BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25494_g1_i2 len=1557 path=[1507:0-98 1606:99-149 1657:150-176
1684:177-178 629:179-196 1703:197-289 1794:290-318 1823:319-385
306:386-386 1889:387-429 1931:430-449 1180:450-572 2071:573-574
2073:575-629 2128:630-650 2149:651-689 2187:690-721 1294:722-846
332:847-872 2364:873-903 1064:904-1143 2633:1144-1172
1452:1173-1556]

Length=1557
                                                                      Score     E

ref|XP_009612191.1|  PREDICTED: APO protein 4, mitochondrial            369   1e-120   
ref|XP_009805015.1|  PREDICTED: APO protein 4, mitochondrial            367   1e-119   
ref|XP_004238237.2|  PREDICTED: APO protein 4, mitochondrial            365   9e-119   
ref|XP_006341909.1|  PREDICTED: APO protein 4, mitochondrial-like       365   1e-118   
ref|XP_008455841.1|  PREDICTED: APO protein 4, mitochondrial            359   2e-116   
ref|XP_004151879.1|  PREDICTED: APO protein 4, mitochondrial-like       355   3e-115   
ref|XP_004158556.1|  PREDICTED: APO protein 4, mitochondrial-like       355   4e-115   
gb|KDP41156.1|  hypothetical protein JCGZ_03650                         350   3e-113   
gb|KHN36547.1|  APO protein 4, mitochondrial                            351   5e-113   
ref|XP_010248529.1|  PREDICTED: APO protein 4, mitochondrial isof...    347   9e-112   
ref|XP_007033060.1|  APO protein 4 isoform 1                            346   1e-111   
ref|XP_010248521.1|  PREDICTED: APO protein 4, mitochondrial isof...    348   1e-111   
ref|XP_006447520.1|  hypothetical protein CICLE_v10015921mg             345   3e-111   
ref|XP_002273999.2|  PREDICTED: APO protein 4, mitochondrial            345   6e-111   Vitis vinifera
gb|EYU32798.1|  hypothetical protein MIMGU_mgv1a010138mg                344   1e-110   
ref|XP_010052452.1|  PREDICTED: APO protein 4, mitochondrial            342   1e-109   
ref|XP_011074514.1|  PREDICTED: LOW QUALITY PROTEIN: APO protein ...    340   2e-109   
emb|CDP07549.1|  unnamed protein product                                338   1e-108   
ref|XP_007149961.1|  hypothetical protein PHAVU_005G114000g             338   2e-108   
ref|XP_003597021.1|  APO protein                                        338   3e-108   
ref|XP_004487390.1|  PREDICTED: APO protein 4, mitochondrial-like...    334   1e-106   
ref|XP_010694573.1|  PREDICTED: APO protein 4, mitochondrial            333   2e-106   
ref|XP_002527241.1|  APO protein 4, mitochondrial precursor, puta...    333   3e-106   Ricinus communis
ref|XP_010089336.1|  APO protein 4                                      333   5e-106   
ref|XP_011037010.1|  PREDICTED: APO protein 4, mitochondrial            332   8e-106   
ref|XP_006372950.1|  hypothetical protein POPTR_0017s06490g             329   7e-105   
ref|XP_009365158.1|  PREDICTED: APO protein 4, mitochondrial-like       327   5e-104   
ref|XP_009337730.1|  PREDICTED: APO protein 4, mitochondrial-like       324   7e-103   
ref|XP_004287928.1|  PREDICTED: APO protein 4, mitochondrial-like       324   1e-102   
ref|XP_007215688.1|  hypothetical protein PRUPE_ppa008702mg             323   1e-102   
ref|XP_008230090.1|  PREDICTED: APO protein 4, mitochondrial            322   3e-102   
ref|XP_009417984.1|  PREDICTED: APO protein 4, mitochondrial            318   1e-100   
ref|XP_008776099.1|  PREDICTED: APO protein 4, mitochondrial isof...    317   2e-100   
ref|XP_008776097.1|  PREDICTED: APO protein 4, mitochondrial isof...    317   3e-100   
ref|XP_008379620.1|  PREDICTED: LOW QUALITY PROTEIN: APO protein ...    318   3e-100   
gb|EPS60487.1|  hypothetical protein M569_14314                         314   2e-99    
ref|XP_009353258.1|  PREDICTED: LOW QUALITY PROTEIN: APO protein ...    312   2e-98    
gb|KDP41149.1|  hypothetical protein JCGZ_03643                         315   5e-98    
ref|XP_010488194.1|  PREDICTED: APO protein 4, mitochondrial-like       306   4e-96    
gb|KFK39492.1|  hypothetical protein AALP_AA3G251000                    305   2e-95    
ref|XP_004976898.1|  PREDICTED: APO protein 4, mitochondrial-like       303   9e-95    
ref|XP_010466431.1|  PREDICTED: APO protein 4, mitochondrial            303   2e-94    
ref|XP_002885464.1|  hypothetical protein ARALYDRAFT_318914             301   6e-94    
ref|NP_001053956.1|  Os04g0628000                                       300   8e-94    Oryza sativa Japonica Group [Japonica rice]
emb|CAJ86368.1|  OSIGBa0117N13.12                                       300   2e-93    Oryza sativa [red rice]
ref|NP_188811.2|  APO protein 4                                         300   2e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009145455.1|  PREDICTED: APO protein 4, mitochondrial            298   5e-93    
ref|XP_006652862.1|  PREDICTED: APO protein 4, mitochondrial-like       298   7e-93    
emb|CDY38637.1|  BnaA05g19500D                                          298   9e-93    
dbj|BAB02836.1|  unnamed protein product                                301   1e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510550.1|  PREDICTED: APO protein 4, mitochondrial-like       296   3e-92    
ref|XP_006279193.1|  hypothetical protein CARUB_v10016518mg             296   7e-92    
ref|XP_010551030.1|  PREDICTED: APO protein 4, mitochondrial-like       295   7e-92    
emb|CDY33138.1|  BnaCnng07090D                                          295   8e-92    
ref|XP_002447052.1|  hypothetical protein SORBIDRAFT_06g027590          295   1e-91    Sorghum bicolor [broomcorn]
ref|XP_010909792.1|  PREDICTED: APO protein 4, mitochondrial            293   2e-91    
gb|AGT17276.1|  hypothetical protein SHCRBa_020_L15_F_200               293   6e-91    
ref|XP_002448571.1|  hypothetical protein SORBIDRAFT_06g029350          293   9e-91    Sorghum bicolor [broomcorn]
gb|ACR37735.1|  unknown                                                 289   2e-90    Zea mays [maize]
ref|NP_001143703.1|  hypothetical protein                               292   2e-90    Zea mays [maize]
ref|XP_006836549.1|  hypothetical protein AMTR_s00131p00039570          292   4e-90    
ref|XP_007199896.1|  hypothetical protein PRUPE_ppa007230mg             291   1e-89    
ref|XP_006406612.1|  hypothetical protein EUTSA_v10021082mg             290   1e-89    
