AE +V+EAGLQD+I+FLLCDYRQLP + ++DRIISC MLE VG E+ 
Sbjct  659   YTGITLAEEQLKLAEQRVKEAGLQDHIKFLLCDYRQLPASHKFDRIISCGMLEHVGDEYY  718

Query  2573  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2752
              +FF  CES+LA+ G+LVLQ ISIPDERYD +R+SSDF++EYIFPGGCLPSLSR+T+AMA
Sbjct  719   EDFFRHCESLLADTGLLVLQTISIPDERYDGHRKSSDFMREYIFPGGCLPSLSRLTTAMA  778

Query  2753  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2932
             ++SRLCVEH+E+IG+HY Q LRCWR NFLE Q +I  LGFD KF+R WEYYFDY A+ F 
Sbjct  779   SASRLCVEHVENIGVHYGQALRCWRKNFLENQGKIRSLGFDDKFMRAWEYYFDYMASMFK  838

Query  2933  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             T TLGDYQIVFSR GN+ AF DPY+ + S++
Sbjct  839   TRTLGDYQIVFSRQGNLVAFSDPYECIPSSH  869


 Score =   275 bits (702),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 159/200 (80%), Gaps = 0/200 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+G GISGL +A+ LAK G  VV+YEKE+ LGGHA+ V ++G+D+DL FMVFNRV+
Sbjct  1     MRFAVIGGGISGLGAAFELAKAGVEVVLYEKEELLGGHAQIVNVNGIDVDLNFMVFNRVS  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YP+  ELF+ LG+D++  DMS SVSLD G G EWGSRNGF  LFAQ  N L P FW+M++
Sbjct  61    YPHTTELFDGLGIDVDAFDMSVSVSLDKGQGCEWGSRNGFRSLFAQTTNALKPNFWRMVQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+DV+ YL+  + NP++DR +T G FIKSR YSELFQKAY+IP+ AS W CSSE 
Sbjct  121   EIKKFKDDVIMYLDGLELNPEIDRAETFGHFIKSRSYSELFQKAYLIPVFASFWCCSSER  180

Query  943   VMAFSAYSILSFCRNHHLLQ  1002
             VM FSA+S+LSFCRNHHLL+
Sbjct  181   VMDFSAFSVLSFCRNHHLLE  200



>ref|XP_010670925.1| PREDICTED: uncharacterized protein LOC104887860 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=793

 Score =   889 bits (2296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/691 (63%), Positives = 539/691 (78%), Gaps = 11/691 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    L+L G PQWL+V   S  YVNK+REELE RG +IR  CEV+ VST
Sbjct  105   FSAFSVLSFCRNHHLLELSGGPQWLSVSGGSQQYVNKLREELEVRGSQIRTSCEVNFVST  164

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              ++G A    +  G    ++ YDGCI+A  AP+ LK+LGK+ T DE RILGA QYV  DI
Sbjct  165   SDKGCA----LFYGDG-SEDLYDGCIIAVPAPNALKILGKEVTDDETRILGALQYVGRDI  219

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR++ FMP+N AAWSA NF G+ +N VCLTYW+N LQN+  T QP L+T+NPP  PE 
Sbjct  220   FLHRDKKFMPQNPAAWSALNFQGSTDNTVCLTYWINVLQNISKTDQPLLLTINPPHPPEN  279

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLK +TG  VPSVA+ +AS EL  IQGKR IWFCG   G GFHEDGLKAG+IAA+ +LK
Sbjct  280   FLLKRSTGVLVPSVASMKASLELRNIQGKRGIWFCGTRHGNGFHEDGLKAGLIAANDVLK  339

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             +   PL NP  M  SW E  AR  + R+L SFI  G +ILLE+GGTV  FEG+DK+   K
Sbjct  340   RTFLPLPNPKKMALSWTEATARRYIIRYLKSFISAGCLILLEDGGTVLKFEGSDKRCTWK  399

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
               +RVH+PQFYWKVA +ADLGLADA+I+GDIS VDK +GLL+LF+IF+AN  L   VS  
Sbjct  400   TAIRVHNPQFYWKVALEADLGLADAFINGDISIVDKDDGLLDLFRIFLANMYLYRCVSMD  459

Query  2045  NSK----RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2212
               K    +GWWTP+ FT+ IASAKYF +H+SR+N++T ARRNI+RHYDLSNE+FSLFLD+
Sbjct  460   EKKSFDFKGWWTPMFFTAGIASAKYFYQHLSRKNSVTLARRNIARHYDLSNEMFSLFLDD  519

Query  2213  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2392
             TMTYSCAVFKS+DEDLK AQ+RK+ LLI+KA++ K+H +L+IGCGWGSLAIE V++TGC+
Sbjct  520   TMTYSCAVFKSKDEDLKVAQLRKLHLLIEKARVEKQHEVLDIGCGWGSLAIEIVKKTGCR  579

Query  2393  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2572
             YTGITL+E+QLK AE +V+EAGLQD+I+FLLCDYRQLP + ++DRIISC MLE VG E+ 
Sbjct  580   YTGITLAEEQLKLAEQRVKEAGLQDHIKFLLCDYRQLPASHKFDRIISCGMLEHVGDEYY  639

Query  2573  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2752
              +FF  CES+LA+ G+LVLQ ISIPDERYD +R+SSDF++EYIFPGGCLPSLSR+T+AMA
Sbjct  640   EDFFRHCESLLADTGLLVLQTISIPDERYDGHRKSSDFMREYIFPGGCLPSLSRLTTAMA  699

Query  2753  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2932
             ++SRLCVEH+E+IG+HY Q LRCWR NFLE Q +I  LGFD KF+R WEYYFDY A+ F 
Sbjct  700   SASRLCVEHVENIGVHYGQALRCWRKNFLENQGKIRSLGFDDKFMRAWEYYFDYMASMFK  759

Query  2933  TCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             T TLGDYQIVFSR GN+ AF DPY+ + S++
Sbjct  760   TRTLGDYQIVFSRQGNLVAFSDPYECIPSSH  790


 Score =   176 bits (446),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 96/121 (79%), Gaps = 0/121 (0%)
 Frame = +1

Query  640   MSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNN  819
             MS SVSLD G G EWGSRNGF  LFAQ  N L P FW+M++EI KFK+DV+ YL+  + N
Sbjct  1     MSVSVSLDKGQGCEWGSRNGFRSLFAQTTNALKPNFWRMVQEIKKFKDDVIMYLDGLELN  60

Query  820   PDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRNHHLL  999
             P++DR +T G FIKSR YSELFQKAY+IP+ AS W CSSE VM FSA+S+LSFCRNHHLL
Sbjct  61    PEIDRAETFGHFIKSRSYSELFQKAYLIPVFASFWCCSSERVMDFSAFSVLSFCRNHHLL  120

Query  1000  Q  1002
             +
Sbjct  121   E  121



>gb|KDO54095.1| hypothetical protein CISIN_1g038410mg [Citrus sinensis]
Length=850

 Score =   887 bits (2293),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/684 (64%), Positives = 540/684 (79%), Gaps = 17/684 (2%)
 Frame = +2

Query  971   FHSVATTTFCRISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDE  1150
             F + +  +FCR+  QLFG PQ +TV+R SHS ++KV E+L+  G +IR  CEV+SV   +
Sbjct  184   FSAFSVLSFCRL-FQLFGHPQCVTVRRHSHSQIDKVSEQLKSWGIQIRMSCEVYSVFPAD  242

Query  1151  QGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYL  1330
             +G +  +V ++G    QE Y+GC+MA HAPD L++LG QATFDE RILGAF+YVY D++L
Sbjct  243   EGCS--IVCVNGS---QEFYNGCVMAVHAPDALRILGNQATFDETRILGAFRYVYRDVFL  297

Query  1331  HREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCL  1510
             HR+++FMP+N AAWSAWNF+G+ N ++CLTY LN LQN+G+T  P+L TLNP RTP+  L
Sbjct  298   HRDKNFMPQNPAAWSAWNFVGSTNGKICLTYCLNVLQNIGETSMPFLATLNPDRTPQNTL  357

Query  1511  LKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKR  1690
             LKW+TGH VPSVAAS+AS EL  IQGKR IW+ G  QGYGF EDGLK GMIAAHG+L K 
Sbjct  358   LKWSTGHSVPSVAASKASLELHLIQGKRGIWYSGVDQGYGFPEDGLKVGMIAAHGVLGKS  417

Query  1691  CSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVL  1870
             C+ L NP  MVPS  E GARL V RFL  FI TG  ILLEEGG  FTFEG      LK  
Sbjct  418   CAILGNPKQMVPSLMEKGARLFVARFLRQFISTGCFILLEEGGKTFTFEGPRTNCPLKSD  477

Query  1871  VRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNS  2050
             +R+ +PQFYWKV TQADLGLA++YI+GD SF+DK EGLLNLF I +AN+ L +S S+ N 
Sbjct  478   LRIQNPQFYWKVMTQADLGLANSYINGDFSFIDKDEGLLNLFLIVIANQGLDSSTSKLNL  537

Query  2051  KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSC  2230
             +           +IASAKY+ RHISR+NTL QARRNIS HYD+SNELFSLFL ++M YSC
Sbjct  538   R-----------SIASAKYYFRHISRKNTLAQARRNISHHYDVSNELFSLFLGKSMMYSC  586

Query  2231  AVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITL  2410
             A+FKSE EDL  AQMRK+SLLI+KA+++K   +LEIGCGWG+LAIE V++TGCKYTGITL
Sbjct  587   AIFKSEYEDLDVAQMRKVSLLIEKARVNKGLDVLEIGCGWGTLAIEIVKQTGCKYTGITL  646

Query  2411  SEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGR  2590
             SE+QLKY E KV+EAGLQD+IR  LCDYRQ+P+  +YD IISCEM+E VGHE++ EFFG 
Sbjct  647   SEEQLKYTETKVKEAGLQDHIRLYLCDYRQMPEVKKYDTIISCEMIENVGHEYIEEFFGC  706

Query  2591  CESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC  2770
             CES+LAE+G+L+LQF S+PD+ YD +R S  FI EY+FPGGCLPSL+R+TSAM +SSRLC
Sbjct  707   CESLLAEHGLLLLQFSSVPDQCYDGHRLSPGFITEYVFPGGCLPSLNRITSAMTSSSRLC  766

Query  2771  VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGD  2950
             VEHLE+IGIH+YQTLRCWR N +E+QS+IL LGF++KFIRTWEYYFDYCAAGF + TLG+
Sbjct  767   VEHLENIGIHFYQTLRCWRTNLMEKQSEILALGFNEKFIRTWEYYFDYCAAGFKSRTLGN  826

Query  2951  YQIVFSRPGNVTAFGDPYKGLASA  3022
             YQIVFSRP  V AF +P++   SA
Sbjct  827   YQIVFSRPSIVAAFSNPHESFPSA  850


 Score =   326 bits (835),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 183/224 (82%), Gaps = 3/224 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAV+G G+SGLVSAYVLAK G  VV+YEKED LGGHAKTVT+DGVDLD+GFM+FN V 
Sbjct  1     MRVAVIGGGMSGLVSAYVLAKAGVEVVLYEKEDSLGGHAKTVTIDGVDLDIGFMLFNHVE  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME  ESLGVDM  SDMSFSVSLD G GYEWG+RNG S LFAQKKN+LNPYFWQM+R
Sbjct  61    YPNMMEFLESLGVDMGTSDMSFSVSLDKGQGYEWGTRNGLSSLFAQKKNVLNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E++KFK+DVLSY+EE +N+PD+DRN+TLG FIKSRGYSELF KAY+IP+C+S+WSC S+G
Sbjct  121   EMMKFKDDVLSYVEELENSPDIDRNETLGHFIKSRGYSELFLKAYLIPICSSVWSCPSDG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALWSPTMAHCEAEVS*LCKQ  1074
              M FSA+S+LSFCR   L Q F          H  +++  + +Q
Sbjct  181   AMRFSAFSVLSFCR---LFQLFGHPQCVTVRRHSHSQIDKVSEQ  221



>emb|CDX77514.1| BnaA07g06520D [Brassica napus]
Length=803

 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/712 (62%), Positives = 530/712 (74%), Gaps = 39/712 (5%)
 Frame = +2

Query  947   WP----SLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCE  1108
             WP    S+L   F + +  +FCR    LQ+F RPQWLTV  RS +Y  KVR ELEKRGC+
Sbjct  111   WPCPPDSILN--FSAYSVLSFCRNHHLLQIFERPQWLTVAGRSETYAAKVRAELEKRGCK  168

Query  1109  IRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELR  1288
             IR  C V SVS  E G     ++++ ++  QE +D CI+A +APD L++LG+ AT DE R
Sbjct  169   IRMNCNVQSVSISEDG----CILVTTEDGSQEVFDRCILAVNAPDALRLLGEDATSDEAR  224

Query  1289  ILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPY  1468
             +LGAF Y YSDIYLHR+   MPRN  AWSAWNFL +  N+  LTYWLN +QNLG+   P+
Sbjct  225   VLGAFHYAYSDIYLHRDTDLMPRNRVAWSAWNFLTSSGNKASLTYWLNIIQNLGEEHDPF  284

Query  1469  LVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHED--  1642
              +T NP  TP+  L KWT+GHP+PSV+A +AS EL  IQGKR +WF   +    F E+  
Sbjct  285   FLTFNPEVTPKMTLFKWTSGHPLPSVSAWKASQELNNIQGKRGLWFYCLW--LPFKENFT  342

Query  1643  ----------GLKAGMIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVT  1789
                        L AGM AA  LL K+  SP +NP HM PS  E GAR L TR        
Sbjct  343   RSTFFLECLMDLHAGMAAAQSLLGKEMVSPPSNPKHMAPSIIEKGARFLFTR--------  394

Query  1790  GSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVD  1969
                 + EEGGT+FTF+G   +  L+ ++++HSP FYWKV TQADLGLADAYI+GD SF D
Sbjct  395   ----VYEEGGTMFTFKGNHLRCNLESVIKIHSPHFYWKVMTQADLGLADAYINGDFSFAD  450

Query  1970  KKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQA  2149
             K  GLLNL  I +AN++L++   + + KRGWWTP+  T+ + SA  F++H SRQNTLT+A
Sbjct  451   KDSGLLNLIMILIANKELNSKNLKLSKKRGWWTPMFMTAGLTSATQFLKHFSRQNTLTKA  510

Query  2150  RRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHI  2329
             RRNISRHYDLSNELF+LFLD+TM+YS AVFKS+DEDLKTAQMRKI+LLIDKA+I K H +
Sbjct  511   RRNISRHYDLSNELFALFLDDTMSYSTAVFKSDDEDLKTAQMRKINLLIDKARIEKNHEV  570

Query  2330  LEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPD  2509
             LEIGCGWG+LAIE V++TGCKYTGITLS +QLKYAE+KV+EAGLQD I F LCDYRQL D
Sbjct  571   LEIGCGWGTLAIEVVKKTGCKYTGITLSIEQLKYAEEKVKEAGLQDRITFELCDYRQLSD  630

Query  2510  NCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFI  2689
               +YDRIISCEM+E VGHEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFI
Sbjct  631   AKKYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFI  690

Query  2690  KEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLG  2869
             KEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQTLRCWR NFLE Q QI+DLG
Sbjct  691   KEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQTLRCWRKNFLENQKQIMDLG  750

Query  2870  FDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             FD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AFGDP+     A+
Sbjct  751   FDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAFGDPFHSFPYAH  802


 Score =   221 bits (564),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 113/144 (78%), Gaps = 0/144 (0%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME F++LGV ME+SDMSFSVSLDNG G EWGSRNG S LFAQK+N+ NPYFWQMI E  
Sbjct  1     MMEFFKNLGVKMEVSDMSFSVSLDNGRGCEWGSRNGLSSLFAQKRNIFNPYFWQMITEFY  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KF  D L Y+EE + NPD DRN+TLGEF+KS GYS LFQKAY++P C SIW C  + ++ 
Sbjct  61    KFNKDALKYIEEMERNPDTDRNETLGEFLKSHGYSALFQKAYLVPACRSIWPCPPDSILN  120

Query  952   FSAYSILSFCRNHHLLQNFSPALW  1023
             FSAYS+LSFCRNHHLLQ F    W
Sbjct  121   FSAYSVLSFCRNHHLLQIFERPQW  144



>ref|XP_008460676.1| PREDICTED: pavine N-methyltransferase-like isoform X3 [Cucumis 
melo]
Length=557

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/555 (75%), Positives = 482/555 (87%), Gaps = 0/555 (0%)
 Frame = +2

Query  1361  LAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvp  1540
             +AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLNP + P+  LLKW+TGHP+P
Sbjct  3     IAAWSAWNFLGNTDKKVCLTYWLNILQNLGETGPPFLVTLNPDKEPKNILLKWSTGHPIP  62

Query  1541  svaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHM  1720
             SVAAS+AS+E   IQG RRIWFCGAYQGYGFHEDGLKAG++AA  LL    + L+NP HM
Sbjct  63    SVAASKASNEFHSIQGNRRIWFCGAYQGYGFHEDGLKAGIVAAQNLLGNSFTLLSNPKHM  122

Query  1721  VPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYW  1900
              PS  +TGARL VTRFL  +I +GS+ L+E+GGT+FTFEGTDKK L KV V+VHSPQFYW
Sbjct  123   APSLVDTGARLFVTRFLGQYITSGSLTLIEDGGTIFTFEGTDKKCLPKVAVKVHSPQFYW  182

Query  1901  KVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLF  2080
             K+ T+ADLGLADAYI+GD SFVDK EGLLN F I +A+RD ++S+++   KRGWWTP LF
Sbjct  183   KIMTRADLGLADAYINGDFSFVDKDEGLLNFFLIIIASRDTNSSIAKQKKKRGWWTPPLF  242

Query  2081  TSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDL  2260
             T+ IASAKYF +H SRQNTLTQARRNISRHYDLSNELFSLFLD+TMTYSCA+FK E+EDL
Sbjct  243   TACIASAKYFFQHASRQNTLTQARRNISRHYDLSNELFSLFLDDTMTYSCAIFKGENEDL  302

Query  2261  KTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAED  2440
             K AQMRKISLLI+KA+I+K HH+LEIGCGWGSLAIE V++TGC YTGITLSE+QLKYAE 
Sbjct  303   KVAQMRKISLLIEKARINKNHHVLEIGCGWGSLAIEIVKKTGCHYTGITLSEEQLKYAEK  362

Query  2441  KVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGI  2620
             +V++A LQD IRFLLCDYR+LP   RYDRIISCEM+EAVGHEFM +FFG CESVLAENG+
Sbjct  363   RVKDANLQDRIRFLLCDYRKLPSTERYDRIISCEMIEAVGHEFMEDFFGSCESVLAENGL  422

Query  2621  LVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIH  2800
              VLQFISIPDERYDEYR SSDFIKEYIFPGGCLP LSR+T+AMA +SRLCVEHLE+IGIH
Sbjct  423   FVLQFISIPDERYDEYRLSSDFIKEYIFPGGCLPCLSRLTTAMANASRLCVEHLENIGIH  482

Query  2801  YYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  2980
             Y+QTLRCWR NFLE QS+IL LGFD+ FIRTWEYYFDYCAAGF + TLG+YQIV+SRPGN
Sbjct  483   YHQTLRCWRKNFLENQSKILQLGFDESFIRTWEYYFDYCAAGFKSHTLGNYQIVYSRPGN  542

Query  2981  VTAFGDPYKGLASAY  3025
             V AF +PY+G+ SAY
Sbjct  543   VAAFTNPYQGIPSAY  557



>ref|XP_010026810.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104417196 
[Eucalyptus grandis]
Length=841

 Score =   882 bits (2279),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 443/697 (64%), Positives = 527/697 (76%), Gaps = 51/697 (7%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQ+ GRPQWLTV+RRSHSYVNKVR+ LE +GCEIR  C
Sbjct  177   PSEEVMSFSAFSILSFCRNHHLLQVVGRPQWLTVRRRSHSYVNKVRDVLESKGCEIRPSC  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV S+ST ++G     ++++G    +E YD CI+A HAPD L+MLG QAT+DE R+LGAF
Sbjct  237   EVRSISTSDEG----CIVLTGDGS-EEVYDKCIVAVHAPDALRMLGDQATYDETRVLGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             +Y Y              N  A S+ + LG  ++ +CLTYWLN LQNL     PYLVTLN
Sbjct  292   KYAYR------------YNWLACSS-HILGXCHDXLCLTYWLNVLQNLDQKDFPYLVTLN  338

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   PE  LLKW TGHP+PSVAAS+A  +L  IQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  339   PSHEPEHTLLKWCTGHPIPSVAASKALLQLHEIQGKRGIWFCGAYQGYGFHEDGLKAGMS  398

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAHG++ +    L+NP HMVPS  E GAR  VT FL  +I TG + LLEEGGT+FTFEGT
Sbjct  399   AAHGVMGQSHFLLDNPRHMVPSLKEIGARFFVTGFLRRYISTGLVTLLEEGGTMFTFEGT  458

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K+  L V +R+HSP+FYWKV TQADLGLAD                     I +ANRD 
Sbjct  459   TKRCPLTVTLRIHSPEFYWKVMTQADLGLAD---------------------ILIANRDS  497

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               ++S+ + +RGWW P+L T+ IASAKYF +H+SRQNTLTQARRNIS+HYDLSNELFSLF
Sbjct  498   DVAISKLSKRRGWWAPMLLTAGIASAKYFFKHVSRQNTLTQARRNISQHYDLSNELFSLF  557

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+F+   EDLK AQMRKISLLI KAKI K H +LEIGCGWG+LAIE V +T
Sbjct  558   LDETMTYSCALFEMAGEDLKAAQMRKISLLIKKAKIEKTHEVLEIGCGWGNLAIEVVRQT  617

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLS++QLKYA+ +V+EAGLQD+I+ +LCDYRQLP   RYDRIISCEM+EAVGH
Sbjct  618   GCKYTGITLSKEQLKYAKSRVKEAGLQDSIKLILCDYRQLPSAYRYDRIISCEMIEAVGH  677

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M EFFG CESVLA++G+ VLQFISIPDERY+EYR+SSDFIKEYIFPGGCLPSLSRVTS
Sbjct  678   EYMEEFFGCCESVLAKDGLFVLQFISIPDERYEEYRRSSDFIKEYIFPGGCLPSLSRVTS  737

Query  2744  AMAASSRL----------CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRT  2893
             AMA++SRL           VEH+++IGIHY+QTLRCWR NF+E+Q +IL  GF++KFIRT
Sbjct  738   AMASASRLRYNCITSSAQSVEHVDNIGIHYHQTLRCWRKNFMEKQRKILAPGFNEKFIRT  797

Query  2894  WEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  3004
             W+YYFDYCAAGF + TLG+YQIVF RPGN  AF D Y
Sbjct  798   WQYYFDYCAAGFKSHTLGNYQIVFLRPGNDAAFTDLY  834


 Score =   324 bits (831),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 170/193 (88%), Gaps = 0/193 (0%)
 Frame = +1

Query  445   SAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLGVD  624
             +AY  A+GGA VVVYEKEDYLGGHAKTV+ +GVDLDLGFMVFNRVTYPNMMELFESLGV+
Sbjct  15    AAYEAARGGAKVVVYEKEDYLGGHAKTVSFNGVDLDLGFMVFNRVTYPNMMELFESLGVE  74

Query  625   MEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLE  804
             MEISDMSFSVSLD G G EWGSRNG   LFAQK N+LNPYFWQM+REI+KFK DVLSYLE
Sbjct  75    MEISDMSFSVSLDEGRGCEWGSRNGLLSLFAQKTNVLNPYFWQMLREIIKFKEDVLSYLE  134

Query  805   EFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCR  984
               ++NPD++R++TLG+FIKSRGYSELFQKAY+IP+C SIWSC SE VM+FSA+SILSFCR
Sbjct  135   GLESNPDINRSETLGQFIKSRGYSELFQKAYLIPICGSIWSCPSEEVMSFSAFSILSFCR  194

Query  985   NHHLLQNFSPALW  1023
             NHHLLQ      W
Sbjct  195   NHHLLQVVGRPQW  207



>ref|XP_009102618.1| PREDICTED: uncharacterized protein LOC103828740 isoform X2 [Brassica 
rapa]
Length=619

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/611 (68%), Positives = 497/611 (81%), Gaps = 1/611 (0%)
 Frame = +2

Query  1196  VQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWS  1375
             ++  +D CI+A +APD L++LG+ AT DE R+LGAFQY YSDIYLHR+   MPRN  AWS
Sbjct  8     LRMVFDRCILAVNAPDALRLLGEDATPDETRVLGAFQYAYSDIYLHRDTDLMPRNRVAWS  67

Query  1376  AWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaas  1555
             AWNFL +  N+  LT+WLN +QNL +    Y +TLNP  +P++ L KWT+G P+PSV+A 
Sbjct  68    AWNFLTSSENKASLTHWLNIIQNLDEEHDSYFLTLNPEVSPKKTLYKWTSGRPLPSVSAW  127

Query  1556  rassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPL-NNPNHMVPSW  1732
             +AS EL +IQGKR IWFCGAYQG GFHEDGLKAGM AA  LL K   PL +NP HMVPS 
Sbjct  128   KASQELNKIQGKRGIWFCGAYQGSGFHEDGLKAGMGAAQSLLGKDMVPLLSNPKHMVPSL  187

Query  1733  PETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVAT  1912
              E GAR L TRFL  FI TG + + EEGGT+FTF+G D +  L+ ++++ SP FYWKV T
Sbjct  188   TEKGARFLFTRFLRHFISTGCVTVYEEGGTMFTFKGKDLRCNLESVIKIRSPHFYWKVMT  247

Query  1913  QADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAI  2092
             QADLGLADAYI+GD SFV+K+ GLLNL  I +ANR+L++       KRGWWTP+  T+ +
Sbjct  248   QADLGLADAYINGDFSFVNKETGLLNLIMILIANRELNSKNLNLAKKRGWWTPMFMTAGL  307

Query  2093  ASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQ  2272
              SA  F+RH SRQNTLT+ARRNISRHYDLSNELF+LFLD+TM+YS AVFKS+DEDLKTAQ
Sbjct  308   TSATQFLRHFSRQNTLTKARRNISRHYDLSNELFALFLDDTMSYSTAVFKSDDEDLKTAQ  367

Query  2273  MRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVRE  2452
             MRKI+LLIDKA+I K+H +LEIGCGWG+LAIE V++TGCKYTGITLS +QLKYAE+KV+E
Sbjct  368   MRKINLLIDKARIEKDHEVLEIGCGWGTLAIEVVKKTGCKYTGITLSIEQLKYAEEKVKE  427

Query  2453  AGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQ  2632
             AGLQD I F LCDYRQL D  +YDRIISCEM+E VGHEFM+ FF  CE+ LAE+GI VLQ
Sbjct  428   AGLQDRITFELCDYRQLSDARKYDRIISCEMIEHVGHEFMDTFFSHCEAALAEDGIFVLQ  487

Query  2633  FISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQT  2812
             FISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL VE++E+IGIHYYQT
Sbjct  488   FISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVISAMASSSRLSVENVENIGIHYYQT  547

Query  2813  LRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAF  2992
             LRCWR NFLE Q QI+DLGFD KFIRTWEYYFDYCAAGF T TL DYQ+VFSRPGNV AF
Sbjct  548   LRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDYQVVFSRPGNVAAF  607

Query  2993  GDPYKGLASAY  3025
             GDP++   SA+
Sbjct  608   GDPFRNFPSAH  618



>ref|XP_002528378.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
 gb|EEF34050.1| cyclopropane-fatty-acyl-phospholipid synthase, putative [Ricinus 
communis]
Length=809

 Score =   874 bits (2257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/693 (62%), Positives = 527/693 (76%), Gaps = 63/693 (9%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + ++ ++CR     +LFG PQWLTVK RSHSYVNKVRE+LE  GC IR GC
Sbjct  177   PSEKIMSFSAYSSLSYCRNHHLFELFGHPQWLTVKHRSHSYVNKVREKLENYGCTIRTGC  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             E+HSVSTD++       ++ G    +E +  CI+A H+PD LK+LG QATFDE R+LGAF
Sbjct  237   EIHSVSTDDKS----CTVLCGDGS-EEQFSRCIIAVHSPDALKLLGNQATFDEKRLLGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY++++I+LH ++ FMPR  AAWSAWNFLG+ NN++CLTYWLN +QNLG+T  P+LVTLN
Sbjct  292   QYMHNEIFLHCDKKFMPRIPAAWSAWNFLGSTNNKLCLTYWLNVIQNLGETNPPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TPE  LLKWT  HPV S+AAS+AS E   IQG+R +WFCGAYQGYGF+EDGLK+GM+
Sbjct  352   PDHTPEHTLLKWTASHPVLSLAASKASLEFVHIQGRRGLWFCGAYQGYGFYEDGLKSGMV  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAH LL++ C+ L+NP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT+FTF+GT
Sbjct  412   AAHSLLERHCTILSNPKHMVPSLLETGARLFVTRFLGKYISTGCLILLEEGGTIFTFQGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              KK   K +++VH+ QFYWK+ TQADLGLADAYI GDISF DK EGLL LF + +ANRD 
Sbjct  472   VKKYFPKSILKVHNLQFYWKIMTQADLGLADAYISGDISFPDKDEGLLKLFMVLIANRDA  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             + SVS  N K+GWWTP+  T++IASAK+F RH+SR+N+LTQARRNISRHYDLSNE+FS+F
Sbjct  532   NISVSERNKKKGWWTPMFVTASIASAKFFFRHVSRKNSLTQARRNISRHYDLSNEMFSMF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCAVFK+EDEDLK+AQMRKISLLI+KA+I+KEH +LEIGCGWG+LAIE V+RT
Sbjct  592   LDETMTYSCAVFKTEDEDLKSAQMRKISLLIEKARINKEHEVLEIGCGWGTLAIEVVKRT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSE+QLK+AE++V++AGLQ         +  +P+  RYD             
Sbjct  652   GCKYTGITLSEEQLKFAEERVKQAGLQ---------FISMPEE-RYD-------------  688

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
                                              EYR+SS+F+KEYIFPG C PSL+R+T+
Sbjct  689   ---------------------------------EYRKSSEFLKEYIFPGLCAPSLTRITT  715

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AMA+S+RLC+EH+E+IGIHYYQTLR WR NFLE +S+IL LGF++KFIRTWEYYFDYCA+
Sbjct  716   AMASSTRLCMEHVENIGIHYYQTLRYWRKNFLENKSKILALGFNEKFIRTWEYYFDYCAS  775

Query  2924  GFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             GF T TLGDYQ+V SRP NV A G+PY   A+A
Sbjct  776   GFKTRTLGDYQVVLSRPRNVAALGNPYDEFAAA  808


 Score =   340 bits (872),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAV+G GISGLVS YVLA+ G  VV+YEKE+Y+GGHAKTV  DGV+LDLGFMVFNRVT
Sbjct  1     MKVAVIGGGISGLVSTYVLARNGVKVVLYEKEEYIGGHAKTVCFDGVELDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM E FESLGVD+E+SDMSFSVSLD+G GYEWGSRNG SGLFAQK N +NPYFWQMIR
Sbjct  61    YPNMTEFFESLGVDLELSDMSFSVSLDHGKGYEWGSRNGLSGLFAQKTNAINPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DVLSYLE  +NNPD+DRN+TL  FI+SRGYSELFQKAY++P+C  IWSC SE 
Sbjct  121   EIIKFKDDVLSYLEVLENNPDIDRNETLENFIRSRGYSELFQKAYLVPICGLIWSCPSEK  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             +M+FSAYS LS+CRNHHL + F    W
Sbjct  181   IMSFSAYSSLSYCRNHHLFELFGHPQW  207



>ref|XP_008340641.1| PREDICTED: uncharacterized protein LOC103403572 isoform X2 [Malus 
domestica]
Length=554

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/549 (78%), Positives = 481/549 (88%), Gaps = 1/549 (0%)
 Frame = +2

Query  1364  AAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvps  1543
              AWSAWNFLG+  N+VCLTYWLN LQN+ +T  P+LVTLNP  TP+  LLKW+T HPVPS
Sbjct  3     TAWSAWNFLGSNGNKVCLTYWLNVLQNIDETGLPFLVTLNPEHTPKHTLLKWSTSHPVPS  62

Query  1544  vaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMV  1723
             VAAS+AS EL RIQGKR IWFCGAY GYGFHEDGLKAGM AAHGLL K  + L+NP HMV
Sbjct  63    VAASKASLELPRIQGKRGIWFCGAYXGYGFHEDGLKAGMDAAHGLLGKGXALLDNPKHMV  122

Query  1724  PSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWK  1903
             PS  ETGARL VTRFL  FI TG +I LEEGGT+FTFEGT K   LK +++VH+PQFYWK
Sbjct  123   PSLTETGARLFVTRFLTHFISTGCLIFLEEGGTIFTFEGTRKGCSLKCVIKVHNPQFYWK  182

Query  1904  VATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFT  2083
             V TQADLGLADAYI+GD SFVDK +GLLNL  I +ANRD ++S S+   KRGWWTPLLFT
Sbjct  183   VMTQADLGLADAYINGDFSFVDKDKGLLNLIMILIANRDANSSDSKLTKKRGWWTPLLFT  242

Query  2084  SAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLK  2263
             ++IASAKYF +H+SRQNTLTQARRNISRHYDLSNELFS FLDETMTYS AVFK+EDEDLK
Sbjct  243   ASIASAKYFFQHVSRQNTLTQARRNISRHYDLSNELFSQFLDETMTYSSAVFKTEDEDLK  302

Query  2264  TAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDK  2443
              AQ+RKIS+LI+KA+I K H +LEIGCGWGSLAI+ V++TGCKYTGITLSE+QLKYA++K
Sbjct  303   VAQLRKISILIEKARIEKNHEVLEIGCGWGSLAIKVVKQTGCKYTGITLSEEQLKYAQEK  362

Query  2444  VREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGIL  2623
             V+EAGLQD I+FLLCDYRQL  + +YDRIISCEMLE+VGHEFM+EFF  CESVLAENG+L
Sbjct  363   VKEAGLQDRIKFLLCDYRQLA-SYKYDRIISCEMLESVGHEFMDEFFSCCESVLAENGLL  421

Query  2624  VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHY  2803
             VLQFISIPD+RYDEYR+SSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLE+IGIHY
Sbjct  422   VLQFISIPDQRYDEYRRSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLENIGIHY  481

Query  2804  YQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  2983
             +QTLR WR NFL+RQ +IL LGFD+KFIRTWEYYFDYCAAGF T TLG+YQIVFSRPGNV
Sbjct  482   FQTLRYWRKNFLDRQGEILALGFDEKFIRTWEYYFDYCAAGFRTYTLGNYQIVFSRPGNV  541

Query  2984  TAFGDPYKG  3010
              AF +PYKG
Sbjct  542   PAFSNPYKG  550



>ref|XP_006606356.1| PREDICTED: uncharacterized protein LOC100815937 isoform X3 [Glycine 
max]
Length=566

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/560 (75%), Positives = 481/560 (86%), Gaps = 0/560 (0%)
 Frame = +2

Query  1328  LHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQC  1507
             +  E S +   L AWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   PE  
Sbjct  6     MSEEYSELFNMLTAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHIPENT  65

Query  1508  LLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKK  1687
             LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAYQGYGFHEDG KAGMIAAHG+L  
Sbjct  66    LLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYQGYGFHEDGFKAGMIAAHGILGS  125

Query  1688  RCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKV  1867
              C+   NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K   LK 
Sbjct  126   CCALQTNPKHMVPSWKELGARIFVTRFLSCYITTGCLMLLEEGGTMFTFEGTGKNCGLKS  185

Query  1868  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2047
             ++RVH PQFYWKV TQADLGLADAYI+GD SFVDK EGLLNL  I +ANRD +AS S+  
Sbjct  186   VLRVHDPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNLILILIANRDSNASNSKLK  245

Query  2048  SKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  2227
               RGWWTP+ FTSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSN+LF+ FLDETMTYS
Sbjct  246   KNRGWWTPVFFTSALTSAKFFMDHVSRRNTLTQARRNISRHYDLSNDLFATFLDETMTYS  305

Query  2228  CAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGIT  2407
             CAVFK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKYTGIT
Sbjct  306   CAVFKNKDEDLKDAQKRKISLLIEKARIDKTHEILEIGCGWGSLAIEVVKQTGCKYTGIT  365

Query  2408  LSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFG  2587
             LSE+QLK AE +V++AGLQD I F+LCDYRQLP   +YDRIISCEM+EAVGHE+M EFFG
Sbjct  366   LSEEQLKLAEQRVKDAGLQDRINFVLCDYRQLPKTYKYDRIISCEMIEAVGHEYMEEFFG  425

Query  2588  RCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL  2767
              CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRL
Sbjct  426   CCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSRL  485

Query  2768  CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLG  2947
             CVEH+E+IGIHYYQTLRCWR NFL+RQ++IL LGF++KFIRTWEYYFDYC AGF + TLG
Sbjct  486   CVEHVENIGIHYYQTLRCWRKNFLKRQNEILALGFNEKFIRTWEYYFDYCGAGFKSLTLG  545

Query  2948  DYQIVFSRPGNVTAFGDPYK  3007
             +YQ+VFSRPGNV A GDPYK
Sbjct  546   NYQVVFSRPGNVPALGDPYK  565



>gb|EPS65744.1| cyclopropane fatty acid synthase, partial [Genlisea aurea]
Length=567

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/569 (73%), Positives = 479/569 (84%), Gaps = 3/569 (1%)
 Frame = +2

Query  1316  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1495
             SDI+LHR++  MP N AAWSAWNFLG+ +++VC+TYWLN LQN+     P+LVTLNPP T
Sbjct  2     SDIFLHRDKRLMPNNEAAWSAWNFLGSTDDKVCVTYWLNVLQNIYQEDLPFLVTLNPPYT  61

Query  1496  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1675
             P   LLKWTT HP+PSVAAS+ASS+ + IQGKRRIWFCGAY GYGFHEDGLKAG++AA+ 
Sbjct  62    PHHSLLKWTTSHPIPSVAASKASSQFDLIQGKRRIWFCGAYHGYGFHEDGLKAGILAANS  121

Query  1676  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1855
             LLK+ C+   NP  MVPS  E GARLLVT+FLA FI  GSI LLE GGT+F+FEG   K+
Sbjct  122   LLKRSCTLHVNPRQMVPSLVEIGARLLVTQFLARFIAIGSITLLENGGTMFSFEGDKGKS  181

Query  1856  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2035
              LKV +R+HSP FY KVA +ADLGLADAYI+GD SFVD+ EGLLNLF IF+ANRD  +S 
Sbjct  182   HLKVTLRIHSPHFYRKVAVEADLGLADAYINGDFSFVDEDEGLLNLFMIFIANRDFCSS-  240

Query  2036  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2215
               +  K GWWTPLL TS ++SAKYF+RH+SRQNTL+QARRNISRHYDLSN+LFSLFLDET
Sbjct  241   --TMPKGGWWTPLLLTSFLSSAKYFLRHVSRQNTLSQARRNISRHYDLSNDLFSLFLDET  298

Query  2216  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2395
             MTYSCA+FK+E EDLK AQ RKISLLI+K++I+K HHILEIGCGWG+L +E V+RTGCKY
Sbjct  299   MTYSCAIFKTEGEDLKVAQRRKISLLIEKSRITKSHHILEIGCGWGTLGVEVVKRTGCKY  358

Query  2396  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2575
             TGITLSEQQL+YA+ K +EAG+QD   FLLCDYRQLP   RYDRIISCEMLEAVGHEFM 
Sbjct  359   TGITLSEQQLRYAQAKAKEAGVQDRTSFLLCDYRQLPKTDRYDRIISCEMLEAVGHEFME  418

Query  2576  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2755
             EFF  CES+L ++G+LVLQFISIPD RYD YR+SSDFIKEYIFPGGCLPSLSRVT+AMA 
Sbjct  419   EFFSCCESLLVKDGLLVLQFISIPDVRYDTYRRSSDFIKEYIFPGGCLPSLSRVTAAMAT  478

Query  2756  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2935
             +SR CVEHLEDIGIHYY TLRCWR  FL  + +I DLGFD+KFIRTW YYFDYCAAGF +
Sbjct  479   ASRFCVEHLEDIGIHYYPTLRCWREKFLGSRKEIEDLGFDEKFIRTWVYYFDYCAAGFKS  538

Query  2936  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             CTLG+YQIV SRPGNVTAFG+PY  L SA
Sbjct  539   CTLGNYQIVMSRPGNVTAFGNPYSSLPSA  567



>gb|EPS70161.1| hypothetical protein M569_04599, partial [Genlisea aurea]
Length=850

 Score =   831 bits (2146),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 401/665 (60%), Positives = 503/665 (76%), Gaps = 6/665 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQ+F   Q LT+   S  +V+++ E LE RGCEIR   EV  VS++E+G       +  +
Sbjct  192   LQIFDYHQQLTINWSSDHFVSRIVESLESRGCEIRTNSEVCCVSSNEEGCT-----VICE  246

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
             N  ++ YD CI+ AHAPD +KMLG Q TFDE+RILGAFQY  SDIYLHR+++ MP++ AA
Sbjct  247   NGSEDKYDHCIITAHAPDAIKMLGNQLTFDEMRILGAFQYACSDIYLHRDKTLMPKSEAA  306

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSA+NFLG++N+  C+T WLN LQNL     P+LVTLNPP  PE  LLKWT+ HP+PSVA
Sbjct  307   WSAYNFLGSLNDGACVTIWLNVLQNLDQGGLPFLVTLNPPYGPEHKLLKWTSKHPIPSVA  366

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             AS A S+   IQGKRRIWF  AYQGYGF +DGLKAG +AA+ LL++  + L N  H+VPS
Sbjct  367   ASIAYSQSNLIQGKRRIWFGAAYQGYGFDDDGLKAGFLAANDLLRRSSTDLINSRHLVPS  426

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
               + GARLLVT+FL+ FI TG++ILLE+GGTV +F+G   K  LKV VR+HS QFYWKVA
Sbjct  427   MMDMGARLLVTQFLSRFIATGTLILLEDGGTVLSFKGALDKCPLKVTVRIHSLQFYWKVA  486

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             T+AD+GL  AY+ GD S VDK EGLLN   I + NRDL +S+  + S RGWWTPL+ T+ 
Sbjct  487   TEADIGLGQAYMDGDFSLVDKNEGLLNFLTILIINRDLDSSI-LAYSHRGWWTPLISTAL  545

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
             +++AKY+ RH  R+NT+  AR+NIS HYDLSNELFSLFLDE M YSC VFK E EDL +A
Sbjct  546   VSTAKYYFRHALRRNTIAHARQNISAHYDLSNELFSLFLDERMQYSCPVFKVEGEDLNSA  605

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q+RKI LLI+K+++   HH+LE+GCGWG L IE V+RTGC+YTG+TLS+QQ KYAE K  
Sbjct  606   QLRKIHLLIEKSRVCASHHVLELGCGWGGLGIELVKRTGCRYTGVTLSKQQQKYAEAKAN  665

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             EAGLQD   F+L DYR++P   +YDRIISCEMLE++G E+  EFF  CES+L E+G+LV+
Sbjct  666   EAGLQDRATFILGDYREVPKTRKYDRIISCEMLESIGVEYTKEFFSICESLLVEDGLLVV  725

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2809
             QF ++PD R++  R++S FI EYIF G C+PSLS VTSAM A+SR  VEHLEDIG+HYY 
Sbjct  726   QFTTVPDSRFENNRRTSGFISEYIFQGSCIPSLSYVTSAMGAASRFWVEHLEDIGVHYYP  785

Query  2810  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  2989
              LRCWR NFL  ++QI  LGFD KF+R +EYYFDYCA+ F TC +G+YQ+V SRPGNV  
Sbjct  786   ALRCWRDNFLRNRNQIEALGFDDKFVRMFEYYFDYCASAFKTCAIGNYQLVLSRPGNVAI  845

Query  2990  FGDPY  3004
             FGDPY
Sbjct  846   FGDPY  850


 Score =   248 bits (632),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 147/190 (77%), Gaps = 6/190 (3%)
 Frame = +1

Query  439   LVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLG  618
             L +A VL   G  VV+YE+E++    A T T+DG  +D+GF+  N VTY NM+ELFESLG
Sbjct  12    LTAARVLKDAGVDVVIYEREEW----APTFTVDGTRIDIGFL--NPVTYSNMVELFESLG  65

Query  619   VDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSY  798
             ++ E+SD+SFSVSLDNG GYEWG RNG S LFAQKKN+ NPY+W M+REI KF  DV+SY
Sbjct  66    LEAELSDVSFSVSLDNGRGYEWGIRNGLSSLFAQKKNVFNPYYWTMLREIRKFSGDVISY  125

Query  799   LEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSF  978
             L+    N D+DRN+TLG FI+SRGYSE+FQKAY+IP+C SIW CSSE VM F+A S+LSF
Sbjct  126   LQVIGENADVDRNETLGHFIQSRGYSEMFQKAYLIPICVSIWGCSSEDVMIFAASSVLSF  185

Query  979   CRNHHLLQNF  1008
              R+ HLLQ F
Sbjct  186   FRDQHLLQIF  195



>ref|XP_009586646.1| PREDICTED: uncharacterized protein LOC104084479 isoform X6 [Nicotiana 
tomentosiformis]
Length=744

 Score =   792 bits (2046),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 390/541 (72%), Positives = 454/541 (84%), Gaps = 6/541 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQLFG  Q LTV+  SH+ VNKV+EELEKRGC+IR  CEV+SVSTD +G       I+  
Sbjct  199   LQLFGLSQLLTVRWGSHTSVNKVKEELEKRGCQIRTDCEVNSVSTDGEGCT-----IACN  253

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
             +  +E YDGCIMAAHAPDTL+MLGK+AT DE RILGAFQY YSDI+LHR+++F+PR+ AA
Sbjct  254   DGAKEVYDGCIMAAHAPDTLRMLGKEATCDETRILGAFQYSYSDIFLHRDKTFLPRDPAA  313

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSA NFLGT  NR  +TYWLN +QNLGD+K PYLVT++PP TPE  LLKWTTGH VPSVA
Sbjct  314   WSALNFLGTTKNRGRMTYWLNVIQNLGDSKLPYLVTVDPPHTPEHILLKWTTGHLVPSVA  373

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             AS+AS EL++IQGKR IWFCGAYQGYGFHEDGLK G+ AA G+L++ CS L+N  HMVP+
Sbjct  374   ASKASRELDQIQGKRGIWFCGAYQGYGFHEDGLKVGVAAADGVLRRNCSILDNSKHMVPT  433

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
             WPETGARL+VTRF  SFI TG IIL E GGTVFTF+GT++K  LKV +R+H PQFYWK A
Sbjct  434   WPETGARLVVTRFFRSFIKTGCIILFE-GGTVFTFQGTERKCSLKVSLRIHGPQFYWKTA  492

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             T+A++GLADA+IHGD SFVDK EGLLNL  IFVAN DL ASV+ S+ KRGWWTP LFT+A
Sbjct  493   TEAEIGLADAFIHGDFSFVDKNEGLLNLIMIFVANSDLKASVTSSSKKRGWWTPFLFTAA  552

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
             + SAKYFI+H+  QNTLTQARRNISRHYDLSNELFSLFLD TMTYSCA+FKSEDEDLK A
Sbjct  553   LPSAKYFIQHVLNQNTLTQARRNISRHYDLSNELFSLFLDGTMTYSCAIFKSEDEDLKDA  612

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q+RKIS+LI KAKISKEHHILEIG GWGS A+E V++TGCKYTGITLSEQQL+YA+  V 
Sbjct  613   QLRKISVLIRKAKISKEHHILEIGFGWGSFAVEVVKQTGCKYTGITLSEQQLEYAQLIVE  672

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             +AGLQD I FLLCDYRQ+P+  +Y RIIS EM+E VGHEFM+EFF  CES LAE+G+LV+
Sbjct  673   QAGLQDRITFLLCDYRQMPNKDKYHRIISIEMIEHVGHEFMDEFFTCCESALAEDGLLVV  732

Query  2630  Q  2632
             Q
Sbjct  733   Q  733


 Score =   327 bits (837),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 156/202 (77%), Positives = 174/202 (86%), Gaps = 0/202 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVGAGISGL+SAY LAK G  VVVYE EDYLGGHAKTVT+D VDLDLGFM+FNRVT
Sbjct  1     MKVAVVGAGISGLISAYELAKSGVKVVVYENEDYLGGHAKTVTVDCVDLDLGFMIFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE LGV+MEIS MSFSV+LD G G EWG+RNG S LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMMEFFEFLGVNMEISHMSFSVTLDQGRGCEWGTRNGISSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK DV+SYLE  DNNPD+D ++TL +FIKS G SELF KAY+IP+C+SIWSC  EG
Sbjct  121   EIIKFKQDVISYLEALDNNPDIDCDETLWQFIKSNGCSELFLKAYLIPICSSIWSCPLEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNF  1008
             VM FSAYSILS  R+HHLLQ F
Sbjct  181   VMGFSAYSILSVFRDHHLLQLF  202