ref|XP_008237745.1|  PREDICTED: APO protein 4, mitochondrial-like       289   2e-89    
ref|XP_003580603.1|  PREDICTED: APO protein 4, mitochondrial            288   4e-89    
gb|EMT11106.1|  hypothetical protein F775_07337                         283   4e-87    
gb|EMS51284.1|  hypothetical protein TRIUR3_05793                       283   7e-87    
ref|XP_010248590.1|  PREDICTED: APO protein 4, mitochondrial isof...    279   1e-85    
dbj|BAK06104.1|  predicted protein                                      278   3e-85    
gb|ACU15542.1|  unknown                                                 262   1e-80    Glycine max [soybeans]
ref|XP_006300272.1|  hypothetical protein CARUB_v100143371mg            259   1e-79    
emb|CAE04242.3|  OSJNBa0089N06.3                                        265   2e-77    Oryza sativa [red rice]
gb|KHN25778.1|  APO protein 4, mitochondrial                            251   2e-76    
ref|XP_010532481.1|  PREDICTED: APO protein 4, mitochondrial            241   3e-71    
ref|XP_010263261.1|  PREDICTED: APO protein 1, chloroplastic isof...    213   5e-59    
ref|XP_010263260.1|  PREDICTED: APO protein 1, chloroplastic isof...    213   5e-59    
ref|XP_009411316.1|  PREDICTED: APO protein 2, chloroplastic            205   2e-56    
gb|KHG21282.1|  APO 2, chloroplastic -like protein                      206   2e-56    
ref|XP_001757664.1|  predicted protein                                  201   1e-55    
ref|XP_011040100.1|  PREDICTED: APO protein 1, chloroplastic isof...    204   1e-55    
ref|XP_011040094.1|  PREDICTED: APO protein 1, chloroplastic isof...    204   2e-55    
ref|XP_003548251.1|  PREDICTED: APO protein 1, chloroplastic-like       203   2e-55    
ref|XP_003533257.1|  PREDICTED: APO protein 1, chloroplastic-like       203   2e-55    
ref|XP_006373554.1|  hypothetical protein POPTR_0016s00340g             202   3e-55    
ref|NP_001053869.2|  Os04g0615500                                       197   6e-55    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001169188.1|  hypothetical protein                               201   1e-54    Zea mays [maize]
gb|KHG25157.1|  APO 1, chloroplastic -like protein                      201   2e-54    
ref|XP_004293776.1|  PREDICTED: APO protein 1, chloroplastic-like       200   3e-54    
ref|XP_008443853.1|  PREDICTED: APO protein 2, chloroplastic            199   5e-54    
ref|XP_004976806.1|  PREDICTED: APO protein 1, chloroplastic-like       198   7e-54    
ref|XP_010058004.1|  PREDICTED: APO protein 1, chloroplastic            199   7e-54    
ref|XP_004146678.1|  PREDICTED: APO protein 2, chloroplastic-like       199   8e-54    
gb|KDO59472.1|  hypothetical protein CISIN_1g013860mg                   198   1e-53    
ref|XP_004512596.1|  PREDICTED: APO protein 1, chloroplastic-like       198   1e-53    
ref|XP_006474008.1|  PREDICTED: APO protein 2, chloroplastic-like       198   1e-53    
ref|XP_008810393.1|  PREDICTED: APO protein 2, chloroplastic            199   1e-53    
ref|XP_004487892.1|  PREDICTED: APO protein 2, chloroplastic-like...    199   1e-53    
ref|XP_004487893.1|  PREDICTED: APO protein 2, chloroplastic-like...    199   1e-53    
ref|XP_009628505.1|  PREDICTED: APO protein 1, chloroplastic            198   1e-53    
ref|XP_010918484.1|  PREDICTED: APO protein 2, chloroplastic isof...    197   2e-53    
ref|XP_010918480.1|  PREDICTED: APO protein 2, chloroplastic isof...    198   2e-53    
ref|XP_002529388.1|  APO protein 2, chloroplast precursor, putative     201   3e-53    Ricinus communis
gb|KHN41432.1|  APO protein 2, chloroplastic                            192   3e-53    
ref|XP_010679592.1|  PREDICTED: APO protein 1, chloroplastic isof...    197   3e-53    
ref|XP_006652824.1|  PREDICTED: APO protein 1, chloroplastic-like...    196   4e-53    
ref|XP_008225867.1|  PREDICTED: APO protein 1, chloroplastic            197   5e-53    
ref|XP_006453603.1|  hypothetical protein CICLE_v10008334mg             196   5e-53    
ref|XP_007211631.1|  hypothetical protein PRUPE_ppa005803mg             197   5e-53    
ref|XP_004290815.1|  PREDICTED: APO protein 2, chloroplastic-like       197   5e-53    
ref|XP_010679590.1|  PREDICTED: APO protein 1, chloroplastic isof...    197   6e-53    
ref|XP_009340319.1|  PREDICTED: APO protein 1, chloroplastic-like...    196   7e-53    
ref|XP_002520827.1|  APO protein 3, mitochondrial precursor, puta...    195   8e-53    Ricinus communis
ref|XP_008383289.1|  PREDICTED: APO protein 1, chloroplastic-like       196   9e-53    
ref|XP_009340317.1|  PREDICTED: APO protein 1, chloroplastic-like...    196   9e-53    
ref|XP_004149527.1|  PREDICTED: APO protein 1, chloroplastic-like       196   1e-52    
ref|XP_011083963.1|  PREDICTED: APO protein 2, chloroplastic            196   1e-52    
emb|CDP10244.1|  unnamed protein product                                195   1e-52    
ref|XP_010106787.1|  APO protein 2                                      195   2e-52    
ref|XP_007021823.1|  APO protein 1, chloroplastic isoform 2             194   2e-52    
gb|EYU27201.1|  hypothetical protein MIMGU_mgv1a007941mg                194   2e-52    
gb|EEE61681.1|  hypothetical protein OsJ_16150                          194   2e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010273620.1|  PREDICTED: APO protein 2, chloroplastic            195   2e-52    
gb|EEC78001.1|  hypothetical protein OsI_17394                          195   2e-52    Oryza sativa Indica Group [Indian rice]
gb|KEH38305.1|  APO RNA-binding protein                                 191   3e-52    
ref|XP_007021822.1|  APO protein 1, chloroplastic isoform 1             194   4e-52    
ref|XP_007011910.1|  APO protein 2, chloroplast, putative               194   4e-52    
ref|XP_008464665.1|  PREDICTED: APO protein 1, chloroplastic            194   6e-52    
ref|XP_010536974.1|  PREDICTED: APO protein 2, chloroplastic            194   6e-52    
ref|XP_010483349.1|  PREDICTED: APO protein 2, chloroplastic            194   6e-52    
ref|XP_006358862.1|  PREDICTED: APO protein 1, chloroplastic-like       193   7e-52    
ref|XP_010452955.1|  PREDICTED: APO protein 2, chloroplastic-like       193   8e-52    
ref|XP_009786956.1|  PREDICTED: APO protein 1, chloroplastic isof...    193   1e-51    
ref|XP_011091964.1|  PREDICTED: APO protein 2, chloroplastic-like       192   1e-51    
ref|XP_009385478.1|  PREDICTED: APO protein 1, chloroplastic            193   2e-51    
ref|XP_002864538.1|  predicted protein                                  192   2e-51    
ref|XP_010096510.1|  APO protein 1                                      193   2e-51    
dbj|BAJ89992.1|  predicted protein                                      192   2e-51    
ref|XP_009786954.1|  PREDICTED: APO protein 1, chloroplastic isof...    193   2e-51    
ref|XP_009786955.1|  PREDICTED: APO protein 1, chloroplastic isof...    193   2e-51    
ref|XP_010443503.1|  PREDICTED: APO protein 2, chloroplastic-like       192   2e-51    
ref|XP_007152418.1|  hypothetical protein PHAVU_004G128500g             192   2e-51    
ref|XP_006280470.1|  hypothetical protein CARUB_v10026405mg             192   2e-51    
emb|CDO98690.1|  unnamed protein product                                192   2e-51    
ref|XP_003580549.1|  PREDICTED: APO protein 1, chloroplastic            191   3e-51    
ref|XP_004245655.1|  PREDICTED: APO protein 1, chloroplastic            191   4e-51    
ref|XP_003596991.1|  APO protein                                        192   4e-51    
gb|EMT18800.1|  hypothetical protein F775_17967                         191   4e-51    
ref|XP_010928994.1|  PREDICTED: APO protein 1, chloroplastic            191   4e-51    
ref|XP_006401151.1|  hypothetical protein EUTSA_v10013543mg             191   4e-51    
emb|CAE04336.2|  OSJNBa0008M17.9                                        194   4e-51    Oryza sativa Japonica Group [Japonica rice]
gb|EMS53738.1|  hypothetical protein TRIUR3_16129                       192   4e-51    
ref|XP_002264685.1|  PREDICTED: APO protein 1, chloroplastic isof...    191   5e-51    Vitis vinifera
ref|XP_004953830.1|  PREDICTED: APO protein 2, chloroplastic-like       191   6e-51    
emb|CAJ86305.1|  H0525G02.2                                             194   6e-51    Oryza sativa [red rice]
gb|KEH26436.1|  APO RNA-binding protein                                 190   6e-51    
gb|KDP21687.1|  hypothetical protein JCGZ_03358                         191   8e-51    
ref|XP_002308405.1|  hypothetical protein POPTR_0006s19750g             190   8e-51    Populus trichocarpa [western balsam poplar]
gb|ADE76138.1|  unknown                                                 191   9e-51    
ref|XP_010680775.1|  PREDICTED: APO protein 2, chloroplastic            191   9e-51    
ref|XP_006587114.1|  PREDICTED: APO protein 2, chloroplastic-like       190   1e-50    
gb|KDO78636.1|  hypothetical protein CISIN_1g013320mg                   190   1e-50    
gb|KDP38686.1|  hypothetical protein JCGZ_04039                         187   1e-50    
ref|XP_003619598.1|  APO protein                                        190   1e-50    
ref|XP_006467238.1|  PREDICTED: APO protein 1, chloroplastic-like...    190   1e-50    
gb|KCW81120.1|  hypothetical protein EUGRSUZ_C02496                     187   2e-50    
dbj|BAB08863.1|  unnamed protein product                                188   2e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007153604.1|  hypothetical protein PHAVU_003G049700g             186   3e-50    
gb|EPS57781.1|  hypothetical protein M569_17036                         187   3e-50    
ref|NP_200601.3|  APO protein 2                                         189   3e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006649018.1|  PREDICTED: APO protein 2, chloroplastic-like       189   3e-50    
ref|NP_851208.1|  APO protein 2                                         189   3e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006449973.1|  hypothetical protein CICLE_v10015251mg             189   4e-50    
ref|XP_009767511.1|  PREDICTED: APO protein 2, chloroplastic            188   4e-50    
ref|XP_011033400.1|  PREDICTED: APO protein 2, chloroplastic            189   5e-50    
ref|XP_008782983.1|  PREDICTED: APO protein 1, chloroplastic            188   5e-50    
gb|EYU33498.1|  hypothetical protein MIMGU_mgv1a020508mg                187   5e-50    
ref|NP_001132782.1|  APO2                                               188   5e-50    Zea mays [maize]
ref|XP_006343652.1|  PREDICTED: APO protein 2, chloroplastic-like...    188   5e-50    
ref|XP_004242590.1|  PREDICTED: APO protein 2, chloroplastic            188   6e-50    
gb|ACG31531.1|  APO2                                                    188   6e-50    Zea mays [maize]
ref|XP_002325131.2|  hypothetical protein POPTR_0018s11560g             188   7e-50    Populus trichocarpa [western balsam poplar]
ref|XP_009617161.1|  PREDICTED: APO protein 2, chloroplastic            187   9e-50    
gb|EYU35330.1|  hypothetical protein MIMGU_mgv1a006906mg                187   1e-49    
ref|XP_003570510.1|  PREDICTED: APO protein 2, chloroplastic            187   2e-49    
ref|XP_009126804.1|  PREDICTED: APO protein 2, chloroplastic            186   3e-49    
ref|XP_010048793.1|  PREDICTED: APO protein 2, chloroplastic-like       187   3e-49    
ref|XP_010048752.1|  PREDICTED: APO protein 2, chloroplastic-like       187   3e-49    
ref|XP_002454332.1|  hypothetical protein SORBIDRAFT_04g028820          186   3e-49    Sorghum bicolor [broomcorn]
gb|AFK43230.1|  unknown                                                 186   3e-49    
ref|XP_007153605.1|  hypothetical protein PHAVU_003G049700g             186   3e-49    
emb|CDY32738.1|  BnaA02g08000D                                          186   4e-49    
ref|NP_001048031.1|  Os02g0732900                                       186   5e-49    Oryza sativa Japonica Group [Japonica rice]
gb|EAY87417.1|  hypothetical protein OsI_08824                          186   5e-49    Oryza sativa Indica Group [Indian rice]
emb|CAN79322.1|  hypothetical protein VITISV_018985                     191   7e-49    Vitis vinifera
ref|XP_007204347.1|  hypothetical protein PRUPE_ppa005668mg             185   1e-48    
ref|XP_010414216.1|  PREDICTED: APO protein 1, chloroplastic-like       184   1e-48    
ref|XP_011018036.1|  PREDICTED: APO protein 2, chloroplastic-like       186   1e-48    