>emb|CDX77513.1| BnaA07g06510D [Brassica napus]
Length=778

 Score =   865 bits (2236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/684 (63%), Positives = 509/684 (74%), Gaps = 49/684 (7%)
 Frame = +2

Query  983   ATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQG  1156
             +  +FCR    LQ+F RPQWLTV  RS +Y  KVR ELE+RG  +R              
Sbjct  140   SVLSFCRNHHLLQIFERPQWLTVAGRSETYAAKVRAELEQRGYALR--------------  185

Query  1157  SAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHR  1336
                                             +LG+ AT DE R+LGAFQY YSDIYLHR
Sbjct  186   --------------------------------LLGEDATPDETRVLGAFQYAYSDIYLHR  213

Query  1337  EQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLK  1516
             +   MPRN  AWSAWNFL +  N+  LT+WLN +QNL +    Y +TLNP  +P++ L K
Sbjct  214   DTDLMPRNRVAWSAWNFLTSSENKASLTHWLNIIQNLDEEHDSYFLTLNPEVSPKKTLYK  273

Query  1517  WTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCS  1696
             WT+G P+PSV+A +AS EL +IQGKR IWFCGAYQG   H+ G  AGM AA  LL K   
Sbjct  274   WTSGRPLPSVSAWKASQELNKIQGKRGIWFCGAYQGSPIHKFGKYAGMGAAQSLLGKDMV  333

Query  1697  PL-NNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLV  1873
             PL +NP HMVPS  E GAR L TRFL  FI TG + + EEGGT+FTF+G D +  L+ ++
Sbjct  334   PLLSNPKHMVPSLTEKGARFLFTRFLRHFISTGCVTVYEEGGTMFTFKGKDLRCNLESVI  393

Query  1874  RVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSK  2053
             ++ SP FYWKV TQADLGLADAYI+GD SFV+K+ GLLNL  I +ANR+L++       K
Sbjct  394   KIRSPHFYWKVMTQADLGLADAYINGDFSFVNKETGLLNLIMILIANRELNSKNLNLAKK  453

Query  2054  RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCA  2233
             RGWWTP+  T+ + SA  F++H SRQNTLT+ARRNISRHYDLSNELFSLFLD+TM+YS A
Sbjct  454   RGWWTPMFMTAGLTSATQFLKHFSRQNTLTKARRNISRHYDLSNELFSLFLDDTMSYSTA  513

Query  2234  VFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLS  2413
             VFKS+DEDLKTAQMRKI+LLIDKA+I K+H +LEIGCGWG+LAIE V++TGCKYTGITLS
Sbjct  514   VFKSDDEDLKTAQMRKINLLIDKARIEKDHEVLEIGCGWGTLAIEVVKKTGCKYTGITLS  573

Query  2414  EQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRC  2593
              +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRIISCEM+E VGHEFM+ FF  C
Sbjct  574   IEQLKYAEEKVKEAGLQDRITFELCDYRQLSDARKYDRIISCEMIEHVGHEFMDTFFSHC  633

Query  2594  ESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCV  2773
             E+ LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+RV SAMA+SSRL V
Sbjct  634   EAALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLARVISAMASSSRLSV  693

Query  2774  EHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDY  2953
             E++E+IGIHYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDYCAAGF T TL DY
Sbjct  694   ENVENIGIHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLEDY  753

Query  2954  QIVFSRPGNVTAFGDPYKGLASAY  3025
             Q+VFSRPGNV AFGDP++   SA+
Sbjct  754   QVVFSRPGNVAAFGDPFRNFPSAH  777


 Score =   229 bits (583),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 121/149 (81%), Gaps = 0/149 (0%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT PNMMELF++LGVD+E+SDMSFSVSL+NG GYEWG+RNG S LFAQK+N+LNPYFW M
Sbjct  11    VTCPNMMELFKNLGVDIEVSDMSFSVSLNNGRGYEWGTRNGLSSLFAQKRNILNPYFWHM  70

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             I E  +FK D L+Y+EE + NPD DRN+TL EF+KS GYS LFQKAY++P C+SIW+C  
Sbjct  71    ITEFKRFKEDALNYIEEMERNPDTDRNETLREFVKSHGYSALFQKAYLVPACSSIWTCPI  130

Query  937   EGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             +  +  SAYS+LSFCRNHHLLQ F    W
Sbjct  131   DSALNLSAYSVLSFCRNHHLLQIFERPQW  159



>ref|XP_006589308.1| PREDICTED: uncharacterized protein LOC100801659 isoform X2 [Glycine 
max]
Length=566

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/560 (74%), Positives = 478/560 (85%), Gaps = 0/560 (0%)
 Frame = +2

Query  1328  LHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQC  1507
             +  E S +   L AWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   PE  
Sbjct  6     MSEEYSELFNMLTAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHIPENT  65

Query  1508  LLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKK  1687
             LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAY GYGFHEDG KAGMIAAHGLL  
Sbjct  66    LLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYLGYGFHEDGFKAGMIAAHGLLGS  125

Query  1688  RCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKV  1867
              C    NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K   LK 
Sbjct  126   CCVLQTNPKHMVPSWKELGARIFVTRFLSYYINTGCLMLLEEGGTMFTFEGTGKNCGLKS  185

Query  1868  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2047
             ++RVH+PQFYWKV TQADLGLADAYI+GD SFVDK EGLL L  I +ANRD +AS  +  
Sbjct  186   VLRVHNPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLILILILIANRDSNASNLKLK  245

Query  2048  SKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYS  2227
               RGWWTP+  TSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSNELF++FLDETMTYS
Sbjct  246   KNRGWWTPVFLTSALTSAKFFMEHVSRRNTLTQARRNISRHYDLSNELFAIFLDETMTYS  305

Query  2228  CAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGIT  2407
             CA+FK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKYTGIT
Sbjct  306   CALFKNKDEDLKDAQKRKISLLIEKARIDKTHEILEIGCGWGSLAIEVVKQTGCKYTGIT  365

Query  2408  LSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFG  2587
             LS++QLK AE +V++AGLQD I+FLLCDYRQLP   +YDRIISCEM+EAVGHE+M EFFG
Sbjct  366   LSKEQLKLAEQRVKDAGLQDRIKFLLCDYRQLPKAYKYDRIISCEMIEAVGHEYMEEFFG  425

Query  2588  RCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRL  2767
              CESVLA+NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAMAA+SRL
Sbjct  426   CCESVLADNGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMAATSRL  485

Query  2768  CVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLG  2947
             C EH+E+IGIHYYQTLRCWR NFLERQ++I+ LGF++KFIRTWEYYFDYC AGF + TLG
Sbjct  486   CGEHVENIGIHYYQTLRCWRKNFLERQNEIMALGFNEKFIRTWEYYFDYCGAGFKSLTLG  545

Query  2948  DYQIVFSRPGNVTAFGDPYK  3007
             +YQ+VFSRPGNV A GDPYK
Sbjct  546   NYQVVFSRPGNVAALGDPYK  565



>ref|XP_006350408.1| PREDICTED: uncharacterized protein LOC102579763 isoform X2 [Solanum 
tuberosum]
Length=812

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/609 (69%), Positives = 502/609 (82%), Gaps = 8/609 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    +QLFG PQ LT++RRSH+YVNKV+EELEKRGC+IR GC
Sbjct  178   PSEGVMGFSAYSILSFCRDHHLMQLFGLPQLLTIRRRSHAYVNKVKEELEKRGCQIRTGC  237

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+SV T+EQG       I   +   E YDGCI+A H+PDTLKMLGK+AT+DE RILGAF
Sbjct  238   EVNSVLTNEQGCT-----IYCNDGSTEVYDGCIIAVHSPDTLKMLGKEATYDETRILGAF  292

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
              YVYSD +LH++++F+P + AAWSA NFLGT+N+R C TYWLN +QNLGD++ PYLVT +
Sbjct  293   HYVYSDTFLHQDKTFLPHDPAAWSACNFLGTMNDRGCATYWLNVIQNLGDSELPYLVTFD  352

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             PP TPE  L+KW T HPVPSVAAS+AS +L +IQGKR IWFCG YQGYGFHE+GLKAG+I
Sbjct  353   PPHTPEHTLVKWRTSHPVPSVAASKASCKLHQIQGKRGIWFCGPYQGYGFHENGLKAGVI  412

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA G+L++ CS L N  ++VP+WPETGARLLVTRF  S+I TG IILLE GGT+FTF+G 
Sbjct  413   AADGMLRRNCSILYNHKYLVPTWPETGARLLVTRFFKSYIQTGCIILLE-GGTIFTFQGR  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             D+K  LKV + V S QFYWKVATQADLGLADA+IHGD SFVDK EGLLNL  IF+AN +L
Sbjct  472   DRKCSLKVSLTVRSMQFYWKVATQADLGLADAFIHGDFSFVDKNEGLLNLITIFIANGEL  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               SV  ++ KRGWWTP+LFT+A++SAKYF RH+S QNTLTQARRNISRHYD+SNELFSLF
Sbjct  532   KESVKPTSKKRGWWTPVLFTAALSSAKYFYRHVSNQNTLTQARRNISRHYDVSNELFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+FKSEDEDLK AQ+RKI +LI KAK+ KEHHILEIG GWGS A+E V++T
Sbjct  592   LDETMTYSCAIFKSEDEDLKDAQLRKIYVLIRKAKVRKEHHILEIGFGWGSFAMEVVKQT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTGITLSEQQL+YA+ +V++AGLQD I F+LCDYRQ+P   +YDRIIS  M+E VGH
Sbjct  652   GCKYTGITLSEQQLEYAQLRVKQAGLQDQITFILCDYRQIPSKDKYDRIISIGMIEHVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             ++M EFF  CES L E+G+L LQFIS+PD RYDEYR S+ FIKEYIFPGGCLPSLSRVTS
Sbjct  712   DYMEEFFTCCESALTEDGLLALQFISMPDGRYDEYRHSTGFIKEYIFPGGCLPSLSRVTS  771

Query  2744  AMAASSRLC  2770
             AMAA+SRLC
Sbjct  772   AMAATSRLC  780


 Score =   325 bits (833),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 176/203 (87%), Gaps = 1/203 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHA-KTVTLDGVDLDLGFMVFNRV  579
             M++AVVGAGISGLVSAY LAK G  VVVYEKE+Y+  HA KTV +D +DL L FM+F++V
Sbjct  1     MKLAVVGAGISGLVSAYELAKAGVKVVVYEKENYISCHANKTVIVDDIDLSLDFMIFDQV  60

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPN+ME FE LGVDMEIS MSFSVSLD G G EWG+RNGFS LFAQKKN+LNPYFWQMI
Sbjct  61    TYPNLMEFFEFLGVDMEISYMSFSVSLDQGRGCEWGTRNGFSSLFAQKKNVLNPYFWQMI  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++FK DV+SYLEE DNNPD+DRN TLG+FI+S  YSELFQKAY++P+CASIW C SE
Sbjct  121   REIIRFKQDVISYLEELDNNPDIDRNKTLGQFIESHVYSELFQKAYLVPICASIWFCPSE  180

Query  940   GVMAFSAYSILSFCRNHHLLQNF  1008
             GVM FSAYSILSFCR+HHL+Q F
Sbjct  181   GVMGFSAYSILSFCRDHHLMQLF  203



>ref|XP_007035215.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06141.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=917

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/733 (59%), Positives = 536/733 (73%), Gaps = 50/733 (7%)
 Frame = +2

Query  971   FHSVATTTFC--RISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSV--  1138
             F + +T + C      QLFGRPQWLT+KR S+ +V KVR+ LE RGC+++ GC+VHSV  
Sbjct  185   FSAFSTLSLCCSHHMFQLFGRPQWLTIKRHSY-FVKKVRDILESRGCQLKLGCQVHSVLP  243

Query  1139  -------STDEQGSAG--GVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRI  1291
                    ++++ G  G  G +++ G    QE Y+GCIMA  AP  L +LG QATF+E+RI
Sbjct  244   ADNAILWTSNDNGKKGLAGSIMVCGDGF-QETYNGCIMAVDAPSALALLGNQATFEEMRI  302

Query  1292  LGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYL  1471
             LGAFQY  SDI+LHR+ + MP+N +AWSA NFL +  ++ CLTYWLN LQN+G T   + 
Sbjct  303   LGAFQYSSSDIFLHRDSNLMPKNRSAWSALNFLRSSEDKACLTYWLNVLQNVGKTSLQFF  362

Query  1472  VTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFH-----  1636
             VTLNP  TP   LLKW+TG  +PS+AAS+AS EL++IQGKR IWFC +      H     
Sbjct  363   VTLNPHHTPNNTLLKWSTGLLIPSIAASKASLELDQIQGKRGIWFCESIISTECHLSICL  422

Query  1637  ---------------------EDGL--KAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGA  1747
                                  ED    +AGM+AAHG+L K  S LN+  H+  S+ ETGA
Sbjct  423   QYFQAMTSMRTNLREMLLFTTEDHFFYQAGMVAAHGILGKHSSVLNSQRHLSLSFTETGA  482

Query  1748  RLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLG  1927
             RL+VT+F   +I  G +IL EEGG VFTF+G+ +K  LK +++VH+PQFYWK  T+ADLG
Sbjct  483   RLVVTKFFQQYISMGCVILFEEGGGVFTFKGSMEKCSLKAVLKVHNPQFYWKTMTEADLG  542

Query  1928  LADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKY  2107
             LADAYIHGD SF DK+EGLLNLF IF+ANR+  +S S  N KRGWW P LFT++I+SAKY
Sbjct  543   LADAYIHGDFSFEDKEEGLLNLFLIFIANRESDSSASGLNKKRGWWAPALFTASISSAKY  602

Query  2108  FIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK-------SEDEDLKT  2266
             F++H+ RQNTL QARRNISRHYDL NELF LF+D TM YS A+FK       +E+EDLK 
Sbjct  603   FLKHVLRQNTLIQARRNISRHYDLRNELFELFMDVTMQYSSAIFKVKTPDSMAENEDLKV  662

Query  2267  AQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKV  2446
             AQ+RKIS LIDKA+I K H ++E G GWG  AIE V+RTGCKYTG+TLSE+QLKYAE KV
Sbjct  663   AQLRKISSLIDKARIEKGHEVIEFGSGWGYFAIEVVKRTGCKYTGVTLSEEQLKYAEAKV  722

Query  2447  REAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILV  2626
             +EAGLQDNI+FLLCDYRQLP  C+YDRIISCEM E VG+E++ EFF  CES+LA++G+ V
Sbjct  723   KEAGLQDNIKFLLCDYRQLPKTCKYDRIISCEMTEHVGNEYIEEFFRCCESILAKDGLFV  782

Query  2627  LQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  2806
             LQFIS+ +E + EY +S  F KEYIFPGGCL SL+R+ SAM A SRL VEH+E+IG +Y 
Sbjct  783   LQFISVTEELFHEYLRSPGFAKEYIFPGGCLLSLTRMLSAMGAGSRLSVEHVENIGPNYV  842

Query  2807  QTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVT  2986
             QTLRCWR NFLE +S+IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRP N  
Sbjct  843   QTLRCWRKNFLENKSKILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPSNFA  902

Query  2987  AFGDPYKGLASAY  3025
             A GDPY+G  SAY
Sbjct  903   ALGDPYQGFPSAY  915


 Score =   288 bits (737),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 162/214 (76%), Gaps = 1/214 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M  AV+G GI GLVSAYVLAK G  VVVYEKED  GGHAKTV    +DLDLGF+  N  T
Sbjct  1     MGFAVIGGGIRGLVSAYVLAKAGVNVVVYEKEDQFGGHAKTVNFHAIDLDLGFLFLNPAT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDN-GHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             YP M+ELF+ LGVD+E SD+SFSVS D  GHGYEWG+ +GFS LFA +KN+LNPYFWQ++
Sbjct  61    YPTMLELFDILGVDVEASDVSFSVSHDKLGHGYEWGTHHGFSSLFAHRKNMLNPYFWQVL  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KF++D +SYL   +NNPD+DRN+TLG+FIKSRGYSE FQ  ++ P+C SIW CS++
Sbjct  121   REIIKFRDDAISYLHMLENNPDIDRNETLGQFIKSRGYSETFQNTFLGPICGSIWCCSTQ  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALWSPTMAH  1041
              V+ FSA+S LS C +HH+ Q F    W     H
Sbjct  181   KVLNFSAFSTLSLCCSHHMFQLFGRPQWLTIKRH  214



>gb|AAM33848.1|AF470622_1 cyclopropane synthase [Sterculia foetida]
Length=864

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/688 (62%), Positives = 525/688 (76%), Gaps = 15/688 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSY-VNKVREELEKRGCEIRCGCEVHSVS  1141
             F + +  +FCR     QLFG PQWLT+KR  HSY V KVR+ LE RGC+ + GCEV SV 
Sbjct  184   FSAYSILSFCRTYHLYQLFGNPQWLTIKR--HSYLVKKVRDILESRGCQFKLGCEVLSVL  241

Query  1142  TDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSD  1321
               + GS+    I+ G    QE Y+GCIMA +AP  LK+LG QATF+E+R+LGAFQY  SD
Sbjct  242   PADDGSS----IVFGDGF-QETYNGCIMAVNAPTALKILGNQATFEEMRVLGAFQYASSD  296

Query  1322  IYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPE  1501
             IYLHR+ + MP N + WSA NFL +  N+  LTYWLN LQN+G T QP+ VTLNP R P+
Sbjct  297   IYLHRDSNLMPTNRSGWSALNFLRSRENKASLTYWLNVLQNVGKTSQPFFVTLNPDRIPD  356

Query  1502  QCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLL  1681
             + LLKW+TG P+PSVAAS+AS EL++IQGKR IWFCG    Y FHED LKAGM AAH +L
Sbjct  357   KILLKWSTGRPIPSVAASKASLELDQIQGKRGIWFCG----YDFHEDELKAGMDAAHRIL  412

Query  1682  KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLL  1861
              K  S L++P  M PS+ ET ARLLVT+F   +I  G +I++EEGG V+TF+G+ +   L
Sbjct  413   GKHFSVLHSPRQMSPSFMETTARLLVTKFFHQYIQVGCVIIIEEGGRVYTFKGSMENCSL  472

Query  1862  KVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSR  2041
             K  ++VH+PQFYW++  +AD+GLADAYI GD SFVDK +GLLNLF+I +AN++L+ S S 
Sbjct  473   KTALKVHNPQFYWRIMKEADIGLADAYIQGDFSFVDKDDGLLNLFRILIANKELN-SASG  531

Query  2042  SNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMT  2221
              N +R W +P LFT+ I+SAKYF++H  RQNT+TQARRNISRHYDLSNELF+L+L E M 
Sbjct  532   QNKRRTWLSPALFTAGISSAKYFLKHYMRQNTVTQARRNISRHYDLSNELFTLYLGEMMQ  591

Query  2222  YSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTG  2401
             YS  +FK+ +E L  AQ RKIS LIDK++I K H +L+IGCGWGSLA+E V+RTGCKYTG
Sbjct  592   YSSGIFKTGEEHLDVAQRRKISSLIDKSRIEKWHEVLDIGCGWGSLAMEVVKRTGCKYTG  651

Query  2402  ITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEF  2581
             ITLSEQQLKYAE+KV+EAGLQ NI+FLLCDYRQLP   +YDRIIS EM+E VG E++ EF
Sbjct  652   ITLSEQQLKYAEEKVKEAGLQGNIKFLLCDYRQLPKTFKYDRIISVEMVEHVGEEYIEEF  711

Query  2582  FGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASS  2761
             F  C+S+LAENG+ VLQFISIP+    E +Q++ F+KEYIFPGG L SL R  SAMAA+S
Sbjct  712   FRCCDSLLAENGLFVLQFISIPEILSKEIQQTAGFLKEYIFPGGTLLSLDRTLSAMAAAS  771

Query  2762  RLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCT  2941
             R  VEH+E+IGI YY TLR WR NFL  +S++L LGFD+KF+RTWEYYFDYCAAGF T T
Sbjct  772   RFSVEHVENIGISYYHTLRWWRKNFLANESKVLALGFDEKFMRTWEYYFDYCAAGFKTGT  831

Query  2942  LGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             L DYQ+VFSR GN  A GDPY G  SAY
Sbjct  832   LIDYQVVFSRAGNFAALGDPYIGFPSAY  859


 Score =   276 bits (705),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 156/213 (73%), Gaps = 0/213 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M VAV+G GI GLVSAYVLAK G  VVVYEKE+ +GGHAKTV+ D VDLDLG +  N   
Sbjct  1     MGVAVIGGGIQGLVSAYVLAKAGVNVVVYEKEEQVGGHAKTVSFDAVDLDLGLLFLNPAR  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YP M+ELF+SL VD+E +D+SFSVS D G+GYEW S+ GFS   A KK +LNPY WQ +R
Sbjct  61    YPTMLELFDSLEVDVEATDVSFSVSHDKGNGYEWCSQYGFSNFLAHKKKMLNPYNWQDLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             E +KF NDV SYLE  + NPD+DRN+TLG F+ S+GYSE F   Y+ P+C S+WSCS E 
Sbjct  121   ETIKFGNDVNSYLESLEKNPDIDRNETLGHFVGSKGYSENFLNTYLAPICGSMWSCSKEE  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALWSPTMAH  1041
             VM+FSAYSILSFCR +HL Q F    W     H
Sbjct  181   VMSFSAYSILSFCRTYHLYQLFGNPQWLTIKRH  213



>gb|AAT74601.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=865

 Score =   849 bits (2194),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/687 (60%), Positives = 522/687 (76%), Gaps = 13/687 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR     Q FG+PQWLT+K  SH +V +VRE LE +GC+ + GCEV SV  
Sbjct  185   FSAFSILSFCRTHHLYQQFGQPQWLTIKGHSH-FVKRVREVLETKGCQFKLGCEVQSVLP  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G+     ++ G    QE Y+GCIMA  AP  LK+LG QATF+E R+LGAFQY  SDI
Sbjct  244   ADNGT----TMVCGDGF-QETYNGCIMAVDAPTALKLLGNQATFEETRVLGAFQYATSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+ + MP+N +AWSA NFL +  N   LTYWLN LQN+G T +P+ VT+NP  TP+ 
Sbjct  299   FLHRDSTLMPQNKSAWSALNFLNSSKNNAFLTYWLNALQNIGKTSEPFFVTVNPDHTPKN  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGH +PSVAAS+AS EL +IQGKR IWFCG    Y F++D LKAGM AAHG+L 
Sbjct  359   TLLKWSTGHAIPSVAASKASLELGQIQGKRGIWFCG----YDFNQDELKAGMDAAHGILG  414

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  S L++P  M PS+ ET ARL VT+F   +I  G +I LEEGG +FTF+G  +K  LK
Sbjct  415   KHSSVLHSPKSMSPSFMETTARLFVTKFFQQYISMGCVIFLEEGGRIFTFKGNMEKCPLK  474

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              +++VH+PQFYW++  +AD+GLADAYIHGD SF+D+ EGLLNLF+I VAN++ SA+ S S
Sbjct  475   TVLKVHNPQFYWRIMKEADIGLADAYIHGDFSFLDETEGLLNLFRILVANKENSAA-SGS  533

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N +R WW+P L T++I+SAKYF++H+ RQNT+TQARRNISRHYDLSNELF+L+L + M Y
Sbjct  534   NKRRTWWSPALLTASISSAKYFVKHLLRQNTITQARRNISRHYDLSNELFTLYLGKMMQY  593

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S  VF++ +E L  AQ RKIS LI+KA+I K H +L+IGCGWGSLAIE V+RTGCKYTGI
Sbjct  594   SSGVFRTGEEHLDVAQRRKISSLIEKARIEKRHEVLDIGCGWGSLAIETVKRTGCKYTGI  653

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSEQQLKYA++KV+EAGLQDNI+ LLCDYRQLP   ++DRIIS EM+E VG E++ EF+
Sbjct  654   TLSEQQLKYAQEKVKEAGLQDNIKILLCDYRQLPKEHQFDRIISVEMVEHVGEEYIEEFY  713

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               C+ +L E+G+ VLQFISIP+E   E +Q++ F+KEYIFPGG L SL R  SAMAA++R
Sbjct  714   RCCDQLLKEDGLFVLQFISIPEELSKEIQQTAGFLKEYIFPGGTLLSLDRNLSAMAAATR  773

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
               VEH+E+IG+ YY TLR WR  FLE  S++L LGFD+KF+RTWEYYFDYCAAGF T TL
Sbjct  774   FSVEHVENIGMSYYHTLRWWRKLFLENTSKVLALGFDEKFMRTWEYYFDYCAAGFKTGTL  833

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
              DYQ+VFSR GN    GDPYKG  SAY
Sbjct  834   IDYQVVFSRAGNFGTLGDPYKGFPSAY  860


 Score =   277 bits (708),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/214 (61%), Positives = 158/214 (74%), Gaps = 1/214 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M VAV+G GI GLVSAYVL K G  VVVYEKE+ LGGHAKTV  D VDLDLGF+  N   
Sbjct  1     MEVAVIGGGIKGLVSAYVLVKAGVDVVVYEKEEQLGGHAKTVNFDAVDLDLGFLFLNPAR  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGH-GYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             Y  ++++ +SLGVD+E SD+SFS+S D G+ GYEW S+ GFS  FAQKK LLNP+ WQ +
Sbjct  61    YATLLDIIDSLGVDVETSDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNWQNL  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI++F NDV SYL   +NNPD+DR +TLG+FIKS+GYSE FQ  Y+ P+C S+WS S E
Sbjct  121   REIIRFSNDVESYLGSLENNPDIDRTETLGQFIKSKGYSENFQNTYLAPICGSMWSSSKE  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALWSPTMAH  1041
              VM+FSA+SILSFCR HHL Q F    W     H
Sbjct  181   DVMSFSAFSILSFCRTHHLYQQFGQPQWLTIKGH  214



>gb|KHG13738.1| Cyclopropane-fatty-acyl-phospholipid synthase [Gossypium arboreum]
Length=799

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/687 (60%), Positives = 520/687 (76%), Gaps = 13/687 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR     QLFG+PQWLT+K  SH +V +V E LE +GC+ + GCEV SV  
Sbjct  119   FSAFSILSFCRTHHLYQLFGQPQWLTIKGHSH-FVKRVSEVLETKGCQFKLGCEVQSVLP  177

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G+     ++ G    QE Y+GCIMA  AP  LK+LG QATF+E R+LGAFQY  SDI
Sbjct  178   ADNGT----TMVCGDGF-QETYNGCIMAVDAPTALKLLGNQATFEETRVLGAFQYATSDI  232

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+ + MP+N +AWSA NFL +  N   LTYWLN LQ +G T +P+ VT+NP  TP+ 
Sbjct  233   FLHRDSTLMPQNKSAWSALNFLNSSKNNAFLTYWLNALQYIGKTSEPFFVTVNPDHTPKN  292

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGH +PSVAAS+AS EL +IQGKR IWFCG    Y F++D LKAGM AAHG+L 
Sbjct  293   TLLKWSTGHAIPSVAASKASLELGQIQGKRGIWFCG----YDFNQDELKAGMDAAHGILG  348

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K  S L++P +M PS+ ET ARL VT+F   +I  G +  LEEGG +FTF+G  +K  LK
Sbjct  349   KHSSVLHSPKNMSPSFMETTARLFVTKFFQQYISMGCVTFLEEGGRIFTFKGNMEKCPLK  408

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              +++VH+PQFYW++  +AD+GLADAYIHGD SF+D+ EGLLNLF+I VAN++ SA+ S S
Sbjct  409   TVLKVHNPQFYWRIMKEADIGLADAYIHGDFSFLDETEGLLNLFRILVANKENSAA-SGS  467

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N +R WW+P L T++I+SAKYF++H+ RQNT+TQARRNISRHYDLSNELF+L+L + M Y
Sbjct  468   NKRRTWWSPALLTASISSAKYFVKHLLRQNTITQARRNISRHYDLSNELFTLYLGKMMQY  527

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             S  VF++ +E L  AQ RKIS LI+K +I K H +L+IGCGWGSLAIE V+RTGCKYTGI
Sbjct  528   SSGVFRTGEEHLDVAQRRKISSLIEKTRIEKWHEVLDIGCGWGSLAIETVKRTGCKYTGI  587

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSEQQLKYA++KV+EAGLQDNI+ LLCDYRQLP   ++DRIIS EM+E VG E++ EF+
Sbjct  588   TLSEQQLKYAQEKVKEAGLQDNIKILLCDYRQLPKEHQFDRIISVEMVEHVGEEYIEEFY  647

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
               C+ +L E+G+ VLQFISIP+E   E +Q++ F+KEYIFPGG L SL R  SAMAA++R
Sbjct  648   RCCDQLLKEDGLFVLQFISIPEELSKEIQQTAGFLKEYIFPGGTLLSLDRNLSAMAAATR  707

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
               VEH+E+IG+ YY TLR WR  FLE  S++L LGFDKKF+RTWEYYFDYCAAGF T TL
Sbjct  708   FSVEHVENIGMSYYHTLRWWRKLFLENTSKVLALGFDKKFMRTWEYYFDYCAAGFKTGTL  767

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASAY  3025
              DYQ+VFSR GN    GDPYKG  SAY
Sbjct  768   IDYQVVFSRAGNFGTLGDPYKGFPSAY  794


 Score =   186 bits (471),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +1

Query  601   LFESLGVDMEISDMSFSVSLDNGH-GYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKF  777
             +F+SL VD+E SD+SFS+S D G+ GYEW S+ GFS  FAQKK LLNP+ WQ +REI+KF
Sbjct  1     MFDSLDVDVETSDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNWQNLREIIKF  60

Query  778   KNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFS  957
              NDV SYL   +NNPD+DR +TLG+FI S+GYSE FQ  Y+ P+C S+WS S E V +FS
Sbjct  61    SNDVESYLGSLENNPDIDRTETLGQFINSKGYSENFQNTYLAPICGSMWSSSKEDVTSFS  120

Query  958   AYSILSFCRNHHLLQNFSPALWSPTMAH  1041
             A+SILSFCR HHL Q F    W     H
Sbjct  121   AFSILSFCRTHHLYQLFGQPQWLTIKGH  148



>ref|XP_002451281.1| hypothetical protein SORBIDRAFT_05g026900 [Sorghum bicolor]
 gb|EES10269.1| hypothetical protein SORBIDRAFT_05g026900 [Sorghum bicolor]
Length=872

 Score =   775 bits (2001),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 385/664 (58%), Positives = 488/664 (73%), Gaps = 13/664 (2%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             L+LF   QWL VK  S SYVNKVREELE  GC+I+ GC+V SVS  +    GG  I+   
Sbjct  205   LELFSPLQWLNVKGGSGSYVNKVREELESMGCQIKTGCKVRSVSRLK----GGYRILEAD  260

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
                +E Y+  I   H PD LK+LG +AT DE R+L AFQY+YSD+Y H ++SFMP N +A
Sbjct  261   GS-EEIYERIIFCVHPPDALKVLGTEATPDEQRVLEAFQYIYSDLYFHCDESFMPHNSSA  319

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSA NFLGT ++ VC+TYWLN LQN  ++ +P+L TLNPPR P+  LLKW T HP+PS+A
Sbjct  320   WSARNFLGTTSSGVCVTYWLNILQNT-ESARPFLATLNPPRVPDHVLLKWHTSHPIPSMA  378

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             A++A+ EL  IQGKR IWFC  YQGYG HED +KAG   A GLL K+C  L NP  MVPS
Sbjct  379   AAKATLELNNIQGKRGIWFCVPYQGYGNHEDSVKAGKAVASGLLGKKCDFLVNPKPMVPS  438

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
             W E GAR LV + +  +I  G+  +LEEGGT  +F  T ++  LK ++RVH+PQFYWK+A
Sbjct  439   WTEAGARFLVAKNMGKYITIGNFSILEEGGTTLSFGKTCERCQLKCVIRVHNPQFYWKIA  498

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD----LSASVSRSNS---KRGWWT  2068
             T+ D G A +YI+G ISFVDKKEGL N+ +I +ANR     LS+S + + S   K+GWWT
Sbjct  499   TEGDPGFAYSYINGYISFVDKKEGLQNIVEITLANRGERKRLSSSHANNKSSYIKKGWWT  558

Query  2069  PLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSE  2248
             PLL  + +  AKY +  + R+NT+++AR+NIS HYDLSNE F+LFLD TMTYSC +FK E
Sbjct  559   PLLRINGVTLAKYVLHEVLRRNTISKARKNISAHYDLSNEFFALFLDPTMTYSCGIFKVE  618

Query  2249  DEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLK  2428
             DE L+ AQ+RK+  LI+KAK+   HH+L+IGCGWGSLAI  V+RTGCK TGITLSE+QLK
Sbjct  619   DESLEAAQLRKLDNLINKAKVEPGHHVLDIGCGWGSLAIRLVKRTGCKCTGITLSEEQLK  678

Query  2429  YAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLA  2608
             Y + KV+E GL+D I  LLCDYRQ+ +  ++DRIISC MLE VGHEF  +FF  CE  LA
Sbjct  679   YGKRKVKEFGLEDRITLLLCDYRQIANGQKFDRIISCGMLEHVGHEFYEDFFASCEYHLA  738

Query  2609  ENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLED  2788
             E+G+LVLQ I+ P+E YD+ R   +F+KEYIFPGGCLPSL+R+TSAM+ +SRLCV H+E+
Sbjct  739   EHGLLVLQSIACPEELYDKMRTRPEFLKEYIFPGGCLPSLARITSAMSNASRLCVHHVEN  798

Query  2789  IGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFS  2968
             IG HYY TL  WR NF+  + ++L LGFD+KFIRTWEYY +YCAA F +    DYQIVF+
Sbjct  799   IGYHYYPTLIHWRDNFVANREKVLALGFDEKFIRTWEYYLNYCAAMFKSHMGLDYQIVFA  858

Query  2969  RPGN  2980
             RPG+
Sbjct  859   RPGD  862


 Score =   252 bits (643),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 160/215 (74%), Gaps = 11/215 (5%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG-----VDLDLGFM  564
             MRVAVVG G+SGLV+A+ LA+ GGA V VYEKE++LGG AKTV ++G     V +D+ FM
Sbjct  2     MRVAVVGGGLSGLVAAHELARSGGARVTVYEKEEHLGG-AKTVAVNGGSSGPVLVDVDFM  60

Query  565   VFNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLLN  738
             VFNRVTYPNMME FE LGV+ME SDMSFS SL  + G+G+EWGSRNG S +  QK N L+
Sbjct  61    VFNRVTYPNMMEWFERLGVEMETSDMSFSASLRLNKGNGFEWGSRNGISSVLVQKSNFLS  120

Query  739   PYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCAS  918
             P FW MI EI KFKN  L YLE+   NPD  +N+TLG+FI+S  YS+LFQ AY+IPMCA 
Sbjct  121   PRFWLMINEIFKFKNHALKYLEDHARNPD--QNETLGQFIQSHRYSQLFQDAYLIPMCAC  178

Query  919   IWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             IWSC S+ V  F A  +LSF  ++HLL+ FSP  W
Sbjct  179   IWSCPSQNVFGFPAGFVLSFFCDNHLLELFSPLQW  213



>ref|XP_007035214.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
 gb|EOY06140.1| Cyclopropane-fatty-acyl-phospholipid synthase, putative [Theobroma 
cacao]
Length=924

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/686 (61%), Positives = 521/686 (76%), Gaps = 11/686 (2%)
 Frame = +2

Query  971   FHSVATTTFCRISL--QLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +T +FC      ++ GR QWLTV+  S    NKV++ LE RGC++  GCEVHSV T
Sbjct  246   FSAFSTLSFCHTHYLYEILGRQQWLTVRGFS-KLENKVKDLLESRGCQLSIGCEVHSVLT  304

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G     ++ SG +  QE YDGC+MA  AP  L++LG QATFDE RILGAF+Y YSDI
Sbjct  305   ADDGR---TIVCSGDDF-QEVYDGCMMAVDAPTALRLLGNQATFDESRILGAFRYAYSDI  360

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LH + + MP N AAWS+ NFL +  N+ CLTYWLN LQN+G T  P+L+TLNP  TP+ 
Sbjct  361   FLHHDDNLMPNNRAAWSSLNFLRSAENKGCLTYWLNMLQNVGKTTLPFLLTLNPDSTPKH  420

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+T   +PSVAAS+AS ELE IQGKR IWFCG    Y FH D ++AG+IA +G+L 
Sbjct  421   TLLKWSTSRLIPSVAASKASLELEEIQGKRGIWFCG----YDFHGDAVEAGLIATYGILG  476

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             KR S LN P +M PS  E GARL VTRFL  FI TG IILLEEGG VFTF+G   K  LK
Sbjct  477   KRNSVLNKPENMAPSLLERGARLFVTRFLRQFISTGCIILLEEGGGVFTFKGNMNKCSLK  536

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++RVHSPQFYWKV T+ADLGLADA+++ D SFVDK++GLL+L  I +ANR+   SVSR 
Sbjct  537   TVLRVHSPQFYWKVMTEADLGLADAFMNRDFSFVDKEDGLLHLLTILIANRNFEHSVSRL  596

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWWTP LFT+ +A AKYF +H+ RQN L QARRNIS+HYD SN+ FSLFLDETMTY
Sbjct  597   KKKRGWWTPPLFTAGLAYAKYFFKHVMRQNNLMQARRNISQHYDQSNDFFSLFLDETMTY  656

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK EDEDLK AQ RKIS+LI+KAKI+ +H ILEIG GWGSLAIE V+ TGC+YTGI
Sbjct  657   SCAVFKKEDEDLKVAQKRKISVLIEKAKINSKHEILEIGFGWGSLAIEVVKLTGCRYTGI  716

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLK++E KV+EAGLQD+I+F LCDYR+LP + + DRIISCEM+E VG E++ EFF
Sbjct  717   TLSEEQLKFSEKKVKEAGLQDHIKFELCDYRKLPSSYKCDRIISCEMIEHVGDEYLEEFF  776

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CE VL E+G+LVLQF S  DE Y +YR +SDF+KEYIFPG C PSL R++SAMAA++R
Sbjct  777   GWCEKVLTEDGLLVLQFSSTSDEGYHDYRHTSDFLKEYIFPGICPPSLGRISSAMAATTR  836

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH+E+IG  Y++T+R W+   L+ +S+I+ LGF+++FIR WEYY DY AAG ++ T 
Sbjct  837   LCVEHVENIGSQYHRTVRFWKNKLLDNKSKIVALGFNEEFIRMWEYYLDYVAAGMNSRTH  896

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASA  3022
              +YQ+VFSR G   A G+P KG +SA
Sbjct  897   LNYQVVFSRHGYPAAPGNPDKGFSSA  922


 Score =   302 bits (773),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 134/215 (62%), Positives = 170/215 (79%), Gaps = 0/215 (0%)
 Frame = +1

Query  379   RRKKELLKMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLG  558
             R++ E  +MRVAV+G GI GLVSAYVLAK G  VVVYEK    GGHA+TV    +DLDL 
Sbjct  55    RQQTEYYRMRVAVIGGGIRGLVSAYVLAKAGVNVVVYEKGKQFGGHARTVNFHAIDLDLA  114

Query  559   FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLN  738
             FM  N   +PN+++ F  LGVD+E SD+SFSVSLDNG GYEWG++ GFS LFAQKKN+ N
Sbjct  115   FMFLNPAKHPNVLDFFTGLGVDVETSDVSFSVSLDNGQGYEWGNQKGFSSLFAQKKNVFN  174

Query  739   PYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCAS  918
             PYFWQM+REI++FK+DV+SYL+E +NNPD  RN+T+G+FI+SRGYSELF+KAY++P+C S
Sbjct  175   PYFWQMLREIIRFKDDVVSYLQELENNPDTGRNETMGQFIESRGYSELFRKAYLVPICCS  234

Query  919   IWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             +WSCS+E VM+FSA+S LSFC  H+L +      W
Sbjct  235   VWSCSAEEVMSFSAFSTLSFCHTHYLYEILGRQQW  269



>ref|XP_008796356.1| PREDICTED: uncharacterized protein LOC103711840 isoform X3 [Phoenix 
dactylifera]
Length=811

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/694 (62%), Positives = 517/694 (74%), Gaps = 63/694 (9%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNK-VREELEKRGCEIRCG  1120
             PS     F + +   FCR    LQLFGRPQWLTVK+RSH YV K VR ELE R C+IR G
Sbjct  177   PSEGVMSFSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHCYVRKQVRGELESRCCQIRTG  236

Query  1121  CEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGA  1300
             C V SV   + G       + G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA
Sbjct  237   CAVKSVLNIDGGCH-----VVGEDQSEETYDGCIISTHAPDALKILGTQATYEESRLLGA  291

Query  1301  FQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTL  1480
             +QYVYSDIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTL
Sbjct  292   YQYVYSDIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNLPFLVTL  351

Query  1481  NPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGM  1660
             NP   P+  LLKW+T HP+PSVAAS+AS E+ +IQGKRRIWFCGAYQG+GFHEDGLKAG+
Sbjct  352   NPRFVPKHTLLKWSTSHPIPSVAASKASLEIGKIQGKRRIWFCGAYQGFGFHEDGLKAGI  411

Query  1661  IAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEG  1840
             +AA+ +L   C  L NP  MVPS  ETGARL+VTRFL  +I TG + LLEEGGT+F FEG
Sbjct  412   VAANSVLGMDCVLLRNPRQMVPSLVETGARLIVTRFLEKYISTGCLTLLEEGGTIFVFEG  471

Query  1841  TDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD  2020
             T+KK+ +K ++++H P FYWKVAT+ADLGLADAYI+   SFVD++EGLLNLF I + NRD
Sbjct  472   TNKKSCIKSILKIHDPLFYWKVATEADLGLADAYINRYFSFVDEQEGLLNLFMILIVNRD  531

Query  2021  LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSL  2200
              ++S S+S + RGWWTP+LFT+ + SA+YF+RHISRQNT+ QA +NIS HYDLSNE FSL
Sbjct  532   QNSS-SKSKTTRGWWTPILFTAGLQSARYFLRHISRQNTVAQAPKNISHHYDLSNEFFSL  590

Query  2201  FLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVER  2380
             FLDETMTYS A+FK E+EDLK AQ+ KISLLI+K +I+    +L                
Sbjct  591   FLDETMTYSGAIFKMENEDLKVAQLHKISLLIEKDRIT---FLL----------------  631

Query  2381  TGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVG  2560
               C Y                          R L C YR+      YDRIISCEM+E VG
Sbjct  632   --CDY--------------------------RQLPC-YRK------YDRIISCEMIEGVG  656

Query  2561  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  2740
             HE+M EFFG CES+LAE+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+T
Sbjct  657   HEYMEEFFGCCESLLAEDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRIT  716

Query  2741  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  2920
             SAMAA+SR CVEHLE+IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCA
Sbjct  717   SAMAAASRFCVEHLENIGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCA  776

Query  2921  AGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             AGF + TLG+YQ+VFSRPGN TAF +PY G+ SA
Sbjct  777   AGFRSRTLGNYQMVFSRPGNSTAFSNPYDGVPSA  810


 Score =   342 bits (878),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 184/216 (85%), Gaps = 2/216 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVGAGISGL SAYVLAK G  VV+YEKED LGGHAKTV  DGV+LDLGFMVFN VT
Sbjct  1     MRVAVVGAGISGLASAYVLAKAGVDVVLYEKEDCLGGHAKTVNFDGVNLDLGFMVFNGVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSF+VSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61    YPNMMEFFESLGVDMEISDMSFAVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV+ YLE+++NNPD+DRN+TLG FIKS GYS+LFQKAY++P+CA IWSC SEG
Sbjct  121   EIVKFKHDVIRYLEKYENNPDLDRNETLGHFIKSHGYSQLFQKAYLVPICACIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW--SPTMAHC  1044
             VM+FSA+S+L+FCRNHHLLQ F    W      +HC
Sbjct  181   VMSFSAFSVLAFCRNHHLLQLFGRPQWLTVKQRSHC  216



>ref|XP_008796359.1| PREDICTED: uncharacterized protein LOC103711840 isoform X6 [Phoenix 
dactylifera]
Length=558

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/558 (71%), Positives = 472/558 (85%), Gaps = 1/558 (0%)
 Frame = +2

Query  1349  MPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTG  1528
             MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLNP   P+  LLKW+T 
Sbjct  1     MPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNLPFLVTLNPRFVPKHTLLKWSTS  60

Query  1529  HpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNN  1708
             HP+PSVAAS+AS E+ +IQGKRRIWFCGAYQG+GFHEDGLKAG++AA+ +L   C  L N
Sbjct  61    HPIPSVAASKASLEIGKIQGKRRIWFCGAYQGFGFHEDGLKAGIVAANSVLGMDCVLLRN  120

Query  1709  PNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSP  1888
             P  MVPS  ETGARL+VTRFL  +I TG + LLEEGGT+F FEGT+KK+ +K ++++H P
Sbjct  121   PRQMVPSLVETGARLIVTRFLEKYISTGCLTLLEEGGTIFVFEGTNKKSCIKSILKIHDP  180

Query  1889  QFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWT  2068
              FYWKVAT+ADLGLADAYI+   SFVD++EGLLNLF I + NRD ++S S+S + RGWWT
Sbjct  181   LFYWKVATEADLGLADAYINRYFSFVDEQEGLLNLFMILIVNRDQNSS-SKSKTTRGWWT  239

Query  2069  PLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSE  2248
             P+LFT+ + SA+YF+RHISRQNT+ QA +NIS HYDLSNE FSLFLDETMTYS A+FK E
Sbjct  240   PILFTAGLQSARYFLRHISRQNTVAQAPKNISHHYDLSNEFFSLFLDETMTYSGAIFKME  299

Query  2249  DEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLK  2428
             +EDLK AQ+ KISLLI+KA+I  +H ILEIGCGWGSLAIE V++TGCKYTGITLSE+QLK
Sbjct  300   NEDLKVAQLHKISLLIEKARIEAKHEILEIGCGWGSLAIEVVKQTGCKYTGITLSEEQLK  359

Query  2429  YAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLA  2608
             +A+ + +EA L+D I FLLCDYRQLP   +YDRIISCEM+E VGHE+M EFFG CES+LA
Sbjct  360   FAKRRAKEACLEDRITFLLCDYRQLPCYRKYDRIISCEMIEGVGHEYMEEFFGCCESLLA  419

Query  2609  ENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLED  2788
             E+G+ VLQFISIPDERYDEYR+SSDFI+EYIFPGGCLPSLSR+TSAMAA+SR CVEHLE+
Sbjct  420   EDGLFVLQFISIPDERYDEYRRSSDFIREYIFPGGCLPSLSRITSAMAAASRFCVEHLEN  479

Query  2789  IGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFS  2968
             IGIHY QTLR WR NF++ + +IL LGFD+KFIRTWEYYF YCAAGF + TLG+YQ+VFS
Sbjct  480   IGIHYDQTLRYWRNNFMQNKCKILALGFDEKFIRTWEYYFIYCAAGFRSRTLGNYQMVFS  539

Query  2969  RPGNVTAFGDPYKGLASA  3022
             RPGN TAF +PY G+ SA
Sbjct  540   RPGNSTAFSNPYDGVPSA  557



>gb|AAT74600.1| cyclopropane fatty acid synthase [Gossypium hirsutum]
Length=873

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/695 (59%), Positives = 519/695 (75%), Gaps = 21/695 (3%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR     QLFG+ QWLT+K  SH +V +VRE LE +GC+ + GCEV SV  
Sbjct  185   FSAFSILSFCRTHHLYQLFGQSQWLTIKGHSH-FVKRVREVLETKGCQFKLGCEVQSVLP  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G+A    ++ G    QE Y+GCIMA  AP  LK+LG QATF+E R+LGAFQY  SDI
Sbjct  244   VDNGTA----MVCGDGF-QETYNGCIMAVDAPTALKLLGNQATFEETRVLGAFQYATSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LH++ + MP+N +AWSA NFL +  N   LTYWLN LQN+G T +P+ VT+NP  TP+ 
Sbjct  299   FLHQDSTLMPQNKSAWSALNFLNSSKNNAFLTYWLNALQNIGKTSEPFFVTVNPDHTPKN  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+TGH + SVAAS+AS EL +IQGKR IWFCG    Y F++D LKAGM AAHG+L 
Sbjct  359   TLLKWSTGHAIXSVAASKASLELGQIQGKRGIWFCG----YDFNQDELKAGMDAAHGILG  414