emb|CBI36535.3|  unnamed protein product                                186   2e-48    
ref|XP_002275774.2|  PREDICTED: APO protein 2, chloroplastic            185   2e-48    Vitis vinifera
emb|CDY02779.1|  BnaC02g11100D                                          184   2e-48    
ref|XP_006302272.1|  hypothetical protein CARUB_v10020316mg             184   2e-48    
ref|XP_009366189.1|  PREDICTED: APO protein 2, chloroplastic isof...    184   2e-48    
dbj|BAJ90733.1|  predicted protein                                      184   3e-48    
ref|XP_009366188.1|  PREDICTED: APO protein 2, chloroplastic isof...    184   3e-48    
ref|XP_008242998.1|  PREDICTED: APO protein 2, chloroplastic            184   3e-48    
ref|XP_008344061.1|  PREDICTED: APO protein 2, chloroplastic-like       179   4e-48    
gb|KFK27330.1|  hypothetical protein AALP_AA8G369000                    186   4e-48    
ref|XP_008394316.1|  PREDICTED: APO protein 2, chloroplastic-like       179   5e-48    
gb|KFK27329.1|  hypothetical protein AALP_AA8G369000                    186   7e-48    
ref|XP_002886768.1|  hypothetical protein ARALYDRAFT_475482             182   1e-47    
emb|CAN76001.1|  hypothetical protein VITISV_019165                     183   1e-47    Vitis vinifera
gb|EMT11689.1|  hypothetical protein F775_05116                         182   1e-47    
emb|CDX77468.1|  BnaA07g06060D                                          181   2e-47    
ref|XP_010424459.1|  PREDICTED: APO protein 4, mitochondrial-like       171   3e-47    
ref|XP_009102558.1|  PREDICTED: APO protein 1, chloroplastic            181   3e-47    
gb|EPS60915.1|  hypothetical protein M569_13885                         181   4e-47    
ref|XP_010510287.1|  PREDICTED: APO protein 1, chloroplastic-like       180   4e-47    
ref|XP_010550896.1|  PREDICTED: APO protein 1, chloroplastic            179   2e-46    
ref|NP_176661.1|  APO protein 1                                         178   2e-46    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469796.1|  PREDICTED: APO protein 1, chloroplastic            178   2e-46    
ref|XP_010930508.1|  PREDICTED: APO protein 3, mitochondrial            177   3e-46    
ref|NP_001031234.1|  APO protein 1                                      178   3e-46    Arabidopsis thaliana [mouse-ear cress]
gb|EYU25371.1|  hypothetical protein MIMGU_mgv1a007845mg                175   1e-45    
ref|XP_010250523.1|  PREDICTED: APO protein 3, mitochondrial            175   2e-45    
gb|EYU46673.1|  hypothetical protein MIMGU_mgv1a007863mg                174   3e-45    
ref|XP_010663253.1|  PREDICTED: APO protein 3, mitochondrial            174   4e-45    
ref|XP_002975837.1|  hypothetical protein SELMODRAFT_104587             173   5e-45    
ref|XP_010105597.1|  APO protein 3                                      174   5e-45    
ref|XP_008776586.1|  PREDICTED: APO protein 3, mitochondrial            174   7e-45    
ref|XP_002965760.1|  hypothetical protein SELMODRAFT_84056              173   8e-45    
ref|XP_009415009.1|  PREDICTED: APO protein 3, mitochondrial            173   9e-45    
ref|XP_011083835.1|  PREDICTED: APO protein 1, chloroplastic isof...    171   2e-44    
ref|XP_009112004.1|  PREDICTED: APO protein 3, mitochondrial            172   2e-44    
gb|KHG05029.1|  APO 3, mitochondrial -like protein                      171   4e-44    
ref|XP_006394451.1|  hypothetical protein EUTSA_v10004339mg             171   4e-44    
ref|XP_003518320.1|  PREDICTED: APO protein 3, mitochondrial-like       171   7e-44    
ref|XP_011083834.1|  PREDICTED: APO protein 1, chloroplastic isof...    171   7e-44    
ref|XP_010457964.1|  PREDICTED: APO protein 3, mitochondrial-like       170   9e-44    
gb|KGN49647.1|  hypothetical protein Csa_5G044010                       170   1e-43    
gb|KFK27935.1|  hypothetical protein AALP_AA8G450000                    169   2e-43    
ref|XP_004142282.1|  PREDICTED: APO protein 3, mitochondrial-like       170   4e-43    
ref|XP_004490634.1|  PREDICTED: APO protein 3, mitochondrial-like...    169   4e-43    
ref|XP_006418818.1|  hypothetical protein EUTSA_v10002534mg             169   4e-43    
emb|CDX87228.1|  BnaC09g05430D                                          168   5e-43    
emb|CDY16799.1|  BnaA09g05830D                                          168   6e-43    
ref|XP_010483880.1|  PREDICTED: APO protein 3, mitochondrial            168   6e-43    
ref|XP_002454004.1|  hypothetical protein SORBIDRAFT_04g022910          168   7e-43    Sorghum bicolor [broomcorn]
ref|XP_003575155.1|  PREDICTED: APO protein 3, mitochondrial            168   9e-43    
ref|XP_010935256.1|  PREDICTED: APO protein 3, mitochondrial-like       167   1e-42    
gb|AAK48980.1|AF370553_1  Unknown protein                               166   1e-42    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004156147.1|  PREDICTED: APO protein 3, mitochondrial-like       165   1e-42    
ref|XP_009796859.1|  PREDICTED: APO protein 3, mitochondrial            167   1e-42    
ref|XP_010444026.1|  PREDICTED: APO protein 3, mitochondrial-like       167   2e-42    
ref|XP_002866462.1|  hypothetical protein ARALYDRAFT_496364             166   2e-42    
ref|XP_006485090.1|  PREDICTED: APO protein 3, mitochondrial-like       167   2e-42    
ref|NP_568945.2|  accumulation of photosystem one 3                     166   4e-42    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006436959.1|  hypothetical protein CICLE_v10031524mg             167   4e-42    
ref|XP_009361363.1|  PREDICTED: APO protein 3, mitochondrial            166   4e-42    
ref|XP_006280572.1|  hypothetical protein CARUB_v10026525mg             166   5e-42    
gb|EMS56751.1|  hypothetical protein TRIUR3_16773                       166   6e-42    
gb|KDO51257.1|  hypothetical protein CISIN_1g014882mg                   165   8e-42    
ref|XP_008375663.1|  PREDICTED: APO protein 3, mitochondrial            166   8e-42    
gb|EAZ04607.1|  hypothetical protein OsI_26756                          165   1e-41    Oryza sativa Indica Group [Indian rice]
ref|NP_001060196.1|  Os07g0600300                                       165   1e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002967618.1|  hypothetical protein SELMODRAFT_88735              163   1e-41    
ref|XP_009617403.1|  PREDICTED: APO protein 3, mitochondrial isof...    163   2e-41    
dbj|BAC15509.1|  hypothetical protein                                   166   2e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009617402.1|  PREDICTED: APO protein 3, mitochondrial isof...    164   2e-41    
ref|XP_002964422.1|  hypothetical protein SELMODRAFT_81660              162   4e-41    
ref|XP_010523444.1|  PREDICTED: APO protein 3, mitochondrial            163   5e-41    
gb|AFW71854.1|  hypothetical protein ZEAMMB73_117996                    162   9e-41    
ref|XP_010696444.1|  PREDICTED: APO protein 3, mitochondrial            162   1e-40    
emb|CDP14098.1|  unnamed protein product                                161   1e-40    
ref|XP_007038143.1|  APO protein 3, mitochondrial                       161   2e-40    
ref|XP_003615806.1|  Cytochrome P450                                    164   2e-40    
ref|XP_004954995.1|  PREDICTED: APO protein 3, mitochondrial-like       161   2e-40    
ref|XP_009394093.1|  PREDICTED: APO protein 3, mitochondrial-like       160   3e-40    
gb|KHG30129.1|  APO 3, mitochondrial -like protein                      160   1e-39    
ref|XP_002321751.2|  hypothetical protein POPTR_0015s11750g             159   1e-39    Populus trichocarpa [western balsam poplar]
ref|XP_008222826.1|  PREDICTED: APO protein 3, mitochondrial-like       159   2e-39    
ref|XP_007145756.1|  hypothetical protein PHAVU_007G265200g             158   2e-39    
gb|EMT08165.1|  hypothetical protein F775_16435                         159   3e-39    
gb|AES98764.2|  APO RNA-binding protein                                 158   3e-39    
ref|XP_007160771.1|  hypothetical protein PHAVU_001G015500g             157   4e-39    
ref|XP_004246892.1|  PREDICTED: APO protein 3, mitochondrial            156   7e-39    
ref|XP_007222447.1|  hypothetical protein PRUPE_ppa006172mg             157   9e-39    
dbj|BAJ88351.1|  predicted protein                                      157   9e-39    
ref|XP_006374572.1|  hypothetical protein POPTR_0015s11750g             156   2e-38    
ref|XP_011040274.1|  PREDICTED: APO protein 3, mitochondrial            155   2e-38    
gb|KHN05750.1|  APO protein 3, mitochondrial                            154   5e-38    
gb|KDP22535.1|  hypothetical protein JCGZ_26366                         154   5e-38    
ref|XP_002511090.1|  translation factor sui1, putative                  154   6e-38    
ref|XP_010052523.1|  PREDICTED: APO protein 3, mitochondrial            154   6e-38    
ref|XP_006341143.1|  PREDICTED: APO protein 3, mitochondrial-like       154   7e-38    
ref|XP_003537145.1|  PREDICTED: APO protein 3, mitochondrial-like...    154   7e-38    
ref|XP_010656899.1|  PREDICTED: APO protein 3, mitochondrial-like       152   3e-37    
gb|EMS67876.1|  hypothetical protein TRIUR3_04546                       154   4e-37    
emb|CBI17911.3|  unnamed protein product                                152   7e-37    
ref|XP_008389334.1|  PREDICTED: APO protein 2, chloroplastic-like       145   1e-36    
gb|KDO67975.1|  hypothetical protein CISIN_1g041820mg                   147   2e-36    
ref|XP_009358569.1|  PREDICTED: APO protein 2, chloroplastic-like       147   3e-36    
ref|XP_010520603.1|  PREDICTED: APO protein 3, mitochondrial-like       149   4e-36    
ref|XP_008450246.1|  PREDICTED: APO protein 3, mitochondrial isof...    149   5e-36    
ref|XP_010269550.1|  PREDICTED: APO protein 3, mitochondrial-like       148   8e-36    
ref|XP_007042759.1|  Uncharacterized protein isoform 1                  147   1e-35    
ref|XP_007042760.1|  Uncharacterized protein isoform 2                  148   1e-35    
emb|CBI28952.3|  unnamed protein product                                142   1e-35    
ref|XP_006422664.1|  hypothetical protein CICLE_v10028534mg             147   1e-35    
ref|XP_007042761.1|  Uncharacterized protein isoform 3                  147   1e-35    
ref|XP_006486787.1|  PREDICTED: APO protein 3, mitochondrial-like...    147   1e-35    
ref|XP_004136169.1|  PREDICTED: APO protein 3, mitochondrial-like       146   3e-35    
ref|XP_011079964.1|  PREDICTED: APO protein 3, mitochondrial-like       145   5e-35    
gb|EPS67067.1|  hypothetical protein M569_07708                         143   2e-34    
ref|XP_002518315.1|  APO protein 3, mitochondrial precursor, puta...    143   2e-34    
ref|XP_008450245.1|  PREDICTED: APO protein 3, mitochondrial isof...    143   4e-34    
ref|XP_010069938.1|  PREDICTED: APO protein 3, mitochondrial-like       141   1e-33    
gb|AEW08058.1|  hypothetical protein 0_18018_01                         133   3e-33    
gb|AEW08059.1|  hypothetical protein 0_18018_01                         133   3e-33    
gb|AFG51971.1|  hypothetical protein 0_18018_01                         133   3e-33    
ref|XP_004512824.1|  PREDICTED: APO protein 3, mitochondrial-like...    139   6e-33    
gb|KDP35940.1|  hypothetical protein JCGZ_09912                         138   1e-32    
ref|XP_008227562.1|  PREDICTED: LOW QUALITY PROTEIN: APO protein ...    135   1e-31    
emb|CAN79621.1|  hypothetical protein VITISV_035895                     128   1e-29    
emb|CDX92921.1|  BnaA03g36430D                                          123   7e-29    
ref|XP_006845363.1|  hypothetical protein AMTR_s00019p00027190          128   8e-29    
ref|XP_008375687.1|  PREDICTED: uncharacterized protein LOC103438924    127   6e-28    
emb|CAN78766.1|  hypothetical protein VITISV_044397                     125   6e-27    
gb|EEE67533.1|  hypothetical protein OsJ_25009                          120   9e-27    
ref|XP_006486788.1|  PREDICTED: APO protein 3, mitochondrial-like...    114   2e-24    
gb|KHN42736.1|  APO protein 2, chloroplastic                            110   5e-23    
ref|XP_008781359.1|  PREDICTED: 1,4-alpha-glucan-branching enzyme...    112   1e-22    
gb|KHN05211.1|  APO protein 3, mitochondrial                            100   2e-20    
emb|CDG58310.1|  accumulation of photosystem 2                        94.7    9e-20    
emb|CDO45887.1|  Accumulation of photosystem one 2 unknown            94.4    1e-19    
emb|CDO45853.1|  Accumulation of photosystem one 2 unknown            93.6    2e-19    