Query  1685  KRCSPLNNPNHMVPSWP--------ETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEG  1840
             K  S   +P +M PS P        ET ARL VT+F   +I  G +I LEEGG +FTF+G
Sbjct  415   KHSSVPPSPKNMSPSLPKNMSPSFMETTARLFVTKFFQQYISMGCVIFLEEGGRIFTFKG  474

Query  1841  TDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD  2020
               +K  LK +++VH+PQFYW++  +AD+GLADAYIHGD SF+D+ EGLLNLF+I VAN++
Sbjct  475   NMEKCPLKTVLKVHNPQFYWRIMKEADIGLADAYIHGDFSFLDENEGLLNLFRILVANKE  534

Query  2021  LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSL  2200
              SA+ S S  +R WW+P L T++I+SAKYF++H+ RQNT+TQARRNISRHYDLSNELFSL
Sbjct  535   NSAA-SGSTKRRTWWSPALLTASISSAKYFVKHLLRQNTITQARRNISRHYDLSNELFSL  593

Query  2201  FLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVER  2380
             +L + M YS  VF++ +E L  AQ RKIS LI+K +I K H +L+IGCGWGSLAIE V+R
Sbjct  594   YLGKMMQYSSGVFRTGEEHLDVAQRRKISSLIEKTRIEKWHEVLDIGCGWGSLAIETVKR  653

Query  2381  TGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVG  2560
             TGCKYTGITLSEQQLKYA++KV+EAGL+DNI+ LLCDYRQLP   ++DRIIS EM+E VG
Sbjct  654   TGCKYTGITLSEQQLKYAQEKVKEAGLEDNIKILLCDYRQLPKEHQFDRIISVEMVEHVG  713

Query  2561  HEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVT  2740
              E++ EF+  C+ +L E+G+ VLQFISIP+E   E +Q++ F+KEYIFPGG L SL R  
Sbjct  714   EEYIEEFYRCCDQLLKEDGLFVLQFISIPEELSKEIQQTAGFLKEYIFPGGTLLSLDRNL  773

Query  2741  SAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCA  2920
             SAMAA++R  VEH+E+IG+ YY TLR WR  FL+  S++L LGFD+KF+RTWEYYFDYCA
Sbjct  774   SAMAAATRFSVEHVENIGMSYYHTLRWWRKLFLKNTSKVLALGFDEKFMRTWEYYFDYCA  833

Query  2921  AGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             AGF T TL DYQ+VFSR GN    GDPYKG  SAY
Sbjct  834   AGFKTGTLIDYQVVFSRAGNFGTLGDPYKGFPSAY  868


 Score =   273 bits (697),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/214 (61%), Positives = 157/214 (73%), Gaps = 1/214 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M VAV+G GI GL+SAYVL K G  VVVYEKE+ LGGHAKTV  D VDLDLGF+  N   
Sbjct  1     MEVAVIGGGIKGLLSAYVLVKAGVDVVVYEKEEQLGGHAKTVNFDAVDLDLGFLFLNPAR  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGH-GYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             Y  ++ +F+SLGVD+E SD+SFS+S D G+ GYEW S+ GFS  FAQKK LLNP+ WQ +
Sbjct  61    YATLLHMFDSLGVDVETSDVSFSISHDKGNNGYEWCSQYGFSNYFAQKKKLLNPFNWQSL  120

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI+KF NDV SYL   +NNPD+DR +TLG+FI S+GYSE FQ  Y+ P+C S+WS S E
Sbjct  121   REIIKFGNDVESYLGSLENNPDIDRTETLGQFINSKGYSENFQNTYLAPICGSMWSSSKE  180

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALWSPTMAH  1041
              V +FSA+SILSFCR HHL Q F  + W     H
Sbjct  181   DVTSFSAFSILSFCRTHHLYQLFGQSQWLTIKGH  214



>ref|XP_006664478.1| PREDICTED: uncharacterized protein LOC102701601 [Oryza brachyantha]
Length=822

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/692 (60%), Positives = 518/692 (75%), Gaps = 11/692 (2%)
 Frame = +2

Query  908   CVLPYGPVHQKG*WPSLLTPFFHSVATTTFCRISLQLFGRPQWLTVKRRSHSYVNKVREE  1087
             C+ P       G     +  FFH      F +     FGR + LTVK  S SY+NKV+EE
Sbjct  132   CIWPCPSQQVLGFSAFFVLSFFHKHHILQFSQ-----FGRGEQLTVKGHSQSYINKVKEE  186

Query  1088  LEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQ  1267
             LE RGC I+  C+V  +S+ ++G    V+ + G   ++E YD  I+  HA D LK+LG +
Sbjct  187   LESRGCRIKTNCQVKCISSFDRGYR--VLEVDG---LEEMYDRIIVDTHATDALKLLGTE  241

Query  1268  ATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNL  1447
             AT +ELRILGAF+Y YSDIYLH ++SFMP N +AWSA NF+G  +   C+TYWLN LQN+
Sbjct  242   ATHEELRILGAFRYAYSDIYLHCDESFMPFNSSAWSACNFMGNKSRCFCVTYWLNLLQNI  301

Query  1448  GDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGY  1627
               T+  +LVT+NP   P   LLKW T H VP+VAAS+AS +L +IQGKR IWFCG YQG 
Sbjct  302   QSTR-TFLVTVNPSHVPNHVLLKWNTSHLVPAVAASKASLDLGQIQGKRGIWFCGTYQGC  360

Query  1628  GFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILL  1807
             GFHEDGLK G  AA  LL K+  P+ NP  MV SW ETGARLLV+RFL  +I  G++IL 
Sbjct  361   GFHEDGLKVGRAAAQSLLGKKIDPIVNPKQMVLSWTETGARLLVSRFLNQYISVGNLILF  420

Query  1808  EEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLL  1987
             EEGGT+F+F    KK  +K +++VH P FYWK+AT+ADLGLADAYI+G  SF +K+EGLL
Sbjct  421   EEGGTMFSFGEACKKCNVKSILQVHDPLFYWKIATEADLGLADAYINGYFSFTNKREGLL  480

Query  1988  NLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISR  2167
             NLF I +ANRD   S SR +  RGWWTPLL T+  ASAKYF+RH+SR+NT+ Q R+N+S+
Sbjct  481   NLFLILIANRDAQRSSSRISCTRGWWTPLLLTAGFASAKYFLRHLSRKNTVAQTRQNVSQ  540

Query  2168  HYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCG  2347
             HYDLSN+ FSLFLD++MTYS A+F  E+E L+ AQ+RK+ +LIDKAK+  +  +LEIG G
Sbjct  541   HYDLSNDFFSLFLDKSMTYSSAIFMDEEESLEEAQLRKVKVLIDKAKVEWDQDVLEIGSG  600

Query  2348  WGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDR  2527
             WGSLAIE V++TGCKYTG+T S +QLKYA+ +V+EAGL D I FLLCDYR++P   +YDR
Sbjct  601   WGSLAIEVVKQTGCKYTGVTQSMEQLKYAQRRVKEAGLADQITFLLCDYREIPACHKYDR  660

Query  2528  IISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFP  2707
             II CEM+E VGHE+M+EFFG CES+LAE+GI V+QF SIP+ERYDEYR+SSDFIKEYIFP
Sbjct  661   IICCEMIEEVGHEYMDEFFGCCESLLAEDGIFVIQFSSIPEERYDEYRRSSDFIKEYIFP  720

Query  2708  GGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFI  2887
             GGC+P L+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL LGFD++F 
Sbjct  721   GGCIPCLTRITSAMSAASRLCIEHVENIGHHYYPTLVRWRDNFMANKDKILALGFDERFT  780

Query  2888  RTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  2983
             RTWEYYF Y AAGF + TLG YQIVFSRPGN 
Sbjct  781   RTWEYYFMYSAAGFKSRTLGVYQIVFSRPGNA  812


 Score =   185 bits (469),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSV--SLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  750
             VT PNMM+ FE LG +ME SDMSFSV   LD G   EW S NG SGL AQK N LNP FW
Sbjct  17    VTCPNMMQWFEVLGANMERSDMSFSVRTQLDVGRACEWASGNGISGLLAQKSNALNPRFW  76

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSC  930
              MI +ILKFK+D L YLE+  NNPD++ N+TLG+FI+S GY +LFQ+AY+IP+C  IW C
Sbjct  77    CMISDILKFKSDALRYLEDRKNNPDLNLNETLGQFIQSHGYCQLFQEAYLIPICCCIWPC  136

Query  931   SSEGVMAFSAYSILSFCRNHHLLQ  1002
              S+ V+ FSA+ +LSF   HH+LQ
Sbjct  137   PSQQVLGFSAFFVLSFFHKHHILQ  160



>ref|XP_008664677.1| PREDICTED: uncharacterized protein LOC103643302 isoform X2 [Zea 
mays]
 tpg|DAA49063.1| TPA: hypothetical protein ZEAMMB73_143484 [Zea mays]
Length=873

 Score =   766 bits (1978),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 382/667 (57%), Positives = 488/667 (73%), Gaps = 15/667 (2%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             L+LF   QWL VK  S  YV KVREELE  GC+I+ GCEV SVS       GG  I+   
Sbjct  204   LELFSPLQWLNVKGGSGCYVKKVREELESMGCQIKTGCEVRSVSRFN----GGYRILEAD  259

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
                +E YD  I   HAPD LK+LG++AT  E R+LGAFQY+YSD+Y H ++SFMPRN +A
Sbjct  260   GS-EEMYDRIIFCVHAPDALKILGEEATPHERRVLGAFQYIYSDLYFHCDESFMPRNSSA  318

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSA NFLGT ++ VC+TYWLN LQN+ ++  P+L TLNPPR P+  LLKW T HP+PS+A
Sbjct  319   WSAMNFLGTTSSGVCVTYWLNILQNI-ESAGPFLATLNPPRVPDHVLLKWHTRHPIPSMA  377

Query  1550  asrassELERIQGKRRIWFCGAYQ-GYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHM-V  1723
             A+RA+ EL  IQGKR IWFC  YQ GYG HED +KAG     GLL K+C  L NP  M V
Sbjct  378   AARATLELNSIQGKRGIWFCVPYQQGYGNHEDSVKAGKAVTLGLLGKKCDLLVNPKPMIV  437

Query  1724  PSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWK  1903
             PSW E G R +V + L  FI  G+  +LE+GGT  +F  T ++  LK ++RVH+PQFYWK
Sbjct  438   PSWTEAGVRYMVAKNLGKFITIGNFSMLEDGGTSLSFGKTCERCQLKCVIRVHNPQFYWK  497

Query  1904  VATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD----LSASVSRSNS---KRGW  2062
             +AT+ D G A +YI+G ISFVDKKEG+ N+ +I +ANR     LS++ +R+ S   K+GW
Sbjct  498   IATEGDPGFAYSYINGYISFVDKKEGIQNIVEIIIANRGERKRLSSTRARNKSGYVKKGW  557

Query  2063  WTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK  2242
             WTPL   +  A AKY +  + R+NT+++AR+NIS HYDLSN+ F+LFLD TMTYSC +FK
Sbjct  558   WTPLFKKNGAAMAKYVLHEVLRRNTISKARKNISAHYDLSNDFFALFLDPTMTYSCGIFK  617

Query  2243  SEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQ  2422
             +EDE L+ AQ+RK+  LI+KAK+   HH+L+IGCGWGSLAI  V+RTGCK TGITLSE+Q
Sbjct  618   AEDESLEAAQLRKLDNLINKAKVDPGHHVLDIGCGWGSLAIRLVKRTGCKCTGITLSEEQ  677

Query  2423  LKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESV  2602
             LKY + KV+E GL+D+I  LLCDYRQ+P+  ++DRIISC MLE VGHEF  +FF  CE  
Sbjct  678   LKYGKRKVKEFGLEDHITLLLCDYRQIPNGQKFDRIISCGMLEHVGHEFYEDFFASCEYH  737

Query  2603  LAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  2782
             LAE+G+LVLQ I++P+E YD+ R   DF+KEYIFPGGC+PSL+R+ SAM+ +SRLC++H+
Sbjct  738   LAEHGLLVLQSIAVPEELYDKMRTKPDFLKEYIFPGGCIPSLARIASAMSNASRLCIQHV  797

Query  2783  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  2962
             E+IG HYY TL  WR NF   + ++L LGFD+KFIRTWEYY +YCAA F +    DYQIV
Sbjct  798   ENIGYHYYPTLIHWRENFEANEEKVLALGFDEKFIRTWEYYLNYCAAMFKSHMGLDYQIV  857

Query  2963  FSRPGNV  2983
             F+R G+ 
Sbjct  858   FARAGDA  864


 Score =   245 bits (625),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 157/214 (73%), Gaps = 10/214 (5%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG----VDLDLGFMV  567
             MRVAVVG G+SGLV+A+ LA+ GGA V VYEKED+LGG AKTV ++G    V +DL FMV
Sbjct  2     MRVAVVGGGLSGLVAAHELARSGGARVTVYEKEDHLGG-AKTVAVNGGSGPVLVDLDFMV  60

Query  568   FNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLLNP  741
             FNRVT+ NMME FE LGV+ME SDMSFS SL  + G G+EWG+RNG S +  QK NLL+P
Sbjct  61    FNRVTFSNMMEWFERLGVEMEKSDMSFSASLRLNEGKGFEWGTRNGISSVLVQKSNLLSP  120

Query  742   YFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASI  921
              FW MI EI KFKN  L Y E++  NPD  +N+T G+FI+S  YS+LFQ AY+IPMCA I
Sbjct  121   RFWLMINEIFKFKNHALKYQEDYARNPD--KNETFGQFIQSHRYSQLFQDAYLIPMCACI  178

Query  922   WSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             WSC  + +  F A  +LSF  ++HLL+ FSP  W
Sbjct  179   WSCPPQNIFGFPAGFVLSFFCDNHLLELFSPLQW  212



>ref|XP_008664676.1| PREDICTED: uncharacterized protein LOC103643302 isoform X1 [Zea 
mays]
Length=875

 Score =   765 bits (1975),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 380/667 (57%), Positives = 488/667 (73%), Gaps = 13/667 (2%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             L+LF   QWL VK  S  YV KVREELE  GC+I+ GCEV SVS     +   ++   G 
Sbjct  204   LELFSPLQWLNVKGGSGCYVKKVREELESMGCQIKTGCEVRSVSRFNGETGYRILEADGS  263

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
                +E YD  I   HAPD LK+LG++AT  E R+LGAFQY+YSD+Y H ++SFMPRN +A
Sbjct  264   ---EEMYDRIIFCVHAPDALKILGEEATPHERRVLGAFQYIYSDLYFHCDESFMPRNSSA  320

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSA NFLGT ++ VC+TYWLN LQN+ ++  P+L TLNPPR P+  LLKW T HP+PS+A
Sbjct  321   WSAMNFLGTTSSGVCVTYWLNILQNI-ESAGPFLATLNPPRVPDHVLLKWHTRHPIPSMA  379

Query  1550  asrassELERIQGKRRIWFCGAYQ-GYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHM-V  1723
             A+RA+ EL  IQGKR IWFC  YQ GYG HED +KAG     GLL K+C  L NP  M V
Sbjct  380   AARATLELNSIQGKRGIWFCVPYQQGYGNHEDSVKAGKAVTLGLLGKKCDLLVNPKPMIV  439

Query  1724  PSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWK  1903
             PSW E G R +V + L  FI  G+  +LE+GGT  +F  T ++  LK ++RVH+PQFYWK
Sbjct  440   PSWTEAGVRYMVAKNLGKFITIGNFSMLEDGGTSLSFGKTCERCQLKCVIRVHNPQFYWK  499

Query  1904  VATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRD----LSASVSRSNS---KRGW  2062
             +AT+ D G A +YI+G ISFVDKKEG+ N+ +I +ANR     LS++ +R+ S   K+GW
Sbjct  500   IATEGDPGFAYSYINGYISFVDKKEGIQNIVEIIIANRGERKRLSSTRARNKSGYVKKGW  559

Query  2063  WTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK  2242
             WTPL   +  A AKY +  + R+NT+++AR+NIS HYDLSN+ F+LFLD TMTYSC +FK
Sbjct  560   WTPLFKKNGAAMAKYVLHEVLRRNTISKARKNISAHYDLSNDFFALFLDPTMTYSCGIFK  619

Query  2243  SEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQ  2422
             +EDE L+ AQ+RK+  LI+KAK+   HH+L+IGCGWGSLAI  V+RTGCK TGITLSE+Q
Sbjct  620   AEDESLEAAQLRKLDNLINKAKVDPGHHVLDIGCGWGSLAIRLVKRTGCKCTGITLSEEQ  679

Query  2423  LKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESV  2602
             LKY + KV+E GL+D+I  LLCDYRQ+P+  ++DRIISC MLE VGHEF  +FF  CE  
Sbjct  680   LKYGKRKVKEFGLEDHITLLLCDYRQIPNGQKFDRIISCGMLEHVGHEFYEDFFASCEYH  739

Query  2603  LAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  2782
             LAE+G+LVLQ I++P+E YD+ R   DF+KEYIFPGGC+PSL+R+ SAM+ +SRLC++H+
Sbjct  740   LAEHGLLVLQSIAVPEELYDKMRTKPDFLKEYIFPGGCIPSLARIASAMSNASRLCIQHV  799

Query  2783  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  2962
             E+IG HYY TL  WR NF   + ++L LGFD+KFIRTWEYY +YCAA F +    DYQIV
Sbjct  800   ENIGYHYYPTLIHWRENFEANEEKVLALGFDEKFIRTWEYYLNYCAAMFKSHMGLDYQIV  859

Query  2963  FSRPGNV  2983
             F+R G+ 
Sbjct  860   FARAGDA  866


 Score =   245 bits (625),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 157/214 (73%), Gaps = 10/214 (5%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG----VDLDLGFMV  567
             MRVAVVG G+SGLV+A+ LA+ GGA V VYEKED+LGG AKTV ++G    V +DL FMV
Sbjct  2     MRVAVVGGGLSGLVAAHELARSGGARVTVYEKEDHLGG-AKTVAVNGGSGPVLVDLDFMV  60

Query  568   FNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLLNP  741
             FNRVT+ NMME FE LGV+ME SDMSFS SL  + G G+EWG+RNG S +  QK NLL+P
Sbjct  61    FNRVTFSNMMEWFERLGVEMEKSDMSFSASLRLNEGKGFEWGTRNGISSVLVQKSNLLSP  120

Query  742   YFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASI  921
              FW MI EI KFKN  L Y E++  NPD  +N+T G+FI+S  YS+LFQ AY+IPMCA I
Sbjct  121   RFWLMINEIFKFKNHALKYQEDYARNPD--KNETFGQFIQSHRYSQLFQDAYLIPMCACI  178

Query  922   WSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             WSC  + +  F A  +LSF  ++HLL+ FSP  W
Sbjct  179   WSCPPQNIFGFPAGFVLSFFCDNHLLELFSPLQW  212



>ref|NP_001066537.1| Os12g0267200 [Oryza sativa Japonica Group]
 gb|ABA97030.2| cyclopropane fatty acid synthase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29556.1| Os12g0267200 [Oryza sativa Japonica Group]
 dbj|BAG91262.1| unnamed protein product [Oryza sativa Japonica Group]
Length=837

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/680 (62%), Positives = 522/680 (77%), Gaps = 9/680 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +F R    LQLF R Q L V  RS SY NKVRE+LE R C I+  C
Sbjct  159   PSQRVLGFSASSVLSFFRKHNLLQLFSRTQPLIVNGRSQSYFNKVREDLESRSCRIKTNC  218

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
              V S+S+ ++G    V+ + G    +E YD  I+  HA D LK+LG +AT +E RILGAF
Sbjct  219   HVKSISSFDRGYR--VLEVDGS---EEMYDRIIVGIHALDALKLLGAEATHEESRILGAF  273

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYV S++YLH ++SFM  N + WSA N   T +  VC+TYWLN LQN+  T   +LVTLN
Sbjct  274   QYVSSNLYLHCDESFMLCNSSTWSACNITRTRSGSVCVTYWLNLLQNIESTNH-FLVTLN  332

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   P+  LLKW T H VP+VAAS+AS EL++IQGKR IWFCGAYQG GFHEDG +AG  
Sbjct  333   PSYVPDHVLLKWNTNHFVPTVAASKASLELDQIQGKRGIWFCGAYQGSGFHEDGFQAGKA  392

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA  LL  +  PL NP  MV SW ETGARLLV RFL  +I  G++IL EEGGT+F+F   
Sbjct  393   AAQSLLGNKIDPLTNPKQMVLSWTETGARLLVLRFLKQYISVGNLILFEEGGTMFSFGEA  452

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              +K   K +++V  P FYW+VAT+ADLGLADAYI+G  SFV+K+EGLLNLF I +A+RD 
Sbjct  453   CEKCNKKSVLQVQDPLFYWQVATEADLGLADAYINGCFSFVNKREGLLNLFLILIASRDA  512

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               S  R++S+RGWWTPLLFT+ +ASAKYF+RHISR+N++TQ R+N+S+HYDLSN+ FSLF
Sbjct  513   HRSSCRNSSRRGWWTPLLFTAGVASAKYFLRHISRKNSVTQTRQNVSQHYDLSNDFFSLF  572

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD++MTYS A+FK E+E L+ AQ+RKI+LLI KAK+ ++  +LEIG GWGSLA+E V++T
Sbjct  573   LDKSMTYSSAIFKDEEESLEEAQLRKINLLIHKAKVGQDDEVLEIGSGWGSLAMEVVKQT  632

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTG+T S +QLKYA+ +V+EAGL+D I FLLCDYR++P + +YDRII CEM+E VGH
Sbjct  633   GCKYTGVTQSVEQLKYAQRRVKEAGLEDRITFLLCDYREIPCH-KYDRIICCEMIEEVGH  691

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M+EFFG CES+LAENGI V QFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TS
Sbjct  692   EYMDEFFGCCESLLAENGIFVTQFISIPEERYDEYRRSSDFIKEYIFPGGCLPSLTRITS  751

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL LGFD+KFIRTWEYYF YCAA
Sbjct  752   AMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKDKILALGFDEKFIRTWEYYFIYCAA  811

Query  2924  GFHTCTLGDYQIVFSRPGNV  2983
             GF + TLGDYQIVFSRPGN 
Sbjct  812   GFKSRTLGDYQIVFSRPGNT  831


 Score =   170 bits (431),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 106/147 (72%), Gaps = 2/147 (1%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSV--SLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  750
             VT PNMM+ F  LG +ME SDMSFSV   LD     EW S NG SGL A++ N L+P FW
Sbjct  39    VTSPNMMQWFADLGANMERSDMSFSVRTQLDACGECEWASSNGISGLLAKRSNALSPSFW  98

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSC  930
             +MI E LKFK D L YLE+ +NN D+++++TLG+F++S GY + FQ+AY+ P+C  +WSC
Sbjct  99    RMISETLKFKRDALRYLEDCENNLDLEQSETLGQFVQSHGYCQFFQEAYLFPICGWMWSC  158

Query  931   SSEGVMAFSAYSILSFCRNHHLLQNFS  1011
              S+ V+ FSA S+LSF R H+LLQ FS
Sbjct  159   PSQRVLGFSASSVLSFFRKHNLLQLFS  185



>ref|XP_010532686.1| PREDICTED: uncharacterized protein LOC104808653 isoform X2 [Tarenaya 
hassleriana]
Length=887

 Score =   828 bits (2138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/638 (64%), Positives = 491/638 (77%), Gaps = 6/638 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +++  +F R +  LQ+FGRPQWLTV  RS +YV K+R ELE+RGC+IR   
Sbjct  183   PSDDVSSFSALSVLSFFRNNHLLQIFGRPQWLTVAGRSRTYVAKIRTELEQRGCKIRTRR  242

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV  V+T    S    V I   +  +E +D C++A +A D L++LG QATFDE R+LGAF
Sbjct  243   EVQWVTT----SVNNGVTIRNGDGSEEIFDRCLLAMNAQDALRLLGDQATFDERRVLGAF  298

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYV+SDIYLHR+  FMP   AAWSA NFL +  ++  +TYWLN LQNLG+ ++P+ VTLN
Sbjct  299   QYVHSDIYLHRDTDFMPHKTAAWSACNFLESTEHKGSITYWLNILQNLGEKQEPFFVTLN  358

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P R P++ LLKWTT   VPSVAA  AS +L++IQG+  +WFC + QGYGFHEDGLKAG+ 
Sbjct  359   PDRVPKKTLLKWTTARTVPSVAALTASQDLDKIQGQHGLWFCESCQGYGFHEDGLKAGIA  418

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA  LL+K    L NP  MV S  ETGARL VTRF+  FI TGSI LLEEGGT+F F G 
Sbjct  419   AARNLLRKDIGNLKNPKCMVLSLSETGARLFVTRFMEQFISTGSITLLEEGGTMFRFGGK  478

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
               K  L+ ++ +HSPQFYWKV T+ADLGLADAYI+GD SFVDK  GLLN+  I +ANRD+
Sbjct  479   HPKCNLRSVLTIHSPQFYWKVMTRADLGLADAYINGDFSFVDKDNGLLNMLMILIANRDM  538

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++  S    KRGWWTP+  T+ +AS  YF++H+SRQNTLTQARRNISRHYDLSNELF++F
Sbjct  539   NSLKSNLAKKRGWWTPMFLTAGLASVNYFLKHVSRQNTLTQARRNISRHYDLSNELFAMF  598

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETM YS A+F SEDEDLKTAQMRKISLLI+KA+I K H +LEIGCGWG+LAIE V RT
Sbjct  599   LDETMMYSAALFSSEDEDLKTAQMRKISLLIEKARIEKNHEVLEIGCGWGTLAIEVVRRT  658

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GC+YTGITLS +QLKYAE K REAGLQD I F LCDYRQL D+  YDRIISCEMLEAVGH
Sbjct  659   GCRYTGITLSVEQLKYAEAKAREAGLQDQITFQLCDYRQLSDSRVYDRIISCEMLEAVGH  718

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             EFM  FF  CE+ LAE+G+LV+QF  IPD+RYDEYR SSDFIKEYIF GGCLPSL+R+TS
Sbjct  719   EFMETFFRSCEAALAEDGLLVMQFAWIPDQRYDEYRLSSDFIKEYIFHGGCLPSLARLTS  778

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQI  2857
             AMA+SSRL ++ +E+IG+HYYQT+RCWR NF ER+  +
Sbjct  779   AMASSSRLYIQQVENIGVHYYQTIRCWRKNFTERRRSL  816


 Score =   267 bits (683),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 164/210 (78%), Gaps = 2/210 (1%)
 Frame = +1

Query  400   KMRVAVVGAGIS-GLVSAYVLAKGGAGVVVYEKEDYLGGHAK-TVTLDGVDLDLGFMVFN  573
             +MRVAV+G G S GL SAYVLA+ G GVV+YE+E  LGG+A  T+ +DG D+DLG ++FN
Sbjct  4     EMRVAVIGGGTSTGLASAYVLAREGLGVVLYEEEHCLGGNANDTIRVDGADVDLGLILFN  63

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  753
                 PNMME FE LG+DME+SDMS SVSLD+G G EWG+ NGFS LFAQK N+LNP+FW+
Sbjct  64    PAICPNMMEFFEDLGLDMEVSDMSLSVSLDSGGGTEWGTLNGFSSLFAQKSNVLNPFFWK  123

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MIREI KFK+D   Y++E + + D+DR +TLG+F++S GYSELFQKAY++P+C SIWS  
Sbjct  124   MIREIAKFKDDASIYVDERERDRDLDRTETLGQFLRSYGYSELFQKAYLVPICGSIWSRP  183

Query  934   SEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             S+ V +FSA S+LSF RN+HLLQ F    W
Sbjct  184   SDDVSSFSALSVLSFFRNNHLLQIFGRPQW  213



>gb|EYU18296.1| hypothetical protein MIMGU_mgv1a024671mg [Erythranthe guttata]
Length=809

 Score =   745 bits (1924),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 378/667 (57%), Positives = 475/667 (71%), Gaps = 62/667 (9%)
 Frame = +2

Query  1007  SLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISG  1186
             +LQLFG  Q +T K RS +Y + V++ELE RGC I+   EV+SV T+++G     V+I+ 
Sbjct  199   ALQLFGPTQRVTPKLRSQNYADIVKKELELRGCLIKTNSEVYSVLTNDEG----CVVITC  254

Query  1187  KNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLA  1366
             K+  +E YDGCI+A +  + LK+LG +AT DE RILGAFQY  SD++LHR+++ MP+N  
Sbjct  255   KDGSEEVYDGCIIATNTRNALKILGNKATHDESRILGAFQYADSDVFLHRDENLMPKNPT  314

Query  1367  AWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsv  1546
             AWS+ NFLGT+ N+V +TYWLN +QN+ +T  PYL+T+NPP  PE  L KW+T  P+PS+
Sbjct  315   AWSSSNFLGTIENKVYITYWLNAVQNISETGLPYLLTVNPPHKPENTLRKWSTSQPIPSL  374

Query  1547  aasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPL-NNPNHMV  1723
             AAS+A +EL  IQGKRRIWFCGAYQ Y FHEDGL+AG++AA+ LL K+   L  NP  M+
Sbjct  375   AASKALAELNLIQGKRRIWFCGAYQDYFFHEDGLQAGLLAANSLLGKKVFTLRKNPKQMI  434

Query  1724  PSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWK  1903
             PSW E GAR+ V RFL  FIV G +IL E+GGTVFTFEG+ K + LK+ +RVH+PQFYWK
Sbjct  435   PSWTEAGARIFVIRFLRRFIVAGCLILAEDGGTVFTFEGSRKTSDLKISLRVHNPQFYWK  494

Query  1904  VATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFT  2083
             +A + DLGLADAYI GD SFVDK +GL+NL  +F+ N +L+ S S+ N KRGWWTPL+FT
Sbjct  495   LAIEGDLGLADAYIDGDFSFVDKDKGLVNLIMLFIGNIELNDSASKLNKKRGWWTPLVFT  554

Query  2084  SAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLK  2263
             S IAS + F + +S +NTLTQARRNIS+HYDLSNELFSLFLD+TMTYSCA+F+   E+L 
Sbjct  555   SIIASGRNFCKLLSEKNTLTQARRNISKHYDLSNELFSLFLDDTMTYSCALFQDSGEELL  614

Query  2264  TAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDK  2443
             + Q+RK+  LI KAK+ K+HHILEIGCGWGS AIE V+RTGCKYTGITLS +QL+YAE K
Sbjct  615   SGQIRKLDSLIKKAKVDKKHHILEIGCGWGSFAIEVVKRTGCKYTGITLSIEQLQYAEIK  674

Query  2444  VREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGIL  2623
             V+EAGLQ +          + D  +YD          + H F+ E               
Sbjct  675   VKEAGLQTS---------SIVDQ-KYDEF-------RLSHGFIKE---------------  702

Query  2624  VLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHY  2803
                                     YIFPGG LPSLSR+TS MA++SRLCV H EDIG HY
Sbjct  703   ------------------------YIFPGGFLPSLSRITSTMASASRLCVVHAEDIGSHY  738

Query  2804  YQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  2983
             YQTLRCWR NFL  Q +I+ LGFD+KFIRTWEYYF Y AAGF    +G+YQIVF+RPG+V
Sbjct  739   YQTLRCWRENFLRNQRKIMALGFDEKFIRTWEYYFSYTAAGFKMSIMGNYQIVFTRPGDV  798

Query  2984  TAFG-DP  3001
              AFG DP
Sbjct  799   AAFGNDP  805


 Score =   252 bits (644),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 153/207 (74%), Gaps = 3/207 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGG-HAKTVT-LDGVDLDLGFMVFNR  576
             MRVAVVG G SGL+S Y+LAK G  VV+YEKE  LGG HA TVT  DG +LD+G + F  
Sbjct  1     MRVAVVGGGTSGLISGYILAKEGVKVVLYEKETRLGGGHANTVTATDGTELDIGLIGFCN  60

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT PN  EL ESLG++M  +D SFSVSL  G G EWG+RNGFS LFAQKKNLLNPYFW+M
Sbjct  61    VTNPNTTELLESLGIEMGPTDTSFSVSLSGGQGCEWGNRNGFSSLFAQKKNLLNPYFWKM  120

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             +REI KF +D + Y+ E +NN D+DRN+TL  F++SRGYSELFQKA++IP CASIWSCSS
Sbjct  121   VREITKFNDDAIKYIAELENNQDVDRNETLDHFVQSRGYSELFQKAFLIPTCASIWSCSS  180

Query  937   EGVMAFSAYSILSFCRNHHLLQNFSPA  1017
                   +  ++L  C NHH LQ F P 
Sbjct  181   SLKSLSAYSALLFLC-NHHALQLFGPT  206



>ref|XP_004169418.1| PREDICTED: cyclopropane-fatty-acyl-phospholipid synthase-like, 
partial [Cucumis sativus]
Length=577

 Score =   808 bits (2088),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/571 (67%), Positives = 469/571 (82%), Gaps = 2/571 (0%)
 Frame = +2

Query  1316  SDIYLHREQSFMPRNLAAWSAWNFL-GTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1492
             SD++LH ++ FMP+NL AWSA NFL    NN +CLTYW+N +QN    K P+ VT+NP +
Sbjct  3     SDMFLHHDKDFMPQNLNAWSARNFLENNTNNELCLTYWINVIQNNLGEKSPFFVTINPEQ  62

Query  1493  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1672
              P+  L   + GHP+PS++A +AS+EL+ IQGKR+IWFCG+Y G G HEDGLKAG + A 
Sbjct  63    KPKDILFNSSIGHPIPSLSAFKASNELDSIQGKRQIWFCGSYLGSGSHEDGLKAGTMVAQ  122

Query  1673  GLLKKRCSPL-NNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDK  1849
              LL K  + L NNPNHMVPS  ETGAR LVT+F A +I  GS+ ++EEGG +FTF+GTD 
Sbjct  123   KLLGKSFTLLSNNPNHMVPSLIETGARYLVTKFFARYISIGSLTIMEEGGRLFTFKGTDN  182

Query  1850  KNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSA  2029
             K L  V+++VH+P FYWK+ T+AD+GLA+AYI+ D SFVDK EGLLNL +I +ANRD ++
Sbjct  183   KFLPNVVLKVHNPNFYWKIMTRADIGLANAYINADFSFVDKNEGLLNLVQILIANRDANS  242

Query  2030  SVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLD  2209
              V++ N KRGWWTP L+T++IA AKYF +H  RQNT+TQAR NISRHYDLSNELFSLFLD
Sbjct  243   LVAKLNKKRGWWTPPLYTASIAYAKYFFQHTLRQNTITQARTNISRHYDLSNELFSLFLD  302

Query  2210  ETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGC  2389
             +TMTYSCA+FK EDEDL+ AQ+RKIS LI KA+I K HH+LEIGCGWGSLAIE V++TGC
Sbjct  303   DTMTYSCAIFKREDEDLRVAQLRKISHLIKKARIDKNHHVLEIGCGWGSLAIELVKQTGC  362

Query  2390  KYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEF  2569
               T ITLSE+Q KYAEDKV+  GLQDNI+F LCDYRQLP+  +YDRIISC +LE+VGHEF
Sbjct  363   HCTAITLSEEQFKYAEDKVKVLGLQDNIKFHLCDYRQLPNTHKYDRIISCGLLESVGHEF  422

Query  2570  MNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAM  2749
             M +FFG CESVL ENG+LV+QFIS+PD+RYDE+R SSDF++EYIFPGGCLPSL+RVT+AM
Sbjct  423   MEDFFGLCESVLVENGLLVVQFISMPDDRYDEHRLSSDFMREYIFPGGCLPSLNRVTTAM  482

Query  2750  AASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGF  2929
             A +SR CVEHLE+IGIHYYQTL+CWR NF+  + +I++LGFD+ FIRTWEYYFDYCAAGF
Sbjct  483   AKASRFCVEHLENIGIHYYQTLKCWRKNFVMNKRKIIELGFDESFIRTWEYYFDYCAAGF  542

Query  2930  HTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
              + T+GDYQIVFSR GNVT F +PY+G+ SA
Sbjct  543   KSRTIGDYQIVFSRAGNVTTFNNPYQGIPSA  573



>ref|XP_008460675.1| PREDICTED: uncharacterized protein LOC103499444 isoform X2 [Cucumis 
melo]
Length=740

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/563 (69%), Positives = 462/563 (82%), Gaps = 7/563 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTVK RSHSYV KV+E LE  GC+IR   
Sbjct  177   PSEGVLSFSAFSVLSFCRNHHLLQLFGRPQWLTVKGRSHSYVKKVQEVLESHGCQIRTSS  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+S+ST ++G       +S  + +QE +D CI+A HAPDTL+MLG QAT +ELR+LGAF
Sbjct  237   EVNSISTMDKGCK-----VSYGDDLQEIFDACIIATHAPDTLRMLGNQATSEELRVLGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QY YSDI+LHR+++ MP+N AAWSAWNFLG  + +VCLTYWLN LQNLG+T  P+LVTLN
Sbjct  292   QYAYSDIFLHRDKNLMPQNPAAWSAWNFLGNTDKKVCLTYWLNILQNLGETGPPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P + P+  LLKW+TGHP+PSVAAS+AS+E   IQG RRIWFCGAYQGYGFHEDGLKAG++
Sbjct  352   PDKEPKNILLKWSTGHPIPSVAASKASNEFHSIQGNRRIWFCGAYQGYGFHEDGLKAGIV  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA  LL    + L+NP HM PS  +TGARL VTRFL  +I +GS+ L+E+GGT+FTFEGT
Sbjct  412   AAQNLLGNSFTLLSNPKHMAPSLVDTGARLFVTRFLGQYITSGSLTLIEDGGTIFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             DKK L KV V+VHSPQFYWK+ T+ADLGLADAYI+GD SFVDK EGLLN F I +A+RD 
Sbjct  472   DKKCLPKVAVKVHSPQFYWKIMTRADLGLADAYINGDFSFVDKDEGLLNFFLIIIASRDT  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S+++   KRGWWTP LFT+ IASAKYF +H SRQNTLTQARRNISRHYDLSNELFSLF
Sbjct  532   NSSIAKQKKKRGWWTPPLFTACIASAKYFFQHASRQNTLTQARRNISRHYDLSNELFSLF  591

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD+TMTYSCA+FK E+EDLK AQMRKISLLI+KA+I+K HH+LEIGCGWGSLAIE V++T
Sbjct  592   LDDTMTYSCAIFKGENEDLKVAQMRKISLLIEKARINKNHHVLEIGCGWGSLAIEIVKKT  651

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GC YTGITLSE+QLKYAE +V++A LQD IRFLLCDYR+LP   RYDRIISCEM+EAVGH
Sbjct  652   GCHYTGITLSEEQLKYAEKRVKDANLQDRIRFLLCDYRKLPSTERYDRIISCEMIEAVGH  711

Query  2564  EFMNEFFGRCESVLAENGILVLQ  2632
             EFM +FFG CESVLAENG+ VLQ
Sbjct  712   EFMEDFFGSCESVLAENGLFVLQ  734


 Score =   344 bits (882),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 182/207 (88%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAVVG GISGLVSA+VLA+ G  VV++EKEDY+GGH+KTV  DGVDLDLGFMVFN VT
Sbjct  1     MKVAVVGGGISGLVSAFVLAEAGVEVVLFEKEDYVGGHSKTVHFDGVDLDLGFMVFNTVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGV+ME SDMSFSVSLD G G EWGSRNG S LFAQKKNLLNPYFWQMIR
Sbjct  61    YPNMMEFFENLGVEMETSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNLLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV++YLE  +NN D+DRN+TLG+FIKSRGYSELFQ AY+IPMC SIWSC SEG
Sbjct  121   EIVKFKDDVINYLEVIENNSDIDRNETLGQFIKSRGYSELFQNAYLIPMCGSIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             V++FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   VLSFSAFSVLSFCRNHHLLQLFGRPQW  207



>gb|AES60365.2| cyclopropane-fatty-acyl-phospholipid synthase [Medicago truncatula]
Length=825

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/685 (59%), Positives = 503/685 (73%), Gaps = 51/685 (7%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F S +  TF      LQL   PQ   V+  S +++ KV+E+L    C+I+  CEVH VST
Sbjct  190   FSSFSVLTFLSNHHLLQLIYSPQCKIVRWNSQNFIKKVKEKLASENCQIKVNCEVHLVST  249

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              ++G      ++  K+  +E YD CI+A HAPD LK+LG +AT DE RILGAFQYVY D 
Sbjct  250   SDKG-----CVVLCKDGSEEMYDSCIIAVHAPDVLKILGDEATSDECRILGAFQYVYCDT  304

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +L                      +N+ VC+TYW++ LQN+ +T  P  +T+NP +TP+ 
Sbjct  305   FL----------------------LNDSVCVTYWIDILQNVEETSGPSFITVNPNQTPQN  342

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              L KW+TGH VP+VAAS+AS EL  IQGKR+IWF G YQGY +H D LKAGM AA+ +L 
Sbjct  343   TLFKWSTGHLVPTVAASKASHELNHIQGKRKIWFSGVYQGYAYHGDELKAGMDAAYDILG  402

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             + CS   N  ++VPSW E GARL VTRFL+++I TG ++LLE+GGT+FTFEG+ KK  LK
Sbjct  403   RICSLQRNLKYIVPSWTEVGARLFVTRFLSAYITTGCLMLLEDGGTIFTFEGSKKKCSLK  462

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++R+H+PQFYWKV T +DLGLA                      I +ANRD + S S +
Sbjct  463   SVLRIHNPQFYWKVMTNSDLGLAS---------------------ILIANRDFNLSNS-T  500

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
                RGWWTP+ FT+ +ASAK+FI+H+SR+NT+TQARRNIS HYDLSN+LF+ FLDE M Y
Sbjct  501   LKNRGWWTPVFFTAGLASAKFFIKHVSRKNTVTQARRNISMHYDLSNDLFACFLDEKMQY  560

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SC VFK E EDLK AQ RKIS+LI+KA+I ++H IL+IGCGWG  AIE V++ GCKYTGI
Sbjct  561   SCGVFKDEYEDLKDAQKRKISILIEKAQIDRKHEILDIGCGWGGFAIEVVKKVGCKYTGI  620

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLKYAE+KV++AGLQ++I FLLC+YRQL    +YDRI+SCEM+EAVGHE+M EFF
Sbjct  621   TLSEEQLKYAENKVKDAGLQEHITFLLCEYRQLSKTKKYDRIVSCEMIEAVGHEYMEEFF  680

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G C+SVLA++G+LVLQF SIPDERYD YR+SS+FIKEYIFPG C+PSLSRVT AMAA+SR
Sbjct  681   GCCDSVLADDGLLVLQFTSIPDERYDAYRRSSEFIKEYIFPGCCIPSLSRVTLAMAAASR  740

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LCVEH E+IGIHYY TLR WR NF+E  S+IL LGFD+KFIR WEYYFDYCAAGF + TL
Sbjct  741   LCVEHAENIGIHYYPTLRWWRKNFMENHSKILALGFDEKFIRIWEYYFDYCAAGFKSRTL  800

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLAS  3019
             G+YQ+VFSRPGN TAF +  K +AS
Sbjct  801   GNYQMVFSRPGNKTAFSNLDKKMAS  825


 Score =   267 bits (683),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 167/212 (79%), Gaps = 9/212 (4%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGG---HAKTVTLDGVDLD-LGFMVF  570
             MRVAVVGAGISGLVSAYVLAK G  VV+YEKED+LG    H  T      D D +GFM+ 
Sbjct  1     MRVAVVGAGISGLVSAYVLAKAGVNVVLYEKEDHLGEEGIHGNTQQY-AFDFDHMGFMLL  59

Query  571   NRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFW  750
             N V YPN+MELF+SL VD ++S +S SVSLDNG GYEWG++NG S LFAQKKN++NPYFW
Sbjct  60    NPVNYPNIMELFDSLEVDKKLSYLSTSVSLDNGKGYEWGTQNGLSSLFAQKKNVINPYFW  119

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASI--W  924
             +MI+E+ KFK DVLSYL+  + N D++ N+T+  FIKSRGYSELFQKAY+IP+C SI  W
Sbjct  120   KMIKEVSKFKEDVLSYLDIVETNQDIEHNETMEHFIKSRGYSELFQKAYLIPLCCSIWPW  179

Query  925   SCSS-EGVMAFSAYSILSFCRNHHLLQ-NFSP  1014
              CSS EGVM+FS++S+L+F  NHHLLQ  +SP
Sbjct  180   PCSSPEGVMSFSSFSVLTFLSNHHLLQLIYSP  211



>ref|XP_001769171.1| predicted protein [Physcomitrella patens]
 gb|EDQ66043.1| predicted protein [Physcomitrella patens]
Length=864

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/686 (58%), Positives = 496/686 (72%), Gaps = 7/686 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  TFC+    LQLF RPQWLTVK RS +YV K+   LE  G +IR  CEV  +S+
Sbjct  184   FSAASILTFCKNHHLLQLFQRPQWLTVKGRSETYVAKMVAGLEAAGADIRTSCEVKRISS  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
                  AGGV I   +  V E +D C++ +HAPD L+MLG+ AT +E  ILGAFQY  S I
Sbjct  244   ----IAGGVEIEDARGGV-EVFDRCLVGSHAPDALQMLGEGATHEERTILGAFQYSPSTI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             YLHR+  +MPRN AAWSAWNFLG  + +VC++YWLN LQNLG+T +PYLVTLNP   P  
Sbjct  299   YLHRDDKWMPRNQAAWSAWNFLGDSSGQVCVSYWLNILQNLGNTGKPYLVTLNPTEEPRH  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              +  W T HP+PS  A++A+     IQGKR IWFCGAYQGYGFHEDGLK+G+ AA  LL 
Sbjct  359   IVNVWRTSHPIPSPGAAKAAKAFGSIQGKRGIWFCGAYQGYGFHEDGLKSGLEAAFDLLG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
              +  PL     MVP++ E+  RL+VT FL  FI TG + L E GGTVF F G +K   LK
Sbjct  419   TQFKPLPLVKQMVPTYLESATRLVVTSFLRKFIRTGHVQLFEAGGTVFNFFGEEKGCTLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
               +RV  P FYWK+AT+ DLGLADAYI GD SFVD KEGLLN   I +ANRD+    S  
Sbjct  479   TSLRVSDPAFYWKIATRQDLGLADAYIDGDFSFVDPKEGLLNFLLIIIANRDIDRLFSSK  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             +S   WW+P+L TS + SA  + RH+ R N+LT  RRNIS+HYDLSN++FSLFLDETMTY
Sbjct  539   SSVNPWWSPVLLTSVLGSATSYFRHMMRNNSLTNTRRNISQHYDLSNDMFSLFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FK  DE L  AQMRKI+ LIDKA++   H +LEIGCGWG+LAI+ V R+GC+YTGI
Sbjct  599   SCAIFKGPDEPLVDAQMRKINHLIDKARVESTHEVLEIGCGWGALAIQLVRRSGCRYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLS++QL YA+  V+EA L+D I F L DYR +    +++RIISCEMLEAVGHE+  E+F
Sbjct  659   TLSQEQLDYAQALVKEARLEDKITFQLVDYRNVQGFHKFNRIISCEMLEAVGHEYYAEWF  718

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
              RC+++LA++G++V+Q ISIP+ERYD YRQSSDFIKEYIFPGGCLPS + +T+AM++ S 
Sbjct  719   RRCDTLLAKDGLVVVQVISIPEERYDGYRQSSDFIKEYIFPGGCLPSFAALTTAMSSGSS  778

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
              CVEH+E+IGIHY +TL  W+  F   +++I+ LGF +KFIRTW+YYF YCAAGF +CTL
Sbjct  779   FCVEHMENIGIHYCETLLRWQEQFTRNRNKIMKLGFGEKFIRTWDYYFFYCAAGFKSCTL  838

Query  2945  GDYQIVFSRPGNVTAFGDPYKGLASA  3022
             G  QIVFSRPGN    G PY    +A
Sbjct  839   GVLQIVFSRPGNEAFLGCPYVSFPTA  864


 Score =   248 bits (632),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/208 (57%), Positives = 153/208 (74%), Gaps = 2/208 (1%)
 Frame = +1

Query  439   LVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVTYPNMMELFESLG  618
             L +A+ LA  G  V +YEKEDY+GGHA+T+   G+ LD GFMVFNRVTYPNM++ FE  G
Sbjct  13    LTAAHTLASAGIQVTLYEKEDYVGGHARTIHDVGIGLDTGFMVFNRVTYPNMIDFFEQAG  72

Query  619   VDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSY  798
             V+ME SDMSFSVSL+ G G EWGS     GLFAQK+N++NP+F+QMIREI++FK+DVLSY
Sbjct  73    VEMEESDMSFSVSLNGGKGCEWGS-TSLGGLFAQKRNMINPFFFQMIREIVRFKDDVLSY  131