emb|CDG58295.1|  accumulation of photosystem 2                        93.6    3e-19    
emb|CDO45896.1|  Accumulation of photosystem one 2 unknown            93.2    3e-19    
emb|CDG58307.1|  accumulation of photosystem 2                        93.2    3e-19    
emb|CDO45816.1|  Accumulation of photosystem one 2 unknown            93.2    3e-19    
emb|CDG58285.1|  accumulation of photosystem 2                        93.2    4e-19    
emb|CDO45908.1|  Accumulation of photosystem one 2 unknown            93.2    4e-19    
emb|CDO45829.1|  Accumulation of photosystem one 2 unknown            92.8    4e-19    
emb|CDO45875.1|  Accumulation of photosystem one 2 unknown            92.8    5e-19    
emb|CDO45814.1|  Accumulation of photosystem one 2 unknown            92.4    6e-19    
emb|CDG58284.1|  accumulation of photosystem 2                        92.0    8e-19    
emb|CDG58314.1|  accumulation of photosystem 2                        92.0    8e-19    
emb|CDG58305.1|  accumulation of photosystem 2                        91.7    1e-18    
emb|CDO45810.1|  Accumulation of photosystem one 2 unknown            91.7    1e-18    
emb|CDG58301.1|  accumulation of photosystem 2                        91.7    1e-18    
emb|CDO45874.1|  Accumulation of photosystem one 2 unknown            91.7    1e-18    
emb|CDG58300.1|  accumulation of photosystem 2                        91.7    1e-18    
emb|CDG58292.1|  accumulation of photosystem 2                        91.7    1e-18    
emb|CDO45911.1|  Accumulation of photosystem one 2 unknown            91.3    1e-18    
emb|CDG58296.1|  accumulation of photosystem 2                        91.3    2e-18    
emb|CDG58289.1|  accumulation of photosystem 2                        91.3    2e-18    
emb|CDO45869.1|  Accumulation of photosystem one 2 unknown            90.9    2e-18    
emb|CDO45828.1|  Accumulation of photosystem one 2 unknown            90.9    2e-18    
emb|CDO45847.1|  Accumulation of photosystem one 2 unknown            90.9    2e-18    
emb|CDO45913.1|  Accumulation of photosystem one 2 unknown            90.9    2e-18    
emb|CDG58286.1|  accumulation of photosystem 2                        90.9    3e-18    
emb|CDO45880.1|  Accumulation of photosystem one 2 unknown            90.5    3e-18    
emb|CDG58287.1|  accumulation of photosystem 2                        90.9    3e-18    
emb|CDG58308.1|  accumulation of photosystem 2                        90.9    3e-18    
emb|CDG58288.1|  accumulation of photosystem 2                        90.5    3e-18    
emb|CDO45899.1|  Accumulation of photosystem one 2 unknown            90.5    3e-18    
emb|CDG58299.1|  accumulation of photosystem 2                        90.5    3e-18    
ref|XP_004512831.1|  PREDICTED: APO protein 3, mitochondrial-like...  93.6    4e-18    
emb|CDG58306.1|  accumulation of photosystem 2                        90.1    5e-18    
emb|CDO45858.1|  Accumulation of photosystem one 2 unknown            90.1    5e-18    
emb|CDO45818.1|  Accumulation of photosystem one 2 unknown            89.7    6e-18    
emb|CDO45840.1|  Accumulation of photosystem one 2 unknown            89.4    9e-18    
emb|CDG58320.1|  accumulation of photosystem 2                        89.4    9e-18    
emb|CDO45839.1|  Accumulation of photosystem one 2 unknown            88.6    1e-17    
emb|CDO45822.1|  Accumulation of photosystem one 2 unknown            88.2    2e-17    
emb|CDO45849.1|  Accumulation of photosystem one 2 unknown            88.2    2e-17    
emb|CDO45844.1|  Accumulation of photosystem one 2 unknown            88.2    2e-17    
emb|CDO45870.1|  Accumulation of photosystem one 2 unknown            88.2    2e-17    
emb|CDO45861.1|  Accumulation of photosystem one 2 unknown            87.8    3e-17    
emb|CDO45842.1|  Accumulation of photosystem one 2 unknown            87.4    4e-17    
emb|CDG58291.1|  accumulation of photosystem 2                        87.4    4e-17    
emb|CDG58290.1|  accumulation of photosystem 2                        87.4    4e-17    
emb|CDO45811.1|  Accumulation of photosystem one 2 unknown            87.4    4e-17    
ref|XP_006849574.1|  hypothetical protein AMTR_s00024p00189370        91.3    5e-17    
emb|CDO45830.1|  Accumulation of photosystem one 2 unknown            87.0    5e-17    
emb|CAN76000.1|  hypothetical protein VITISV_019164                   93.2    2e-16    
emb|CDG58315.1|  accumulation of photosystem 2                        85.1    3e-16    
emb|CDG58283.1|  accumulation of photosystem 2                        81.3    6e-15    
emb|CDG58309.1|  accumulation of photosystem 2                        80.5    1e-14    
ref|XP_008356141.1|  PREDICTED: LOW QUALITY PROTEIN: APO protein ...  83.6    3e-14    
ref|XP_006648746.1|  PREDICTED: APO protein 3, mitochondrial-like     77.8    2e-12    
emb|CDO45897.1|  Accumulation of photosystem one 2 unknown            73.2    3e-12    
emb|CDO45891.1|  Accumulation of photosystem one 2 unknown            71.2    1e-11    
emb|CDO45898.1|  Accumulation of photosystem one 2 unknown            71.6    1e-11    
gb|AAK53005.1|AF375421_1  AT5g57930/MTI20_19                          73.6    3e-11    
gb|AEW07964.1|  hypothetical protein 0_15611_01                       66.6    6e-10    
gb|AEW07965.1|  hypothetical protein 0_15611_01                       66.2    9e-10    
gb|AFG59101.1|  hypothetical protein 0_15611_01                       65.1    2e-09    
gb|AFG59100.1|  hypothetical protein 0_15611_01                       65.1    2e-09    
ref|XP_006827629.1|  hypothetical protein AMTR_s00009p00244800        64.7    1e-08    
emb|CDY24260.1|  BnaC03g42330D                                        65.5    1e-08    
ref|XP_008451572.1|  PREDICTED: APO protein 3, mitochondrial-like...  65.1    2e-08    
ref|XP_008451570.1|  PREDICTED: APO protein 3, mitochondrial-like...  65.1    2e-08    
gb|KHN07712.1|  APO protein 2, chloroplastic                          59.3    2e-06    
gb|KEH41801.1|  photosystem one accumulation protein                  53.1    3e-05    
emb|CDX86948.1|  BnaC03g52180D                                        53.9    5e-05    
gb|KHN40101.1|  APO protein 3, mitochondrial                          53.5    6e-05    



>ref|XP_009612191.1| PREDICTED: APO protein 4, mitochondrial [Nicotiana tomentosiformis]
Length=323

 Score =   369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 194/237 (82%), Gaps = 0/237 (0%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+YCPEVY+GENGHLIRTC GYR R KNQ H WI+GSL+ IL+PVE FHL  MFQNVI H
Sbjct  85    CKYCPEVYIGENGHLIRTCHGYRQRAKNQAHEWIRGSLNDILVPVEAFHLRTMFQNVINH  144

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLGNETLNAW  856
              ERFDY RI AVVELCLQAGA P++E +  S +      +     D  + LLG ETL AW
Sbjct  145   QERFDYDRIPAVVELCLQAGAVPSEEIVCGSSLPSSDPFQADSLSDDDLLLLGRETLKAW  204

Query  855   ETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLV  676
             E LRSGV +LLLVYP KVC+HCSEVH+GPSGHKARLCGVFK+ESWR  HFW+KA VD LV
Sbjct  205   EALRSGVQRLLLVYPAKVCEHCSEVHIGPSGHKARLCGVFKFESWRGSHFWKKAEVDHLV  264

Query  675   PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAP  505
             PP IVW+RRPQDPPLLLD+GRNYYGHAPAVVDLCTKAG IAPSKY+CMMKV+GLSAP
Sbjct  265   PPKIVWYRRPQDPPLLLDDGRNYYGHAPAVVDLCTKAGVIAPSKYYCMMKVEGLSAP  321


 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 68/134 (51%), Gaps = 5/134 (4%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  +  E L A   L  GV  L+  +P   CK+C EV++G +GH  R C  ++  +  
Sbjct  53   KSMVPVAEEVLKARTILYHGVSALIQRFPTWACKYCPEVYIGENGHLIRTCHGYRQRAKN  112

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            + H W + S++D++ P   +H R     ++  + R  Y   PAVV+LC +AGA+   +  
Sbjct  113  QAHEWIRGSLNDILVPVEAFHLRTMFQNVINHQERFDYDRIPAVVELCLQAGAVPSEEIV  172

Query  537  CMMKVDGLSAPISD  496
            C     G S P SD
Sbjct  173  C-----GSSLPSSD  181



>ref|XP_009805015.1| PREDICTED: APO protein 4, mitochondrial [Nicotiana sylvestris]
Length=323