Query  799   LEEFDNNPDMDRND-TLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMAFSAYSILS  975
             LE+ ++  +  R D TLGEF+ S  YS  F++ Y++P+C SIWSCSS+ V+ FSA SIL+
Sbjct  132   LEKIESGDESIRQDETLGEFLASHKYSNKFRECYLVPVCGSIWSCSSDVVLGFSAASILT  191

Query  976   FCRNHHLLQNFSPALWSPTMAHCEAEVS  1059
             FC+NHHLLQ F    W       E  V+
Sbjct  192   FCKNHHLLQLFQRPQWLTVKGRSETYVA  219



>ref|XP_002964119.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
 ref|XP_002992048.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ06897.1| hypothetical protein SELMODRAFT_186510 [Selaginella moellendorffii]
 gb|EFJ34452.1| hypothetical protein SELMODRAFT_166747 [Selaginella moellendorffii]
Length=864

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/689 (58%), Positives = 506/689 (73%), Gaps = 15/689 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  TFCR    LQ+FGRPQWLTVK RS  YV K+  EL K GCE+R GC V  +S+
Sbjct  186   FSAASILTFCRNHHLLQIFGRPQWLTVKDRSIKYVEKIVAELTKMGCELRLGCAVSRISS  245

Query  1145  DEQGSAGGVVII--SGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYS  1318
              E    GGV +I  SG+ +V   YD C++AAHAPD L +LG+ ATFDE R+LGAFQY YS
Sbjct  246   TE----GGVKLILESGEKVV---YDTCLVAAHAPDALTLLGETATFDERRLLGAFQYSYS  298

Query  1319  DIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTK-QPYLVTLNPPRT  1495
             DIYLHR+++ MP++ AAWSAWNFLG+V  RVC+TYWLN LQNLGDT+ +PYLVTLNPPR 
Sbjct  299   DIYLHRDRALMPKSTAAWSAWNFLGSVQGRVCVTYWLNLLQNLGDTEGKPYLVTLNPPRP  358

Query  1496  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1675
             P+  + KW TGHPVPS  A+ A  EL+ IQG R+IWF GAYQGYGFHEDGLKAGM AA+ 
Sbjct  359   PKNLISKWRTGHPVPSPGAATALKELDTIQGARKIWFAGAYQGYGFHEDGLKAGMAAANS  418

Query  1676  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1855
             LL  +   L+N   +  +W ++ AR  VT+FL  +IV G +  +E GGT+  F G D   
Sbjct  419   LLGAKYQALSNVKQLNFTWCQSQARREVTKFLQKYIVFGKLQFIEAGGTILDFVGKDCD-  477

Query  1856  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2035
              L   +R+H P FYWK+AT++DLGLA+AY+ GD + +D + GLLNL  I + NRD     
Sbjct  478   -LTSKLRIHHPDFYWKIATRSDLGLAEAYMDGDFTCIDSQNGLLNLLLIIIKNRDWMLK-  535

Query  2036  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2215
             S  + KRGWWTP + T+A  SA  +++H  R N++  AR+NIS HYDLSNE+FSLFLDET
Sbjct  536   SLKDEKRGWWTPPILTAAFGSAVAYLKHKLRNNSIVNARKNISEHYDLSNEMFSLFLDET  595

Query  2216  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2395
             MTYSCA+FK  +E LK AQ+RKI  LIDKA+I   H +LEIG GWGS+A+E V RTGCKY
Sbjct  596   MTYSCAIFKGPEEPLKDAQLRKIHHLIDKARIDNSHEVLEIGFGWGSMAVEVVRRTGCKY  655

Query  2396  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2575
             TGI+LSE+QL +A+  V +  L+D I   LCDYR L    +Y+RIISCEM+EAVG E+ +
Sbjct  656   TGISLSEEQLAFAKQLVTQERLEDKITLKLCDYRCLEGCKKYNRIISCEMMEAVGPEYYD  715

Query  2576  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2755
             EFF +C+ +LAE+G+ V+Q I++P+ERYDE R+SS+FIKEYIFPGG LP L+ +T+AM  
Sbjct  716   EFFAKCDYLLAEDGLAVIQVITVPEERYDELRRSSEFIKEYIFPGGSLPCLAALTAAMFR  775

Query  2756  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2935
             +S LCVEHLE+IG+HYYQTL CWR NF  + S+I  LGF + F+R W+YYF YCAAGF T
Sbjct  776   ASSLCVEHLENIGLHYYQTLMCWRRNFNSKTSEIAKLGFSESFMRKWDYYFIYCAAGFLT  835

Query  2936  CTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             CTLG+ QIVFSR GN  A G+PY+   +A
Sbjct  836   CTLGNLQIVFSRSGNAAALGNPYRSFPTA  864


 Score =   273 bits (698),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 172/230 (75%), Gaps = 7/230 (3%)
 Frame = +1

Query  406   RVAVVGAGISGLVSAYVLAKGGAG-VVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             R+AV+GAG+SGLV+AY L K G   VV+YEKE+Y GGHA+T   +G+ +DLGFMVFN+VT
Sbjct  3     RIAVIGAGVSGLVAAYTLCKAGCHEVVLYEKENYFGGHARTEDANGIAVDLGFMVFNQVT  62

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM+ LF+ LGVDME SDMSFSVSLD G G EWGS  G + +FAQK NL+NPYF +MIR
Sbjct  63    YPNMVSLFDELGVDMETSDMSFSVSLDGGKGCEWGS-TGLAAVFAQKSNLVNPYFLRMIR  121

Query  763   EILKFKNDVLSYLEEFDNNPD-MDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             EI+KF++DVL+YL + +   D +D N TLG F++  GYSE F+  Y+IP+CASIWSCSSE
Sbjct  122   EIVKFQDDVLNYLNKLEQGDDAVDPNQTLGSFLQLHGYSEKFRDCYLIPVCASIWSCSSE  181

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALW----SPTMAHCEAEVS*LCKQG  1077
              V+ FSA SIL+FCRNHHLLQ F    W      ++ + E  V+ L K G
Sbjct  182   QVLGFSAASILTFCRNHHLLQIFGRPQWLTVKDRSIKYVEKIVAELTKMG  231



>ref|XP_003590114.1| Cyclopropane fatty acid synthase [Medicago truncatula]
Length=793

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/695 (58%), Positives = 502/695 (72%), Gaps = 61/695 (9%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F S +  TF      LQL   PQ   V+  S +++ KV+E+L    C+I+  CEVH VST
Sbjct  148   FSSFSVLTFLSNHHLLQLIYSPQCKIVRWNSQNFIKKVKEKLASENCQIKVNCEVHLVST  207

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              ++G      ++  K+  +E YD CI+A HAPD LK+LG +AT DE RILGAFQYVY D 
Sbjct  208   SDKG-----CVVLCKDGSEEMYDSCIIAVHAPDVLKILGDEATSDECRILGAFQYVYCDT  262

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +L                      +N+ VC+TYW++ LQN+ +T  P  +T+NP +TP+ 
Sbjct  263   FL----------------------LNDSVCVTYWIDILQNVEETSGPSFITVNPNQTPQN  300

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              L KW+TGH VP+VAAS+AS EL  IQGKR+IWF G YQGY +H D LKAGM AA+ +L 
Sbjct  301   TLFKWSTGHLVPTVAASKASHELNHIQGKRKIWFSGVYQGYAYHGDELKAGMDAAYDILG  360

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             + CS   N  ++VPSW E GARL VTRFL+++I TG ++LLE+GGT+FTFEG+ KK  LK
Sbjct  361   RICSLQRNLKYIVPSWTEVGARLFVTRFLSAYITTGCLMLLEDGGTIFTFEGSKKKCSLK  420

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++R+H+PQFYWKV T +DLGLA                      I +ANRD + S S +
Sbjct  421   SVLRIHNPQFYWKVMTNSDLGLAS---------------------ILIANRDFNLSNS-T  458

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
                RGWWTP+ FT+ +ASAK+FI+H+SR+NT+TQARRNIS HYDLSN+LF+ FLDE M Y
Sbjct  459   LKNRGWWTPVFFTAGLASAKFFIKHVSRKNTVTQARRNISMHYDLSNDLFACFLDEKMQY  518

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SC VFK E EDLK AQ RKIS+LI+KA+I ++H IL+IGCGWG  AIE V++ GCKYTGI
Sbjct  519   SCGVFKDEYEDLKDAQKRKISILIEKAQIDRKHEILDIGCGWGGFAIEVVKKVGCKYTGI  578

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLKYAE+KV++AGLQ++I FLLC+YRQL    +YDRI+SCEM+EAVGHE+M EFF
Sbjct  579   TLSEEQLKYAENKVKDAGLQEHITFLLCEYRQLSKTKKYDRIVSCEMIEAVGHEYMEEFF  638

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G C+SVLA++G+LVLQF SIPDERYD YR+SS+FIKEYIFPG C+PSLSRVT AMAA+SR
Sbjct  639   GCCDSVLADDGLLVLQFTSIPDERYDAYRRSSEFIKEYIFPGCCIPSLSRVTLAMAAASR  698

Query  2765  LC----------VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2914
             L           VEH E+IGIHYY TLR WR NF+E  S+IL LGFD+KFIR WEYYFDY
Sbjct  699   LWYMLYFNTANNVEHAENIGIHYYPTLRWWRKNFMENHSKILALGFDEKFIRIWEYYFDY  758

Query  2915  CAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLAS  3019
             CAAGF + TLG+YQ+VFSRPGN TAF +  K +AS
Sbjct  759   CAAGFKSRTLGNYQMVFSRPGNKTAFSNLDKKMAS  793


 Score =   208 bits (529),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 125/154 (81%), Gaps = 3/154 (2%)
 Frame = +1

Query  550   DLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKN  729
              +  ++  +V YPN+MELF+SL VD ++S +S SVSLDNG GYEWG++NG S LFAQKKN
Sbjct  11    QIKLLITKQVNYPNIMELFDSLEVDKKLSYLSTSVSLDNGKGYEWGTQNGLSSLFAQKKN  70

Query  730   LLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPM  909
             ++NPYFW+MI+E+ KFK DVLSYL+  + N D++ N+T+  FIKSRGYSELFQKAY+IP+
Sbjct  71    VINPYFWKMIKEVSKFKEDVLSYLDIVETNQDIEHNETMEHFIKSRGYSELFQKAYLIPL  130

Query  910   CASI--WSCSS-EGVMAFSAYSILSFCRNHHLLQ  1002
             C SI  W CSS EGVM+FS++S+L+F  NHHLLQ
Sbjct  131   CCSIWPWPCSSPEGVMSFSSFSVLTFLSNHHLLQ  164



>ref|XP_006350427.1| PREDICTED: uncharacterized protein LOC102587606 [Solanum tuberosum]
Length=513

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/507 (74%), Positives = 434/507 (86%), Gaps = 0/507 (0%)
 Frame = +2

Query  1436  LQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGA  1615
             LQNLGD++ PYLVT +PP TPE  L+KW T H VPSVAAS+AS EL +IQGKR IWFCGA
Sbjct  6     LQNLGDSELPYLVTFDPPHTPEHTLVKWRTSHSVPSVAASKASRELHQIQGKRGIWFCGA  65

Query  1616  YQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGS  1795
             YQGYGFH +GLKAG++AA  +L++ CS  +NP HMVP+WPETGARL+V RF  SFI TG 
Sbjct  66    YQGYGFHANGLKAGVVAADSMLRRSCSIRDNPKHMVPTWPETGARLVVARFFKSFIQTGC  125

Query  1796  IILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKK  1975
             IILLEEGGT+FTF+GT++K  LKV +RVHS QFYWKV+TQAD+GLADA+I GD SFVDK 
Sbjct  126   IILLEEGGTIFTFQGTERKCSLKVSLRVHSTQFYWKVSTQADIGLADAFIQGDFSFVDKN  185

Query  1976  EGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARR  2155
             EGLLNL  IF+ANRDL ASV  S  +R WWTPLL T+A++SAKYFIRH+S +NTLTQARR
Sbjct  186   EGLLNLIMIFIANRDLKASVRTSRKERAWWTPLLLTAALSSAKYFIRHVSNRNTLTQARR  245

Query  2156  NISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILE  2335
             NIS HYDLSNELFSLFLDETMTYSCA+FKSEDEDLK AQ+RKI LLI KAKISKEHHILE
Sbjct  246   NISCHYDLSNELFSLFLDETMTYSCAIFKSEDEDLKDAQLRKIFLLIRKAKISKEHHILE  305

Query  2336  IGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNC  2515
             IG GWGS A+E V++TGCKYTGITLSEQQL+YA+ KV +AGLQD I  LLCDYRQ+P+  
Sbjct  306   IGFGWGSFAVEVVKQTGCKYTGITLSEQQLEYAQLKVEQAGLQDQITLLLCDYRQIPNKD  365

Query  2516  RYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKE  2695
             +YDRIISCEMLE +GH+F+ +FF  CES LAE+G+LVLQFISIPDERYD +R S+DF++E
Sbjct  366   KYDRIISCEMLEHIGHDFIGKFFTCCESSLAEDGLLVLQFISIPDERYDSHRHSTDFMRE  425

Query  2696  YIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFD  2875
             YIFPGG L + S+VTS MAA+SRLCVEHLE+IGIHYYQTL+CWR NF + QSQI  LGFD
Sbjct  426   YIFPGGGLNAPSQVTSVMAAASRLCVEHLENIGIHYYQTLKCWRRNFFKNQSQIRALGFD  485

Query  2876  KKFIRTWEYYFDYCAAGFHTCTLGDYQ  2956
              KFIRTWEYYFDYCAAG  TCT+GDYQ
Sbjct  486   DKFIRTWEYYFDYCAAGLKTCTIGDYQ  512



>gb|ABG37642.1| cyclopropane fatty acid synthase [Populus trichocarpa]
Length=1664

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/568 (70%), Positives = 467/568 (82%), Gaps = 24/568 (4%)
 Frame = +2

Query  1316  SDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRT  1495
             S+I+LHR++++MP+N AAWSAWNFLG+  N+VCLTYWLN LQN+ +T  P+LVTLNP   
Sbjct  234   SEIFLHRDKTYMPQNSAAWSAWNFLGSTENKVCLTYWLNVLQNIDETGLPFLVTLNPDNA  293

Query  1496  PEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHG  1675
             P+  LLKW+TG PVPSVAA++AS EL+ IQGKRRIWF GAYQGYGF+EDGLK+GM+AAHG
Sbjct  294   PDHTLLKWSTGRPVPSVAATKASLELDHIQGKRRIWFGGAYQGYGFYEDGLKSGMVAAHG  353

Query  1676  LLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKN  1855
             LL K C  L NP HMVPS  ETGARL VTRFL   I TG + LLE+GGTVF+FEGT KK 
Sbjct  354   LLGKSCDILRNPKHMVPSMLETGARLFVTRFLGHHISTGCLTLLEDGGTVFSFEGTSKKC  413

Query  1856  LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASV  2035
              LK +++VH+PQFYWK+ TQADLGLADAYI+GD SFVDK EGL+NLF I + NRD   S 
Sbjct  414   SLKTVLKVHNPQFYWKIMTQADLGLADAYINGDFSFVDKDEGLINLFMILIVNRDADNST  473

Query  2036  SRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDET  2215
             S+ N KRGWWTPLLFT+ IASAK+FI+H+SRQNTLTQARRNISRHYDL            
Sbjct  474   SKLNKKRGWWTPLLFTAGIASAKFFIQHVSRQNTLTQARRNISRHYDL------------  521

Query  2216  MTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKY  2395
                       EDEDLK AQ+RKISLLI+KA+++K+H +LEIGCGWG+LAIE V+RTGCKY
Sbjct  522   ---------KEDEDLKAAQIRKISLLIEKARVNKDHEVLEIGCGWGTLAIEVVQRTGCKY  572

Query  2396  TGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMN  2575
             TGITLSE+QLKYAE KV+EAGLQD+I+F LCDYRQLP   +YD IISCEM+EAVGHE+M 
Sbjct  573   TGITLSEEQLKYAELKVKEAGLQDSIKFHLCDYRQLPKTHKYDTIISCEMIEAVGHEYME  632

Query  2576  EFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAA  2755
             EFFG CESVLAENG+ VLQFISIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAMA+
Sbjct  633   EFFGCCESVLAENGLFVLQFISIPEERYDEYRKSSDFIKEYIFPGGCLPSLTRITSAMAS  692

Query  2756  SSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHT  2935
             SSRLCVEH+E+IGI YYQTLR WR NFLE Q +IL LGF++KFIRTWEYYFDYCAAGF T
Sbjct  693   SSRLCVEHVENIGIQYYQTLRYWRKNFLENQREILSLGFNEKFIRTWEYYFDYCAAGFKT  752

Query  2936  CTLGDYQIVF-SRPGNVTAFGDPYKGLA  3016
              TLG+YQ++   RPG  T   DP   +A
Sbjct  753   HTLGNYQLLNPDRPGGSTR--DPVDPVA  778


 Score =   492 bits (1266),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 264/494 (53%), Positives = 319/494 (65%), Gaps = 83/494 (17%)
 Frame = +2

Query  1646  LKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTV  1825
             L A M AA+    + C+ L +   M PS  E  ARL VT+FL   I T  +IL EEGG  
Sbjct  872   LVASMAAANCSSGETCAALIHGKQMAPSRLEAWARLFVTKFLGRHISTHRLILEEEGGAT  931

Query  1826  FTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLF---  1996
             FTFEGT KK  L+V+++VH+PQFYWKV T+AD+GLADAYI GD SF DK +GLL+L    
Sbjct  932   FTFEGTSKKCSLEVVLKVHNPQFYWKVTTRADIGLADAYIDGDFSFADKDQGLLHLIMRC  991

Query  1997  -KIFVANR-----DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRN  2158
              +I++        D ++  S            L        +Y  +H+ RQNTLTQARRN
Sbjct  992   KQIYLPGEEEKVCDFASFYSFDPIGPSNIHLWLSIGVGGHHRYLQQHVLRQNTLTQARRN  1051

Query  2159  ISRHYDL-----------------------------------------------SNELFS  2197
             ISRHYDL                                               SNE+FS
Sbjct  1052  ISRHYDLVWDHSLLILLFNNVHAVGQIDCVEIVWKCMYIASAMFRILMLVKDLSSNEVFS  1111

Query  2198  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2377
             LFL ETM YS A+FK+EDEDL TAQ+RKIS+LI+KA+I K+H IL+IGCGWG+ AIE V+
Sbjct  1112  LFLGETMAYSSAIFKTEDEDLNTAQLRKISVLIEKARIDKKHEILDIGCGWGTFAIEVVK  1171

Query  2378  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2557
             +TGCKYTG+TLS +QLKYAE KV+EAGLQDNIR LLCDYR+LP   +YDRI+SCEM+E V
Sbjct  1172  QTGCKYTGLTLSVEQLKYAEMKVKEAGLQDNIRLLLCDYRELPKGYKYDRIVSCEMIEHV  1231

Query  2558  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2737
             GHE+M +FF  CES LAE+G+LVLQFISI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+
Sbjct  1232  GHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYRRSSDFIKEYIFPGGCLPSLSRI  1291

Query  2738  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2917
             TSAM  +SRLC                           +IL +GFD+KFIRTWEYYFDY 
Sbjct  1292  TSAMGVASRLC---------------------------KILAMGFDEKFIRTWEYYFDYS  1324

Query  2918  AAGFHTCTLGDYQI  2959
             +AGF + TLGDYQ+
Sbjct  1325  SAGFKSYTLGDYQL  1338


 Score =   343 bits (880),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 167/226 (74%), Positives = 186/226 (82%), Gaps = 23/226 (10%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV-  579
             MRVAVVGAGISGLVSAYVLAK GA VV+YEKED LGGHAKTV  DGVDLDLGFMVFNRV 
Sbjct  1     MRVAVVGAGISGLVSAYVLAKAGAEVVLYEKEDSLGGHAKTVCFDGVDLDLGFMVFNRVV  60

Query  580   ----------------------TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSR  693
                                   TYPNMME FE+LG+DME+SDMSFSVSLD G G EWGSR
Sbjct  61    GFVTNLRVGLIDLEGYWDHEQVTYPNMMEFFENLGIDMELSDMSFSVSLDQGKGCEWGSR  120

Query  694   NGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGY  873
             NGFSGLFAQKKN LNPYFW+M+REI+KFK+DVLSYLE  +NNP +DRN+TLG+F+KSRGY
Sbjct  121   NGFSGLFAQKKNALNPYFWKMLREIVKFKDDVLSYLEVLENNPVVDRNETLGQFVKSRGY  180

Query  874   SELFQKAYIIPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQNFS  1011
             SELFQKAY++P+C SIWSC SEGVM FSA+S+LSFCRNHHLLQ F+
Sbjct  181   SELFQKAYLVPVCGSIWSCPSEGVMNFSAFSVLSFCRNHHLLQIFN  226


 Score =   297 bits (761),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/239 (61%), Positives = 176/239 (74%), Gaps = 28/239 (12%)
 Frame = +2

Query  2243  SEDEDLKTAQMRKISLLI-DKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQ  2419
             +E+  L   + R ++  I   A+I K+H ILEIGCGWG+ AIE V++TGCKYTG+TLS +
Sbjct  1413  AEEGKLGDERYRLVAFTIFGLARIDKKHEILEIGCGWGTFAIEVVKQTGCKYTGLTLSVE  1472

Query  2420  QLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCES  2599
             QLKYAE KV+EAGLQDNIR LLCDYR+LP+  +YDRI+SCEM+E VGHE+M +FF  CES
Sbjct  1473  QLKYAEMKVKEAGLQDNIRLLLCDYRELPEGYKYDRIVSCEMIEHVGHEYMEDFFSSCES  1532

Query  2600  VLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  2779
              LAE+G+LVLQ  SI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLC   
Sbjct  1533  ALAEDGLLVLQSTSIADERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMGVASRLC---  1589

Query  2780  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  2956
                                     +IL +GFD+KFIRTWEYYFDY AAGF +  LG+YQ
Sbjct  1590  ------------------------KILAMGFDEKFIRTWEYYFDYSAAGFKSYALGNYQ  1624



>dbj|BAC83502.1| putative cyclopropane synthase [Oryza sativa Japonica Group]
 dbj|BAC83939.1| putative cyclopropane synthase [Oryza sativa Japonica Group]
Length=798

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/709 (60%), Positives = 512/709 (72%), Gaps = 62/709 (9%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +    +FCR    LQLFGRPQWLTVK RSH+YVN+VREELE  GC+I+ GC
Sbjct  134   PSQGVLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHTYVNRVREELESLGCQIKTGC  193

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV SVS  E G  G  V+ +G    +EAYD  I A HAPD L +LG +AT DE RILGAF
Sbjct  194   EVQSVSALEGG--GYRVVEAGG--TEEAYDSIIFAVHAPDALNILGDEATHDERRILGAF  249

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNL----GDTKQPYL  1471
             QYVYSDIYLH ++S MPRN +AWS+WNFLGT    VC+TYWLN LQN+    G  ++P+L
Sbjct  250   QYVYSDIYLHCDKSLMPRNPSAWSSWNFLGTTTTGVCVTYWLNLLQNIEQSAGRGRRPFL  309

Query  1472  VTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLK  1651
             VTLNPPR P+  LL W T HPVPSVAA+ A+ EL R+QG R +WFCGAYQGYGFHEDGLK
Sbjct  310   VTLNPPRVPDHVLLAWKTSHPVPSVAAAAAAGELRRVQGCRGLWFCGAYQGYGFHEDGLK  369

Query  1652  AGMIAAH--------GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILL  1807
             AGM AA         G  ++R   L NP  MVPSW E GARLLVTRFLA ++  G++ LL
Sbjct  370   AGMAAARGLLLAANGGAGERRL--LANPRQMVPSWTEAGARLLVTRFLAGYVSVGNLTLL  427

Query  1808  EEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLL  1987
             EEGGT+F+F    KK   K ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDKK+GLL
Sbjct  428   EEGGTMFSFGEAGKKCQAKCVMRVHDPLFYWKVATEADLGLADAYINGYCSFVDKKQGLL  487

Query  1988  NLFKIFVANRDLSASVSRSNSK-RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNIS  2164
             NL  I +ANRD +   S S S+ RGWWTP+L T+ +ASAKYF+RH+SR+NT+TQ R+NIS
Sbjct  488   NLLLILIANRDANKQSSTSTSRIRGWWTPMLLTAGVASAKYFLRHVSRKNTVTQTRQNIS  547

Query  2165  RHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGC  2344
             +HYDLSN+ FSLFLD +MTYSCAVFK EDE L+ AQ RK+SLLI KA++ ++HH+LEIG 
Sbjct  548   QHYDLSNDFFSLFLDPSMTYSCAVFKDEDESLEAAQQRKVSLLIHKARVERDHHVLEIGS  607

Query  2345  GWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYD  2524
             GWGSLAI+ V++TGCKYTG+TLSE+QLKY + KV+EAGL+D++ FLLCDYRQ+P   +YD
Sbjct  608   GWGSLAIQVVKQTGCKYTGVTLSEEQLKYCQRKVKEAGLEDHMTFLLCDYRQIPTVRKYD  667

Query  2525  RIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIF  2704
             RIISCEM+E VGHE+M++FFG CES+LA++G+ VLQFISIP+ER                
Sbjct  668   RIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEER----------------  711

Query  2705  PGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKF  2884
                                   +EHLE+IG HYY TL  WR NF+  + +I  LGFD KF
Sbjct  712   ----------------------IEHLENIGYHYYPTLIRWRDNFMANREEIKSLGFDDKF  749

Query  2885  IRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  3022
             IR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  750   IRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  798


 Score =   223 bits (569),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 125/154 (81%), Gaps = 4/154 (3%)
 Frame = +1

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVS--LDNG--HGYEWGSRNGFSGLFAQKKNLLNP  741
             +VTYPNMME FE LGV+ME+SDMSFSVS  L +G     EWGSRNG +GL AQK N ++P
Sbjct  11    QVTYPNMMEWFEELGVEMELSDMSFSVSAQLQDGDEQTMEWGSRNGLAGLLAQKTNAVSP  70

Query  742   YFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASI  921
              FW+MIREILKFK+DVL+YLEE D NPD+DRN+TLG F++S GYS LFQ+AY++P+CA I
Sbjct  71    AFWRMIREILKFKDDVLTYLEEHDKNPDLDRNETLGHFVQSHGYSRLFQQAYLVPICACI  130

Query  922   WSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             WSC S+GV+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  131   WSCPSQGVLGFSAFFVLSFCRNHHLLQLFGRPQW  164



>gb|EEC78767.1| hypothetical protein OsI_18995 [Oryza sativa Indica Group]
Length=1429

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/680 (61%), Positives = 516/680 (76%), Gaps = 18/680 (3%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +F R    LQLF R Q L V  RS SY NKVRE+LE R C I+  C
Sbjct  760   PSQRVLGFSASSVLSFFRKHNLLQLFSRTQPLIVNGRSQSYFNKVREDLESRSCRIKTNC  819

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
              V S+S+ ++G    V+ + G    +E YD  I+  HAPD LK+LG +AT +E RILGAF
Sbjct  820   HVKSISSFDRGYR--VLEVDGS---EEMYDRIIVGIHAPDALKLLGAEATHEESRILGAF  874

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYV S++YLH ++SFMP N + WSA N   T +  VC+TYWLN LQN+  T+  +LVTLN
Sbjct  875   QYVSSNLYLHCDESFMPCNSSTWSACNITRTRSGSVCVTYWLNLLQNIESTRT-FLVTLN  933

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   P+  LLKW T H VP+VAAS+AS EL++IQGKR         G GFHEDG +AG  
Sbjct  934   PSYVPDHVLLKWNTNHFVPTVAASKASLELDQIQGKR---------GSGFHEDGFQAGKA  984

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA  LL  +  PL NP  MV SW ETGARLLV RFL  +I  G++IL EEGGT+F+F   
Sbjct  985   AAQSLLGNKIDPLTNPKQMVLSWTETGARLLVLRFLKQYISVGNLILFEEGGTMFSFGEA  1044

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              +K   K ++RV  P FYW+VAT+ADLGLADAYI+G  SFV+K+EGLLNLF I +A+RD 
Sbjct  1045  CEKCNKKSVLRVQDPLFYWQVATEADLGLADAYINGCFSFVNKREGLLNLFLILIASRDA  1104

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
               S  R++S+RGWWTPLLFT+ +ASAKYF+RHISR+N++TQ R+N+S+HYDLSN+ FSLF
Sbjct  1105  HRSSCRNSSRRGWWTPLLFTAGVASAKYFLRHISRKNSVTQTRQNVSQHYDLSNDFFSLF  1164

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LD++MTYS A+FK E+E L+ AQ+RKI+LLI KAK+ ++  +LEIG GWGSLA+E V++T
Sbjct  1165  LDKSMTYSSAIFKDEEESLEEAQLRKINLLIHKAKVGQDDEVLEIGSGWGSLAMEVVKQT  1224

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGH  2563
             GCKYTG+T S +QLKYA+ +V+EAGL+D I FLLCDYR++P + +YDRII CEM+E VGH
Sbjct  1225  GCKYTGVTQSVEQLKYAQRRVKEAGLEDRITFLLCDYREIPCH-KYDRIICCEMIEEVGH  1283

Query  2564  EFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTS  2743
             E+M+EFFG CES+LAENGI V QF SIP+ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TS
Sbjct  1284  EYMDEFFGCCESLLAENGIFVTQFTSIPEERYDEYRRSSDFIKEYIFPGGCLPSLTRITS  1343

Query  2744  AMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAA  2923
             AM+A+SRLC+EH+E+IG HYY TL  WR NF+  + +IL LGFD+KFIRTWEYYF YCAA
Sbjct  1344  AMSAASRLCIEHVENIGYHYYTTLIRWRDNFMANKDKILALGFDEKFIRTWEYYFIYCAA  1403

Query  2924  GFHTCTLGDYQIVFSRPGNV  2983
             GF + TLGDYQIVFSRPGN 
Sbjct  1404  GFKSRTLGDYQIVFSRPGNT  1423


 Score =   222 bits (566),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 113/226 (50%), Positives = 151/226 (67%), Gaps = 56/226 (25%)
 Frame = +2

Query  2129  QNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAK  2308
             +N++TQ R+N+S+HYDLSN+ FSLFLD++MTYS A+FK E+E L+ AQ+RKI+LLI KAK
Sbjct  447   KNSVTQTRQNVSQHYDLSNDFFSLFLDKSMTYSSAIFKDEEESLEEAQLRKINLLIHKAK  506

Query  2309  ISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLC  2488
             + ++  +LEIG GWGSLA+E V++TGCKYTG+T S +QLKYA+ +V+EAGL+        
Sbjct  507   VGQDDEVLEIGSGWGSLAMEVVKQTGCKYTGVTQSVEQLKYAQRRVKEAGLE--------  558

Query  2489  DYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEY  2668
              +  +P+  RYD                                              EY
Sbjct  559   -FISIPEE-RYD----------------------------------------------EY  570

Query  2669  RQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYY  2806
             R+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY
Sbjct  571   RRSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYY  616


 Score =   171 bits (434),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 108/152 (71%), Gaps = 2/152 (1%)
 Frame = +1

Query  562   MVFNRVTYPNMMELFESLGVDMEISDMSFSV--SLDNGHGYEWGSRNGFSGLFAQKKNLL  735
             M   +VT PNMM+ F  LG +ME SDMSFSV   LD     EW S NG SGL A++ N L
Sbjct  635   MPSTQVTSPNMMQWFADLGANMERSDMSFSVRTQLDACGECEWASGNGISGLLAKRSNAL  694

Query  736   NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             +P FW+MI E LKFK D L YLE+ +NN D+++++TLG+F++S GY + FQ+AY+ P+C 
Sbjct  695   SPSFWRMISETLKFKRDALRYLEDCENNLDLEQSETLGQFVQSHGYCQFFQEAYLFPICG  754

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQNFS  1011
              +WSC S+ V+ FSA S+LSF R H+LLQ FS
Sbjct  755   WMWSCPSQRVLGFSASSVLSFFRKHNLLQLFS  786


 Score =   108 bits (269),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 77/117 (66%), Gaps = 9/117 (8%)
 Frame = +2

Query  1451  DTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYG  1630
             ++ + +LVTLNP   P+  LLKW T H VP+VAAS+AS EL++IQGKR         G G
Sbjct  339   ESTRTFLVTLNPSYVPDHVLLKWNTNHFVPTVAASKASLELDQIQGKR---------GSG  389

Query  1631  FHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSII  1801
             FHEDG +AG  AA  LL  +  PL NP  MV SW ETGARLLV RFL  +I  G+++
Sbjct  390   FHEDGFQAGKAAAQSLLGNKIDPLTNPKQMVLSWTETGARLLVLRFLKQYISVGNLM  446


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 46/69 (67%), Gaps = 10/69 (14%)
 Frame = +1

Query  403  MRVAVVGAGISGLVSAYVLAK---GGAGVVVYEKEDYLGGH-AKTVTLDG------VDLD  552
            MRVAVVGAG+SGL +A+ LA    GG  V VYEKED LGG  A+TV +DG      V L 
Sbjct  1    MRVAVVGAGVSGLAAAHELATSCAGGVDVTVYEKEDSLGGSFARTVGVDGGAGGEVVHLH  60

Query  553  LGFMVFNRV  579
            LGFM FN V
Sbjct  61   LGFMPFNSV  69



>dbj|BAK05892.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/657 (59%), Positives = 490/657 (75%), Gaps = 7/657 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQLF  PQ  T+K RS S+V+KV+  LE  GC I+  C V SV++   G AG  V+ +  
Sbjct  213   LQLFRYPQLPTIKARSQSFVDKVKGALESMGCRIKTSCHVKSVAS--FGGAGYKVLENDG  270

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
             +  +E YD  I+  HAP+ LK+LG +AT  EL+ILGA QYV+ D YLHR+Q+ MPRN +A
Sbjct  271   S--EETYDNVILGIHAPNALKVLGAEATDYELKILGACQYVHRDTYLHRDQNLMPRNSSA  328

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSAWNFLGT  +   +TYWLN +Q +   K P+LVTLNPP  P+  LLKW+T  PV SVA
Sbjct  329   WSAWNFLGTTTSGFSITYWLNHIQKIESVK-PFLVTLNPPCVPDHVLLKWSTSLPVLSVA  387

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             A++A  +L++IQGKR IWFCGAYQ +GFHEDGLKAG + A GLL K+C  L NP  M+PS
Sbjct  388   AAKAYLQLDQIQGKRGIWFCGAYQSHGFHEDGLKAGKVVAQGLLGKKCELLLNPKQMIPS  447

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
             W E GARLLV RF   ++  G++  +EEGG+VF+F     K  +K ++RVH P FYWKVA
Sbjct  448   WTEAGARLLVQRFFNQYVSIGNLTFVEEGGSVFSFGKACDKCHVKSVMRVHDPLFYWKVA  507

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             T+ +LGLA+AYI+G  SF+DK+EGLLN   I +ANRD   S SR    RG WTPL   + 
Sbjct  508   TEGNLGLAEAYINGCFSFLDKREGLLNFLLILIANRDARRS-SRIAGNRGRWTPLHVIAR  566

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
              A AKYF+   SR+NT+ Q+RRNIS+HYDLSNE FSLF+D++MTYSCA+FK ++E L+ A
Sbjct  567   FAHAKYFMGQASRKNTMAQSRRNISQHYDLSNEFFSLFMDKSMTYSCAIFKKDNESLEAA  626

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q RK+SLLI KAK+ + HH+L+IG GWGSLAI+ V++TGCKYTG+TLSE+QLKYAE K +
Sbjct  627   QERKLSLLIKKAKVERGHHVLDIGFGWGSLAIQVVKQTGCKYTGVTLSEEQLKYAEGKAK  686

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             EAGL+D+I FLLCDYR++P  C+YD IIS  M+E VGHE++++FF  CES LAE+GI+ L
Sbjct  687   EAGLEDHITFLLCDYRKIPP-CKYDAIISICMIEHVGHEYLDDFFACCESYLAEDGIMAL  745

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2809
             QFIS+PDERY++YR+  DFIKEYIFPGGCLPSLSRV SAM  SSR  +EH+E+IG HYY 
Sbjct  746   QFISVPDERYEQYRRKPDFIKEYIFPGGCLPSLSRVMSAMTRSSRFSIEHVENIGPHYYT  805

Query  2810  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  2980
             TL CW  N+   + +IL LGFD+KFIR WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  806   TLMCWMDNYTANRDKILALGFDEKFIRIWEYYLIFSAACMKARALGDYQVVFSRPGN  862


 Score =   203 bits (517),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 158/226 (70%), Gaps = 17/226 (8%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVL--AKGGAGVVV--YEKEDYLGGHAKTVTLDG-------VDL  549
             MRVAVVG G+SGL +A+ L  A GG  V V  YE+E+ LGGHA+TV +D        V+L
Sbjct  1     MRVAVVGGGVSGLAAAHELLGASGGGDVRVTLYEQEESLGGHARTVAVDDDDGAGGCVNL  60

Query  550   DLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDN---GHGYEWGSRNGFSGLFAQ  720
             DLGF  FN+VTY +MME    LGV+ME +DMS SVS  +   G G EW + NG S L AQ
Sbjct  61    DLGFTSFNQVTYSHMMEWLVGLGVEMERTDMSLSVSTQSDGAGGGCEWENSNGISSLLAQ  120

Query  721   KKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYI  900
             K N+L   FW+M+R+I KFKND L+YLE  ++N D+D N+TLG+FI+S GYS LFQ+AY+
Sbjct  121   KANILKISFWRMVRDIFKFKNDALTYLEYQEHNRDLDCNETLGQFIQSHGYSVLFQEAYL  180

Query  901   IPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQNFS-PALWSPTM  1035
              P+CA +WS SS+ V++ SA+ +LSF RNH LLQ F  P L  PT+
Sbjct  181   FPVCAGMWSSSSQDVLSLSAFFVLSFFRNHDLLQLFRYPQL--PTI  224



>dbj|BAK05129.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=872

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/657 (59%), Positives = 490/657 (75%), Gaps = 7/657 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQLF  PQ  T+K RS S+V+KV+  LE  GC I+  C V SV++   G AG  V+ +  
Sbjct  213   LQLFRYPQLPTIKARSQSFVDKVKGALESMGCRIKTSCHVKSVAS--FGGAGYKVLENDG  270

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
             +  +E YD  I+  HAP+ LK+LG +AT  EL+ILGA QYV+ D YLHR+Q+ MPRN +A
Sbjct  271   S--EETYDNVILGIHAPNALKVLGAEATDYELKILGACQYVHRDTYLHRDQNLMPRNSSA  328

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsva  1549
             WSAWNFLGT  +   +TYWLN +Q +   K P+LVTLNPP  P+  LLKW+T  PV SVA
Sbjct  329   WSAWNFLGTTTSGFSITYWLNHIQKIESVK-PFLVTLNPPCVPDHVLLKWSTSLPVLSVA  387

Query  1550  asrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPS  1729
             A++A  +L++IQGKR IWFCGAYQ +GFHEDGLKAG + A GLL K+C  L NP  M+PS
Sbjct  388   AAKAYLQLDQIQGKRGIWFCGAYQSHGFHEDGLKAGKVVAQGLLGKKCELLLNPKQMIPS  447

Query  1730  WPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVA  1909
             W E GARLLV RF   ++  G++  +EEGG+VF+F     K  +K ++RVH P FYWKVA
Sbjct  448   WTEAGARLLVARFFNQYVSIGNLTFVEEGGSVFSFGKACDKCHVKSVMRVHDPLFYWKVA  507

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             T+ +LGLA+AYI+G  SF+DK+EGLLN   I +ANRD   S SR    RG WTPL   + 
Sbjct  508   TEGNLGLAEAYINGCFSFLDKREGLLNFLLILIANRDARRS-SRIAGNRGRWTPLHVIAR  566

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
              A AKYF+   SR+NT+ Q+RRNIS+HYDLSNE FSLF+D++MTYSCA+FK ++E L+ A
Sbjct  567   FAHAKYFMGQASRKNTMAQSRRNISQHYDLSNEFFSLFMDKSMTYSCAIFKKDNESLEAA  626

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q RK+SLLI KAK+ + HH+L+IG GWGSLAI+ V++TGCKYTG+TLSE+QLKYAE K +
Sbjct  627   QERKLSLLIKKAKVERGHHVLDIGFGWGSLAIQVVKQTGCKYTGVTLSEEQLKYAEGKAK  686

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             EAGL+D+I FLLCDYR++P  C+YD IIS  M+E VGHE++++FF  CES LAE+GI+ L
Sbjct  687   EAGLEDHITFLLCDYRKIPP-CKYDAIISICMIEHVGHEYLDDFFACCESYLAEDGIMAL  745

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2809
             QFIS+PDERY++YR+  DFIKEYIFPGGCLPSLSRV SAM  SSR  +EH+E+IG HYY 
Sbjct  746   QFISVPDERYEQYRRKPDFIKEYIFPGGCLPSLSRVMSAMTRSSRFSIEHVENIGPHYYT  805

Query  2810  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  2980
             TL CW  N+   + +IL LGFD+KFIR WEYY  + AA      LGDYQ+VFSRPGN
Sbjct  806   TLMCWMDNYTANRDKILALGFDEKFIRIWEYYLIFSAACMKARALGDYQVVFSRPGN  862


 Score =   206 bits (525),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 159/226 (70%), Gaps = 17/226 (8%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVL--AKGGAGVVV--YEKEDYLGGHAKTVTLDG-------VDL  549
             MRVAVVG G+SGL +A+ L  A GG  V V  YE+E+ LGGHA+TV +D        V+L
Sbjct  1     MRVAVVGGGVSGLAAAHELLGASGGGDVRVTLYEQEESLGGHARTVAVDDDDGAGGCVNL  60

Query  550   DLGFMVFNRVTYPNMMELFESLGVDMEISDMSFSVSLDN---GHGYEWGSRNGFSGLFAQ  720
             DLGF  FN+VTY +MME    LGV+ME +DMS SVS  +   G G EWG+ NG S L AQ
Sbjct  61    DLGFTSFNQVTYSHMMEWLVGLGVEMERTDMSLSVSTQSDGAGGGCEWGNSNGISSLLAQ  120

Query  721   KKNLLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYI  900
             K N+L   FW+M+R+I KFKND L+YLE  ++N D+D N+TLG+FI+S GYS LFQ+AY+
Sbjct  121   KANILKISFWRMVRDIFKFKNDALTYLEYQEHNRDLDCNETLGQFIQSHGYSVLFQEAYL  180

Query  901   IPMCASIWSCSSEGVMAFSAYSILSFCRNHHLLQNFS-PALWSPTM  1035
              P+CA +WS SS+ V++ SA+ +LSF RNH LLQ F  P L  PT+
Sbjct  181   FPVCAGMWSSSSQDVLSLSAFFVLSFFRNHDLLQLFRYPQL--PTI  224



>ref|XP_006606355.1| PREDICTED: uncharacterized protein LOC100815937 isoform X2 [Glycine 
max]
Length=741

 Score =   780 bits (2013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/562 (69%), Positives = 458/562 (81%), Gaps = 8/562 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTV+ RS +YVNKV++ELE+ G +I    EVH VST
Sbjct  184   FSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSQTYVNKVKQELEREGSQIITNREVHLVST  243

Query  1145  -DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSD  1321
               E+G      ++   +  QE YDGCIMA HAPD L++LG +AT+DE RILGAFQY YSD
Sbjct  244   TSEKG-----CVVYCNDGSQEMYDGCIMAVHAPDALRLLGDEATYDERRILGAFQYAYSD  298

Query  1322  IYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPE  1501
             I+LHR+++ MP+N AAWSAWNFLG+ NN+VCLTYW+N LQN+ +T QP+LVTLNP   PE
Sbjct  299   IFLHRDKNLMPQNPAAWSAWNFLGSNNNKVCLTYWINILQNIKETSQPFLVTLNPDHIPE  358

Query  1502  QCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLL  1681
               LLKW+TGHPVPSVAA +AS EL+ IQGKR+IWF GAYQGYGFHEDG KAGMIAAHG+L
Sbjct  359   NTLLKWSTGHPVPSVAAFKASLELDHIQGKRKIWFSGAYQGYGFHEDGFKAGMIAAHGIL  418

Query  1682  KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLL  1861
                C+   NP HMVPSW E GAR+ VTRFL+ +I TG ++LLEEGGT+FTFEGT K   L
Sbjct  419   GSCCALQTNPKHMVPSWKELGARIFVTRFLSCYITTGCLMLLEEGGTMFTFEGTGKNCGL  478

Query  1862  KVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSR  2041
             K ++RVH PQFYWKV TQADLGLADAYI+GD SFVDK EGLLNL  I +ANRD +AS S+
Sbjct  479   KSVLRVHDPQFYWKVMTQADLGLADAYINGDFSFVDKDEGLLNLILILIANRDSNASNSK  538

Query  2042  SNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMT  2221
                 RGWWTP+ FTSA+ SAK+F+ H+SR+NTLTQARRNISRHYDLSN+LF+ FLDETMT
Sbjct  539   LKKNRGWWTPVFFTSALTSAKFFMDHVSRRNTLTQARRNISRHYDLSNDLFATFLDETMT  598

Query  2222  YSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTG  2401
             YSCAVFK++DEDLK AQ RKISLLI+KA+I K H ILEIGCGWGSLAIE V++TGCKYTG
Sbjct  599   YSCAVFKNKDEDLKDAQKRKISLLIEKARIDKTHEILEIGCGWGSLAIEVVKQTGCKYTG  658

Query  2402  ITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEF  2581
             ITLSE+QLK AE +V++AGLQD I F+LCDYRQLP   +YDRIISCEM+EAVGHE+M EF
Sbjct  659   ITLSEEQLKLAEQRVKDAGLQDRINFVLCDYRQLPKTYKYDRIISCEMIEAVGHEYMEEF  718

Query  2582  FGRCESVLAENGILVLQFISIP  2647
             FG CESVLA+NG+LVLQ ++ P
Sbjct  719   FGCCESVLADNGLLVLQEVAYP  740


 Score =   353 bits (907),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVAVVG+GISGL SAY+LAKGG  VV+YEKED LGGHAKTV +DGVD+DLGFMVFNRVT
Sbjct  1     MRVAVVGSGISGLASAYLLAKGGVNVVLYEKEDSLGGHAKTVNVDGVDVDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNM++ FE+LGVDME SDMSFSVSLD G G EWGSRNG S LFAQKKN+LNPYFWQMIR
Sbjct  61    YPNMLDFFENLGVDMESSDMSFSVSLDKGRGCEWGSRNGLSSLFAQKKNVLNPYFWQMIR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI+KFK+DV+SYL+  +NNPD+DRN+ LGEFIKSRGYSELFQKAY+IP+C SIWSCSSEG
Sbjct  121   EIVKFKDDVISYLDMLENNPDIDRNEPLGEFIKSRGYSELFQKAYLIPICGSIWSCSSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM+FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQW  207



>ref|XP_004972625.1| PREDICTED: uncharacterized protein LOC101764920 [Setaria italica]
Length=871

 Score =   784 bits (2024),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/679 (57%), Positives = 504/679 (74%), Gaps = 15/679 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F +++  +F R +  L+LFGRP W TVK  S SYVNKVREELE  GC+I+ GCEV SVS 
Sbjct  191   FPALSVLSFFRDNHLLELFGRPHWHTVKGGSVSYVNKVREELESMGCQIKTGCEVSSVSK  250

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
               Q     V  I   +  +E YD  I    APD LK+LG +AT +ELRILGAFQY+YSD+
Sbjct  251   FNQ-----VYRILEVDGSEEMYDRIIFGLQAPDALKVLGAEATHEELRILGAFQYIYSDV  305

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             Y H ++S MP N  AWSA NFLGT ++ VC+TYWLN +QN+ ++ +P+LVT NPPR P  
Sbjct  306   YFHCDESLMPHNFYAWSARNFLGT-SSGVCVTYWLNIVQNI-ESSRPFLVTFNPPRAPNH  363

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
               LKW T HP+PS+A+++A+ EL  IQGKR IWFCG YQGYG HED +KAG +AA  LL+
Sbjct  364   VFLKWHTSHPIPSLASAKATVELNNIQGKRGIWFCGPYQGYGCHEDSVKAGKVAASELLQ  423

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             ++C+ L NP  MVPSW E GARLLV +    +I  G++ + EEGGT F+F    ++  +K
Sbjct  424   RKCNLLVNPKPMVPSWTEAGARLLVLKRFDQYINIGNVSIREEGGTTFSFGKACERCHVK  483

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              +++VH PQFYWK+ T+ADLGLA AYI+G ISF D +EGLLN   I  ANR     + RS
Sbjct  484   SVIQVHDPQFYWKLVTEADLGLAYAYINGYISFSDNREGLLNFILINFANRGERKRLMRS  543

Query  2045  NS------KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFL  2206
             ++      ++GWW+P L  + IA AKY +RH SR N++++A +NIS+HYDLSN+ F+L+L
Sbjct  544   SASKSSSIRKGWWSPWLRITGIACAKYILRHASRNNSVSKAAKNISKHYDLSNDFFALYL  603

Query  2207  DETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTG  2386
             D +MTYS  +FK+EDE L+ AQ+RKI+ LI+KAK+   HH+L+IG GWG+LAIE V++TG
Sbjct  604   DPSMTYSSGIFKAEDESLEAAQLRKINSLINKAKVESGHHVLDIGSGWGTLAIELVKKTG  663

Query  2387  CKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHE  2566
             CKYTGITLSE+QLKY++ KV+EAGL+D I FLLCDYRQ+P + ++DRIISCEM+E VGHE
Sbjct  664   CKYTGITLSEEQLKYSKRKVKEAGLEDRISFLLCDYRQIPTDQKFDRIISCEMIEHVGHE  723

Query  2567  FMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSA  2746
             +M++FFG CE  LAE+G+ VLQFI+IP+E YD+ R   +F+KEYIFPGGCLPSL+RV SA
Sbjct  724   YMDDFFGSCEYHLAEHGLFVLQFIAIPEELYDKMRTRPEFLKEYIFPGGCLPSLARVVSA  783

Query  2747  MAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAG  2926
             M  +SRLC++H+E+IG HYY TL  WR NF+  + ++  LGFD+KF+ TW+YY  YCAA 
Sbjct  784   MTNASRLCIQHVENIGDHYYPTLMHWRDNFMANRKKVAALGFDEKFMLTWQYYLTYCAAM  843

Query  2927  FHTCTLGDYQIVFSRPGNV  2983
             F + TL DYQIVFSR G+ 
Sbjct  844   FRSRTLMDYQIVFSRSGDA  862


 Score =   241 bits (616),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 158/216 (73%), Gaps = 12/216 (6%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG-----VDLDLGFM  564
             MRVAVVG G+SGL +A+ LA+ GGA V VYEKE++LGG  KT+ +D      V  DLG M
Sbjct  2     MRVAVVGGGLSGLAAAHELARSGGARVTVYEKEEHLGG--KTMAVDDGAGGRVPADLGCM  59

Query  565   VFNRVTYPNMMELFESLGVDMEISDMSFSVSL---DNGHGYEWGSRNGFSGLFAQKKNLL  735
             VFNR+T PNMM  FE LGV++E SDMSFS SL   D G G+EWGS NG SG+ AQK NLL
Sbjct  60    VFNRMTCPNMMRWFEDLGVEVETSDMSFSASLRLDDKGGGFEWGSHNGISGVLAQKSNLL  119

Query  736   NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             +P FW +IREI+KFKN  L YLEE D+  + DRN+TLG+FI+S  YS+LFQ AY+IP+C+
Sbjct  120   SPRFWLVIREIIKFKNHALKYLEE-DHGRNPDRNETLGQFIQSHRYSQLFQDAYLIPLCS  178

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
              IWS   +GV+ F A S+LSF R++HLL+ F    W
Sbjct  179   CIWSSPPQGVLGFPALSVLSFFRDNHLLELFGRPHW  214



>ref|XP_004956057.1| PREDICTED: uncharacterized protein LOC101762231 isoform X2 [Setaria 
italica]
Length=872

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/677 (57%), Positives = 503/677 (74%), Gaps = 15/677 (2%)
 Frame = +2

Query  977   SVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDE  1150
             +V+  +F R +  L+LFGRPQW TVK  S SYVNKVREELE  GC+I+ GCEV SV    
Sbjct  194   AVSVLSFFRDNHLLELFGRPQWHTVKGGSGSYVNKVREELESMGCQIKTGCEVKSVLKFN  253

Query  1151  QGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYL  1330
             +     V+ + G    +E YD  I    APD +K+LG +AT +ELRILGAFQY+YSD+Y 
Sbjct  254   E--VYRVLEVDGS---EEMYDRIIFGLQAPDAIKLLGAEATHEELRILGAFQYIYSDVYF  308

Query  1331  HREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCL  1510
             H ++S MP N  AWSA NFLGT ++ VC+TYWLN +QN+ ++ +P+LVT NPPR P    
Sbjct  309   HCDESLMPHNSYAWSARNFLGT-SSGVCVTYWLNIVQNI-ESSRPFLVTFNPPRAPNHVF  366

Query  1511  LKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKR  1690
             LKW T  P+PS+A+++A+ EL  IQGKR IWFCG YQGY  HED +KAG +AA  LL+++
Sbjct  367   LKWHTSLPIPSLASAKATVELNNIQGKRGIWFCGPYQGYRCHEDSVKAGKVAASELLQRK  426

Query  1691  CSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVL  1870
             C+ L NP  MVPSW E GARLLV +    +I  G++ +LEEGGT F+F    ++  +K +
Sbjct  427   CNLLVNPKPMVPSWTEAGARLLVLKHFDQYINIGNVSILEEGGTTFSFGRAGERCHVKSV  486

Query  1871  VRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNS  2050
             ++VH PQFYWK+AT+ADLG A AYI+G ISF D +EGLLN   I  ANR     + RS++
Sbjct  487   IQVHDPQFYWKLATEADLGFAYAYINGYISFSDNREGLLNFILITFANRGERKRLMRSSA  546

Query  2051  ------KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2212
                   ++GWW+P L  + IA AKY +RH SR NT+++A +NIS+HYDLSN+ F+L+LD 
Sbjct  547   SKSSCIRKGWWSPWLRITGIACAKYILRHASRNNTVSKAAKNISKHYDLSNDFFALYLDP  606

Query  2213  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2392
             +MTYS  +FK+EDE L+ AQ+RKI+ LI+KAK+   HH+L+IG GWG+LAIE V++TGCK
Sbjct  607   SMTYSSGIFKAEDESLEAAQLRKINSLINKAKVESGHHVLDIGSGWGTLAIELVKKTGCK  666

Query  2393  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2572
             YTGITLSE+QLKY++ KV+EAGL+D I FLLCDYRQ+P + ++DRIISCEM+E VGHE+M
Sbjct  667   YTGITLSEEQLKYSKRKVKEAGLEDRISFLLCDYRQIPTDQKFDRIISCEMIEHVGHEYM  726

Query  2573  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2752
             ++FFG CE  LAE+G+ VLQFI+IP+E YD+ R   +F+KEYIFPGGCLPSL+RV SAM 
Sbjct  727   DDFFGSCEYHLAEHGLFVLQFIAIPEELYDKLRTRPEFLKEYIFPGGCLPSLARVVSAMT  786

Query  2753  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2932
              +SRLC++H+E+IG HYY TL  WR NF+  + ++  LGFD+KF+ TW+YY  YCAA F 
Sbjct  787   NASRLCIQHVENIGDHYYPTLMHWRDNFMANRKKVAALGFDEKFMLTWQYYLTYCAAMFR  846

Query  2933  TCTLGDYQIVFSRPGNV  2983
             + TL DYQIVFSR G+ 
Sbjct  847   SRTLMDYQIVFSRSGDA  863


 Score =   241 bits (614),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 156/216 (72%), Gaps = 11/216 (5%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHA-KTVTLDG-----VDLDLGF  561
             MRVAVVG G+SGL +A+ LA+ GGA V VYEKE++LGG   KT+ +D      V +DLG 
Sbjct  2     MRVAVVGGGLSGLAAAHELARSGGARVTVYEKEEHLGGGGNKTMAVDDGTGGRVPVDLGC  61

Query  562   MVFNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLL  735
             MVFNR+T PNMM  FE LG+++E SDMSFS SL  D G G+EWG+RNG SG+  QK NLL
Sbjct  62    MVFNRMTCPNMMRWFEDLGLEVETSDMSFSASLRLDKGAGFEWGTRNGISGVLVQKSNLL  121

Query  736   NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             +P FW +IREI+KFKN  L YLE+   NP  DRN+TLG+FI+S  YS+LFQ AY+IPMC 
Sbjct  122   SPRFWLVIREIIKFKNHALKYLEDHGRNP--DRNETLGQFIQSHRYSQLFQDAYLIPMCL  179

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
              IWS   +GV+   A S+LSF R++HLL+ F    W
Sbjct  180   CIWSSPPQGVLGIPAVSVLSFFRDNHLLELFGRPQW  215



>gb|EMT06798.1| Cyclopropane-fatty-acyl-phospholipid synthase [Aegilops tauschii]
Length=783

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/658 (59%), Positives = 495/658 (75%), Gaps = 11/658 (2%)
 Frame = +2

Query  992   TFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAG  1165
             +FCR    +QLF   Q  TVK RS SYVNKV+ ELE  GC I+  C+V S+S+ + G+AG
Sbjct  130   SFCRNHGLVQLFRHSQLPTVKPRSQSYVNKVKGELESIGCRIKTSCQVKSISSID-GAAG  188

Query  1166  GVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQS  1345
               V+   K+  +E YD  I+  HAP+ LK+LG +AT  E RILGA QYV+ DIYLH +Q+
Sbjct  189   YRVL--EKDGSEETYDSVILGVHAPNALKVLGIEATHHERRILGACQYVHRDIYLHCDQN  246

Query  1346  FMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTT  1525
              MPRN +AWSAWNFLGT +    +TYWLN +Q + ++ +P+LVTLNPP  P+  LLKW  
Sbjct  247   LMPRNTSAWSAWNFLGTTSRGFSVTYWLNQIQKV-ESVRPFLVTLNPPCVPDHVLLKWNA  305

Query  1526  GHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLN  1705
               PVPSVAA++A  +L++IQGKR IWFCG Y G+GFHEDGLK+G  AA GLL K+C  L 
Sbjct  306   SLPVPSVAAAKAYLQLDQIQGKRGIWFCGVYNGHGFHEDGLKSGKAAAQGLLGKKCDVLL  365

Query  1706  NPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHS  1885
             NP  M PSW E GARLLVTRF   +I  G++IL+EEGG+VF+F     K  +K +++VH 
Sbjct  366   NPKKMSPSWTEAGARLLVTRFFNQYISIGNLILVEEGGSVFSFGKACDKCCVKSVIQVHD  425

Query  1886  PQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWW  2065
             P FYWKVA +  +GLA+AYI G  S +DK+EGLLNL  I +ANRD     +R  +++G+W
Sbjct  426   PLFYWKVAIEGGMGLAEAYIDGCYSVLDKREGLLNLILILIANRD--ERRNRRIARKGFW  483

Query  2066  -TPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK  2242
              +P    + +A AK+F+R  SR+NT TQ RRNIS+HYDLSN+ FSLFLD+TMTYSCAVFK
Sbjct  484   LSPFHVIAQLAYAKHFLRQTSRKNTATQTRRNISQHYDLSNDFFSLFLDKTMTYSCAVFK  543

Query  2243  SEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQ  2422
              ++E L+ AQ RK+SLLI+KAK+ +EHH+L+IG GWGSLAIE V++TGCKYTG+TLS +Q
Sbjct  544   -DNESLEAAQQRKLSLLINKAKVKREHHVLDIGSGWGSLAIETVKQTGCKYTGVTLSAEQ  602

Query  2423  LKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESV  2602
              KYAE KVREAGL+D I FLLCDYR++P   +YD IISC M+E VGHE+M+EFF  CES 
Sbjct  603   HKYAERKVREAGLEDRINFLLCDYRKIPP-FKYDTIISCGMIEHVGHEYMDEFFACCESY  661

Query  2603  LAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  2782
             LAE+GILVLQFIS+P+ERY++YR+  DFIKEYIFPGGCLPSL+R+ SAM  SSR C+EH+
Sbjct  662   LAEDGILVLQFISVPEERYEQYRKRPDFIKEYIFPGGCLPSLARIMSAMTTSSRFCIEHV  721

Query  2783  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ  2956
             E+IG +YY TL  WR NF+  + ++L LGFD++F+R WEYY  + AAGF +  LGDYQ
Sbjct  722   ENIGPNYYTTLMHWRDNFMANKDEVLALGFDERFLRIWEYYLIFSAAGFKSRALGDYQ  779


 Score =   162 bits (410),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 102/141 (72%), Gaps = 3/141 (2%)
 Frame = +1

Query  595   MELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNG---FSGLFAQKKNLLNPYFWQMIRE  765
             ME  E LGV+ME SDMSFSVS  +  G            S L AQK N+L P FW+M+ E
Sbjct  1     MEWLEGLGVEMERSDMSFSVSTQSKGGGGGCEWGNGNGISSLLAQKTNILKPSFWRMVCE  60

Query  766   ILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGV  945
             ILKFKND L+YLE+ ++NPD+DR +TLG+FI+S GYS  FQ+AY+IP+C  +WSCSS+ V
Sbjct  61    ILKFKNDALTYLEDHEHNPDLDRKETLGQFIQSHGYSLSFQEAYLIPVCTGMWSCSSQDV  120

Query  946   MAFSAYSILSFCRNHHLLQNF  1008
             ++ SA+ +LSFCRNH L+Q F
Sbjct  121   LSLSAFLVLSFCRNHGLVQLF  141



>ref|XP_004956056.1| PREDICTED: uncharacterized protein LOC101762231 isoform X1 [Setaria 
italica]
Length=912

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/717 (54%), Positives = 503/717 (70%), Gaps = 55/717 (8%)
 Frame = +2

Query  977   SVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDE  1150
             +V+  +F R +  L+LFGRPQW TVK  S SYVNKVREELE  GC+I+ GCEV SV    
Sbjct  194   AVSVLSFFRDNHLLELFGRPQWHTVKGGSGSYVNKVREELESMGCQIKTGCEVKSVLKFN  253

Query  1151  QGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYL  1330
             +     V+ + G    +E YD  I    APD +K+LG +AT +ELRILGAFQY+YSD+Y 
Sbjct  254   E--VYRVLEVDGS---EEMYDRIIFGLQAPDAIKLLGAEATHEELRILGAFQYIYSDVYF  308

Query  1331  HREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCL  1510
             H ++S MP N  AWSA NFLGT ++ VC+TYWLN +QN+ ++ +P+LVT NPPR P    
Sbjct  309   HCDESLMPHNSYAWSARNFLGT-SSGVCVTYWLNIVQNI-ESSRPFLVTFNPPRAPNHVF  366

Query  1511  LKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKR  1690
             LKW T  P+PS+A+++A+ EL  IQGKR IWFCG YQGY  HED +KAG +AA  LL+++
Sbjct  367   LKWHTSLPIPSLASAKATVELNNIQGKRGIWFCGPYQGYRCHEDSVKAGKVAASELLQRK  426

Query  1691  CSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVL  1870
             C+ L NP  MVPSW E GARLLV +    +I  G++ +LEEGGT F+F    ++  +K +
Sbjct  427   CNLLVNPKPMVPSWTEAGARLLVLKHFDQYINIGNVSILEEGGTTFSFGRAGERCHVKSV  486

Query  1871  VRVHSPQFYWKV----------------------------------------ATQADLGL  1930
             ++VH PQFYWKV                                        AT+ADLG 
Sbjct  487   IQVHDPQFYWKVQLSSSRFFFALFLNNILFSSSHLVRDTSYIFTVPPLFHQLATEADLGF  546

Query  1931  ADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNS------KRGWWTPLLFTSAI  2092
             A AYI+G ISF D +EGLLN   I  ANR     + RS++      ++GWW+P L  + I
Sbjct  547   AYAYINGYISFSDNREGLLNFILITFANRGERKRLMRSSASKSSCIRKGWWSPWLRITGI  606

Query  2093  ASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQ  2272
             A AKY +RH SR NT+++A +NIS+HYDLSN+ F+L+LD +MTYS  +FK+EDE L+ AQ
Sbjct  607   ACAKYILRHASRNNTVSKAAKNISKHYDLSNDFFALYLDPSMTYSSGIFKAEDESLEAAQ  666

Query  2273  MRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVRE  2452
             +RKI+ LI+KAK+   HH+L+IG GWG+LAIE V++TGCKYTGITLSE+QLKY++ KV+E
Sbjct  667   LRKINSLINKAKVESGHHVLDIGSGWGTLAIELVKKTGCKYTGITLSEEQLKYSKRKVKE  726

Query  2453  AGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQ  2632
             AGL+D I FLLCDYRQ+P + ++DRIISCEM+E VGHE+M++FFG CE  LAE+G+ VLQ
Sbjct  727   AGLEDRISFLLCDYRQIPTDQKFDRIISCEMIEHVGHEYMDDFFGSCEYHLAEHGLFVLQ  786

Query  2633  FISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQT  2812
             FI+IP+E YD+ R   +F+KEYIFPGGCLPSL+RV SAM  +SRLC++H+E+IG HYY T
Sbjct  787   FIAIPEELYDKLRTRPEFLKEYIFPGGCLPSLARVVSAMTNASRLCIQHVENIGDHYYPT  846

Query  2813  LRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNV  2983
             L  WR NF+  + ++  LGFD+KF+ TW+YY  YCAA F + TL DYQIVFSR G+ 
Sbjct  847   LMHWRDNFMANRKKVAALGFDEKFMLTWQYYLTYCAAMFRSRTLMDYQIVFSRSGDA  903


 Score =   241 bits (614),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 156/216 (72%), Gaps = 11/216 (5%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHA-KTVTLDG-----VDLDLGF  561
             MRVAVVG G+SGL +A+ LA+ GGA V VYEKE++LGG   KT+ +D      V +DLG 
Sbjct  2     MRVAVVGGGLSGLAAAHELARSGGARVTVYEKEEHLGGGGNKTMAVDDGTGGRVPVDLGC  61

Query  562   MVFNRVTYPNMMELFESLGVDMEISDMSFSVSL--DNGHGYEWGSRNGFSGLFAQKKNLL  735
             MVFNR+T PNMM  FE LG+++E SDMSFS SL  D G G+EWG+RNG SG+  QK NLL
Sbjct  62    MVFNRMTCPNMMRWFEDLGLEVETSDMSFSASLRLDKGAGFEWGTRNGISGVLVQKSNLL  121

Query  736   NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             +P FW +IREI+KFKN  L YLE+   NP  DRN+TLG+FI+S  YS+LFQ AY+IPMC 
Sbjct  122   SPRFWLVIREIIKFKNHALKYLEDHGRNP--DRNETLGQFIQSHRYSQLFQDAYLIPMCL  179

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
              IWS   +GV+   A S+LSF R++HLL+ F    W
Sbjct  180   CIWSSPPQGVLGIPAVSVLSFFRDNHLLELFGRPQW  215



>ref|XP_008677860.1| PREDICTED: uncharacterized protein LOC103652693 isoform X1 [Zea 
mays]
Length=887

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/701 (54%), Positives = 502/701 (72%), Gaps = 20/701 (3%)
 Frame = +2

Query  893   LTLFQCVLPYGPVHQKG*WPSLLT-PFFHSVATTTFCRISLQLFGRPQWLTVKRRSHSYV  1069
             + +  C+ P  P H+   +P+L    FF            L++    +WLTVK  S SYV
Sbjct  192   IPMCACIWP-SPSHEILGFPALFVLSFFRDNQL-------LEILSGSKWLTVKGGSGSYV  243

Query  1070  NKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTL  1249
             NK+REELE  GC+I+ GCEV+S+S    G    ++ + G     E YD  I+  +A D L
Sbjct  244   NKIREELESNGCQIKIGCEVNSISKSNDGYQ--ILEVDGS---VETYDRIIIGINAHDAL  298

Query  1250  KMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWL  1429
             K+LG +AT +EL+ LGAF ++ S  YLH ++S MPRN +AWSA NFLGT ++ VC+T WL
Sbjct  299   KVLGAEATNEELKNLGAFHFIRSIAYLHSDESLMPRNSSAWSARNFLGTTSSGVCVTSWL  358

Query  1430  NTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFC  1609
             N L+N+ ++  P LVTLNPPR P   LLK    HP+PS+AA++A+ +L  IQGKR IWFC
Sbjct  359   NILENI-ESAGPLLVTLNPPRVPNHVLLKCHISHPIPSIAAAKANLQLNSIQGKRGIWFC  417

Query  1610  GAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVT  1789
             G+YQGYG+HED +KAG  AA GLL ++C  L+NP  MV SW E GARLLV R L  +I  
Sbjct  418   GSYQGYGYHEDSVKAGKAAALGLLGRKCDLLSNPKPMVSSWTEAGARLLVARSLDQYITI  477

Query  1790  GSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVD  1969
             G+  +LEEGGT F+F    +K  +K  +RVH PQFYWK AT+ DLG A AYI+G ISFVD
Sbjct  478   GNFCILEEGGTTFSFGKACEKCHVKSAIRVHDPQFYWKAATEGDLGFASAYINGQISFVD  537

Query  1970  KKEGLLNLFKIFVANRD----LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNT  2137
              ++GL+NL +I +ANR     LS++ S  N+++ WW+PLL  + ++ AKYF+RH  R+N+
Sbjct  538   HRKGLVNLVRIILANRGEFKRLSSTAS-GNTRKAWWSPLLGITGVSFAKYFLRHALRKNS  596

Query  2138  LTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISK  2317
             +++AR+NIS HYDLSN+ F+L+LD +MTYS  +FK  +E L+TAQ+RK+  LI+KAK+  
Sbjct  597   VSKARKNISEHYDLSNDFFALYLDPSMTYSSGIFKVAEESLETAQLRKLDSLINKAKVEP  656

Query  2318  EHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYR  2497
              HH+L+IGCGWG+LAI  V++TGCKYTGITLSE+QLKYA+ KV+E+GL+D I  LLCDYR
Sbjct  657   GHHVLDIGCGWGTLAIRLVKQTGCKYTGITLSEEQLKYAKRKVKESGLEDRITLLLCDYR  716

Query  2498  QLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQS  2677
             QLP   ++DRIISCEM+E VGHE+M++FFG CE  LAE+G+LVLQ I++P+E YD+ R  
Sbjct  717   QLPAGDKFDRIISCEMIEHVGHEYMDDFFGCCEYHLAEHGLLVLQSIALPEELYDKMRMR  776

Query  2678  SDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQI  2857
              +F+K YIFPGGCLPSL R+ SAM+ +SRL ++HLE+IG HYY TL  WR NF+  + + 
Sbjct  777   PEFLKTYIFPGGCLPSLGRIVSAMSNASRLNIQHLENIGDHYYTTLMNWRDNFVANREKA  836

Query  2858  LDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  2980
               LGFD KFIRTWEYY  Y AA F + T  DYQIVF+RPG+
Sbjct  837   SALGFDDKFIRTWEYYLSYAAALFKSRTAIDYQIVFARPGD  877


 Score =   222 bits (566),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 154/218 (71%), Gaps = 13/218 (6%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG------VDLDLG  558
             +MRVA+VG+G+SGLV+A+ LA+ GG  V VYEKED+LGG AKTV +DG      V +DLG
Sbjct  18    EMRVAMVGSGLSGLVAAHELARSGGVRVTVYEKEDHLGG-AKTVAVDGGAEEGRVLVDLG  76

Query  559   FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSL---DNGHGYEWGSRNGFSGLFAQKKN  729
              +VFN VT PN+ME FE LGV+M  SDMSFS S+    +   +EWGSR+G SG+ AQK N
Sbjct  77    PVVFNPVTSPNLMEWFERLGVEMCTSDMSFSASMRLNKSSESFEWGSRSGMSGVLAQKSN  136

Query  730   LLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPM  909
             LL+P FW ++ EI KFKN  L YLE+  + P+  RN+TLG+FI S  YS+LFQ AY+IPM
Sbjct  137   LLSPRFWLVVHEIFKFKNHALKYLEDHRSGPN--RNETLGQFILSHRYSQLFQDAYLIPM  194

Query  910   CASIWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             CA IW   S  ++ F A  +LSF R++ LL+  S + W
Sbjct  195   CACIWPSPSHEILGFPALFVLSFFRDNQLLEILSGSKW  232



>ref|XP_010650130.1| PREDICTED: uncharacterized protein LOC100249441 isoform X3 [Vitis 
vinifera]
Length=678

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/500 (73%), Positives = 422/500 (84%), Gaps = 7/500 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQWLTVK RSH YVNKVREELE +GC+IR GCEV SVST
Sbjct  184   FSAFSVLSFCRNHHLLQLFGRPQWLTVKWRSHYYVNKVREELESKGCQIRTGCEVVSVST  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G      +  G    QE +DGCIMA HAPD L +LG +ATFDE+R+LGAFQYV SDI
Sbjct  244   TDDG----CTVFCGDGS-QEMHDGCIMAVHAPDALNILGNKATFDEMRVLGAFQYVSSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LH +++FMP+N AAWSAWNFLGT++N+VCLTYWLN LQN+  T +P+LVTLNPP TP+ 
Sbjct  299   FLHCDKNFMPQNPAAWSAWNFLGTIDNKVCLTYWLNVLQNIDQTSRPFLVTLNPPHTPDH  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+T HP PSVAAS+AS EL+ IQGKR IWFCGAYQGYGFHEDGLKAGM+AAHG+L 
Sbjct  359   TLLKWSTSHPFPSVAASKASLELDHIQGKRGIWFCGAYQGYGFHEDGLKAGMVAAHGMLG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ LNNP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT++TFEG+ KK LLK
Sbjct  419   KGCAVLNNPKHMVPSLLETGARLFVTRFLGHYISTGCLILLEEGGTIYTFEGSRKKCLLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
             V +++H+PQFYWK+ATQADLGLADAYI+GD S VDK EGL NLF IF+ANRDL +S+SR 
Sbjct  479   VSLKIHNPQFYWKIATQADLGLADAYINGDFSLVDKDEGLQNLFMIFIANRDLDSSLSRL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             N+KRGWWTPL FT+ IASA+YF +H+SRQNTLTQARRNISRHYDLSNELFSLFLDETMTY
Sbjct  539   NNKRGWWTPLFFTAGIASARYFFQHVSRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK+E EDLK AQ+RKISLLI+K +I K+H +LEIGCGWGSLAIE V+RTGCKYTGI
Sbjct  599   SCAVFKTEGEDLKVAQLRKISLLIEKVRIDKKHEVLEIGCGWGSLAIEVVKRTGCKYTGI  658

Query  2405  TLSEQQLKYAEDKVREAGLQ  2464
             TLSE+QLK+AE KV+EAGLQ
Sbjct  659   TLSEEQLKFAEMKVKEAGLQ  678


 Score =   356 bits (913),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+GAG+SGLVSAYVLA+ G  VV+YEKEDYLGGHAKTVT+DGV LDLGFMVFNRVT
Sbjct  1     MRAAVIGAGVSGLVSAYVLARAGMKVVLYEKEDYLGGHAKTVTVDGVPLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FE+LGVDME+SDMSF+VSLD G G EWGSRNG S LFAQKKN+LNPYFWQMI 
Sbjct  61    YPNMMEFFETLGVDMELSDMSFAVSLDEGRGCEWGSRNGLSSLFAQKKNILNPYFWQMIG  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             +++KFK+DVL YLEE +NNPDMDRN TLG+FIK RGYSELFQKAY++P+CASIWSC +EG
Sbjct  121   DVIKFKDDVLKYLEELENNPDMDRNQTLGDFIKCRGYSELFQKAYLVPICASIWSCPAEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSA+S+LSFCRNHHLLQ F    W
Sbjct  181   VMTFSAFSVLSFCRNHHLLQLFGRPQW  207



>ref|XP_010670963.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase isoform 
X4 [Beta vulgaris subsp. vulgaris]
Length=457

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/452 (75%), Positives = 392/452 (87%), Gaps = 1/452 (0%)
 Frame = +2

Query  1658  MIAAHGLLKKRCSP-LNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1834
             MIAA GLL K  +  L NP  MV S  E  A + VTRFL++FI  G + LLEEGGT+ TF
Sbjct  1     MIAARGLLGKSFNNILTNPKQMVASLTEAAACIFVTRFLSNFISAGCLTLLEEGGTILTF  60

Query  1835  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2014
             EG+ K   LKV +R+HSPQFYWKVA +ADLGLADAYI+GD SFVDK EGLLNLF IF+A+
Sbjct  61    EGSSKICPLKVALRIHSPQFYWKVAKEADLGLADAYINGDFSFVDKNEGLLNLFMIFIAS  120

Query  2015  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2194
             RDL+++ +  N KRGWWTP+LFT+ IASAKYF  H+SRQNTLTQARRNISRHYDLSN++F
Sbjct  121   RDLNSTATLVNKKRGWWTPMLFTAGIASAKYFYHHVSRQNTLTQARRNISRHYDLSNDMF  180

Query  2195  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2374
             SLFLDETMTYSCAVF+SE+EDLK AQMRKISLL++KA++ K H +LEIGCGWGSLAIE V
Sbjct  181   SLFLDETMTYSCAVFESENEDLKVAQMRKISLLLEKARVEKHHEVLEIGCGWGSLAIEVV  240

Query  2375  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2554
             +RTGC+YTGITLSE+QL+YAE++V+EAGLQD IRFLLCDYRQLPD  +Y+RIISCEMLEA
Sbjct  241   KRTGCRYTGITLSEEQLRYAEERVKEAGLQDRIRFLLCDYRQLPDVHKYNRIISCEMLEA  300

Query  2555  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2734
             VGHE+M EFF  CES+LA NG+LVLQFISIPDERYDEYR+SSDFIKEYIFPGGCLP LSR
Sbjct  301   VGHEYMEEFFQCCESLLAANGLLVLQFISIPDERYDEYRRSSDFIKEYIFPGGCLPCLSR  360

Query  2735  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2914
             VTSAMAA+SRLCVEH+E+IGIHYY+TLRCWR NFLE QS+I  LGFD+KFIRTWEYYFDY
Sbjct  361   VTSAMAAASRLCVEHIENIGIHYYKTLRCWRKNFLEHQSKIHSLGFDEKFIRTWEYYFDY  420

Query  2915  CAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKG  3010
             CAAGF T TLG+YQIVFSRPGN+ +FG  Y G
Sbjct  421   CAAGFKTRTLGNYQIVFSRPGNLASFGGAYAG  452



>ref|XP_006421139.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
 gb|ESR34379.1| hypothetical protein CICLE_v10004346mg [Citrus clementina]
Length=650

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/507 (71%), Positives = 414/507 (82%), Gaps = 7/507 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RSHSYVNKVR++LE  GC+IR   
Sbjct  114   PSEGVTSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHSYVNKVRKQLESWGCQIRTSS  173

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV SV   ++G      I+ G    +E Y+ C+MA HAPD LK+LG QATFDE RILGAF
Sbjct  174   EVCSVLPADKG----CTIVCGDG-SREFYNSCVMALHAPDALKILGNQATFDETRILGAF  228

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSD++LHR++ FMP+N AAWSAWNFL + +++VCLTYWLN LQNLG+T  P+LVTLN
Sbjct  229   QYVYSDVFLHRDKRFMPQNPAAWSAWNFLESFDSKVCLTYWLNVLQNLGETSLPFLVTLN  288

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   PE  LLKW+TGHPVPSVAAS+A  EL  IQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  289   PDHVPEHTLLKWSTGHPVPSVAASKALLELNHIQGKRGIWFCGAYQGYGFHEDGLKAGMT  348

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AAH +L K C+ L+NP HMVPS  ETGARL V RFL  +I TGS+ILLEEGGT+FTFEGT
Sbjct  349   AAHAVLGKSCTLLSNPRHMVPSLMETGARLFVARFLGQYISTGSMILLEEGGTIFTFEGT  408

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K   LK ++R+HSPQFYWKV TQADLG+ADAYI+GD SFVDK EGLLNLF I +ANRDL
Sbjct  409   RKNCHLKTVLRIHSPQFYWKVMTQADLGVADAYINGDFSFVDKDEGLLNLFMILIANRDL  468

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
              +SVS+   KRGWW+P+LFT+ IASAKYF RHISRQNTLTQARRNISRHYDLSNELFSLF
Sbjct  469   DSSVSKLKQKRGWWSPMLFTAGIASAKYFFRHISRQNTLTQARRNISRHYDLSNELFSLF  528

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDE+MTYSCAVFKSEDEDLK AQMRK+SLLI+K ++SK   +LEIGCGWG+LAIE V+RT
Sbjct  529   LDESMTYSCAVFKSEDEDLKAAQMRKVSLLIEKVRVSKGQEVLEIGCGWGTLAIEIVKRT  588

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQ  2464
             GCKYTGITLSE+QLKYAE KV+EAGLQ
Sbjct  589   GCKYTGITLSEEQLKYAEMKVKEAGLQ  615


 Score =   248 bits (633),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +1

Query  592   MMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREIL  771
             MME FESLGVDME+SDMSFSVSL+ GHG EWGSRNG S LFAQKKN+LNPYFWQM+REI+
Sbjct  1     MMEFFESLGVDMEMSDMSFSVSLEKGHGCEWGSRNGLSSLFAQKKNVLNPYFWQMLREII  60

Query  772   KFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEGVMA  951
             KFK+DVLSYLEE ++NPD+DR++TLG+F+ SRGYSELFQKAY+IP+C SIWSC SEGV +
Sbjct  61    KFKDDVLSYLEELESNPDIDRSETLGQFVNSRGYSELFQKAYLIPICGSIWSCPSEGVTS  120

Query  952   FSAYSILSFCRNHHLLQNFSPALW  1023
             FSA+S+LSFCRNHHLLQ F    W
Sbjct  121   FSAFSVLSFCRNHHLLQLFGRPQW  144



>gb|EEE62857.1| hypothetical protein OsJ_17660 [Oryza sativa Japonica Group]
Length=796

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/719 (55%), Positives = 497/719 (69%), Gaps = 59/719 (8%)
 Frame = +2

Query  959   LTPFFHSVATTTFCRISLQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSV  1138
             L  F  S     F + +  LF R Q L V  RS SY NKVRE+LE R C I+  C V S+
Sbjct  87    LGQFVQSHGYCQFFQEAYLLFSRTQPLIVNGRSQSYFNKVREDLESRSCRIKTNCHVKSI  146

Query  1139  STDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYS  1318
             S+ ++G    V+ + G    +E YD  I+  HA D LK+LG +AT +E RILGAFQ++  
Sbjct  147   SSFDRGYR--VLEVDGS---EEMYDRIIVGIHALDALKLLGAEATHEESRILGAFQHLSV  201

Query  1319  DIY-----------LHR--------------EQSFMPRNLAA-------WSAWNFLGTVN  1402
              +Y           +H               +    P  L         W      G   
Sbjct  202   IVYQGAIPISTRKHVHLCIGEDSGSGGSGKFKVVLPPLALVVDGCGGDDWIGETREGREG  261

Query  1403  NRVCLTYWLNTLQNLG-----DTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrass  1567
             +   LT   +  +N+G     ++   +LVTLNP   P+  LLKW T H VP+VAAS+AS 
Sbjct  262   SFPALTLVDDVDRNMGKPLNIESTNHFLVTLNPSYVPDHVLLKWNTNHFVPTVAASKASL  321

Query  1568  ELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGA  1747
             EL++IQGKR         G GFHEDG +AG  AA  LL  +  PL NP  MV SW ETGA
Sbjct  322   ELDQIQGKR---------GSGFHEDGFQAGKAAAQSLLGNKIDPLTNPKQMVLSWTETGA  372

Query  1748  RLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLG  1927
             RLLV RFL  +I  G++IL EEGGT+F+F    +K   K +++V  P FYW+VAT+ADLG
Sbjct  373   RLLVLRFLKQYISVGNLILFEEGGTMFSFGEACEKCNKKSVLQVQDPLFYWQVATEADLG  432

Query  1928  LADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKY  2107
             LADAYI+G  SFV+K+EGLLNLF I +A+RD   S  R++S+RGWWTPLLFT+ +ASAKY
Sbjct  433   LADAYINGCFSFVNKREGLLNLFLILIASRDAHRSSCRNSSRRGWWTPLLFTAGVASAKY  492

Query  2108  FIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKIS  2287
             F+RHISR+N++TQ R+N+S+HYDLSN+ FSLFLD++MTYS A+FK E+E L+ AQ+RKI+
Sbjct  493   FLRHISRKNSVTQTRQNVSQHYDLSNDFFSLFLDKSMTYSSAIFKDEEESLEEAQLRKIN  552

Query  2288  LLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQD  2467
             LLI KAK+ ++  +LEIG GWGSLA+E V++TGCKYTG+T S +QLKYA+ +V+EAGL+D
Sbjct  553   LLIHKAKVGQDDEVLEIGSGWGSLAMEVVKQTGCKYTGVTQSVEQLKYAQRRVKEAGLED  612

Query  2468  NIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIP  2647
              I FLLCDYR++P + +YDRII CEM+E VGHE+M+EFFG CES+LAENGI V QFISIP
Sbjct  613   RITFLLCDYREIPCH-KYDRIICCEMIEEVGHEYMDEFFGCCESLLAENGIFVTQFISIP  671

Query  2648  DERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWR  2827
             +ERYDEYR+SSDFIKEYIFPGGCLPSL+R+TSAM+A+SRLC+EH+E+IG HYY TL  WR
Sbjct  672   EERYDEYRRSSDFIKEYIFPGGCLPSLTRITSAMSAASRLCIEHVENIGYHYYTTLIRWR  731

Query  2828  ANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQ-------IVFSRPGNV  2983
              NF+  + +IL LGFD+KFIRTWEYYF YCAAGF + TLGDYQ       IVFSRPGN 
Sbjct  732   DNFMANKDKILALGFDEKFIRTWEYYFIYCAAGFKSRTLGDYQASTVLLYIVFSRPGNT  790


 Score =   118 bits (296),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 76/106 (72%), Gaps = 2/106 (2%)
 Frame = +1

Query  592  MMELFESLGVDMEISDMSFSV--SLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIRE  765
            MM+ F  LG +ME SDMSFSV   LD     EW S NG SGL A++ N L+P FW+MI E
Sbjct  1    MMQWFADLGANMERSDMSFSVRTQLDACGECEWASSNGISGLLAKRSNALSPSFWRMISE  60

Query  766  ILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYII  903
             LKFK D L YLE+ +NN D+++++TLG+F++S GY + FQ+AY++
Sbjct  61   TLKFKRDALRYLEDCENNLDLEQSETLGQFVQSHGYCQFFQEAYLL  106



>ref|XP_002528809.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF33543.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=563

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/514 (67%), Positives = 416/514 (81%), Gaps = 23/514 (4%)
 Frame = +2

Query  1091  EKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQA  1270
             +K+GC + CG           GS             +E Y  CI+A HAPD LK+LG Q 
Sbjct  5     QKKGCTVLCG----------DGS-------------EEQYSRCIIAVHAPDALKLLGNQT  41

Query  1271  TFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLG  1450
             TFDE+R+LGAFQYVYS+I+LHR++ FMP+   AWSAWNFLG  +N+ CLTYWLN LQNLG
Sbjct  42    TFDEIRVLGAFQYVYSEIFLHRDKKFMPQVPTAWSAWNFLGNTDNKGCLTYWLNVLQNLG  101

Query  1451  DTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYG  1630
             +T  P+L+TLNP  TP+  LLKWT GHPVP +AAS+AS E E IQG+R +WFCGAYQGYG
Sbjct  102   ETNLPFLITLNPDHTPDHTLLKWTAGHPVPCLAASKASLEFEHIQGRRGLWFCGAYQGYG  161

Query  1631  FHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLE  1810
             FHEDGLK GM+AAH LL+K C+ L+NPN +VPS  ETGARL VTRFL  +I TG +ILLE
Sbjct  162   FHEDGLKFGMVAAHSLLEKMCAILSNPNQIVPSLIETGARLFVTRFLGKYISTGCLILLE  221

Query  1811  EGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLN  1990
             EGGT+FTF+GT KK   K +++VH+PQFYWK+ TQADLGLADAYI+GDISF DK EGLLN
Sbjct  222   EGGTIFTFQGTVKKYFPKSILKVHNPQFYWKIMTQADLGLADAYINGDISFPDKDEGLLN  281

Query  1991  LFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRH  2170
             L  + +ANRD + SV   N K+GWWTP+  T++IASAK+F RH+SR+N+LT ARRNISRH
Sbjct  282   LVMVLIANRDANISVPERNKKKGWWTPMFLTASIASAKFFFRHVSRKNSLTLARRNISRH  341

Query  2171  YDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGW  2350
             YDLSNE+FS+FLDETM+YSCAVFK+EDEDLK+AQMRKISLLI+KA+I+KE   LEIGCGW
Sbjct  342   YDLSNEMFSMFLDETMSYSCAVFKTEDEDLKSAQMRKISLLIEKARINKEREFLEIGCGW  401

Query  2351  GSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRI  2530
             G+LAIE V+RTGCKYTGITLS++QLK+AE++V EAGLQ+NIRF LCD+RQLPD  + D I
Sbjct  402   GTLAIEVVKRTGCKYTGITLSKEQLKFAEERVNEAGLQENIRFQLCDHRQLPDTYKCDGI  461

Query  2531  ISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQ  2632
             ISCEMLEAVGHE+M E+FG CESVLA++GI+VLQ
Sbjct  462   ISCEMLEAVGHEYMEEYFGCCESVLAKDGIIVLQ  495



>ref|XP_008224159.1| PREDICTED: uncharacterized protein LOC103323914 isoform X3 [Prunus 
mume]
Length=689

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/507 (70%), Positives = 417/507 (82%), Gaps = 7/507 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTV+ RSH YV KVRE LE +GC+IR   
Sbjct  182   PSEGVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHCYVKKVREVLESKGCQIRTSS  241

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EVH VST ++G +    I+SG  + +E YDGCIMA HAPD +++LG QAT DELR+LGAF
Sbjct  242   EVHRVSTTDEGCS----ILSGDGL-EEIYDGCIMAVHAPDAVRILGDQATSDELRVLGAF  296

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDI+LHR+++ MP+N AAWSAWNFLG+  N+VCLTYWLN LQN+ +   P+LVTLN
Sbjct  297   QYVYSDIFLHRDKTLMPQNPAAWSAWNFLGSNGNKVCLTYWLNVLQNIDEKGLPFLVTLN  356

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TPE  LLKW+T HPVPSVAAS+AS EL RIQGKR IWFCGAYQGYGFHEDGLKAGM 
Sbjct  357   PDHTPEHTLLKWSTSHPVPSVAASKASVELHRIQGKRGIWFCGAYQGYGFHEDGLKAGMA  416

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA G+L K CS L+NP HMVPS  ETGARL VTRFL  +I TG +ILLEEGGT+F FEGT
Sbjct  417   AARGILGKGCSLLSNPKHMVPSLTETGARLFVTRFLRHYISTGCLILLEEGGTIFNFEGT  476

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              K   LK ++RVH+PQFYWKV TQADLGLADAYI+GD SF+DK +GLLNLF I +ANRD 
Sbjct  477   RKGCSLKCVLRVHTPQFYWKVMTQADLGLADAYINGDFSFIDKDKGLLNLFMILIANRDS  536

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++S S  N KRGWWTPLLFT++IASAKYF +H+SR+NTLTQARRNISRHYDLSN+LFS F
Sbjct  537   NSSDSTLNKKRGWWTPLLFTASIASAKYFFQHVSRKNTLTQARRNISRHYDLSNDLFSQF  596

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYS AVFK+EDEDLKTAQ+RKISLLI+K++I K H +LEIGCGWGSLAIE V++T
Sbjct  597   LDETMTYSSAVFKTEDEDLKTAQLRKISLLIEKSRIEKNHEVLEIGCGWGSLAIEVVKQT  656

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQ  2464
             GCKYTGITLSE+QLKYA+ KV++AGLQ
Sbjct  657   GCKYTGITLSEEQLKYAQQKVKDAGLQ  683


 Score =   362 bits (928),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 168/217 (77%), Positives = 189/217 (87%), Gaps = 2/217 (1%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRV  579
             KMRVAV+GAGISGLVSAYVLAK GA VV++EK+DYLGGHA+TVT DGVDLDLGFMVFNRV
Sbjct  5     KMRVAVIGAGISGLVSAYVLAKEGAEVVLFEKDDYLGGHARTVTFDGVDLDLGFMVFNRV  64

Query  580   TYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMI  759
             TYPNMMELFE LGVDME SDMSFS SLD G G EWGSRNG S LFAQK+NL NPYFWQM+
Sbjct  65    TYPNMMELFERLGVDMETSDMSFSASLDKGRGCEWGSRNGLSSLFAQKRNLFNPYFWQML  124

Query  760   REILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSE  939
             REI KFK+D ++YLEE +NNPD+DRN+TLG+FIKSRGYSELFQKAY++P+C SIWSC SE
Sbjct  125   REITKFKHDAINYLEELENNPDIDRNETLGQFIKSRGYSELFQKAYLVPVCGSIWSCPSE  184

Query  940   GVMAFSAYSILSFCRNHHLLQNFSPALWSPT--MAHC  1044
             GVM+FSA+S+LSFCRNHHLLQ F    W      +HC
Sbjct  185   GVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVRWRSHC  221



>gb|KDO40331.1| hypothetical protein CISIN_1g036521mg, partial [Citrus sinensis]
Length=602

 Score =   675 bits (1742),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 337/487 (69%), Positives = 389/487 (80%), Gaps = 7/487 (1%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             LQLFGRPQWLTV+ RSHSYVNKV   LE  GC+I+ GCEV SV   ++G       + G 
Sbjct  118   LQLFGRPQWLTVRSRSHSYVNKVIALLESLGCQIKTGCEVCSVLQYDEGRTE----VRGD  173

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
                Q  YDGCIMA HAPD L++LG Q+TF+E R+LGAFQYVYSDI+LHR+++FMPRN AA
Sbjct  174   GF-QGFYDGCIMAVHAPDALRILGNQSTFEEKRLLGAFQYVYSDIFLHRDKNFMPRNPAA  232

Query  1370  WSAWNFLGTVNNRVCLTYWLNTLQNLGD--TKQPYLVTLNPPRTPEQCLLKWTTGHpvps  1543
             WSAWNFLG ++ + CLTYWLN LQN+GD  T  P+LVTLNP  TP   LLKW+TGHPVPS
Sbjct  233   WSAWNFLGGLDGKACLTYWLNVLQNIGDGETGLPFLVTLNPDHTPNNTLLKWSTGHPVPS  292

Query  1544  vaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMV  1723
             VAAS+AS EL+ IQGKR IWFC AYQGYGFHEDGLKAGMIAAHG+L KRC+ L NP +MV
Sbjct  293   VAASKASLELDHIQGKRGIWFCEAYQGYGFHEDGLKAGMIAAHGVLGKRCASLCNPRNMV  352

Query  1724  PSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWK  1903
             PS  E GARL V RFL  F+  G +ILLEE GT FTFEGT +   L+ ++R+H+PQFYWK
Sbjct  353   PSLMERGARLFVARFLKQFVCAGCLILLEEVGTTFTFEGTRRYCNLRTVLRIHNPQFYWK  412

Query  1904  VATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFT  2083
             V T ADLGLAD+YI GD SF DK+EGLLNL  I +A RDL ASVS+ N KRGWWTPLLFT
Sbjct  413   VMTHADLGLADSYIDGDFSFADKEEGLLNLIMILIAIRDLDASVSKVNQKRGWWTPLLFT  472

Query  2084  SAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLK  2263
             S IASA YF+RHISR+N+L QARRNIS HYDLSNELF+LF+DE+MTYSC +FK EDEDLK
Sbjct  473   SGIASASYFLRHISRRNSLAQARRNISYHYDLSNELFALFMDESMTYSCPIFKDEDEDLK  532

Query  2264  TAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDK  2443
              AQMRK SL I+KA++SK H +LEIGCGWG+ AIE V +TGC YTGITLS +QLKYAE K
Sbjct  533   VAQMRKHSLQIEKARVSKGHGVLEIGCGWGTFAIEVVRQTGCNYTGITLSAEQLKYAEMK  592

Query  2444  VREAGLQ  2464
             V EAGLQ
Sbjct  593   VNEAGLQ  599


 Score =   198 bits (503),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 95/149 (64%), Positives = 111/149 (74%), Gaps = 23/149 (15%)
 Frame = +1

Query  577   VTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQM  756
             VT PNMME  ESLG DMEIS+MSFS                       KKN+L PYFWQ+
Sbjct  1     VTCPNMMEFLESLGADMEISNMSFS-----------------------KKNVLGPYFWQI  37

Query  757   IREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSS  936
             IREI+KFK+DVL YLEE +NNPD+DR++TLG+FIKSRGYSELFQKAY++P+C SIWSC S
Sbjct  38    IREIMKFKDDVLCYLEELENNPDIDRDETLGQFIKSRGYSELFQKAYLVPICGSIWSCPS  97

Query  937   EGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             EG+M+FSA+SILSF RNHHLLQ F    W
Sbjct  98    EGIMSFSAFSILSFYRNHHLLQLFGRPQW  126



>ref|XP_006489668.1| PREDICTED: uncharacterized protein LOC102613225 isoform X3 [Citrus 
sinensis]
Length=524

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/524 (66%), Positives = 419/524 (80%), Gaps = 7/524 (1%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    L+LFG PQWLT + RSHSYVNKV  +L+  GC+IR  CEV+SV  
Sbjct  3     FSAFSVLSFCRNHHLLELFGHPQWLTFRNRSHSYVNKVTGQLQSWGCQIRTSCEVYSVYP  62

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              ++G    VV   G    QE Y  C+MA HAPD L++LG QAT DE RILGAF+YVYSDI
Sbjct  63    ADEGCT--VVSSDGS---QENYSCCVMAVHAPDALRILGNQATLDETRILGAFRYVYSDI  117

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++FMP+N AAWSAWNFLG+ + ++CLTYWLN LQN G+T  P+L TLNP  TPE 
Sbjct  118   FLHRDKNFMPQNTAAWSAWNFLGSTDGKICLTYWLNVLQNNGETGVPFLATLNPDHTPEN  177

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW+T +  PSVAAS+AS  ++ IQGKR IWFCGAYQGYGF EDGLKAGMI AHG+L 
Sbjct  178   TLLKWSTSNQAPSVAASKASLAVDLIQGKRGIWFCGAYQGYGFQEDGLKAGMITAHGVLG  237

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K C+ L+ P HMVPS  E GARL V  F   +I TG +ILLEEGGT+FTFEG  + + LK
Sbjct  238   KNCAVLSKPKHMVPSLLEKGARLFVAGFFRRYISTGCLILLEEGGTIFTFEGALRNSPLK  297

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK EGLLNLF I +AN+DL++S S+ 
Sbjct  298   TVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKDEGLLNLFLILIANQDLNSSASKL  357

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
               KRGWW+P+ FT++IASAK F RHISR+NTLTQARRN+SRHYDLSNELFSLFLD++MTY
Sbjct  358   KQKRGWWSPMFFTASIASAKCFFRHISRKNTLTQARRNVSRHYDLSNELFSLFLDKSMTY  417

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCA+FKSE EDL+  QMRKIS+LI+KA++SK   +L+IGCGWG+LAIE V++TGCKYTGI
Sbjct  418   SCAIFKSEHEDLEVGQMRKISVLIEKARVSKGQEVLDIGCGWGTLAIEIVKQTGCKYTGI  477

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIIS  2536
             TLS++QLKYA+ KVREAGLQD+IRF LCDYRQLP   +YDRIIS
Sbjct  478   TLSKEQLKYAQIKVREAGLQDHIRFYLCDYRQLPKANKYDRIIS  521



>ref|XP_006354535.1| PREDICTED: pavine N-methyltransferase-like [Solanum tuberosum]
Length=439

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/437 (76%), Positives = 378/437 (86%), Gaps = 1/437 (0%)
 Frame = +2

Query  1718  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1897
             ++P+W ETGARLLVTRF  SFI TG IILLEEGGT FTF+GT++K  LKV +RVHS QFY
Sbjct  3     LLPTWTETGARLLVTRFFKSFIQTGCIILLEEGGTTFTFQGTERKCSLKVSLRVHSMQFY  62

Query  1898  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2077
             WKVAT+AD+GLADA+IHGD SFVDK EGLLNL  IF+ANRDL ASV  S+ KRGWWTP++
Sbjct  63    WKVATRADVGLADAFIHGDFSFVDKNEGLLNLVMIFIANRDLKASVGTSSKKRGWWTPVI  122

Query  2078  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2257
             FT+A++SA YFIRH+S +NTLTQARRNISRHYDLSNELFSLF+DETM YSCA+FKS+DED
Sbjct  123   FTAALSSATYFIRHVSNRNTLTQARRNISRHYDLSNELFSLFMDETMLYSCAIFKSKDED  182

Query  2258  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2437
             LK AQ+RK+S+LI+KAKISKEHHILEIG GWG  A+E V++TGCKYTGITLSEQQL+YA+
Sbjct  183   LKVAQLRKMSILIEKAKISKEHHILEIGFGWGGFAVEVVKQTGCKYTGITLSEQQLEYAQ  242

Query  2438  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2617
              +V +AGLQD I  LLCDYRQ+P+  +YDRII CE+LE VGHEF+ EFF  CES L E+G
Sbjct  243   LRVEQAGLQDQITLLLCDYRQMPNQDKYDRIIVCEVLEHVGHEFIGEFFSCCESALTEDG  302

Query  2618  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGI  2797
             +LVLQFIS+PD  YDEYR S+ FI EYIFPGGCLP+LSRVTSAMAA+SRLCV HLEDIG+
Sbjct  303   LLVLQFISMPDPMYDEYRHSAGFINEYIFPGGCLPALSRVTSAMAAASRLCVVHLEDIGV  362

Query  2798  HYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2977
             HYYQTLRCWR NFL+ +SQI  LGFD KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPG
Sbjct  363   HYYQTLRCWRKNFLKNKSQIHALGFDDKFIRTWEYYFDYCAAGFKTHTLGDYQIVFSRPG  422

Query  2978  NVTAFGDPYK-GLASAY  3025
             NV  FGDPY   + SAY
Sbjct  423   NVATFGDPYNVTMPSAY  439



>gb|KCW60259.1| hypothetical protein EUGRSUZ_H029682, partial [Eucalyptus grandis]
Length=458

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/451 (73%), Positives = 384/451 (85%), Gaps = 0/451 (0%)
 Frame = +2

Query  1652  AGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFT  1831
              GM AAHG++ +    L+NP HMVPS  E GAR  VT FL  +I TG I LLEEGGT+FT
Sbjct  1     GGMAAAHGVIGQSHFLLDNPQHMVPSLKEIGARFFVTGFLRRYISTGLITLLEEGGTMFT  60

Query  1832  FEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVA  2011
             FEGT K+  L V +R+HSP+FYWKV TQADLGLADAYI+GD S VDK +GLLNLF+I +A
Sbjct  61    FEGTTKRCPLTVTLRIHSPEFYWKVMTQADLGLADAYINGDFSCVDKNKGLLNLFQILIA  120

Query  2012  NRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNEL  2191
             NRD   ++S+ + +RGWWTP+L T+ IASAKYF +HI RQNTLTQARRNIS+HYDLSNEL
Sbjct  121   NRDSDITMSKLSKRRGWWTPMLSTAGIASAKYFFKHILRQNTLTQARRNISQHYDLSNEL  180

Query  2192  FSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEA  2371
             FSLFLDETMTYSCAVF+   EDLK AQMRKISLLI KA+I K H +LEIGCGWGSLAIE 
Sbjct  181   FSLFLDETMTYSCAVFEMAGEDLKAAQMRKISLLIKKARIEKTHEVLEIGCGWGSLAIEV  240

Query  2372  VERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLE  2551
             V +TGCKYTGITLS++QLKYA+ +V+EAGLQD+I+F+LCDYRQLP   +YDRIISCEM+E
Sbjct  241   VRQTGCKYTGITLSKEQLKYAKSRVKEAGLQDSIKFILCDYRQLPSAYKYDRIISCEMIE  300

Query  2552  AVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLS  2731
             AVGHE+M EFF  CESVLA++G+LVLQF SIPDERY+EYRQSSDFIKEYIFPG C+PSLS
Sbjct  301   AVGHEYMEEFFSCCESVLAKDGLLVLQFTSIPDERYEEYRQSSDFIKEYIFPGCCVPSLS  360

Query  2732  RVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFD  2911
             R+TSAMA++SRL VEH+++IGIH+YQTLRCWR NF+E+Q +IL LGF++KFIRTWEYYFD
Sbjct  361   RITSAMASASRLSVEHVDNIGIHFYQTLRCWRKNFMEKQRKILALGFNEKFIRTWEYYFD  420

Query  2912  YCAAGFHTCTLGDYQIVFSRPGNVTAFGDPY  3004
             YCAAGF + TLG+YQIVFSRPGN  AF D Y
Sbjct  421   YCAAGFKSHTLGNYQIVFSRPGNEAAFTDLY  451



>ref|XP_008677861.1| PREDICTED: uncharacterized protein LOC103652693 isoform X2 [Zea 
mays]
Length=834

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/654 (54%), Positives = 470/654 (72%), Gaps = 20/654 (3%)
 Frame = +2

Query  893   LTLFQCVLPYGPVHQKG*WPSLLT-PFFHSVATTTFCRISLQLFGRPQWLTVKRRSHSYV  1069
             + +  C+ P  P H+   +P+L    FF            L++    +WLTVK  S SYV
Sbjct  192   IPMCACIWP-SPSHEILGFPALFVLSFFRDNQL-------LEILSGSKWLTVKGGSGSYV  243

Query  1070  NKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTL  1249
             NK+REELE  GC+I+ GCEV+S+S    G    ++ + G     E YD  I+  +A D L
Sbjct  244   NKIREELESNGCQIKIGCEVNSISKSNDGYQ--ILEVDGS---VETYDRIIIGINAHDAL  298

Query  1250  KMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWL  1429
             K+LG +AT +EL+ LGAF ++ S  YLH ++S MPRN +AWSA NFLGT ++ VC+T WL
Sbjct  299   KVLGAEATNEELKNLGAFHFIRSIAYLHSDESLMPRNSSAWSARNFLGTTSSGVCVTSWL  358

Query  1430  NTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFC  1609
             N L+N+ ++  P LVTLNPPR P   LLK    HP+PS+AA++A+ +L  IQGKR IWFC
Sbjct  359   NILENI-ESAGPLLVTLNPPRVPNHVLLKCHISHPIPSIAAAKANLQLNSIQGKRGIWFC  417

Query  1610  GAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVT  1789
             G+YQGYG+HED +KAG  AA GLL ++C  L+NP  MV SW E GARLLV R L  +I  
Sbjct  418   GSYQGYGYHEDSVKAGKAAALGLLGRKCDLLSNPKPMVSSWTEAGARLLVARSLDQYITI  477

Query  1790  GSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVD  1969
             G+  +LEEGGT F+F    +K  +K  +RVH PQFYWK AT+ DLG A AYI+G ISFVD
Sbjct  478   GNFCILEEGGTTFSFGKACEKCHVKSAIRVHDPQFYWKAATEGDLGFASAYINGQISFVD  537

Query  1970  KKEGLLNLFKIFVANRD----LSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNT  2137
              ++GL+NL +I +ANR     LS++ S  N+++ WW+PLL  + ++ AKYF+RH  R+N+
Sbjct  538   HRKGLVNLVRIILANRGEFKRLSSTAS-GNTRKAWWSPLLGITGVSFAKYFLRHALRKNS  596

Query  2138  LTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISK  2317
             +++AR+NIS HYDLSN+ F+L+LD +MTYS  +FK  +E L+TAQ+RK+  LI+KAK+  
Sbjct  597   VSKARKNISEHYDLSNDFFALYLDPSMTYSSGIFKVAEESLETAQLRKLDSLINKAKVEP  656

Query  2318  EHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYR  2497
              HH+L+IGCGWG+LAI  V++TGCKYTGITLSE+QLKYA+ KV+E+GL+D I  LLCDYR
Sbjct  657   GHHVLDIGCGWGTLAIRLVKQTGCKYTGITLSEEQLKYAKRKVKESGLEDRITLLLCDYR  716

Query  2498  QLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQS  2677
             QLP   ++DRIISCEM+E VGHE+M++FFG CE  LAE+G+LVLQ I++P+E YD+ R  
Sbjct  717   QLPAGDKFDRIISCEMIEHVGHEYMDDFFGCCEYHLAEHGLLVLQSIALPEELYDKMRMR  776

Query  2678  SDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFL  2839
              +F+K YIFPGGCLPSL R+ SAM+ +SRL ++HLE+IG HYY TL  WR NF+
Sbjct  777   PEFLKTYIFPGGCLPSLGRIVSAMSNASRLNIQHLENIGDHYYTTLMNWRDNFV  830


 Score =   222 bits (566),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 154/218 (71%), Gaps = 13/218 (6%)
 Frame = +1

Query  400   KMRVAVVGAGISGLVSAYVLAK-GGAGVVVYEKEDYLGGHAKTVTLDG------VDLDLG  558
             +MRVA+VG+G+SGLV+A+ LA+ GG  V VYEKED+LGG AKTV +DG      V +DLG
Sbjct  18    EMRVAMVGSGLSGLVAAHELARSGGVRVTVYEKEDHLGG-AKTVAVDGGAEEGRVLVDLG  76

Query  559   FMVFNRVTYPNMMELFESLGVDMEISDMSFSVSL---DNGHGYEWGSRNGFSGLFAQKKN  729
              +VFN VT PN+ME FE LGV+M  SDMSFS S+    +   +EWGSR+G SG+ AQK N
Sbjct  77    PVVFNPVTSPNLMEWFERLGVEMCTSDMSFSASMRLNKSSESFEWGSRSGMSGVLAQKSN  136

Query  730   LLNPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPM  909
             LL+P FW ++ EI KFKN  L YLE+  + P+  RN+TLG+FI S  YS+LFQ AY+IPM
Sbjct  137   LLSPRFWLVVHEIFKFKNHALKYLEDHRSGPN--RNETLGQFILSHRYSQLFQDAYLIPM  194

Query  910   CASIWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             CA IW   S  ++ F A  +LSF R++ LL+  S + W
Sbjct  195   CACIWPSPSHEILGFPALFVLSFFRDNQLLEILSGSKW  232



>ref|XP_004247760.1| PREDICTED: uncharacterized protein LOC101261068 [Solanum lycopersicum]
Length=436

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/430 (75%), Positives = 366/430 (85%), Gaps = 1/430 (0%)
 Frame = +2

Query  1718  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1897
             + P+W ETGAR LVTRF  +FI TG IILLEEGG+ FTF+GT+ K  LKV + V S QFY
Sbjct  3     LSPTWTETGARHLVTRFFKNFIQTGCIILLEEGGSTFTFQGTEGKCSLKVSLTVRSMQFY  62

Query  1898  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2077
             WKVAT+AD+GLADA+IHGD SFVDK +GLLNL  IF+ANRDL ASV  SN KRGWWTPL 
Sbjct  63    WKVATRADIGLADAFIHGDFSFVDKNKGLLNLIMIFIANRDLKASVKTSNKKRGWWTPLF  122

Query  2078  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2257
             +T+A++SA YFIRH+S +NTLTQARRNISRHYDLSNELFSLF+DETM YSCA+FKSEDED
Sbjct  123   YTAALSSATYFIRHVSNRNTLTQARRNISRHYDLSNELFSLFMDETMLYSCAIFKSEDED  182

Query  2258  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2437
             LK AQ RK+S+LI+KAKISKEHHILEIG GWG  A+E V +TGCKYTGI+LSEQQL+YA+
Sbjct  183   LKVAQRRKMSVLIEKAKISKEHHILEIGFGWGGFAVEVVHQTGCKYTGISLSEQQLEYAQ  242

Query  2438  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2617
              +V +AGLQD I  LLCDYRQ+P+  +YDRII CE+LE VGHEF+ EFF  CES LAE+G
Sbjct  243   LRVEQAGLQDQITLLLCDYRQMPNKDKYDRIIVCEVLEHVGHEFIGEFFSCCESALAEDG  302

Query  2618  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGI  2797
             +LVLQFIS+PD  YDE R SS FIKEYIFPGG LP+LSRVTSAMA++SRLCV HLEDIG+
Sbjct  303   LLVLQFISLPDTMYDENRLSSGFIKEYIFPGGYLPALSRVTSAMASASRLCVVHLEDIGV  362

Query  2798  HYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2977
             HYYQTLRCWR NFL  +SQI  LGFD+KFIRTWEYYFDYCAAGF T TLGDYQIVFSRPG
Sbjct  363   HYYQTLRCWRKNFLNNKSQIRALGFDEKFIRTWEYYFDYCAAGFKTRTLGDYQIVFSRPG  422

Query  2978  NVTAFGD-PY  3004
             NV  FGD PY
Sbjct  423   NVATFGDHPY  432



>ref|XP_011013987.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
 ref|XP_011013989.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
 ref|XP_011013990.1| PREDICTED: (S)-coclaurine N-methyltransferase-like [Populus euphratica]
Length=460

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/462 (69%), Positives = 381/462 (82%), Gaps = 2/462 (0%)
 Frame = +2

Query  1658  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1837
             M AAH    +  + L +   M PS  E  ARL V +FL S I +  +I+ EEGG  FTFE
Sbjct  1     MAAAHCSSGETGAALIHGKQMAPSRLEAWARLFVNKFLGSHISSDRLIVEEEGGATFTFE  60

Query  1838  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2017
             GT KK  L+V+++VH+PQFYWKV T+AD+GLADAYI GD SF DK + LL+LF + +ANR
Sbjct  61    GTSKKCSLEVVLKVHNPQFYWKVTTRADIGLADAYIDGDFSFADKDQCLLDLFMVLIANR  120

Query  2018  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2197
             D + S+S++N KRGWWTP LFT+ IASAK+F++H+ RQNTLTQARRNISRHYDLSNE+FS
Sbjct  121   DANKSISKANKKRGWWTPSLFTAGIASAKFFLQHVLRQNTLTQARRNISRHYDLSNEVFS  180

Query  2198  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2377
             LFL ETM YS A+FK+EDEDL TAQ+RKIS+LI+KA+I K+H IL+IGCGWG+ AIE V+
Sbjct  181   LFLGETMAYSSAIFKTEDEDLNTAQLRKISVLIEKARIDKKHEILDIGCGWGTFAIEVVK  240

Query  2378  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2557
             +TGCKYTG+TLS +QLKYAE KV+EAGLQDNI+ LLCDYR+LP   +YDRI+SCEM+E V
Sbjct  241   QTGCKYTGLTLSVEQLKYAEMKVKEAGLQDNIKLLLCDYRELPKGYKYDRIVSCEMIEHV  300

Query  2558  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2737
             GHE+M +FF  CES LAE+G+LVLQFISI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+
Sbjct  301   GHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYRRSSDFIKEYIFPGGCLPSLSRI  360

Query  2738  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2917
             TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL +GFD+KFIRTWEYYFDYC
Sbjct  361   TSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKILAMGFDEKFIRTWEYYFDYC  420

Query  2918  AAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY*AHSLL  3043
             AAGF + TLGDYQ+VFSRPGNV A G+PYKG  SAY  H LL
Sbjct  421   AAGFKSYTLGDYQVVFSRPGNVVALGNPYKGFPSAY--HHLL  460



>emb|CDY67345.1| BnaCnng54600D [Brassica napus]
Length=454

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/457 (70%), Positives = 375/457 (82%), Gaps = 5/457 (1%)
 Frame = +2

Query  1658  MIAAHGLLKKRCSPL-NNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1834
             M AA  LL K   PL +NP HMVPS  E GAR L TRFL  FI TG + + EEGGT+FTF
Sbjct  1     MGAAQSLLGKDMVPLLSNPKHMVPSLTEKGARFLFTRFLRHFISTGCVTVYEEGGTMFTF  60

Query  1835  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2014
             +G D +  L+ ++++H+P FYWKV TQADLGLADAYI+GD SFV+K+ GLLNL  I +AN
Sbjct  61    KGKDLRCNLESVMKIHNPHFYWKVMTQADLGLADAYINGDFSFVNKETGLLNLIMILIAN  120

Query  2015  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2194
             R+L++       KRGWWTP+  T+ + SA  F++H SRQNTLT+ARRNISRHYDLSNELF
Sbjct  121   RELNSKNLNLAKKRGWWTPMFMTAGLTSATQFLKHFSRQNTLTKARRNISRHYDLSNELF  180

Query  2195  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2374
             SLFLD+TM+YS     S+DEDLKTAQMRKI+LLIDKA+I K H +LEIGCGWG+LAIE V
Sbjct  181   SLFLDDTMSYST----SDDEDLKTAQMRKINLLIDKARIEKNHEVLEIGCGWGTLAIEVV  236

Query  2375  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2554
             ++TGCKYTGITLS +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRIISCEM+E 
Sbjct  237   KKTGCKYTGITLSIEQLKYAEEKVKEAGLQDRITFELCDYRQLSDAKKYDRIISCEMIEH  296

Query  2555  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2734
             VGHEFM+ FF  CE+ LAE+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+R
Sbjct  297   VGHEFMDTFFSHCEAALAEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLAR  356

Query  2735  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2914
             V SAMA+SSRL VE++E+IG+HYYQTLRCWR NFLE Q QI+DLGFD KFIRTWEYYFDY
Sbjct  357   VISAMASSSRLSVENVENIGLHYYQTLRCWRKNFLENQKQIMDLGFDDKFIRTWEYYFDY  416

Query  2915  CAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             CAAGF T TL DYQ+VFSRPGNV AFGDP++   SA+
Sbjct  417   CAAGFKTLTLEDYQVVFSRPGNVAAFGDPFRNFPSAH  453



>ref|XP_002314497.2| hypothetical protein POPTR_0010s07830g, partial [Populus trichocarpa]
 gb|EEF00668.2| hypothetical protein POPTR_0010s07830g, partial [Populus trichocarpa]
Length=464

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/460 (68%), Positives = 380/460 (83%), Gaps = 0/460 (0%)
 Frame = +2

Query  1646  LKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTV  1825
             L A M AA+    + C+ L +   M PS  +  ARL VT+FL S I T  +IL E+GG  
Sbjct  1     LVASMAAANCSSGETCAALIHGKQMAPSRLQAWARLFVTKFLGSHISTDHLILEEDGGAT  60

Query  1826  FTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIF  2005
             FTFEGT K+  L+V+++VH+P+FYWKV T+AD+GLADAYI GD SF DK +GLL+L  + 
Sbjct  61    FTFEGTSKRFSLEVVLKVHNPRFYWKVTTRADIGLADAYIDGDYSFADKDQGLLHLIMVL  120

Query  2006  VANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSN  2185
             +ANRD + S+S++N+KRGWWTP LFT+ IASAK+F++H+ RQNTLTQARRNISRHYDLSN
Sbjct  121   IANRDANKSISKANNKRGWWTPSLFTAGIASAKFFLQHVLRQNTLTQARRNISRHYDLSN  180

Query  2186  ELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAI  2365
             E+FSLFL ETM YSCA+FK+EDEDL TAQ+RKIS+LI+KA+I K+H ILEIGCGWG+ AI
Sbjct  181   EVFSLFLGETMAYSCAIFKTEDEDLNTAQLRKISVLIEKARIDKKHEILEIGCGWGTFAI  240

Query  2366  EAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEM  2545
             E V++TGCKYTG+TLS +QLKYAE KV+EAGLQDNIR LLCDYR+LP+  +YDRI+SCEM
Sbjct  241   EVVKQTGCKYTGLTLSVEQLKYAEMKVKEAGLQDNIRLLLCDYRELPEGYKYDRIVSCEM  300

Query  2546  LEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPS  2725
             +E VGHE+M +FF  CES LAE+G+LVLQ  SI DERYDEYR+SSDFIKEYIFPGGCLPS
Sbjct  301   IEHVGHEYMEDFFSSCESALAEDGLLVLQSTSIADERYDEYRRSSDFIKEYIFPGGCLPS  360

Query  2726  LSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYY  2905
             LSR+TSAM  +SRLCVEH+E+IG HYY TLRCW+  FLE +S+IL +GFD+KFIRTWEYY
Sbjct  361   LSRITSAMGVASRLCVEHVENIGSHYYLTLRCWKKYFLENKSKILAMGFDEKFIRTWEYY  420

Query  2906  FDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             FDY AAGF +  LG+YQIVFSRPGNV   G+PYKG  SAY
Sbjct  421   FDYSAAGFKSYALGNYQIVFSRPGNVGVLGNPYKGFPSAY  460



>ref|XP_002314494.2| hypothetical protein POPTR_0010s07840g [Populus trichocarpa]
 gb|EEF00665.2| hypothetical protein POPTR_0010s07840g [Populus trichocarpa]
Length=460

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/456 (68%), Positives = 375/456 (82%), Gaps = 0/456 (0%)
 Frame = +2

Query  1658  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1837
             M AA+    + C+ L +   M PS  E  ARL VT+FL   I T  +IL EEGG  FTFE
Sbjct  1     MAAANCSSGETCAALIHGKQMAPSRLEAWARLFVTKFLGRHISTHRLILEEEGGATFTFE  60

Query  1838  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2017
             GT KK  L+V+++VH+PQFYWKV T+AD+GLADAYI GD SF DK +GLL+L  + +ANR
Sbjct  61    GTSKKCSLEVVLKVHNPQFYWKVTTRADIGLADAYIDGDFSFADKDQGLLHLIMVLIANR  120

Query  2018  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2197
             D + S+S++  KRGWWTP LFT+ IASAK+F++H+ RQNTLTQARRNISRHYDLSNE+FS
Sbjct  121   DANRSISQAKRKRGWWTPSLFTAGIASAKFFLQHVLRQNTLTQARRNISRHYDLSNEVFS  180

Query  2198  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2377
             LFL ETM YS A+FK+E EDL TAQ+RKIS+LI+KA+I K+H IL+IGCGWG+ AIE V+
Sbjct  181   LFLGETMAYSSAIFKTEGEDLNTAQLRKISVLIEKARIDKKHEILDIGCGWGTFAIEVVK  240

Query  2378  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2557
             +TGCKYTG++LS +QLKYAE KV+EAGLQDNIR LLCDYR+LP   +YDRI+SCEM+E V
Sbjct  241   QTGCKYTGLSLSVEQLKYAEMKVKEAGLQDNIRLLLCDYRELPKGYKYDRIVSCEMIEHV  300

Query  2558  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2737
             GHE+M +FF  CES LAE+G+LVLQFISI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+
Sbjct  301   GHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYRRSSDFIKEYIFPGGCLPSLSRI  360

Query  2738  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2917
             TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL +GFD+KFIRTWEYYFDY 
Sbjct  361   TSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKILAMGFDEKFIRTWEYYFDYS  420

Query  2918  AAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             +AGF + TL DYQ+VFSRPGNV A G+PYKG  SAY
Sbjct  421   SAGFKSYTLRDYQVVFSRPGNVEALGNPYKGFPSAY  456



>ref|XP_002314496.2| hypothetical protein POPTR_0010s07820g [Populus trichocarpa]
 gb|EEF00667.2| hypothetical protein POPTR_0010s07820g [Populus trichocarpa]
Length=460

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/456 (67%), Positives = 374/456 (82%), Gaps = 0/456 (0%)
 Frame = +2

Query  1658  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1837
             M AA+    + C+ L +   M PS  +  ARL VT+FL   I T  +IL E+GG  FTFE
Sbjct  1     MAAANCSSGETCAALIHGKQMAPSRLQAWARLFVTKFLGRHISTDHLILEEDGGATFTFE  60

Query  1838  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2017
             GT K+  L+V+++VH+P+FYWKV T+AD+GLADAYI GD SF DK +GLL+L  + +ANR
Sbjct  61    GTSKRFSLEVVLKVHNPRFYWKVTTRADIGLADAYIDGDFSFADKDQGLLHLIMVLIANR  120

Query  2018  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2197
             D + S+S++N KRGWWTP LFT+ IASAK+F++H+ RQNTLTQARRNISRHYDLSNE+FS
Sbjct  121   DANKSISKANKKRGWWTPSLFTAGIASAKFFLQHVLRQNTLTQARRNISRHYDLSNEVFS  180

Query  2198  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2377
             LFL ETM YSCA+FK+EDEDL TAQ+RKIS+LI+KA+I K+H IL+IGCGWG+ AIE V+
Sbjct  181   LFLGETMAYSCAIFKTEDEDLNTAQLRKISVLIEKARIDKKHEILDIGCGWGTFAIEVVK  240

Query  2378  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2557
             +TGCKYTG+TLS +QLKYAE KV+EAGLQDNIR LLCDYR+LP   +YDRI+SCEM+E V
Sbjct  241   QTGCKYTGLTLSVEQLKYAEMKVKEAGLQDNIRLLLCDYRELPQGYKYDRIVSCEMIEHV  300

Query  2558  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2737
             GHE+M +FF  CES LAE+G+LVLQ  SI DERYDEYR+SSDFIKEYIFPG C+PSLSR+
Sbjct  301   GHEYMEDFFSSCESALAEDGLLVLQSTSIADERYDEYRRSSDFIKEYIFPGACVPSLSRI  360

Query  2738  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2917
             TSAM  +SRLCVEH+E+IG HYY TLRCW+  FLE +S+IL +GFD+KFIRTWEYYFDY 
Sbjct  361   TSAMGVASRLCVEHVENIGSHYYLTLRCWKKYFLENKSKILAMGFDEKFIRTWEYYFDYS  420

Query  2918  AAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             AAGF +  LG+YQIVFSRPGNV   G+PYKG  SAY
Sbjct  421   AAGFKSYALGNYQIVFSRPGNVGVLGNPYKGFPSAY  456



>ref|XP_007035212.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 4 [Theobroma 
cacao]
 gb|EOY06138.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 4 [Theobroma 
cacao]
Length=672

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/464 (70%), Positives = 388/464 (84%), Gaps = 7/464 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQW+TV+ RSH YVNKVR+ELE RGC+IR GCEVHSV T
Sbjct  184   FSAFSILSFCRNHHLLQLFGRPQWMTVRWRSHRYVNKVRKELESRGCQIRTGCEVHSVLT  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
                 +A G  ++ G +  QE Y+GC+MA HAPD L++LG QAT+DELR+LGAFQYVYSDI
Sbjct  244   ----TAEGCTVLCGDD-SQETYEGCVMAVHAPDALRLLGNQATYDELRVLGAFQYVYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++ MP+N AAWSAWNFLG+ + +VCLTYWLN LQNLG+T  P+LVTLNP   P+Q
Sbjct  299   FLHRDKNLMPKNPAAWSAWNFLGSTDKKVCLTYWLNVLQNLGETSLPFLVTLNPDYIPQQ  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW TGHPVPSVAA++AS EL++IQGKR IWFCGAYQGYGFHEDGLKAG +AA+G+L 
Sbjct  359   TLLKWKTGHPVPSVAATKASLELDQIQGKRGIWFCGAYQGYGFHEDGLKAGTVAANGVLG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K CS L+NP HMVPS  ETGARL VTRFL+ FI+TGS+ILLEEGGT+FTFEGT  K  LK
Sbjct  419   KSCSILSNPKHMVPSLVETGARLFVTRFLSHFILTGSVILLEEGGTMFTFEGTSTKCPLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              +++VH+P  YWKV T+ADLGLADAYI+G+ SFVDKKEGLLNL  I +ANRDL++S S+ 
Sbjct  479   TVLKVHNPHIYWKVMTEADLGLADAYINGEFSFVDKKEGLLNLIMILIANRDLNSSNSKL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + +RGWWTPLLFT+ + SAKYF++H+ R N+LTQARRNISRHYDLSN+LF+LFLDETMTY
Sbjct  539   SKQRGWWTPLLFTAGLTSAKYFLKHVLRHNSLTQARRNISRHYDLSNDLFALFLDETMTY  598

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGS  2356
             SCAVFK+EDEDLK AQ RKISLLI+KA+I  +H ILEIGCGW S
Sbjct  599   SCAVFKTEDEDLKDAQQRKISLLIEKARIDSKHEILEIGCGWSS  642


 Score =   347 bits (889),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+G GISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1     MRTAVIGGGISGLVSAYVLAKSGVNVVLYEKEDYLGGHAKTVNFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME SDMSF+VSLD G G EWGSRNG S LFA+K N+LNPYFW+M+R
Sbjct  61    YPNMMEFFESLGVDMEASDMSFAVSLDEGKGCEWGSRNGLSSLFAKKMNILNPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+DV+SYLE  +NNPD+DRN+TLG+FI+SRGYSELFQKAY++P+C SIWSC +E 
Sbjct  121   EISKFKDDVISYLEVLENNPDIDRNETLGQFIESRGYSELFQKAYLVPICGSIWSCPTER  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSA+SILSFCRNHHLLQ F    W
Sbjct  181   VMGFSAFSILSFCRNHHLLQLFGRPQW  207



>ref|XP_006378321.1| hypothetical protein POPTR_0010s07800g, partial [Populus trichocarpa]
 gb|ERP56118.1| hypothetical protein POPTR_0010s07800g, partial [Populus trichocarpa]
Length=466

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/462 (67%), Positives = 378/462 (82%), Gaps = 2/462 (0%)
 Frame = +2

Query  1646  LKAGMIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTV  1825
             L A M AA+    + C+ L +   M PS  +  ARL VT+FL S I T  +IL EEGG+ 
Sbjct  1     LVASMAAANCSSGETCAALIHGKQMAPSRLQAWARLFVTKFLGSHISTDHLILEEEGGST  60

Query  1826  FTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISF--VDKKEGLLNLFK  1999
             FTFEGT KK  L+V+++VH+PQFYWKV T+AD+GLADAYI  +  F  + K +GLL+LF 
Sbjct  61    FTFEGTSKKCSLEVVLKVHNPQFYWKVMTRADIGLADAYIKMEDLFCLLTKDQGLLDLFM  120

Query  2000  IFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDL  2179
             + +ANRD + S+S++N KRGWWTP LFT+ IASAK+F++H+ RQNTLTQARRNISRHYDL
Sbjct  121   VLIANRDANKSISKANKKRGWWTPSLFTAGIASAKFFLQHVLRQNTLTQARRNISRHYDL  180

Query  2180  SNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSL  2359
             SNE+FSLFL ETM YSCA+FK+EDEDL TAQ+RKIS+LI+KA+I K+H IL+IGCGWG+ 
Sbjct  181   SNEVFSLFLGETMAYSCAIFKTEDEDLNTAQLRKISVLIEKARIDKKHEILDIGCGWGTF  240

Query  2360  AIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISC  2539
             AIE V++TGCKYTG+TLS +QLKYAE KV+EAGLQDNIR LLCDYR+LP   +YDRI+SC
Sbjct  241   AIEVVKQTGCKYTGLTLSVEQLKYAEMKVKEAGLQDNIRLLLCDYRELPKGYKYDRIVSC  300

Query  2540  EMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCL  2719
             EM+E VGHE+M +FF  CES LAE+G+LVLQ ISI DE YDE+R+SS F++EYIFPGGCL
Sbjct  301   EMIEHVGHEYMEDFFSSCESALAEDGLLVLQSISIADECYDEHRRSSCFMREYIFPGGCL  360

Query  2720  PSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWE  2899
             PSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR  FLE +S+IL +GFD+KFIRTWE
Sbjct  361   PSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKTFLENKSKILAMGFDEKFIRTWE  420

Query  2900  YYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             YYFDYCAAGF + TLGDYQIVFSRPGNV   G+PYKG  SAY
Sbjct  421   YYFDYCAAGFKSYTLGDYQIVFSRPGNVGVLGNPYKGFPSAY  462



>ref|XP_010532687.1| PREDICTED: uncharacterized protein LOC104808653 isoform X3 [Tarenaya 
hassleriana]
Length=717

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/537 (62%), Positives = 403/537 (75%), Gaps = 6/537 (1%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +++  +F R +  LQ+FGRPQWLTV  RS +YV K+R ELE+RGC+IR   
Sbjct  183   PSDDVSSFSALSVLSFFRNNHLLQIFGRPQWLTVAGRSRTYVAKIRTELEQRGCKIRTRR  242

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV  V+T    S    V I   +  +E +D C++A +A D L++LG QATFDE R+LGAF
Sbjct  243   EVQWVTT----SVNNGVTIRNGDGSEEIFDRCLLAMNAQDALRLLGDQATFDERRVLGAF  298

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYV+SDIYLHR+  FMP   AAWSA NFL +  ++  +TYWLN LQNLG+ ++P+ VTLN
Sbjct  299   QYVHSDIYLHRDTDFMPHKTAAWSACNFLESTEHKGSITYWLNILQNLGEKQEPFFVTLN  358

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P R P++ LLKWTT   VPSVAA  AS +L++IQG+  +WFC + QGYGFHEDGLKAG+ 
Sbjct  359   PDRVPKKTLLKWTTARTVPSVAALTASQDLDKIQGQHGLWFCESCQGYGFHEDGLKAGIA  418

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA  LL+K    L NP  MV S  ETGARL VTRF+  FI TGSI LLEEGGT+F F G 
Sbjct  419   AARNLLRKDIGNLKNPKCMVLSLSETGARLFVTRFMEQFISTGSITLLEEGGTMFRFGGK  478

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
               K  L+ ++ +HSPQFYWKV T+ADLGLADAYI+GD SFVDK  GLLN+  I +ANRD+
Sbjct  479   HPKCNLRSVLTIHSPQFYWKVMTRADLGLADAYINGDFSFVDKDNGLLNMLMILIANRDM  538

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             ++  S    KRGWWTP+  T+ +AS  YF++H+SRQNTLTQARRNISRHYDLSNELF++F
Sbjct  539   NSLKSNLAKKRGWWTPMFLTAGLASVNYFLKHVSRQNTLTQARRNISRHYDLSNELFAMF  598

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETM YS A+F SEDEDLKTAQMRKISLLI+KA+I K H +LEIGCGWG+LAIE V RT
Sbjct  599   LDETMMYSAALFSSEDEDLKTAQMRKISLLIEKARIEKNHEVLEIGCGWGTLAIEVVRRT  658

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2554
             GC+YTGITLS +QLKYAE K REAGLQD I F LCDYRQL D+  YDRIISC ++ A
Sbjct  659   GCRYTGITLSVEQLKYAEAKAREAGLQDQITFQLCDYRQLSDSRVYDRIISCFVVSA  715


 Score =   267 bits (683),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 164/210 (78%), Gaps = 2/210 (1%)
 Frame = +1

Query  400   KMRVAVVGAGIS-GLVSAYVLAKGGAGVVVYEKEDYLGGHAK-TVTLDGVDLDLGFMVFN  573
             +MRVAV+G G S GL SAYVLA+ G GVV+YE+E  LGG+A  T+ +DG D+DLG ++FN
Sbjct  4     EMRVAVIGGGTSTGLASAYVLAREGLGVVLYEEEHCLGGNANDTIRVDGADVDLGLILFN  63

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQ  753
                 PNMME FE LG+DME+SDMS SVSLD+G G EWG+ NGFS LFAQK N+LNP+FW+
Sbjct  64    PAICPNMMEFFEDLGLDMEVSDMSLSVSLDSGGGTEWGTLNGFSSLFAQKSNVLNPFFWK  123

Query  754   MIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCS  933
             MIREI KFK+D   Y++E + + D+DR +TLG+F++S GYSELFQKAY++P+C SIWS  
Sbjct  124   MIREIAKFKDDASIYVDERERDRDLDRTETLGQFLRSYGYSELFQKAYLVPICGSIWSRP  183

Query  934   SEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
             S+ V +FSA S+LSF RN+HLLQ F    W
Sbjct  184   SDDVSSFSALSVLSFFRNNHLLQIFGRPQW  213



>emb|CDY18120.1| BnaA01g23810D [Brassica napus]
Length=460

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/455 (68%), Positives = 361/455 (79%), Gaps = 0/455 (0%)
 Frame = +2

Query  1658  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1837
             M AA  LL K  + L N  HM  S  E+GARL VTRFL  FI  G + +LE+GGT+FTF 
Sbjct  1     MEAARSLLGKGITLLKNLQHMALSVTESGARLFVTRFLRQFISIGCLTILEDGGTMFTFG  60

Query  1838  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2017
             G     LLK ++++HSPQFYWKV TQADLGLADAYI GD SFVDK+ G+LNL  I +ANR
Sbjct  61    GNYSNCLLKSILKIHSPQFYWKVMTQADLGLADAYISGDFSFVDKELGMLNLIMILIANR  120

Query  2018  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2197
             DLS+       KRGWWTP+  T+ +ASAKYF +H+SRQNTLTQARRNISRHYDLSNELFS
Sbjct  121   DLSSRKPNFAKKRGWWTPMFLTAGLASAKYFFKHVSRQNTLTQARRNISRHYDLSNELFS  180

Query  2198  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2377
             LF+D+TM YS AVFKS +EDL+TAQMRKI+LLI+KA+I K H +LE+GCGWG+LAIE V 
Sbjct  181   LFMDDTMAYSSAVFKSVNEDLRTAQMRKITLLIEKARIEKNHEVLELGCGWGTLAIEVVR  240

Query  2378  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2557
             RTGCKYTGITLS +QLKYAE KV+EA L+D I F LCDYRQL D  +Y+RII+CEM+EAV
Sbjct  241   RTGCKYTGITLSIEQLKYAEAKVKEARLEDRITFQLCDYRQLSDAQKYNRIIACEMIEAV  300

Query  2558  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2737
             GHEF   FF  CE  LA++GI V+QF ++P+E YDE R SS FI EYIFPGGCLPSL+RV
Sbjct  301   GHEFYEAFFSCCEVALAKDGIFVMQFTAVPEELYDETRLSSGFITEYIFPGGCLPSLARV  360

Query  2738  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2917
             TSAM++SSRLC+E +E+IGIHYY TLRCWR  FLE Q QI++LGFD KFIRTWEYYFDY 
Sbjct  361   TSAMSSSSRLCIEDVENIGIHYYYTLRCWRKRFLENQKQIMELGFDDKFIRTWEYYFDYV  420

Query  2918  AAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             AAGF T TL  YQIVFSRPGN+ AFGDP+    SA
Sbjct  421   AAGFKTLTLRSYQIVFSRPGNIAAFGDPFHSFPSA  455



>ref|XP_009107970.1| PREDICTED: uncharacterized protein LOC103833648 [Brassica rapa]
Length=460

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/455 (68%), Positives = 361/455 (79%), Gaps = 0/455 (0%)
 Frame = +2

Query  1658  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1837
             M AA  LL K  + L N  HM  S  E+GARL VTRFL  FI  G + +LE+GGT+FTF 
Sbjct  1     MEAARSLLGKGITLLKNLQHMALSVTESGARLFVTRFLRQFISIGCLTILEDGGTMFTFG  60

Query  1838  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2017
             G     LLK ++++HSPQFYWKV TQADLGLADAYI GD SFVDK+ G+LNL  I +ANR
Sbjct  61    GNYSNCLLKSILKIHSPQFYWKVMTQADLGLADAYISGDFSFVDKELGMLNLIMILIANR  120

Query  2018  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2197
             DLS+       KRGWWTP+  T+ +ASAKYF +H+SRQNTLTQARRNISRHYDLSNELFS
Sbjct  121   DLSSRKPNFAKKRGWWTPMFLTAGLASAKYFFKHVSRQNTLTQARRNISRHYDLSNELFS  180

Query  2198  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2377
             LF+D+TM YS AVFKS +EDL+TAQMRKI+LLI+KA+I K H +LE+GCGWG+LAIE V 
Sbjct  181   LFMDDTMAYSSAVFKSVNEDLRTAQMRKITLLIEKARIEKNHEVLELGCGWGTLAIEVVR  240

Query  2378  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2557
             RTGCKYTGITLS +QLKYAE KV+EA L+D I F LCDYRQL D  ++DRII+CEM+EAV
Sbjct  241   RTGCKYTGITLSIEQLKYAEAKVKEARLEDRITFQLCDYRQLSDAQKHDRIIACEMIEAV  300

Query  2558  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2737
             GHEF   FFG CE  LA++GI V+QF ++P+E YDE R SS FI EYIFPGGCLPSL+RV
Sbjct  301   GHEFYEAFFGCCEVALAKDGIFVMQFTAVPEELYDETRLSSGFITEYIFPGGCLPSLARV  360

Query  2738  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2917
             TSAM++SSRLC+E +E+IGIHYY TLRCWR  FLE Q QI++LGFD KFIRTWEYYFDY 
Sbjct  361   TSAMSSSSRLCIEDVENIGIHYYYTLRCWRKRFLENQKQIMELGFDDKFIRTWEYYFDYV  420

Query  2918  AAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASA  3022
             AAGF T TL  YQIVFSRPGN+ AFG P+    SA
Sbjct  421   AAGFKTLTLRSYQIVFSRPGNIAAFGHPFHSFPSA  455



>ref|NP_188989.2| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AAV84488.1| At3g23470 [Arabidopsis thaliana]
 gb|AAW30030.1| At3g23470 [Arabidopsis thaliana]
 gb|AEE76768.1| cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=461

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/452 (68%), Positives = 359/452 (79%), Gaps = 2/452 (0%)
 Frame = +2

Query  1658  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1837
             M+ A  LL K  + L    HMV S  E+GARL VTRFL  FI  G + +LEEGGT+F F 
Sbjct  1     MVIAQSLLWKEITLLKKIQHMVLSLTESGARLFVTRFLEQFISIGCVTILEEGGTMFIFG  60

Query  1838  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2017
               D    LK ++++HSPQFYWKV TQADLGLADAYI GD SFVDK  GLLNL  I +ANR
Sbjct  61    EKDSTCPLKSILKIHSPQFYWKVMTQADLGLADAYISGDFSFVDKDSGLLNLIMILIANR  120

Query  2018  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2197
             D  +  S    KRGWWTP+  T+ +AS KY+++H+ +QNTLTQAR+NIS HYDLSNE F 
Sbjct  121   DQRSPKSNLVKKRGWWTPVFLTAGLASVKYYLKHVLKQNTLTQARKNISSHYDLSNEFFG  180

Query  2198  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2377
             LF+D+TM YS A+FKSE+ED +TAQMRKISLLI+KA+I K H +LE+GCGWG+ AIE V+
Sbjct  181   LFMDDTMMYSSAIFKSENEDPRTAQMRKISLLIEKARIEKNHEVLEMGCGWGTFAIEVVK  240

Query  2378  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2557
             RTGCKYTGITLS +QLKYA+ KV+EAGLQ  I F+LCDYRQL D  +YDRII+CEM+EAV
Sbjct  241   RTGCKYTGITLSIEQLKYAKAKVKEAGLQGRITFMLCDYRQLSDARKYDRIIACEMIEAV  300

Query  2558  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2737
             GHEFM++FF  CE  LAENGI VLQF +IP+  YDE R +S FI EYIFPGGCLPSL+RV
Sbjct  301   GHEFMDKFFSCCEDALAENGIFVLQFTAIPEALYDESRLTSGFITEYIFPGGCLPSLARV  360

Query  2738  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2917
             TSAMA+SSRLC+E++E+IGIHYY TLRCWR NFLERQ QI+DLGFD KFIRTWEYYFDYC
Sbjct  361   TSAMASSSRLCIENVENIGIHYYHTLRCWRKNFLERQKQIIDLGFDDKFIRTWEYYFDYC  420

Query  2918  AAGFHTCTLGDYQIVFSRPGNVTAFG--DPYK  3007
             AAGF T TL  YQIVFSRPGNV AFG  DP++
Sbjct  421   AAGFKTLTLRSYQIVFSRPGNVAAFGDDDPFR  452



>ref|XP_011041421.1| PREDICTED: (S)-coclaurine N-methyltransferase-like, partial [Populus 
euphratica]
Length=419

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/408 (73%), Positives = 354/408 (87%), Gaps = 0/408 (0%)
 Frame = +2

Query  1802  LLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEG  1981
             L EEGG  FTFEGT KK  L+V+++VH+PQFYWKV T+AD+GLADAYI GD SF DK + 
Sbjct  8     LEEEGGATFTFEGTSKKCSLEVVLKVHNPQFYWKVTTRADIGLADAYIDGDFSFADKDQC  67

Query  1982  LLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNI  2161
             LL+LF + +ANRD + S+S++N KRGWWTP LFT+ IASAK+F++H+ RQNTLTQARRNI
Sbjct  68    LLDLFMVLIANRDANKSISKANKKRGWWTPSLFTAGIASAKFFLQHVLRQNTLTQARRNI  127

Query  2162  SRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIG  2341
             SRHYDLSNE+FSLFL ETM YS A+FK+EDEDL TAQ+RKIS+LI+KA+I K+H IL+IG
Sbjct  128   SRHYDLSNEVFSLFLGETMAYSSAIFKTEDEDLNTAQLRKISVLIEKARIDKKHEILDIG  187

Query  2342  CGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRY  2521
             CGWG+ AIE V++TGCKYTG+TLS +QLKYAE KV+EAGLQD+IR LLCDYR+LP   +Y
Sbjct  188   CGWGTFAIEVVKQTGCKYTGLTLSVEQLKYAEMKVKEAGLQDHIRLLLCDYRELPKGYKY  247

Query  2522  DRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYI  2701
             DRI+SCEM+E VGHE+M +FF  CES LAE+G+LVLQFISI DERYDEYR+SSDFIKEYI
Sbjct  248   DRIVSCEMIEHVGHEYMEDFFSSCESALAEDGLLVLQFISIADERYDEYRRSSDFIKEYI  307

Query  2702  FPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKK  2881
             FPGGCLPSLSR+TSAM  +SRLCVEH+E+IG HYY TLR WR NFLE +S+IL +GFD+K
Sbjct  308   FPGGCLPSLSRITSAMGVASRLCVEHVENIGSHYYHTLRRWRKNFLENKSKILAMGFDEK  367

Query  2882  FIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             FIRTWEYYFDYCAAGF + TLGDYQ+VFSRPGNV A G+PYKG  SAY
Sbjct  368   FIRTWEYYFDYCAAGFKSYTLGDYQVVFSRPGNVVALGNPYKGFPSAY  415



>ref|XP_010936016.1| PREDICTED: uncharacterized protein LOC105055750 isoform X3 [Elaeis 
guineensis]
Length=677

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/507 (64%), Positives = 400/507 (79%), Gaps = 8/507 (2%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    LQLFGRPQWLTVK+RSH YV KV  ELE R C+IR G 
Sbjct  177   PSEGVMSFSAFSVLSFCRNHHLLQLFGRPQWLTVKQRSHCYVRKVTGELESRYCQIRTGY  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
              V SV + +    GG  ++ G++  +E YDGCI++ HAPD LK+LG QAT++E R+LGA+
Sbjct  237   AVQSVLSID----GGCCVV-GEDQSKETYDGCIISIHAPDALKILGTQATYEESRLLGAY  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             QYVYSDIYLH ++S MP+N +AWSAWNFLGT NN VC+TYWLN LQNLG T  P+LVTLN
Sbjct  292   QYVYSDIYLHHDKSLMPQNPSAWSAWNFLGTTNNGVCVTYWLNVLQNLGSTNMPFLVTLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P   PE  LLKWTT HP+PSVAAS+AS ELE+IQGKR IWFCGAYQG+GFHEDG+K G++
Sbjct  352   PYFVPEHILLKWTTSHPIPSVAASKASLELEKIQGKRGIWFCGAYQGFGFHEDGVKTGIV  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
             AA+ +L K C  L NP HMVPS  ETGARL+VTRFL  ++ TG + LLEEGGT+F FEGT
Sbjct  412   AANSVLGKDCVILRNPRHMVPSLVETGARLIVTRFLEKYVATGCLTLLEEGGTIFVFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
             +KK+ +K ++++H P FYWKVAT+ADLGLA AYI+   S VD++EGLL+LF I + NRDL
Sbjct  472   NKKSCVKSILKIHDPLFYWKVATEADLGLAYAYINRYFSVVDEQEGLLDLFMILIVNRDL  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLF  2203
             + S  +S ++RGWWTP+LFT+ + SA+YF+RHISR N + Q  +NISRHYDLSNE FSLF
Sbjct  532   NYSC-KSKTRRGWWTPILFTAGLQSARYFLRHISRHNAVAQTPKNISRHYDLSNEFFSLF  590

Query  2204  LDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERT  2383
             LDETMTYSCA+FK E+EDLK AQ+RKISLLI+KA+I  +H IL+IGCGWGSLAIE   +T
Sbjct  591   LDETMTYSCAIFKMENEDLKVAQLRKISLLIEKARIKAKHEILDIGCGWGSLAIEVARQT  650

Query  2384  GCKYTGITLSEQQLKYAEDKVREAGLQ  2464
             GCKYTGITLSE+QLK+A+ + +EA L+
Sbjct  651   GCKYTGITLSEEQLKFAKRRAQEACLE  677


 Score =   345 bits (884),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/216 (75%), Positives = 183/216 (85%), Gaps = 2/216 (1%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MRVA+VGAGISGLVSAYVLAK G  VV+YEKEDYLGGHA+TV  DGV LDLGFMVFNRVT
Sbjct  1     MRVAIVGAGISGLVSAYVLAKAGVDVVLYEKEDYLGGHARTVNFDGVHLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDMEISDMSFSVSLD G G EWGSRNG + LFAQK N +NPYFWQM++
Sbjct  61    YPNMMEFFESLGVDMEISDMSFSVSLDEGKGCEWGSRNGLASLFAQKSNAINPYFWQMLQ  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+DV+ YL+E +NNPD+D ++TL  FIKS GYS+LFQKAY++P+CASIWSC SEG
Sbjct  121   EIFKFKHDVIKYLDEHENNPDLDHDETLEHFIKSHGYSQLFQKAYLVPICASIWSCPSEG  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW--SPTMAHC  1044
             VM+FSA+S+LSFCRNHHLLQ F    W      +HC
Sbjct  181   VMSFSAFSVLSFCRNHHLLQLFGRPQWLTVKQRSHC  216



>ref|XP_010532682.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X1 [Tarenaya hassleriana]
Length=440

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/435 (69%), Positives = 352/435 (81%), Gaps = 0/435 (0%)
 Frame = +2

Query  1718  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1897
             M PS+ ET AR  VTRF+  +I TG + L+E+GGT F F G   K  LK ++++HSPQFY
Sbjct  1     MAPSFVETAARAFVTRFMGQYISTGYVTLVEDGGTTFEFGGKHPKCTLKSVMKIHSPQFY  60

Query  1898  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2077
             WKV T+AD+GLADAYI GDISF DK EGLLNL  I +ANRDL++S S    KR WW P+ 
Sbjct  61    WKVMTEADIGLADAYISGDISFADKDEGLLNLIVILIANRDLNSSKSNLAEKRRWWKPMF  120

Query  2078  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2257
             FT+ +ASAKYF++H+ R+NTLTQARRNIS HYDLSNELF+LF+DETM YSCAVFKS+DED
Sbjct  121   FTAGLASAKYFLKHVFRKNTLTQARRNISDHYDLSNELFALFMDETMAYSCAVFKSDDED  180

Query  2258  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2437
             L+TAQ RKISLLIDKA+I K H +LEIGCGWG+LAIE V RTGCKYTGITLS +QLKYAE
Sbjct  181   LRTAQTRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTGCKYTGITLSIEQLKYAE  240

Query  2438  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2617
              KV+E GL+D I F L DYRQL D+ +YDRIISCEM+EAVGH+FM  FF RCES LAE G
Sbjct  241   AKVKEEGLEDRITFELRDYRQLSDSRKYDRIISCEMIEAVGHKFMETFFNRCESALAEEG  300

Query  2618  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGI  2797
             +LVLQF ++PD RYDE R S  FI EYIFPG C PSL+RVTSAMA+SSRLC+EH+E+IGI
Sbjct  301   LLVLQFSAVPDSRYDESRLSPGFITEYIFPGACHPSLARVTSAMASSSRLCIEHVENIGI  360

Query  2798  HYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2977
             HY++TLRCWR NFL+RQ ++  +GFD+KFIR WEYYFDYCAAGF T  L  YQ+VFSRPG
Sbjct  361   HYHKTLRCWRQNFLKRQEEVKAIGFDEKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPG  420

Query  2978  NVTAFGDPYKGLASA  3022
             N T FGDPY    SA
Sbjct  421   NTTMFGDPYMSYPSA  435



>ref|XP_010488415.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase-like 
[Camelina sativa]
Length=455

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/453 (68%), Positives = 362/453 (80%), Gaps = 11/453 (2%)
 Frame = +2

Query  1658  MIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1834
             M+AA GLL K   +   N N MV S  E   R   TRFL  FI TG + ++E G T+ TF
Sbjct  1     MVAAQGLLGKDMVTSSRNQNRMVLSLTEKVVRFFFTRFLTKFISTGCVTIIE-GETMVTF  59

Query  1835  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2014
             +G D    LK  + +HSPQFYWKV T++DLGLADAYI+GD SF +K+ GLLNL  I +AN
Sbjct  60    QGEDLSCHLKSELEIHSPQFYWKVMTRSDLGLADAYINGDFSFCNKETGLLNLIMILIAN  119

Query  2015  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2194
             RDL+ S++++   RGWW P+  T+ +A+AK+F R    QNTLTQARRNISRHYDLSNELF
Sbjct  120   RDLNFSLAKN---RGWWNPMFLTTGLAAAKHFYR----QNTLTQARRNISRHYDLSNELF  172

Query  2195  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2374
             +LFLD+TM+YS AVFKS DEDL+ AQMRKI LLIDKA+I K H +L+IGCGWG+LAIEAV
Sbjct  173   ALFLDDTMSYSSAVFKSGDEDLRIAQMRKIYLLIDKARIKKNHEVLDIGCGWGTLAIEAV  232

Query  2375  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2554
              RTGCKYTGITLS +QLKYAE K +EAGL+D I F LCDYRQL D  +YDRIISCEMLE 
Sbjct  233   RRTGCKYTGITLSVEQLKYAEAKAKEAGLEDRITFKLCDYRQLSDAQKYDRIISCEMLEH  292

Query  2555  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2734
              GHEFM  FF  CE+ L E+GI ++QFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+R
Sbjct  293   AGHEFMETFFSHCEAALTEDGITIIQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLAR  352

Query  2735  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2914
             VTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+R +QI+DLGFD KFIRTWEYYFDY
Sbjct  353   VTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRHNQIMDLGFDDKFIRTWEYYFDY  412

Query  2915  CAAGFHTCTLGDYQIVFSRPGNVTAFG--DPYK  3007
             CAAGF T TLGDYQIVFSRPGNV AFG  DP++
Sbjct  413   CAAGFKTRTLGDYQIVFSRPGNVAAFGDDDPFR  445



>ref|XP_010532683.1| PREDICTED: (S)-coclaurine N-methyltransferase-like isoform X2 
[Tarenaya hassleriana]
Length=438

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/435 (68%), Positives = 349/435 (80%), Gaps = 2/435 (0%)
 Frame = +2

Query  1718  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1897
             M PS+ ET AR  VTRF+  +I TG + L+E+GGT F F G   K  LK ++++HSPQFY
Sbjct  1     MAPSFVETAARAFVTRFMGQYISTGYVTLVEDGGTTFEFGGKHPKCTLKSVMKIHSPQFY  60

Query  1898  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2077
             WKV T+AD+GLADAYI GDISF DK EGLLNL  I +ANRDL++S S    KR WW P+ 
Sbjct  61    WKVMTEADIGLADAYISGDISFADKDEGLLNLIVILIANRDLNSSKSNLAEKRRWWKPMF  120

Query  2078  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2257
             FT+ +ASAKYF++H+ R+NTLTQARRNIS HYDLSNELF+LF+DETM YSCAVFKS+DED
Sbjct  121   FTAGLASAKYFLKHVFRKNTLTQARRNISDHYDLSNELFALFMDETMAYSCAVFKSDDED  180

Query  2258  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2437
             L+TAQ RKISLLIDKA+I K H +LEIGCGWG+LAIE V RTGCKYTGITLS +QLKYAE
Sbjct  181   LRTAQTRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTGCKYTGITLSIEQLKYAE  240

Query  2438  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2617
              KV+E GL+D I F L DYRQL D+ +YDRIISCEM+EAVGH+FM  FF RCES LAE G
Sbjct  241   AKVKEEGLEDRITFELRDYRQLSDSRKYDRIISCEMIEAVGHKFMETFFNRCESALAEEG  300

Query  2618  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGI  2797
             +LVLQF ++PD RYDE R S  FI EYIFPG C PSL+RVTSAMA+SS   +EH+E+IGI
Sbjct  301   LLVLQFSAVPDSRYDESRLSPGFITEYIFPGACHPSLARVTSAMASSS--SIEHVENIGI  358

Query  2798  HYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2977
             HY++TLRCWR NFL+RQ ++  +GFD+KFIR WEYYFDYCAAGF T  L  YQ+VFSRPG
Sbjct  359   HYHKTLRCWRQNFLKRQEEVKAIGFDEKFIRKWEYYFDYCAAGFKTLALEVYQVVFSRPG  418

Query  2978  NVTAFGDPYKGLASA  3022
             N T FGDPY    SA
Sbjct  419   NTTMFGDPYMSYPSA  433



>ref|XP_007035217.1| Cyclopropane fatty acid synthase isoform 1 [Theobroma cacao]
 gb|EOY06143.1| Cyclopropane fatty acid synthase isoform 1 [Theobroma cacao]
Length=433

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/430 (68%), Positives = 358/430 (83%), Gaps = 0/430 (0%)
 Frame = +2

Query  1736  ETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQ  1915
             ET AR +V +F   +I TG +ILLEE GTV TF G+ +K  LKV+++VH+PQFYWK+ T+
Sbjct  2     ETMARHIVIKFFEQYISTGCVILLEEEGTVLTFTGSMEKCSLKVVLKVHNPQFYWKIMTE  61

Query  1916  ADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIA  2095
             ADLGLADAYI GD SF DK+EGLLNLF IF+ANR   +S S  N KRGWW P LFT++I+
Sbjct  62    ADLGLADAYIQGDFSFEDKEEGLLNLFLIFIANRVSDSSASGLNKKRGWWAPALFTASIS  121

Query  2096  SAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQM  2275
             SAKYF++H+ RQNTL QARRNISRHY+LSNELF LFLDE M YS A+FK+E+EDLK AQ+
Sbjct  122   SAKYFLKHVLRQNTLIQARRNISRHYNLSNELFELFLDEKMQYSSAIFKAENEDLKVAQL  181

Query  2276  RKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREA  2455
             RKIS LIDKA+I K H +++IGCGWG  AIE V+RTGCKYTG+TLSE+QLKYAE KV+EA
Sbjct  182   RKISSLIDKARIEKGHEVIDIGCGWGYFAIEVVKRTGCKYTGVTLSEEQLKYAEAKVKEA  241

Query  2456  GLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQF  2635
             GLQDNIRFLLCDYRQLP+  +YDRIISCEM+E VG+E++ EFF  CES+LA++G+ VLQF
Sbjct  242   GLQDNIRFLLCDYRQLPETGKYDRIISCEMIEHVGNEYIEEFFRCCESILAKDGLFVLQF  301

Query  2636  ISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTL  2815
             IS+ +E++ E+ +S  F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTL
Sbjct  302   ISMTEEQFPEHLRSPGFVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTL  361

Query  2816  RCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG  2995
             RCWR NFLE +S+IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A G
Sbjct  362   RCWRKNFLENKSKILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALG  421

Query  2996  DPYKGLASAY  3025
             DPY+G   AY
Sbjct  422   DPYQGFPLAY  431



>ref|XP_004296401.1| PREDICTED: cyclopropane-fatty-acyl-phospholipid synthase-like 
[Fragaria vesca subsp. vesca]
Length=455

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/457 (66%), Positives = 365/457 (80%), Gaps = 4/457 (1%)
 Frame = +2

Query  1658  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1837
             M AA G+L   C+ L N  HM  S  ET AR  VTRF   FI  G +ILLEEGGT+FTFE
Sbjct  1     MAAADGMLGNGCALLGNTKHMALSLTETAARQFVTRFFRHFISVGCLILLEEGGTMFTFE  60

Query  1838  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2017
             G+ K   L+ +++VHSPQFYWKV TQADLG+ADAYI+GD SF DK   L NLF + +AN 
Sbjct  61    GSRKDCSLRSILKVHSPQFYWKVMTQADLGIADAYINGDFSFDDKDRDLFNLFMLLIAN-  119

Query  2018  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2197
              + ++ S+SN KR WW PLLFT+ IA+AKY  +H  RQN+LTQARRNISRHYDLSNELFS
Sbjct  120   -VESNASKSNKKRRWWQPLLFTATIATAKYCFQHFLRQNSLTQARRNISRHYDLSNELFS  178

Query  2198  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2377
             LFL ETM YS A+FK+EDE+LKTAQ+RKIS+LI+KA+I ++H +L+IGCGWG+ AIE V+
Sbjct  179   LFLGETMMYSTAIFKTEDEELKTAQLRKISILIEKARIDEKHEVLDIGCGWGTFAIEVVK  238

Query  2378  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2557
             +TGC+YTGITLS++QLK+AE KV++AGLQ+ I FLLCDYRQLP + +YDRIISCEM+E V
Sbjct  239   QTGCRYTGITLSDEQLKFAEKKVKDAGLQERINFLLCDYRQLPSDHKYDRIISCEMIEHV  298

Query  2558  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2737
             GHEF++EFF  CESVL ENG+ +LQFIS+PD+RYD+YR+ + FIKEYIFPGGCLPSL RV
Sbjct  299   GHEFVDEFFSCCESVLEENGLFILQFISMPDDRYDDYRRGTGFIKEYIFPGGCLPSLGRV  358

Query  2738  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLE-RQSQILDLGFDKKFIRTWEYYFDY  2914
              SAMAASSRLCVEHLE+IGI    T+  ++  FL    S+IL LGF++ FIRTWEYYFDY
Sbjct  359   ISAMAASSRLCVEHLENIGIFMTATV-LYKMQFLFCIYSEILALGFNENFIRTWEYYFDY  417

Query  2915  CAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             CAAGF +  +GDYQIVFSRPGN   + +PYKG  SAY
Sbjct  418   CAAGFKSHIVGDYQIVFSRPGNALTYNNPYKGFPSAY  454



>ref|XP_011041574.1| PREDICTED: uncharacterized protein LOC105137508 [Populus euphratica]
Length=668

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/436 (69%), Positives = 354/436 (81%), Gaps = 14/436 (3%)
 Frame = +2

Query  1718  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1897
             M PS  E  ARL VT+FL S I T  +IL EEGG  FTF+G  KK+ L+V+++VH+PQFY
Sbjct  1     MSPSRFEAWARLFVTKFLGSHISTDRLILTEEGGATFTFKGASKKSSLEVVLKVHNPQFY  60

Query  1898  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2077
             WKV T+AD+GLADAYI GD+SF DK +GLL+L                +N KRGWWTP L
Sbjct  61    WKVTTRADIGLADAYIDGDLSFADKDQGLLHLIM--------------ANMKRGWWTPSL  106

Query  2078  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2257
             FT+ IASAK+F++H+ RQNTLTQARRNIS HYDLSNE+FSLFL ETM YSCA+FK+EDED
Sbjct  107   FTAGIASAKFFLQHVLRQNTLTQARRNISHHYDLSNEVFSLFLGETMAYSCAIFKTEDED  166

Query  2258  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2437
             L TAQ+RKIS LI+KA+I K+H IL+IGCGWG+ AIE V++TGCK TG+TLS +QLKYAE
Sbjct  167   LDTAQLRKISALIEKARIDKKHEILDIGCGWGTFAIEVVKQTGCKCTGLTLSVEQLKYAE  226

Query  2438  DKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENG  2617
              KV+EAGLQD+IR LLCDYR+LP   +YD I+SCEM+E VGHE+M +FF  CES LAE+G
Sbjct  227   MKVKEAGLQDHIRLLLCDYRELPKGYKYDIIVSCEMIEHVGHEYMEDFFSSCESALAEDG  286

Query  2618  ILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGI  2797
             +LVLQ  SI DERYDEYR+SSDFIKEYIFPGGCLPSLSR+TSAM  +SRLCVEH+E+IG 
Sbjct  287   LLVLQSTSIADERYDEYRRSSDFIKEYIFPGGCLPSLSRITSAMGVASRLCVEHVENIGS  346

Query  2798  HYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPG  2977
             HYY TLR WR NFLE +S+IL +GFD+KFIRTWEYYFDYCAAGF + TL +YQIVFSRPG
Sbjct  347   HYYHTLRRWRKNFLENKSKILAMGFDEKFIRTWEYYFDYCAAGFKSYTLWNYQIVFSRPG  406

Query  2978  NVTAFGDPYKGLASAY  3025
             NV   G+PYKG  SAY
Sbjct  407   NVGVLGNPYKGFPSAY  422



>gb|KFK39641.1| hypothetical protein AALP_AA3G270000 [Arabis alpina]
Length=438

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/438 (66%), Positives = 347/438 (79%), Gaps = 4/438 (1%)
 Frame = +2

Query  1691  CSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVL  1870
              +PL+N   MVPS  E  AR   TRFL  FI TGS+ +LEEG   F+FEG D +  LK +
Sbjct  2     VNPLSNQKQMVPSMTEKWARNFFTRFLRQFISTGSVTILEEGSE-FSFEGNDPRCPLKSV  60

Query  1871  VRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNS  2050
             + +HSPQFYWKV T+AD+GLADAYI GD SFVDK+ GLLNL  I +AN++L +  S    
Sbjct  61    LEIHSPQFYWKVMTRADVGLADAYIDGDFSFVDKETGLLNLIMILIANKELHSRNSNLAK  120

Query  2051  KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSC  2230
             KRGWWTP+  ++ +ASA  F++H+SRQNTLTQARRNISRHYDLSNELF+L+L +TMTYS 
Sbjct  121   KRGWWTPMFLSAGLASAMNFLKHVSRQNTLTQARRNISRHYDLSNELFALYLGDTMTYSS  180

Query  2231  AVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITL  2410
             A+FKS DEDL+TAQMRKISLLI            E+  GWG+L IE V +TGCKYTGITL
Sbjct  181   AIFKSHDEDLETAQMRKISLLIXXXXXXXX---FELASGWGTLGIEVVRKTGCKYTGITL  237

Query  2411  SEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGR  2590
             S +QL YAE+K +EAGLQD I F LCDYRQL D  +YDRIISCEM+E VG +F   FF  
Sbjct  238   SIEQLNYAEEKAKEAGLQDRITFQLCDYRQLSDAKKYDRIISCEMIEHVGDKFFETFFSH  297

Query  2591  CESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC  2770
             CE+ LAE+GI VLQFISIP+ERY+EYR +SDFI+EYIFPGGCLPSL+RVTSAM++SSRLC
Sbjct  298   CEAALAEDGIFVLQFISIPEERYNEYRLNSDFIREYIFPGGCLPSLARVTSAMSSSSRLC  357

Query  2771  VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGD  2950
             +E +E+IGIHYY TL+ WR NFLE+Q +I+DLGF+ KFIRTWEYYFDYCAAGF T TLGD
Sbjct  358   IESVENIGIHYYHTLKYWRKNFLEKQKEIMDLGFNDKFIRTWEYYFDYCAAGFKTLTLGD  417

Query  2951  YQIVFSRPGNVTAFGDPY  3004
             YQ+VFSRPGNV AFGDP+
Sbjct  418   YQVVFSRPGNVAAFGDPF  435



>ref|XP_002528379.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
 gb|EEF34051.1| 2-heptaprenyl-1,4-naphthoquinone methyltransferase, putative 
[Ricinus communis]
Length=372

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/371 (75%), Positives = 332/371 (89%), Gaps = 0/371 (0%)
 Frame = +2

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             TQADLGLA+AYI GDISF DK EGLLNLF + +ANRD + SVS  N K+GWWTP+  T++
Sbjct  2     TQADLGLANAYISGDISFPDKDEGLLNLFMVLIANRDANISVSERNKKKGWWTPMFLTAS  61

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
             IASAK+F RH+SR+N+LTQARRNISRHYDLSNE+FS+FLDETMTYSCAVFK+EDEDLK+A
Sbjct  62    IASAKFFFRHVSRKNSLTQARRNISRHYDLSNEMFSMFLDETMTYSCAVFKTEDEDLKSA  121

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             QMRKISLLI+KA+I+KEH +LEIGCGWG+LAIE V+RTGCKYTGITLSE+QLK+AE++V+
Sbjct  122   QMRKISLLIEKARINKEHEVLEIGCGWGTLAIEVVKRTGCKYTGITLSEEQLKFAEERVK  181

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             +AGLQ+NIRF LCDYRQLPD  + DRIISCEMLEAVGHE+M E+FG CESVLA++G++VL
Sbjct  182   QAGLQENIRFQLCDYRQLPDTYKCDRIISCEMLEAVGHEYMEEYFGCCESVLADDGLIVL  241

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2809
             QF SIP+ERY+EYR+SSD IKEYIFPG C+PSL+R+T AMAAS+RLCVEH+E+IG+HYYQ
Sbjct  242   QFTSIPEERYEEYRRSSDVIKEYIFPGTCVPSLTRITIAMAASTRLCVEHVENIGMHYYQ  301

Query  2810  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  2989
             TLR WR NFLE +S+I  LGF++KFIRTWEYYFDYCAAGF T TLG+YQ+V SRPGNV A
Sbjct  302   TLRLWRKNFLESKSKITALGFNEKFIRTWEYYFDYCAAGFKTLTLGNYQVVLSRPGNVAA  361

Query  2990  FGDPYKGLASA  3022
              G+PY    +A
Sbjct  362   LGNPYNEFPAA  372



>ref|XP_010466684.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X2 [Camelina sativa]
Length=434

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/436 (67%), Positives = 349/436 (80%), Gaps = 7/436 (2%)
 Frame = +2

Query  1658  MIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1834
             M+AA GLL     + L N N M  S  E  AR    RFL  FI TG + ++E G T+ TF
Sbjct  1     MVAAQGLLGNDMVTSLRNQNRMDLSLTEKAARFFFIRFLTHFISTGCVTIIE-GETMITF  59

Query  1835  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2014
             +G D +  LK  + +HSPQFYWK  T++DLGLADAYI+GD SF +K+ GLLNL  I +AN
Sbjct  60    KGEDSRCHLKSELEIHSPQFYWKAMTRSDLGLADAYINGDFSFCNKETGLLNLIMILIAN  119

Query  2015  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2194
             RDL+  ++++   RGWW P+  T+ +ASAK+F++H  RQNTLTQARRNISRHYDLSNELF
Sbjct  120   RDLNLRLAKN---RGWWKPMFLTTGLASAKHFLKHFYRQNTLTQARRNISRHYDLSNELF  176

Query  2195  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2374
             +LFLD+TM+YS AVFKS DEDL+TAQ+RKI LLIDKA+I K H +L+IGCGWG+LAIE V
Sbjct  177   ALFLDDTMSYSSAVFKSGDEDLRTAQLRKIYLLIDKARIKKNHEVLDIGCGWGTLAIETV  236

Query  2375  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2554
              RTGCKYTGIT+S +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRI+SCEMLE 
Sbjct  237   RRTGCKYTGITISIEQLKYAEEKVKEAGLQDRITFKLCDYRQLSDVQKYDRIVSCEMLEH  296

Query  2555  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2734
             VGHEFM  FF  C++   E+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+R
Sbjct  297   VGHEFMETFFSHCDA--XEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLAR  354

Query  2735  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2914
             VTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ QI DLGFD KFIRTWEYY+DY
Sbjct  355   VTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQKQITDLGFDNKFIRTWEYYYDY  414

Query  2915  CAAGFHTCTLGDYQIV  2962
             CAAGF T TLGDYQ+ 
Sbjct  415   CAAGFKTRTLGDYQVT  430



>ref|XP_010466685.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X3 [Camelina sativa]
Length=428

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/434 (68%), Positives = 348/434 (80%), Gaps = 7/434 (2%)
 Frame = +2

Query  1658  MIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1834
             M+AA GLL     + L N N M  S  E  AR    RFL  FI TG + ++E G T+ TF
Sbjct  1     MVAAQGLLGNDMVTSLRNQNRMDLSLTEKAARFFFIRFLTHFISTGCVTIIE-GETMITF  59

Query  1835  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2014
             +G D +  LK  + +HSPQFYWK  T++DLGLADAYI+GD SF +K+ GLLNL  I +AN
Sbjct  60    KGEDSRCHLKSELEIHSPQFYWKAMTRSDLGLADAYINGDFSFCNKETGLLNLIMILIAN  119

Query  2015  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2194
             RDL+  ++++   RGWW P+  T+ +ASAK+F++H  RQNTLTQARRNISRHYDLSNELF
Sbjct  120   RDLNLRLAKN---RGWWKPMFLTTGLASAKHFLKHFYRQNTLTQARRNISRHYDLSNELF  176

Query  2195  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2374
             +LFLD+TM+YS AVFKS DEDL+TAQ+RKI LLIDKA+I K H +L+IGCGWG+LAIE V
Sbjct  177   ALFLDDTMSYSSAVFKSGDEDLRTAQLRKIYLLIDKARIKKNHEVLDIGCGWGTLAIETV  236

Query  2375  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2554
              RTGCKYTGIT+S +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRI+SCEMLE 
Sbjct  237   RRTGCKYTGITISIEQLKYAEEKVKEAGLQDRITFKLCDYRQLSDVQKYDRIVSCEMLEH  296

Query  2555  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2734
             VGHEFM  FF  C++   E+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+R
Sbjct  297   VGHEFMETFFSHCDA--XEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLAR  354

Query  2735  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2914
             VTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ QI DLGFD KFIRTWEYY+DY
Sbjct  355   VTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQKQITDLGFDNKFIRTWEYYYDY  414

Query  2915  CAAGFHTCTLGDYQ  2956
             CAAGF T TLGDYQ
Sbjct  415   CAAGFKTRTLGDYQ  428



>ref|XP_010466683.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X1 [Camelina sativa]
Length=440

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/434 (68%), Positives = 348/434 (80%), Gaps = 7/434 (2%)
 Frame = +2

Query  1658  MIAAHGLL-KKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTF  1834
             M+AA GLL     + L N N M  S  E  AR    RFL  FI TG + ++E G T+ TF
Sbjct  1     MVAAQGLLGNDMVTSLRNQNRMDLSLTEKAARFFFIRFLTHFISTGCVTIIE-GETMITF  59

Query  1835  EGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVAN  2014
             +G D +  LK  + +HSPQFYWK  T++DLGLADAYI+GD SF +K+ GLLNL  I +AN
Sbjct  60    KGEDSRCHLKSELEIHSPQFYWKAMTRSDLGLADAYINGDFSFCNKETGLLNLIMILIAN  119

Query  2015  RDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELF  2194
             RDL+  ++++   RGWW P+  T+ +ASAK+F++H  RQNTLTQARRNISRHYDLSNELF
Sbjct  120   RDLNLRLAKN---RGWWKPMFLTTGLASAKHFLKHFYRQNTLTQARRNISRHYDLSNELF  176

Query  2195  SLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAV  2374
             +LFLD+TM+YS AVFKS DEDL+TAQ+RKI LLIDKA+I K H +L+IGCGWG+LAIE V
Sbjct  177   ALFLDDTMSYSSAVFKSGDEDLRTAQLRKIYLLIDKARIKKNHEVLDIGCGWGTLAIETV  236

Query  2375  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2554
              RTGCKYTGIT+S +QLKYAE+KV+EAGLQD I F LCDYRQL D  +YDRI+SCEMLE 
Sbjct  237   RRTGCKYTGITISIEQLKYAEEKVKEAGLQDRITFKLCDYRQLSDVQKYDRIVSCEMLEH  296

Query  2555  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2734
             VGHEFM  FF  C++   E+GI VLQFISIP+ERY+EYR +SDFIKEYIFPGGCLPSL+R
Sbjct  297   VGHEFMETFFSHCDA--XEDGIFVLQFISIPEERYNEYRLNSDFIKEYIFPGGCLPSLAR  354

Query  2735  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2914
             VTSAMA+SSRLC+EH+E+IGIHYYQTLR WR NFL+RQ QI DLGFD KFIRTWEYY+DY
Sbjct  355   VTSAMASSSRLCIEHVENIGIHYYQTLRLWRKNFLDRQKQITDLGFDNKFIRTWEYYYDY  414

Query  2915  CAAGFHTCTLGDYQ  2956
             CAAGF T TLGDYQ
Sbjct  415   CAAGFKTRTLGDYQ  428



>ref|XP_007035213.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 5, partial 
[Theobroma cacao]
 gb|EOY06139.1| Cyclopropane-fatty-acyl-phospholipid synthase isoform 5, partial 
[Theobroma cacao]
Length=604

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/426 (69%), Positives = 356/426 (84%), Gaps = 7/426 (2%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F + +  +FCR    LQLFGRPQW+TV+ RSH YVNKVR+ELE RGC+IR GCEVHSV T
Sbjct  184   FSAFSILSFCRNHHLLQLFGRPQWMTVRWRSHRYVNKVRKELESRGCQIRTGCEVHSVLT  243

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
                 +A G  ++ G +  QE Y+GC+MA HAPD L++LG QAT+DELR+LGAFQYVYSDI
Sbjct  244   ----TAEGCTVLCGDDS-QETYEGCVMAVHAPDALRLLGNQATYDELRVLGAFQYVYSDI  298

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQ  1504
             +LHR+++ MP+N AAWSAWNFLG+ + +VCLTYWLN LQNLG+T  P+LVTLNP   P+Q
Sbjct  299   FLHRDKNLMPKNPAAWSAWNFLGSTDKKVCLTYWLNVLQNLGETSLPFLVTLNPDYIPQQ  358

Query  1505  CLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLK  1684
              LLKW TGHPVPSVAA++AS EL++IQGKR IWFCGAYQGYGFHEDGLKAG +AA+G+L 
Sbjct  359   TLLKWKTGHPVPSVAATKASLELDQIQGKRGIWFCGAYQGYGFHEDGLKAGTVAANGVLG  418

Query  1685  KRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLK  1864
             K CS L+NP HMVPS  ETGARL VTRFL+ FI+TGS+ILLEEGGT+FTFEGT  K  LK
Sbjct  419   KSCSILSNPKHMVPSLVETGARLFVTRFLSHFILTGSVILLEEGGTMFTFEGTSTKCPLK  478

Query  1865  VLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRS  2044
              +++VH+P  YWKV T+ADLGLADAYI+G+ SFVDKKEGLLNL  I +ANRDL++S S+ 
Sbjct  479   TVLKVHNPHIYWKVMTEADLGLADAYINGEFSFVDKKEGLLNLIMILIANRDLNSSNSKL  538

Query  2045  NSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             + +RGWWTPLLFT+ + SAKYF++H+ R N+LTQARRNISRHYDLSN+LF+LFLDETMTY
Sbjct  539   SKQRGWWTPLLFTAGLTSAKYFLKHVLRHNSLTQARRNISRHYDLSNDLFALFLDETMTY  598

Query  2225  SCAVFK  2242
             SCAVFK
Sbjct  599   SCAVFK  604


 Score =   346 bits (888),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             MR AV+G GISGLVSAYVLAK G  VV+YEKEDYLGGHAKTV  DGVDLDLGFMVFNRVT
Sbjct  1     MRTAVIGGGISGLVSAYVLAKSGVNVVLYEKEDYLGGHAKTVNFDGVDLDLGFMVFNRVT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             YPNMME FESLGVDME SDMSF+VSLD G G EWGSRNG S LFA+K N+LNPYFW+M+R
Sbjct  61    YPNMMEFFESLGVDMEASDMSFAVSLDEGKGCEWGSRNGLSSLFAKKMNILNPYFWKMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+DV+SYLE  +NNPD+DRN+TLG+FI+SRGYSELFQKAY++P+C SIWSC +E 
Sbjct  121   EISKFKDDVISYLEVLENNPDIDRNETLGQFIESRGYSELFQKAYLVPICGSIWSCPTER  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
             VM FSA+SILSFCRNHHLLQ F    W
Sbjct  181   VMGFSAFSILSFCRNHHLLQLFGRPQW  207



>ref|XP_006299255.1| hypothetical protein CARUB_v10015414mg [Capsella rubella]
 gb|EOA32153.1| hypothetical protein CARUB_v10015414mg [Capsella rubella]
Length=424

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/429 (67%), Positives = 336/429 (78%), Gaps = 20/429 (5%)
 Frame = +2

Query  1712  NHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQ  1891
              HM  S  +T ARL VTRFL  FI  G +++LE G  +F F   D    LK ++++H PQ
Sbjct  2     QHMFLSLTQTVARLFVTRFLGQFISIGCVMILE-GERMFVFGEKDSTCSLKSILKIHCPQ  60

Query  1892  FYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTP  2071
             FYWKV TQADLGLADAYI GD SFVDK  GLLNL                     GWWTP
Sbjct  61    FYWKVMTQADLGLADAYISGDFSFVDKDSGLLNLI-------------------MGWWTP  101

Query  2072  LLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSED  2251
             +  T+ +ASAKY+++H+SRQNTLTQAR+NIS HYDLSNE FSLF+D+TM YS AVFKSE+
Sbjct  102   MFLTAGLASAKYYLKHVSRQNTLTQARKNISCHYDLSNEFFSLFMDDTMMYSSAVFKSEN  161

Query  2252  EDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKY  2431
             ED +TAQMRKISLLI+KA+I + H +LE+GCGWG+LAIE V+RTGCKY GITLS +QLKY
Sbjct  162   EDPRTAQMRKISLLIEKARIERNHEVLEMGCGWGTLAIEVVKRTGCKYNGITLSIEQLKY  221

Query  2432  AEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAE  2611
             AE K +EAGLQD I F LCDYRQL D  +YDRII+CEM+EAVGHEFM +FF  CE+ LA+
Sbjct  222   AETKAKEAGLQDQITFELCDYRQLSDARKYDRIIACEMIEAVGHEFMEKFFSCCEAALAQ  281

Query  2612  NGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDI  2791
             NGI VLQF +IP++ YDE R SS FI EYIFPGGCLPSL+RVTSAMA+SSRLC+E++E+ 
Sbjct  282   NGIFVLQFTAIPEKLYDESRLSSGFITEYIFPGGCLPSLARVTSAMASSSRLCIENVENF  341

Query  2792  GIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSR  2971
             GIHYY TLRCWR NFLERQ QI+DLGFD KFIRTWEYYFDYCAAGF T TL +YQIVFSR
Sbjct  342   GIHYYHTLRCWRKNFLERQKQIMDLGFDDKFIRTWEYYFDYCAAGFKTLTLKNYQIVFSR  401

Query  2972  PGNVTAFGD  2998
             PGN+ AFGD
Sbjct  402   PGNLAAFGD  410



>ref|XP_004307321.1| PREDICTED: probable fatty acid methyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=433

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/437 (66%), Positives = 347/437 (79%), Gaps = 5/437 (1%)
 Frame = +2

Query  1718  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSP-QF  1894
             M  +  E  +RL VT+FL  ++ TG +IL E+GGTV TFEGT K   LK +++VH P QF
Sbjct  1     MASAILERVSRLYVTKFLRQYVSTGCLILSEDGGTVETFEGTKKGCSLKCVLQVHDPAQF  60

Query  1895  YWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPL  2074
             YWKV T+ADLGLADAYI+GD S  DK +GL NLF I  ANRD ++ +S+ N  R      
Sbjct  61    YWKVMTRADLGLADAYINGDFSLADKDKGLENLFTILNANRDSTSPLSKLNKIR----RR  116

Query  2075  LFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDE  2254
             L  + ++ A+Y   H S QNTLT ARRN+SRHYDLSN LFSLFLDETM+YS  VFK +DE
Sbjct  117   LLEACLSPARYLFHHGSGQNTLTVARRNVSRHYDLSNALFSLFLDETMSYSTVVFKKDDE  176

Query  2255  DLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYA  2434
             DLKT Q+RKI  LIDKA+I+K H +LE+GCGWG LAIE V++TGC+YTGITLS++QL++A
Sbjct  177   DLKTGQLRKIKTLIDKARITKNHEVLEVGCGWGGLAIEVVKQTGCRYTGITLSKEQLQFA  236

Query  2435  EDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAEN  2614
             E +V++AGL++NI+FLLCDYR LP N +YDRI+SCEM+E VGHE+M EFF  C+S LAEN
Sbjct  237   EQRVKDAGLEENIKFLLCDYRTLPKNYKYDRIVSCEMVEHVGHEYMEEFFACCDSALAEN  296

Query  2615  GILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIG  2794
             G+LVLQF S+PDE YDEYR+   FI+EYI PGGCLPSLSR+T+AMAASSRL VEHLE+IG
Sbjct  297   GLLVLQFTSLPDELYDEYRRCPSFIREYILPGGCLPSLSRLTAAMAASSRLSVEHLENIG  356

Query  2795  IHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRP  2974
              HYY+TL+ WR NFLE+QS+I  LGFD KFIRTWEYYFDYCAAGF+ CTLG+YQIVFSRP
Sbjct  357   SHYYRTLKYWRKNFLEKQSEIQALGFDDKFIRTWEYYFDYCAAGFNACTLGNYQIVFSRP  416

Query  2975  GNVTAFGDPYKGLASAY  3025
             GNV    DPYKG  SAY
Sbjct  417   GNVVLLNDPYKGFPSAY  433



>ref|NP_188990.4| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AEE76769.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=447

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/443 (64%), Positives = 345/443 (78%), Gaps = 2/443 (0%)
 Frame = +2

Query  1658  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1837
             M+ A GLL  + + + N  HMV S  E GARL VTRF   FI  G + +LE G T+F F 
Sbjct  1     MVIARGLLGIQTTLVKNMQHMVFSLTEAGARLFVTRFFRQFISIGCVTILE-GDTIFIFG  59

Query  1838  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2017
               +    LK ++++HSPQFYWKV T ADLGLADAYI+GD SFVDK  GLLNL  I +ANR
Sbjct  60    ENESTCPLKSILKIHSPQFYWKVMTLADLGLADAYINGDFSFVDKDSGLLNLIMILIANR  119

Query  2018  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2197
             DL++  S    KRGWWTP+  T+++ASA Y+++H+ RQNTLTQARRN+S HYDLSNE F 
Sbjct  120   DLNSRKSNLAKKRGWWTPVFLTASLASATYYLKHVCRQNTLTQARRNVSSHYDLSNEFFG  179

Query  2198  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2377
             LF+D+TM YS AVFKSE+E+L+TAQMRKI LLI+K K  + + +LEIGCGWG+LAIE V+
Sbjct  180   LFMDDTMMYSSAVFKSENENLRTAQMRKIHLLIEKDK-EEPYEVLEIGCGWGTLAIEVVK  238

Query  2378  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2557
             RTGCKYTG TLS +QLKY E+KV+EAGLQ+ I F LCDYRQL D  +YDRIISCEM+E V
Sbjct  239   RTGCKYTGFTLSIEQLKYVEEKVKEAGLQERITFKLCDYRQLCDTQKYDRIISCEMIEHV  298

Query  2558  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2737
             GH+FM  FF  CE+ LAE+GI VLQF +IP+E YDE R +S FI EYIFPGGCLPSL+RV
Sbjct  299   GHKFMETFFSHCEAALAEDGIFVLQFTAIPEELYDESRLTSGFITEYIFPGGCLPSLARV  358

Query  2738  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2917
             TSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ QI+DLGFD+KF+RTWEYYFDYC
Sbjct  359   TSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQKQIIDLGFDEKFLRTWEYYFDYC  418

Query  2918  AAGFHTCTLGDYQIVFSRPGNVT  2986
             AAGF T TL +YQ+  +    +T
Sbjct  419   AAGFKTLTLRNYQVTHTHSSTLT  441



>ref|XP_006658552.1| PREDICTED: uncharacterized protein LOC102715408 [Oryza brachyantha]
Length=764

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/443 (67%), Positives = 364/443 (82%), Gaps = 4/443 (1%)
 Frame = +2

Query  1706  NPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHS  1885
             NP  M PSW E GARLLVTRFL  ++  G+  LLEEGGT+++F    K+   K ++RVH 
Sbjct  322   NPKQMAPSWTEAGARLLVTRFLDGYVSAGNFTLLEEGGTMYSFGEAGKRCQAKCVMRVHD  381

Query  1886  PQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSK-RGW  2062
             P FYWKVAT+ADLGLADAYI+G  SFVDKK+GLLNL  I +ANRD +   S S+SK RGW
Sbjct  382   PLFYWKVATEADLGLADAYINGYCSFVDKKQGLLNLLLILIANRDSNKQSSISSSKIRGW  441

Query  2063  WTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFK  2242
             WTP+L T+ +ASAKYF+RH+SR+NT+TQ RRNIS+HYDLSN+ FSLFLD +MTYSCAVFK
Sbjct  442   WTPMLLTAGVASAKYFLRHVSRKNTVTQTRRNISQHYDLSNDFFSLFLDPSMTYSCAVFK  501

Query  2243  SEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQ  2422
              E+E L+ AQ RK+SLLI KA++ ++HH+LEIG GWG LAI+ V++TGCKYTG+TLSE+Q
Sbjct  502   DEEESLEAAQQRKVSLLIHKARVERDHHVLEIGSGWGRLAIQVVKQTGCKYTGVTLSEEQ  561

Query  2423  LKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESV  2602
             LKY + KV+EAGL+D++ F+LCDYRQ+P + +YDRIISCEM+E VGHE+M+EFFG CES+
Sbjct  562   LKYCQRKVKEAGLEDHMTFMLCDYRQIPTSRKYDRIISCEMIEGVGHEYMDEFFGCCESL  621

Query  2603  LAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHL  2782
             LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSLSR+TSAM+ASSRLC+EHL
Sbjct  622   LAQDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLSRITSAMSASSRLCIEHL  681

Query  2783  EDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIV  2962
             E+IG HYY TL  WR NF+  + +I  LGFD KFIR WEYYF YCAAGF + TLG+YQIV
Sbjct  682   ENIGYHYYPTLIRWRDNFMVNREEISALGFDDKFIRIWEYYFIYCAAGFKSRTLGNYQIV  741

Query  2963  FSRPGN--VTAFGD-PYKGLASA  3022
             FSRPGN  +  F D PY    +A
Sbjct  742   FSRPGNDKLMPFADNPYTTFPAA  764


 Score =   214 bits (545),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 118/151 (78%), Gaps = 1/151 (1%)
 Frame = +1

Query  574   RVTYPNMMELFESLGVDMEISDMSFSVSLDNGH-GYEWGSRNGFSGLFAQKKNLLNPYFW  750
             +VTYPNMME FE LGV+ME SDMSFSVS        EWGSRNG +GL AQK N ++P FW
Sbjct  2     QVTYPNMMEWFEELGVEMERSDMSFSVSTRGEEINVEWGSRNGLAGLLAQKSNAVSPAFW  61

Query  751   QMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSC  930
             +MIREI+ FK+DVL Y+EE + NPD+DRN+TLG+FI+S GYS LFQ AY+IP+CA IWSC
Sbjct  62    RMIREIVYFKDDVLKYVEEHERNPDLDRNETLGQFIQSHGYSRLFQHAYLIPICACIWSC  121

Query  931   SSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
              S GV+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  122   PSHGVLGFSAFFVLSFCRNHHLLQLFGRPQW  152


 Score =   210 bits (534),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 128/179 (72%), Gaps = 10/179 (6%)
 Frame = +2

Query  971   FHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVST  1144
             F +    +FCR    LQLFGRPQWLTVK RSH+YVN+VREELE  GC+I+  CEV SVS 
Sbjct  129   FSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHTYVNRVREELESLGCQIKTSCEVQSVSA  188

Query  1145  DEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDI  1324
              + G  G  V+ +G +  +E YD  I A HAPD LK+LG  AT DE RILGAFQYVYSDI
Sbjct  189   LDGG--GYRVVEAGGS--EEVYDRIIFAVHAPDALKILGDDATHDERRILGAFQYVYSDI  244

Query  1325  YLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNL----GDTKQPYLVTLNPP  1489
             YLH ++  MPRN +AWSAWNFLGT    VC+TYWLN LQN+    G  ++P+LVTLNPP
Sbjct  245   YLHCDKRLMPRNPSAWSAWNFLGTTAAGVCVTYWLNLLQNIEESAGRGRRPFLVTLNPP  303



>ref|XP_010532684.1| PREDICTED: probable (S)-tetrahydroprotoberberine N-methyltransferase 
2 isoform X3 [Tarenaya hassleriana]
Length=389

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/384 (72%), Positives = 320/384 (83%), Gaps = 0/384 (0%)
 Frame = +2

Query  1871  VRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNS  2050
             +++HSPQFYWKV T+AD+GLADAYI GDISF DK EGLLNL  I +ANRDL++S S    
Sbjct  1     MKIHSPQFYWKVMTEADIGLADAYISGDISFADKDEGLLNLIVILIANRDLNSSKSNLAE  60

Query  2051  KRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSC  2230
             KR WW P+ FT+ +ASAKYF++H+ R+NTLTQARRNIS HYDLSNELF+LF+DETM YSC
Sbjct  61    KRRWWKPMFFTAGLASAKYFLKHVFRKNTLTQARRNISDHYDLSNELFALFMDETMAYSC  120

Query  2231  AVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITL  2410
             AVFKS+DEDL+TAQ RKISLLIDKA+I K H +LEIGCGWG+LAIE V RTGCKYTGITL
Sbjct  121   AVFKSDDEDLRTAQTRKISLLIDKARIEKNHEVLEIGCGWGTLAIEVVRRTGCKYTGITL  180

Query  2411  SEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGR  2590
             S +QLKYAE KV+E GL+D I F L DYRQL D+ +YDRIISCEM+EAVGH+FM  FF R
Sbjct  181   SIEQLKYAEAKVKEEGLEDRITFELRDYRQLSDSRKYDRIISCEMIEAVGHKFMETFFNR  240

Query  2591  CESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLC  2770
             CES LAE G+LVLQF ++PD RYDE R S  FI EYIFPG C PSL+RVTSAMA+SSRLC
Sbjct  241   CESALAEEGLLVLQFSAVPDSRYDESRLSPGFITEYIFPGACHPSLARVTSAMASSSRLC  300

Query  2771  VEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGD  2950
             +EH+E+IGIHY++TLRCWR NFL+RQ ++  +GFD+KFIR WEYYFDYCAAGF T  L  
Sbjct  301   IEHVENIGIHYHKTLRCWRQNFLKRQEEVKAIGFDEKFIRKWEYYFDYCAAGFKTLALEV  360

Query  2951  YQIVFSRPGNVTAFGDPYKGLASA  3022
             YQ+VFSRPGN T FGDPY    SA
Sbjct  361   YQVVFSRPGNTTMFGDPYMSYPSA  384



>gb|KDO54091.1| hypothetical protein CISIN_1g0146251mg, partial [Citrus sinensis]
Length=389

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/408 (67%), Positives = 337/408 (83%), Gaps = 21/408 (5%)
 Frame = +2

Query  1802  LLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEG  1981
             LLEEGGT+FTFEGT + + LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK EG
Sbjct  1     LLEEGGTIFTFEGTLRNSPLKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKDEG  60

Query  1982  LLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNI  2161
             LLNLF I +AN+D  +S S+   KRGWW+P+ FT++IASAKYF R+ISR+N+LTQARRN+
Sbjct  61    LLNLFLIVIANQDFDSSTSKLKKKRGWWSPMFFTASIASAKYFFRNISRKNSLTQARRNV  120

Query  2162  SRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIG  2341
             SRHYDLS                     E EDL+  QMRKIS+LI+KA++SK   +L+IG
Sbjct  121   SRHYDLS---------------------EHEDLEVGQMRKISVLIEKARVSKGQEVLDIG  159

Query  2342  CGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRY  2521
             CGWG+LAIE V++TGCKYTGITLS++QLKYA+ KVREAGLQD+IRF LCDYRQLP   +Y
Sbjct  160   CGWGTLAIEIVKQTGCKYTGITLSKEQLKYAQIKVREAGLQDHIRFYLCDYRQLPKANKY  219

Query  2522  DRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYI  2701
             DRIISCEM+E VGH++M EFF  CES+LA++G+LVLQF S PD+ YDEYR S  F+ EYI
Sbjct  220   DRIISCEMIEHVGHDYMEEFFDCCESLLAKHGLLVLQFTSAPDQSYDEYRLSPGFLNEYI  279

Query  2702  FPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKK  2881
             FPGGC+PSLSRVT+AM +SSRLC+EH+E+IGIHYYQTLRCWR NF+E+QS+IL LGF++K
Sbjct  280   FPGGCVPSLSRVTAAMTSSSRLCMEHVENIGIHYYQTLRCWRKNFMEKQSEILALGFNEK  339

Query  2882  FIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFGDPYKGLASAY  3025
             FIRTWEYYFDYCAA F +  +G+YQIVFSRPG+V AF +PY+GL SAY
Sbjct  340   FIRTWEYYFDYCAASFKSRIIGNYQIVFSRPGDVAAFSNPYEGLPSAY  387



>ref|XP_007035240.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06166.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=461

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/442 (65%), Positives = 352/442 (80%), Gaps = 1/442 (0%)
 Frame = +2

Query  1703  NNPNH-MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRV  1879
             ++P H M  S  ET AR +V +F   FI TG +ILLE+ GTV TF G+ +K  LKV+++V
Sbjct  18    SDPRHIMALSLMETVARHIVIKFFERFISTGCVILLEKEGTVLTFTGSMEKCSLKVVLKV  77

Query  1880  HSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRG  2059
             H+PQFYWK+ T+ADLGLADAYIHGD SF DK++GLLNL  I +ANR+ ++S S    KRG
Sbjct  78    HNPQFYWKIMTEADLGLADAYIHGDFSFEDKEDGLLNLILILIANRESNSSASGLIKKRG  137

Query  2060  WWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVF  2239
             WWTP LFT++I+SAKYF++ + RQNTLTQARRNISRHYD SNELF  F+DETM YS A+F
Sbjct  138   WWTPALFTASISSAKYFLKQVLRQNTLTQARRNISRHYDQSNELFESFMDETMQYSAAIF  197

Query  2240  KSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQ  2419
             K+ED+DLK AQ+RKI+ LIDKA+I K H ++E G GWG  AIE V+RTGCKYTG+TLSE+
Sbjct  198   KAEDDDLKVAQLRKITSLIDKARIEKWHEVIEFGSGWGYFAIEVVKRTGCKYTGVTLSEE  257

Query  2420  QLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCES  2599
             QLKYAE KV+EAGLQDNI+FLLCDYRQLP  C+YDRIISCEM E VG+E++ EFF  CES
Sbjct  258   QLKYAEAKVKEAGLQDNIKFLLCDYRQLPKTCKYDRIISCEMSEHVGNEYIEEFFRCCES  317

Query  2600  VLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEH  2779
             +LA++G+ VLQF S+ +  Y EY +S  F KEYIFPG CL SL+R+ SAMA +SRL VEH
Sbjct  318   ILAKDGLFVLQFTSVTEGLYHEYLRSPGFAKEYIFPGACLLSLTRILSAMATASRLSVEH  377

Query  2780  LEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQI  2959
             +E+IG +Y QTL+ WR NFL+ +S+IL LGFD+KF RTWEY+FDY AAGF + TL  YQ+
Sbjct  378   VENIGSNYVQTLKGWRKNFLKNKSKILALGFDEKFTRTWEYFFDYAAAGFKSRTLETYQV  437

Query  2960  VFSRPGNVTAFGDPYKGLASAY  3025
             VFSRPGN  A GDPY+G  SAY
Sbjct  438   VFSRPGNFAALGDPYQGFPSAY  459



>ref|XP_007035218.1| Cyclopropane fatty acid synthase isoform 2 [Theobroma cacao]
 gb|EOY06144.1| Cyclopropane fatty acid synthase isoform 2 [Theobroma cacao]
Length=412

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/430 (65%), Positives = 341/430 (79%), Gaps = 21/430 (5%)
 Frame = +2

Query  1736  ETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQ  1915
             ET AR +V +F   +I TG +ILLEE GTV TF G+ +K  LKV+++VH+PQFYWK+ T+
Sbjct  2     ETMARHIVIKFFEQYISTGCVILLEEEGTVLTFTGSMEKCSLKVVLKVHNPQFYWKIMTE  61

Query  1916  ADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIA  2095
             ADLGLADAYI GD SF DK+EGLLNLF IF+ANR   +S S  N KRGWW P LFT++I+
Sbjct  62    ADLGLADAYIQGDFSFEDKEEGLLNLFLIFIANRVSDSSASGLNKKRGWWAPALFTASIS  121

Query  2096  SAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQM  2275
             SAKYF++H+ RQNTL QARRNISRHY+L+                     E+EDLK AQ+
Sbjct  122   SAKYFLKHVLRQNTLIQARRNISRHYNLA---------------------ENEDLKVAQL  160

Query  2276  RKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREA  2455
             RKIS LIDKA+I K H +++IGCGWG  AIE V+RTGCKYTG+TLSE+QLKYAE KV+EA
Sbjct  161   RKISSLIDKARIEKGHEVIDIGCGWGYFAIEVVKRTGCKYTGVTLSEEQLKYAEAKVKEA  220

Query  2456  GLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQF  2635
             GLQDNIRFLLCDYRQLP+  +YDRIISCEM+E VG+E++ EFF  CES+LA++G+ VLQF
Sbjct  221   GLQDNIRFLLCDYRQLPETGKYDRIISCEMIEHVGNEYIEEFFRCCESILAKDGLFVLQF  280

Query  2636  ISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTL  2815
             IS+ +E++ E+ +S  F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y QTL
Sbjct  281   ISMTEEQFPEHLRSPGFVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQTL  340

Query  2816  RCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTAFG  2995
             RCWR NFLE +S+IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A G
Sbjct  341   RCWRKNFLENKSKILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAALG  400

Query  2996  DPYKGLASAY  3025
             DPY+G   AY
Sbjct  401   DPYQGFPLAY  410



>ref|XP_010670965.1| PREDICTED: (S)-tetrahydroprotoberberine N-methyltransferase-like 
[Beta vulgaris subsp. vulgaris]
Length=436

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/437 (64%), Positives = 346/437 (79%), Gaps = 4/437 (1%)
 Frame = +2

Query  1718  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1897
             M  S  E+ ARL VTRFL  FI  G++ LLE+ GTV TFEG+ K   L V++++H+PQFY
Sbjct  1     MALSLTESAARLSVTRFLKDFISAGTLTLLEKDGTVLTFEGSLKICPLSVVIKIHNPQFY  60

Query  1898  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2077
             WKVAT+ADLG ADAYIHGD SF+DK EGL+N+  IF+A +DL +S S   +K  W T L 
Sbjct  61    WKVATEADLGFADAYIHGDFSFIDKDEGLVNIIMIFIACKDLQSSASIV-TKWDWLTSLF  119

Query  2078  -FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDE  2254
              F++ I SAKY  R+  R+NTLTQARRNISRHYD+SNE+FSLF+DETM YSCA+ KSE+E
Sbjct  120   SFSAWIISAKYIYRNFCRRNTLTQARRNISRHYDMSNEMFSLFMDETMMYSCAIHKSENE  179

Query  2255  DLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYA  2434
             DLK AQMRKISLLI+KA++ + H +LEIG GWG  AIE V++TGCKYTG+TLS++QLK+A
Sbjct  180   DLKVAQMRKISLLIEKARVEQHHEVLEIGSGWGIFAIELVKKTGCKYTGLTLSKEQLKFA  239

Query  2435  EDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAEN  2614
             EDKV++AGL+D I+FLLCDYR+L D  +YDRII+CEM+EAVG E++ EFF  C+S L  N
Sbjct  240   EDKVKKAGLEDRIKFLLCDYRELKDVNKYDRIIACEMIEAVGDEYIEEFFRCCDSSLTTN  299

Query  2615  GILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIG  2794
             G+LVLQF ++ DE Y+++R+   FI EYIFPGG L SLSRVTSAM  +S+L VEH+E+IG
Sbjct  300   GLLVLQFTAVRDEGYEKFRKCPGFIPEYIFPGGHLFSLSRVTSAMGTASKLSVEHVENIG  359

Query  2795  IHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRP  2974
              HYYQTLRCWR NFLE QS+IL LGF++KFI+TWEYYFDYCAAGF    L +YQIVFSR 
Sbjct  360   EHYYQTLRCWRKNFLENQSKILSLGFNEKFIQTWEYYFDYCAAGFKMRFLKNYQIVFSRR  419

Query  2975  GNVTAFGDPYKGLASAY  3025
             G  TAF DP   + SA+
Sbjct  420   G--TAFNDPSATIPSAH  434



>gb|EMS47376.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=676

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/676 (47%), Positives = 406/676 (60%), Gaps = 121/676 (18%)
 Frame = +2

Query  959   LTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVH  1132
             L+ FF      +FCR +  LQLF   Q  TVK RS SYVNKV+ ELE  GC I+  C V 
Sbjct  114   LSAFF----VLSFCRNNDLLQLFRHTQLPTVKPRSQSYVNKVKGELESMGCLIKTSCRVK  169

Query  1133  SVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYV  1312
             SVS+ + G+   V+   G    +E +D  I+  HAP+ LK+LG +AT  ELRILGA QYV
Sbjct  170   SVSSLD-GAGYRVLENDGS---EETFDSVILGVHAPNALKVLGAEATHQELRILGACQYV  225

Query  1313  YSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPR  1492
               DIYLH +Q+ MP+N +AWSAWNFLGT +    +TYWLN +Q +G  + P+LVTLNPP 
Sbjct  226   QRDIYLHCDQNLMPQNPSAWSAWNFLGTTSRGFSVTYWLNQIQKIGSVR-PFLVTLNPPG  284

Query  1493  TPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAH  1672
              P+                                                  AG  AA 
Sbjct  285   VPDH-------------------------------------------------AGKAAAQ  295

Query  1673  GLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKK  1852
             GLL K+C  L  P  ++PSW   GARL  TRF   ++  G++I +E GG+VF+F     K
Sbjct  296   GLLGKKCELLLYPKQIIPSWTVAGARLAFTRFFMQYVSIGNLIFVEAGGSVFSFGKACNK  355

Query  1853  NLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSAS  2032
               +K +VRVH P FYWK  T+ ++GL +AYI+G  S +DK+EGLLNL             
Sbjct  356   CPVKSVVRVHDPLFYWKATTEGEIGLGEAYINGYFSCLDKREGLLNL-------------  402

Query  2033  VSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDE  2212
                                I S  +F   + +  T + A       + + NE        
Sbjct  403   -------------------ILSNDFFSLFLDKSMTYSCAV------FKMENE--------  429

Query  2213  TMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCK  2392
                            L+ AQ RK+SLLIDKAK+ +EHH+L+IG GWGSLAI+ V++TGCK
Sbjct  430   --------------SLEAAQQRKLSLLIDKAKVEREHHVLDIGSGWGSLAIQMVKQTGCK  475

Query  2393  YTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFM  2572
             YTG+TLSE+QLKYAE KVREAGL+D+I FLLCDYR +P   +YD IISC M+E VGHE+M
Sbjct  476   YTGVTLSEEQLKYAESKVREAGLEDHITFLLCDYRLIPPY-KYDAIISCGMIEHVGHEYM  534

Query  2573  NEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMA  2752
             +EFF  CES LAE+GILVLQFISI +ERY++YR+   F+KEYIFPGGC+PSL+RV SAM 
Sbjct  535   DEFFACCESYLAEDGILVLQFISIAEERYEQYRRRPHFVKEYIFPGGCIPSLARVMSAMT  594

Query  2753  ASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFH  2932
              SSR  +EH+E+IG +YY TL  WR NF+  + Q+L+LGFD+KFI  WE+Y  Y AAGF 
Sbjct  595   TSSRFSIEHVENIGPNYYTTLMHWRDNFMANKDQVLELGFDEKFILIWEFYLIYSAAGFK  654

Query  2933  TCTLGDYQIVFSRPGN  2980
             +  +GDYQ+VFSRPGN
Sbjct  655   SRAVGDYQVVFSRPGN  670


 Score =   167 bits (422),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 101/132 (77%), Gaps = 4/132 (3%)
 Frame = +1

Query  625   MEISDMSFSVSLD---NGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIREILKFKNDVLS  795
             ME SDMSFSVS        G EWG+ NG SGL AQK N+L P FW+M+REI+KFKND L+
Sbjct  1     MERSDMSFSVSTQLKGGSRGCEWGNGNGISGLLAQKTNILKPSFWRMVREIIKFKNDALT  60

Query  796   YLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAY-IIPMCASIWSCSSEGVMAFSAYSIL  972
             YLE+ ++NPD+D N+TLG+FI+S GYS  FQ+AY +IP+C  +WSCS + V++ SA+ +L
Sbjct  61    YLEDHEHNPDLDHNETLGQFIQSHGYSPSFQEAYLVIPVCTGMWSCSPQDVLSLSAFFVL  120

Query  973   SFCRNHHLLQNF  1008
             SFCRN+ LLQ F
Sbjct  121   SFCRNNDLLQLF  132



>ref|XP_007035220.1| Cyclopropane fatty acid synthase [Theobroma cacao]
 gb|EOY06146.1| Cyclopropane fatty acid synthase [Theobroma cacao]
Length=375

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/372 (70%), Positives = 315/372 (85%), Gaps = 0/372 (0%)
 Frame = +2

Query  1910  TQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSA  2089
             T+ADLGLADAYI GD SF DK+EGLLNLF IF+ANR+  +S S  N KRGWW P LFT++
Sbjct  2     TEADLGLADAYIQGDFSFEDKEEGLLNLFLIFIANRESDSSASGLNKKRGWWAPALFTAS  61

Query  2090  IASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTA  2269
             I+SAKYF++H+ RQNTL QARRNISRHY+LSNELF LFLDE M YS A+FK+E+EDLK A
Sbjct  62    ISSAKYFLKHVLRQNTLIQARRNISRHYNLSNELFELFLDEKMQYSSAIFKAENEDLKVA  121

Query  2270  QMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVR  2449
             Q+RKIS LIDKA+I K H ++E G GWG  AIE V+RTGCKYTG+TLSE+QLKYAE KV+
Sbjct  122   QLRKISSLIDKARIEKGHEVIEFGSGWGYFAIEVVKRTGCKYTGVTLSEEQLKYAEAKVK  181

Query  2450  EAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVL  2629
             EAGLQDNI+FLLCDYRQLP+  +YDRIISCEM+E VG+E++ EFF  CES+LA++G+ VL
Sbjct  182   EAGLQDNIKFLLCDYRQLPETGKYDRIISCEMIEHVGNEYIEEFFRCCESILAKDGLFVL  241

Query  2630  QFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQ  2809
             QFIS+ +E++ EY +S  F+KEYIFPGGCL SL+R+ SAMAA SRL VEH+E+IG +Y Q
Sbjct  242   QFISMTEEQFPEYLRSPGFVKEYIFPGGCLLSLTRMLSAMAAGSRLSVEHVENIGPNYVQ  301

Query  2810  TLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGNVTA  2989
             TLRCWR NFLE +S+IL LGFD+KF+RTWEYYFDYCAAGF + T+GDYQ+VFSRPGN  A
Sbjct  302   TLRCWRKNFLENKSKILALGFDEKFMRTWEYYFDYCAAGFKSRTIGDYQVVFSRPGNFAA  361

Query  2990  FGDPYKGLASAY  3025
              GDPY+G  SAY
Sbjct  362   LGDPYQGFPSAY  373



>gb|EEE67149.1| hypothetical protein OsJ_24210 [Oryza sativa Japonica Group]
Length=719

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/411 (68%), Positives = 340/411 (83%), Gaps = 4/411 (1%)
 Frame = +2

Query  1802  LLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEG  1981
             LLEEGGT+F+F    KK   K ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDKK+G
Sbjct  309   LLEEGGTMFSFGEAGKKCQAKCVMRVHDPLFYWKVATEADLGLADAYINGYCSFVDKKQG  368

Query  1982  LLNLFKIFVANRDLSASVSRSNSK-RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRN  2158
             LLNL  I +ANRD +   S S S+ RGWWTP+L T+ +ASAKYF+RH+SR+NT+TQ R+N
Sbjct  369   LLNLLLILIANRDANKQSSTSTSRIRGWWTPMLLTAGVASAKYFLRHVSRKNTVTQTRQN  428

Query  2159  ISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEI  2338
             IS+HYDLSN+ FSLFLD +MTYSCAVFK EDE L+ AQ RK+SLLI KA++ ++HH+LEI
Sbjct  429   ISQHYDLSNDFFSLFLDPSMTYSCAVFKDEDESLEAAQQRKVSLLIHKARVERDHHVLEI  488

Query  2339  GCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCR  2518
             G GWGSLAI+ V++TGCKYTG+TLSE+QLKY + KV+EAGL+D++ FLLCDYRQ+P   +
Sbjct  489   GSGWGSLAIQVVKQTGCKYTGVTLSEEQLKYCQRKVKEAGLEDHMTFLLCDYRQIPTVRK  548

Query  2519  YDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEY  2698
             YDRIISCEM+E VGHE+M++FFG CES+LA++G+ VLQFISIP+ERY+EYR+SSDFIKEY
Sbjct  549   YDRIISCEMIEGVGHEYMDDFFGCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFIKEY  608

Query  2699  IFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDK  2878
             IFPGGCLPSLSR+TSAM+ SSRLC+EHLE+IG HYY TL  WR NF+  + +I  LGFD 
Sbjct  609   IFPGGCLPSLSRITSAMSTSSRLCIEHLENIGYHYYPTLIRWRDNFMANREEIKSLGFDD  668

Query  2879  KFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN--VTAFGD-PYKGLASA  3022
             KFIR WEYYF YCAAGF + TLG+YQIV SRPGN  +  F D PY    +A
Sbjct  669   KFIRIWEYYFIYCAAGFKSRTLGNYQIVLSRPGNDKLLPFADNPYATFPAA  719


 Score =   301 bits (772),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 174/216 (81%), Gaps = 10/216 (5%)
 Frame = +1

Query  406   RVAVVGAGISGLVSAYVLAKGGAGVVV--YEKEDYLGGHAKTVTLDG----VDLDLGFMV  567
             RVAVVGAG+SGL +A+  A+GG GV V  YE+ED LGGHA+TV +DG    VDLDLGFMV
Sbjct  3     RVAVVGAGVSGLAAAHEAARGGGGVRVTLYEREDSLGGHARTVAVDGDAGPVDLDLGFMV  62

Query  568   FNRVTYPNMMELFESLGVDMEISDMSFSVS--LDNG--HGYEWGSRNGFSGLFAQKKNLL  735
             FNRVTYPNMME FE LGV+ME+SDMSFSVS  L +G     EWGSRNG +GL AQK N +
Sbjct  63    FNRVTYPNMMEWFEELGVEMELSDMSFSVSAQLQDGDEQTMEWGSRNGLAGLLAQKTNAV  122

Query  736   NPYFWQMIREILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCA  915
             +P FW+MIREILKFK+DVL+YLEE D NPD+DRN+TLG F++S GYS LFQ+AY++P+CA
Sbjct  123   SPAFWRMIREILKFKDDVLTYLEEHDKNPDLDRNETLGHFVQSHGYSRLFQQAYLVPICA  182

Query  916   SIWSCSSEGVMAFSAYSILSFCRNHHLLQNFSPALW  1023
              IWSC S+GV+ FSA+ +LSFCRNHHLLQ F    W
Sbjct  183   CIWSCPSQGVLGFSAFFVLSFCRNHHLLQLFGRPQW  218


 Score =   133 bits (335),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 84/124 (68%), Gaps = 6/124 (5%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F +    +FCR    LQLFGRPQWLTVK RSH+YVN+VREELE  GC+I+ GC
Sbjct  188   PSQGVLGFSAFFVLSFCRNHHLLQLFGRPQWLTVKGRSHTYVNRVREELESLGCQIKTGC  247

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV SVS  E G  G  V+ +G    +EAYD  I A HAPD L +LG +AT DE RILGAF
Sbjct  248   EVQSVSALEGG--GYRVVEAGGT--EEAYDSIIFAVHAPDALNILGDEATHDERRILGAF  303

Query  1304  QYVY  1315
             QYVY
Sbjct  304   QYVY  307



>dbj|BAB01740.1| cyclopocyclopropane fatty acid synthase-like protein [Arabidopsis 
thaliana]
Length=436

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/443 (61%), Positives = 331/443 (75%), Gaps = 13/443 (3%)
 Frame = +2

Query  1658  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1837
             M+ A GLL  + + + N  HMV S  E GARL VTRF   FI  G + +LE G T+F F 
Sbjct  1     MVIARGLLGIQTTLVKNMQHMVFSLTEAGARLFVTRFFRQFISIGCVTILE-GDTIFIFG  59

Query  1838  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2017
               +    LK ++++HSPQFYWKV T ADLGLADAYI+GD SFVDK  GLLNL  I +ANR
Sbjct  60    ENESTCPLKSILKIHSPQFYWKVMTLADLGLADAYINGDFSFVDKDSGLLNLIMILIANR  119

Query  2018  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2197
             DL++  S    KRGWWTP+  T+++ASA Y+++H+ RQNTLTQARRN+S HYDLSNE F 
Sbjct  120   DLNSRKSNLAKKRGWWTPVFLTASLASATYYLKHVCRQNTLTQARRNVSSHYDLSNEFFG  179

Query  2198  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVE  2377
             LF+D+TM YS AVFK   ++ ++          DK    + + +LEIGCGWG+LAIE V+
Sbjct  180   LFMDDTMMYSSAVFKVTIKNFQSE---------DK---EEPYEVLEIGCGWGTLAIEVVK  227

Query  2378  RTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAV  2557
             RTGCKYTG TLS +QLKY E+KV+EAGLQ+ I F LCDYRQL D  +YDRIISCEM+E V
Sbjct  228   RTGCKYTGFTLSIEQLKYVEEKVKEAGLQERITFKLCDYRQLCDTQKYDRIISCEMIEHV  287

Query  2558  GHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRV  2737
             GH+FM  FF  CE+ LAE+GI VLQF +IP+E YDE R +S FI EYIFPGGCLPSL+RV
Sbjct  288   GHKFMETFFSHCEAALAEDGIFVLQFTAIPEELYDESRLTSGFITEYIFPGGCLPSLARV  347

Query  2738  TSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYC  2917
             TSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ QI+DLGFD+KF+RTWEYYFDYC
Sbjct  348   TSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQKQIIDLGFDEKFLRTWEYYFDYC  407

Query  2918  AAGFHTCTLGDYQIVFSRPGNVT  2986
             AAGF T TL +YQ+  +    +T
Sbjct  408   AAGFKTLTLRNYQVTHTHSSTLT  430



>gb|EMS56688.1| Cyclopropane-fatty-acyl-phospholipid synthase [Triticum urartu]
Length=624

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/656 (46%), Positives = 391/656 (60%), Gaps = 129/656 (20%)
 Frame = +2

Query  1013  QLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGKN  1192
             QLF  PQ  TVK R  S+V+K                    ++     +AG  V+ +  +
Sbjct  92    QLFCYPQLPTVKARLQSFVDK-------------------GLNNATIAAAGYRVLENDGS  132

Query  1193  MVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAAW  1372
               +E YD  I+  HAP+ LK+LG +AT  ELRILGA QY+  DIYLH +Q+ MP+N + W
Sbjct  133   --EETYDSVILGVHAPNALKVLGAEATHHELRILGACQYIQRDIYLHCDQNLMPQNSSTW  190

Query  1373  SAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTPEQCLLKWTTGHpvpsvaa  1552
             SAWNFLGT +    +TYWLN +QN+                 +  L+ W  GH       
Sbjct  191   SAWNFLGTTSRGFSVTYWLNRIQNI---------------RSQMSLVPWIAGH-------  228

Query  1553  srassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSPLNNPNHMVPSW  1732
                                      GFHEDGLKAG  AA GLL K+C  L NP  M+PSW
Sbjct  229   -------------------------GFHEDGLKAGKAAAQGLLGKKCQLLQNPKQMIPSW  263

Query  1733  PETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFYWKVAT  1912
              E G RLLV RF   FI  G++IL+EEGG+V  F     K  +K ++RVH P FYWKVAT
Sbjct  264   TEAGTRLLVARFFNQFISIGNLILVEEGGSVLNFGKACDKCRIKSVMRVHDPLFYWKVAT  323

Query  1913  QADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAI  2092
             + +LGLA+AYI+G  SF+DK+EGLLNL   F++N   S  + +S         + ++ A+
Sbjct  324   EGNLGLAEAYINGCFSFLDKREGLLNL---FLSNDFFSLFLDKS---------MTYSCAV  371

Query  2093  ASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQ  2272
                +     +++Q  L                  SL +D+                    
Sbjct  372   FKMENESLEVAQQRKL------------------SLLIDK--------------------  393

Query  2273  MRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVRE  2452
                       AK+ + HH+L+IG GWGSLAI+AV++TGCKYTG+TLS +Q KYAE KVRE
Sbjct  394   ----------AKVKRGHHVLDIGSGWGSLAIQAVKQTGCKYTGVTLSAEQHKYAERKVRE  443

Query  2453  AGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQ  2632
             AGL+DNI F+LCDYRQ+P  C+YD IISC M+E VGHE+M+EFF  CES LAE+GILVLQ
Sbjct  444   AGLEDNISFMLCDYRQIPP-CKYDAIISCGMIEHVGHEYMDEFFACCESYLAEDGILVLQ  502

Query  2633  FISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQT  2812
             FIS PDERY++YR+ +DFIKEYIFPGGCLPSL RV SAM  SSR C+EH+E+IG HYY T
Sbjct  503   FISAPDERYEQYRRRTDFIKEYIFPGGCLPSLGRVVSAMTTSSRFCIEHVENIGPHYYTT  562

Query  2813  LRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDYQIVFSRPGN  2980
             L  WR NF+  + Q+L LGFD+KF+R WE+Y  Y AAGF +  +GDYQ+VFSRPGN
Sbjct  563   LMHWRDNFMTNKDQVLALGFDEKFMRIWEFYLIYSAAGFKSRAVGDYQVVFSRPGN  618


 Score = 81.3 bits (199),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 50/73 (68%), Gaps = 3/73 (4%)
 Frame = +1

Query  592  MMELFESLGVDMEISDMSFSVSLD---NGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
            M+E  E LGV+ME SDMSFSVS     +  G EW + NG S L AQK N+L   FW+M+R
Sbjct  1    MVEWLEGLGVEMERSDMSFSVSTQPDGSNRGCEWCNGNGISSLLAQKANILKTSFWRMLR  60

Query  763  EILKFKNDVLSYL  801
            EI KFKND L++L
Sbjct  61   EIFKFKNDALAFL  73



>ref|NP_001059618.1| Os07g0474600 [Oryza sativa Japonica Group]
 dbj|BAF21532.1| Os07g0474600, partial [Oryza sativa Japonica Group]
Length=390

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/389 (68%), Positives = 326/389 (84%), Gaps = 4/389 (1%)
 Frame = +2

Query  1868  LVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSN  2047
             ++RVH P FYWKVAT+ADLGLADAYI+G  SFVDKK+GLLNL  I +ANRD +   S S 
Sbjct  2     VMRVHDPLFYWKVATEADLGLADAYINGYCSFVDKKQGLLNLLLILIANRDANKQSSTST  61

Query  2048  SK-RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTY  2224
             S+ RGWWTP+L T+ +ASAKYF+RH+SR+NT+TQ R+NIS+HYDLSN+ FSLFLD +MTY
Sbjct  62    SRIRGWWTPMLLTAGVASAKYFLRHVSRKNTVTQTRQNISQHYDLSNDFFSLFLDPSMTY  121

Query  2225  SCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGI  2404
             SCAVFK EDE L+ AQ RK+SLLI KA++ ++HH+LEIG GWGSLAI+ V++TGCKYTG+
Sbjct  122   SCAVFKDEDESLEAAQQRKVSLLIHKARVERDHHVLEIGSGWGSLAIQVVKQTGCKYTGV  181

Query  2405  TLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFF  2584
             TLSE+QLKY + KV+EAGL+D++ FLLCDYRQ+P   +YDRIISCEM+E VGHE+M++FF
Sbjct  182   TLSEEQLKYCQRKVKEAGLEDHMTFLLCDYRQIPTVRKYDRIISCEMIEGVGHEYMDDFF  241

Query  2585  GRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSR  2764
             G CES+LA++G+ VLQFISIP+ERY+EYR+SSDFIKEYIFPGGCLPSLSR+TSAM+ SSR
Sbjct  242   GCCESLLAQDGLFVLQFISIPEERYEEYRRSSDFIKEYIFPGGCLPSLSRITSAMSTSSR  301

Query  2765  LCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTL  2944
             LC+EHLE+IG HYY TL  WR NF+  + +I  LGFD KFIR WEYYF YCAAGF + TL
Sbjct  302   LCIEHLENIGYHYYPTLIRWRDNFMANREEIKSLGFDDKFIRIWEYYFIYCAAGFKSRTL  361

Query  2945  GDYQIVFSRPGN--VTAFGD-PYKGLASA  3022
             G+YQIV SRPGN  +  F D PY    +A
Sbjct  362   GNYQIVLSRPGNDKLLPFADNPYATFPAA  390



>ref|NP_001189954.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
 gb|AEE76770.1| Cyclopropane-fatty-acyl-phospholipid synthase [Arabidopsis thaliana]
Length=492

 Score =   541 bits (1395),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 271/456 (59%), Positives = 327/456 (72%), Gaps = 27/456 (6%)
 Frame = +2

Query  1658  MIAAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFE  1837
             M+ A GLL  + + + N  HMV S  E GARL VTRF   FI  G + +LE G T+F F 
Sbjct  1     MVIARGLLGIQTTLVKNMQHMVFSLTEAGARLFVTRFFRQFISIGCVTILE-GDTIFIFG  59

Query  1838  GTDKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANR  2017
               +    LK ++++HSPQFYWKV T ADLGLADAYI+GD SFVDK  GLLNL  I +ANR
Sbjct  60    ENESTCPLKSILKIHSPQFYWKVMTLADLGLADAYINGDFSFVDKDSGLLNLIMILIANR  119

Query  2018  DLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFS  2197
             DL++  S    KRGWWTP+  T+++ASA Y+++H                    SNE F 
Sbjct  120   DLNSRKSNLAKKRGWWTPVFLTASLASATYYLKH--------------------SNEFFG  159

Query  2198  LFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKE-HHILEIGCGWGSLAIEAV  2374
             LF+D+TM YS AVFK     +K  Q  K +    K +  +E + +LEIGCGWG+LAIE V
Sbjct  160   LFMDDTMMYSSAVFKV---TIKNFQNEKNTSFNRKGEDKEEPYEVLEIGCGWGTLAIEVV  216

Query  2375  ERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEA  2554
             +RTGCKYTG TLS +QLKY E+KV+EAGLQ+ I F LCDYRQL D  +YDRIISCEM+E 
Sbjct  217   KRTGCKYTGFTLSIEQLKYVEEKVKEAGLQERITFKLCDYRQLCDTQKYDRIISCEMIEH  276

Query  2555  VGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSR  2734
             VGH+FM  FF  CE+ LAE+GI VLQF +IP+E YDE R +S FI EYIFPGGCLPSL+R
Sbjct  277   VGHKFMETFFSHCEAALAEDGIFVLQFTAIPEELYDESRLTSGFITEYIFPGGCLPSLAR  336

Query  2735  VTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDY  2914
             VTSAMA+SSRLC+E++E+IGIHYY TLR WR N LERQ QI+DLGFD+KF+RTWEYYFDY
Sbjct  337   VTSAMASSSRLCIENVENIGIHYYPTLRYWRKNLLERQKQIIDLGFDEKFLRTWEYYFDY  396

Query  2915  CAAGFHTCTLGDYQIVFSRPGNVTAFG--DPYKGLA  3016
             CAAGF T TL +YQIVFSRPGNV AFG  DP+   A
Sbjct  397   CAAGFKTLTLRNYQIVFSRPGNVAAFGNDDPFHSSA  432



>ref|XP_004173332.1| PREDICTED: LOW QUALITY PROTEIN: probable fatty acid methyltransferase-like, 
partial [Cucumis sativus]
Length=325

 Score =   533 bits (1372),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 245/324 (76%), Positives = 280/324 (86%), Gaps = 0/324 (0%)
 Frame = +2

Query  2054  RGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCA  2233
             RGWWTP LFTS IASAKYF  H SR+NTLTQARRNISRHYDLSNELFSLF+D+TM YSCA
Sbjct  2     RGWWTPPLFTSCIASAKYFFHHTSRRNTLTQARRNISRHYDLSNELFSLFMDDTMQYSCA  61

Query  2234  VFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLS  2413
             +FKSE+EDLK AQMRK+SLLI KA+I+K HH+LEIGCGWGSLAIE V++TGC+YTGITLS
Sbjct  62    IFKSENEDLKVAQMRKMSLLIKKARINKXHHVLEIGCGWGSLAIEIVKQTGCRYTGITLS  121

Query  2414  EQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNCRYDRIISCEMLEAVGHEFMNEFFGRC  2593
             EQQLKYAE KV++A LQD I  LLCDYR +P   +YDRIISCEM+EAVGHEFM +FFG C
Sbjct  122   EQQLKYAEKKVKDANLQDRINLLLCDYRNVPSTXKYDRIISCEMIEAVGHEFMEDFFGTC  181

Query  2594  ESVLAENGILVLQFISIPDERYDEYRQSSDFIKEYIFPGGCLPSLSRVTSAMAASSRLCV  2773
             ESVLAENGI V QF ++PD RYD YR SS+FIKEYIFPGGCLP LSRVT+AM  +SR C+
Sbjct  182   ESVLAENGIFVQQFTAMPDARYDAYRLSSEFIKEYIFPGGCLPCLSRVTTAMTKASRFCI  241

Query  2774  EHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDKKFIRTWEYYFDYCAAGFHTCTLGDY  2953
             EHLE+IGIHY+QTLR WR +FLE +S+IL LGFD+ FIRTWEYYFDYCAAGF + TL +Y
Sbjct  242   EHLENIGIHYHQTLRYWRKDFLENKSKILQLGFDESFIRTWEYYFDYCAAGFKSRTLNNY  301

Query  2954  QIVFSRPGNVTAFGDPYKGLASAY  3025
             QIV+SRPGNV  F +PY+G  SAY
Sbjct  302   QIVYSRPGNVAVFNNPYQGFPSAY  325



>ref|XP_006431328.1| hypothetical protein CICLE_v10030464mg [Citrus clementina]
 gb|ESR44568.1| hypothetical protein CICLE_v10030464mg [Citrus clementina]
Length=585

 Score =   536 bits (1382),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 264/414 (64%), Positives = 320/414 (77%), Gaps = 7/414 (2%)
 Frame = +2

Query  950   PSLLTPFFHSVATTTFCRIS--LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGC  1123
             PS     F + +  +FCR    L+LFG PQWLT + RSHSYVNKV  +L+  GC+IR  C
Sbjct  177   PSERAMSFSAFSVLSFCRNHHLLELFGHPQWLTFRIRSHSYVNKVTGQLQSWGCQIRTSC  236

Query  1124  EVHSVSTDEQGSAGGVVIISGKNMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAF  1303
             EV+SV   ++G    VV   G    QE Y  C+MA HAPD L++LG QAT DE RILGAF
Sbjct  237   EVYSVYPADEGCT--VVSSDGS---QENYSCCVMAVHAPDALRILGNQATLDETRILGAF  291

Query  1304  QYVYSDIYLHREQSFMPRNLAAWSAWNFLGTVNNRVCLTYWLNTLQNLGDTKQPYLVTLN  1483
             +YVYSDI+LHR+++FMP+N AAWSAWNFLG+ + ++CLTYWLN LQN G+T  P+L TLN
Sbjct  292   RYVYSDIFLHRDKNFMPQNTAAWSAWNFLGSTDGKICLTYWLNVLQNNGETGVPFLATLN  351

Query  1484  PPRTPEQCLLKWTTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMI  1663
             P  TPE  LLKW+T + VPSVAAS+AS EL+ IQGKR IWFCGAYQGYGF EDGLKAGMI
Sbjct  352   PDHTPENTLLKWSTSNRVPSVAASKASLELDLIQGKRGIWFCGAYQGYGFQEDGLKAGMI  411

Query  1664  AAHGLLKKRCSPLNNPNHMVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGT  1843
              AHG+L K C+ L+NP HMVPS  E GARL V RF   +I TG +ILLEEGGT+FTFEGT
Sbjct  412   TAHGVLGKNCAVLSNPKHMVPSLLEKGARLFVARFFRRYISTGCLILLEEGGTIFTFEGT  471

Query  1844  DKKNLLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDL  2023
              + + LK ++R+H+PQFYWKV T+ADLGLAD+YI+GD SFVDK EGLLNLF I +AN+DL
Sbjct  472   LRNSPLKTVLRIHNPQFYWKVMTEADLGLADSYINGDFSFVDKDEGLLNLFLIVIANKDL  531

Query  2024  SASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSN  2185
             ++S S+   KRGWW+P+ FT++IASAK F RHISR+NTLTQARRN+SRHYDL N
Sbjct  532   NSSTSKLKQKRGWWSPMFFTASIASAKCFFRHISRKNTLTQARRNVSRHYDLVN  585


 Score =   328 bits (840),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 177/207 (86%), Gaps = 0/207 (0%)
 Frame = +1

Query  403   MRVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKTVTLDGVDLDLGFMVFNRVT  582
             M+VAV+G GISGL SA+VLAK G  VV+YEKED LGGHAKT+T+DGVDLDLGF +FN  T
Sbjct  1     MQVAVIGGGISGLASAFVLAKAGVDVVLYEKEDSLGGHAKTITIDGVDLDLGFTLFNHAT  60

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
              PN ME F+SLGVDM+ SDMSFSVSLD G G+EWG+RNGFS LFAQKKN LNPYFWQM+R
Sbjct  61    SPNTMEFFDSLGVDMKSSDMSFSVSLDKGQGFEWGTRNGFSSLFAQKKNFLNPYFWQMLR  120

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             EI KFK+D L Y++E +NNPD++RN+TLG+F+KSRGYSELFQK+Y+IP+C S+WSC SE 
Sbjct  121   EINKFKDDALRYIDELENNPDINRNETLGQFLKSRGYSELFQKSYLIPLCDSVWSCPSER  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
              M+FSA+S+LSFCRNHHLL+ F    W
Sbjct  181   AMSFSAFSVLSFCRNHHLLELFGHPQW  207



>ref|XP_005824669.1| hypothetical protein GUITHDRAFT_165417 [Guillardia theta CCMP2712]
 gb|EKX37689.1| hypothetical protein GUITHDRAFT_165417 [Guillardia theta CCMP2712]
Length=1146

 Score =   450 bits (1157),  Expect(2) = 3e-172, Method: Compositional matrix adjust.
 Identities = 262/691 (38%), Positives = 378/691 (55%), Gaps = 72/691 (10%)
 Frame = +2

Query  1010  LQLFGRPQWLTVKRRSHSYVNKVREELEKRGCEIRCGCEVHSVSTDEQGSAGGVVIISGK  1189
             L+L  RP+W  VK RS SYV KV E L+    + R  C V SV        G  V +  +
Sbjct  199   LELIERPKWRVVKDRSRSYVRKVVEILQ----DARSSCAVRSVV-----RKGDKVEVRDE  249

Query  1190  NMVQEAYDGCIMAAHAPDTLKMLGKQATFDELRILGAFQYVYSDIYLHREQSFMPRNLAA  1369
                 E +D  I A H+  T+K+LG   + +E  IL    Y  +D+YLHR+ S MPR    
Sbjct  250   QGKCEEFDHVIFATHSDVTMKILGGDISKEEEAILKGIPYAENDVYLHRDPSLMPRERKV  309

Query  1370  WSAWNFLGTV--------NNRVCLTYWLNTLQNLGDTKQPYLVTLNPPRTP--EQCLLKW  1519
             W++WN L           +  VC++YW+N+LQ L +      VTLNPP  P  E+ +   
Sbjct  310   WASWNCLDMTELNKDAPSDRAVCVSYWVNSLQRLPEGTGDLFVTLNPPHAPAEEKTVKHL  369

Query  1520  TTGHpvpsvaasrassELERIQGKRRIWFCGAYQGYGFHEDGLKAGMIAAHGLLKKRCSP  1699
                HPV S A+ ++   L++IQG +R WFCGA+ GYGFHEDG+K+ +     +       
Sbjct  370   KLSHPVFSGASKKSQETLDKIQGVKRTWFCGAWCGYGFHEDGMKSAVNVVEKM-------  422

Query  1700  LNNPNHMVPSW---PETGARLLVTRFLAS--------FIVTGSIILLEEGGTVFTF----  1834
                   M+P W   P +    L+TRF+ S         I  GS+ L+   GT   +    
Sbjct  423   ----GGMIP-WVPRPTSPYMPLLTRFVCSSVHRFAGRAIKRGSLRLIMPNGTEVVYGNPE  477

Query  1835  ------EGTDKKN----LLKVLVRVHSPQFYWKVATQADLGLADAYIHGDISFVDKKEGL  1984
                   EG D+K     +    VRV   +F+ ++A   D+GL ++Y++G+     + + L
Sbjct  478   QKYVEEEGGDEKKGRREVYHSRVRVFDCKFFHRIAKDTDIGLGESYMNGEF----EPDDL  533

Query  1985  LNLFKIFVANRDLSASVSRSNSKRGWWTPLLFTSAIASAKYFIRHISRQNTLTQARRNIS  2164
              N   +   N +   S+ +S     W         I +    + H++R NT+  + +NI+
Sbjct  534   TNFLNVLTQNVEEFNSLQKSLGVLNW---------IGTQVQTMAHMARANTVEGSLKNIN  584

Query  2165  RHYDLSNELFSLFLDETMTYSCAVFKSEDEDLKTAQMRKISLLIDKAKISKEHHILEIGC  2344
              HYDL N+++ LFLDET  YS  VF S  + L  +Q+ K+ L++DK +++  HHI EIGC
Sbjct  585   EHYDLGNDMYRLFLDETWMYSSGVFNSPQDTLYQSQLNKLDLILDKLELNSGHHIFEIGC  644

Query  2345  GWGSLAIEAVERTGCKYTGITLSEQQLKYAEDKVREAGLQDNIRFLLCDYRQLPDNC--R  2518
             GWG  AI AVER GC+ TGIT+SE+Q  YA  KV E G+ D I  L CDYR+LP     +
Sbjct  645   GWGGFAIRAVERFGCRVTGITISEEQFSYATAKVEERGMSDRITILFCDYRKLPAELLGK  704

Query  2519  YDRIISCEMLEAVGHEFMNEFFGRCESVLAENGILVLQFISIPDERYDEYRQSSDFIKEY  2698
             +DR++S EM+EAVGHE + E+FG  E +L   G  V+Q I+  DE Y EY + SDFI+ +
Sbjct  705   FDRLVSIEMIEAVGHENLGEYFGVIEQLLVPGGKAVIQAITYKDEHYMEYCRCSDFIRRH  764

Query  2699  IFPGGCLPSLSRVTSAMAASSRLCVEHLEDIGIHYYQTLRCWRANFLERQSQILDLGFDK  2878
             IFPGG LPS+  +  A   SS  C +H+EDIG+HY +TL+ W  N+   + +I  LG+  
Sbjct  765   IFPGGHLPSMGAMLGATRNSSLFC-QHVEDIGLHYARTLKMWHENWTGAEDKIKKLGYSD  823

Query  2879  KFIRTWEYYFDYCAAGFHTCTLGDYQIVFSR  2971
             +F R W +YF YC AGF    + +YQIV+ +
Sbjct  824   EFYRKWRFYFSYCEAGFQLQFIHNYQIVWCK  854


 Score =   186 bits (472),  Expect(2) = 3e-172, Method: Compositional matrix adjust.
 Identities = 99/207 (48%), Positives = 137/207 (66%), Gaps = 8/207 (4%)
 Frame = +1

Query  406   RVAVVGAGISGLVSAYVLAKGGAGVVVYEKEDYLGGHAKT-VTLDGVDLDLGFMVFNRVT  582
             RVA++G+GISGL +A+++ K G  V +YE EDY GGH  T  T+ GV +DLGF VFNR T
Sbjct  8     RVAIIGSGISGLAAAWLMQKSGWKVTLYEAEDYFGGHTLTDETIPGVPVDLGFQVFNRTT  67

Query  583   YPNMMELFESLGVDMEISDMSFSVSLDNGHGYEWGSRNGFSGLFAQKKNLLNPYFWQMIR  762
             Y +  +  E+LGVD E SDMSF++S+D+G   EWGS N  S +FAQ++NL++P F  MIR
Sbjct  68    YGHFEQFLEALGVDSEESDMSFALSVDDGK-VEWGSHN-LSTIFAQRRNLVSPKFLLMIR  125

Query  763   EILKFKNDVLSYLEEFDNNPDMDRNDTLGEFIKSRGYSELFQKAYIIPMCASIWSCSSEG  942
             ++L+F  +    L E +   DM    TLGE++K  GYSE F   Y++PMCA++WS S++ 
Sbjct  126   DVLRFGKEAPKVLVE-EQYADM----TLGEYLKKEGYSEGFTYWYLLPMCAAVWSVSNKQ  180

Query  943   VMAFSAYSILSFCRNHHLLQNFSPALW  1023
              M FS   ++ F  NHHLL+      W
Sbjct  181   CMEFSIRVMIRFWVNHHLLELIERPKW  207



>gb|AFW60130.1| hypothetical protein ZEAMMB73_361545 [Zea mays]
Length=430

 Score =   525 bits (1352),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 245/421 (58%), Positives = 321/421 (76%), Gaps = 1/421 (0%)
 Frame = +2

Query  1718  MVPSWPETGARLLVTRFLASFIVTGSIILLEEGGTVFTFEGTDKKNLLKVLVRVHSPQFY  1897
             MV SW E GARLLV R L  +I  G+  +LEEGGT F+F    +K  +K  +RVH PQFY
Sbjct  1     MVSSWTEAGARLLVARSLDQYITIGNFCILEEGGTTFSFGKACEKCHVKSAIRVHDPQFY  60

Query  1898  WKVATQADLGLADAYIHGDISFVDKKEGLLNLFKIFVANRDLSASVSRSNSKRGWWTPLL  2077
             WK AT+ DLG A AYI+G ISFVD ++GL+NL +I +ANR     +S S +++ WW+PLL
Sbjct  61    WKAATEGDLGFASAYINGQISFVDHRKGLVNLVRIILANRGEFKRLS-STARKAWWSPLL  119

Query  2078  FTSAIASAKYFIRHISRQNTLTQARRNISRHYDLSNELFSLFLDETMTYSCAVFKSEDED  2257
               + ++ AKYF+RH  R+N++++AR+NIS HYDLSN+ F+L+LD +MTYS  +FK  +E 
Sbjct  120   GITGVSFAKYFLRHALRKNSVSKARKNISEHYDLSNDFFALYLDPSMTYSSGIFKVAEES  179

Query  2258  LKTAQMRKISLLIDKAKISKEHHILEIGCGWGSLAIEAVERTGCKYTGITLSEQQLKYAE  2437
             L+TAQ+RK+  LI+KAK+   HH+L+IGCGWG+LAI  V++TGCKYTGITLSE+QLKYA+
Sbjct  180   LETAQLRKLDSLINKAKVEPGH