 Score =   367 bits (941),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/237 (73%), Positives = 193/237 (81%), Gaps = 0/237 (0%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+YCPEVY+GENGHLIRTC GYR R KNQ H WI+GSL+ IL+PVE FHL  MFQNVI H
Sbjct  85    CKYCPEVYIGENGHLIRTCHGYRQRAKNQAHEWIRGSLNDILVPVEAFHLRTMFQNVINH  144

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLGNETLNAW  856
              ERFDY RI AVVELCLQAGA P++E +  S +      +     D  + LLG ETL AW
Sbjct  145   QERFDYDRIPAVVELCLQAGAVPSEEIVCGSSLPSSDPFQADSLSDDDLLLLGRETLKAW  204

Query  855   ETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLV  676
             E LRSGV +LLLVYP KVC+HCSEVH+GPSGHKARLCGVFK+ESWR  HFW+KA VD L 
Sbjct  205   EALRSGVQRLLLVYPAKVCEHCSEVHIGPSGHKARLCGVFKFESWRGSHFWKKAEVDHLF  264

Query  675   PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAP  505
             PP IVW+RRPQDPPLLLD+GRNYYGHAPAVVDLCTKAG +APSKY+CMMKV+GLSAP
Sbjct  265   PPKIVWYRRPQDPPLLLDDGRNYYGHAPAVVDLCTKAGVVAPSKYYCMMKVEGLSAP  321


 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 68/134 (51%), Gaps = 5/134 (4%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  +  E L A   L  GV  L+  +P   CK+C EV++G +GH  R C  ++  +  
Sbjct  53   KSMVPVAEEVLKARTILYHGVSALIQRFPTWACKYCPEVYIGENGHLIRTCHGYRQRAKN  112

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            + H W + S++D++ P   +H R     ++  + R  Y   PAVV+LC +AGA+   +  
Sbjct  113  QAHEWIRGSLNDILVPVEAFHLRTMFQNVINHQERFDYDRIPAVVELCLQAGAVPSEEIV  172

Query  537  CMMKVDGLSAPISD  496
            C     G S P SD
Sbjct  173  C-----GSSLPSSD  181



>ref|XP_004238237.2| PREDICTED: APO protein 4, mitochondrial [Solanum lycopersicum]
Length=343

 Score =   365 bits (938),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 191/237 (81%), Gaps = 0/237 (0%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+YCPEVY+GENGHLI+TC GYR R KNQ H WI+GSL+ IL+PVE FHL  MFQN+I H
Sbjct  105   CKYCPEVYIGENGHLIQTCHGYRRRAKNQAHEWIRGSLNDILVPVEAFHLRTMFQNIINH  164

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLGNETLNAW  856
              ERFDY RI AVVELCLQAGA P++E +  S +      +     D  + LLG ETL AW
Sbjct  165   QERFDYDRIPAVVELCLQAGAIPSEEIVCGSSLPSSVPFQADSLSDDDLMLLGRETLKAW  224

Query  855   ETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLV  676
             E LRSGV +LLLVYP KVC+HCSEVH+GPSGHKARLCGVFK+ESWR  HFW+KA VD LV
Sbjct  225   EALRSGVQRLLLVYPAKVCEHCSEVHIGPSGHKARLCGVFKFESWRGSHFWKKAEVDHLV  284

Query  675   PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAP  505
             P   VW+RRPQDPPLLLD+GRNYYGHAPAVVDLCTKAG IAPSKY CMMK++GLSAP
Sbjct  285   PSKTVWYRRPQDPPLLLDDGRNYYGHAPAVVDLCTKAGIIAPSKYHCMMKLEGLSAP  341


 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  +      A   L  GV  L+  +P   CK+C EV++G +GH  + C  ++  +  
Sbjct  73   KSMVPVAEGVFKARTILYHGVSALMQRFPTWACKYCPEVYIGENGHLIQTCHGYRRRAKN  132

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            + H W + S++D++ P   +H R     ++  + R  Y   PAVV+LC +AGAI   +  
Sbjct  133  QAHEWIRGSLNDILVPVEAFHLRTMFQNIINHQERFDYDRIPAVVELCLQAGAIPSEEIV  192

Query  537  C  535
            C
Sbjct  193  C  193



>ref|XP_006341909.1| PREDICTED: APO protein 4, mitochondrial-like [Solanum tuberosum]
Length=325

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 191/237 (81%), Gaps = 0/237 (0%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+YCPEVY+GENGHLI+TC GYR R KNQ H WI+GSL+ IL+PVE FHL  MFQN+I H
Sbjct  87    CKYCPEVYIGENGHLIQTCHGYRRRAKNQAHEWIRGSLNDILVPVEAFHLRTMFQNIINH  146

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLGNETLNAW  856
              ERFDY RI AVVELCLQAGA P++E +  S +      +     D  + LLG ETL AW
Sbjct  147   QERFDYDRIPAVVELCLQAGAIPSEEIVCGSSLPSSVPFQADSLSDDDLMLLGRETLKAW  206

Query  855   ETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLV  676
             E LRSGV +LLLVYP KVC+HCSEVH+GPSGHKARLCGVFK+ESWR  HFW+KA VD LV
Sbjct  207   EALRSGVQRLLLVYPAKVCEHCSEVHIGPSGHKARLCGVFKFESWRGSHFWKKAEVDHLV  266

Query  675   PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAP  505
             P   VW+RRPQDPPLLLD+GRNYYGHAPAVVDLCTKAG IAPSKY CMMK++GLSAP
Sbjct  267   PSKTVWYRRPQDPPLLLDDGRNYYGHAPAVVDLCTKAGIIAPSKYHCMMKLEGLSAP  323


 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/121 (30%), Positives = 61/121 (50%), Gaps = 0/121 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  +      A   L  GV  L+  +P   CK+C EV++G +GH  + C  ++  +  
Sbjct  55   KSMVPVAEGVFKARTILYHGVSALMQRFPTWACKYCPEVYIGENGHLIQTCHGYRRRAKN  114

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            + H W + S++D++ P   +H R     ++  + R  Y   PAVV+LC +AGAI   +  
Sbjct  115  QAHEWIRGSLNDILVPVEAFHLRTMFQNIINHQERFDYDRIPAVVELCLQAGAIPSEEIV  174

Query  537  C  535
            C
Sbjct  175  C  175



>ref|XP_008455841.1| PREDICTED: APO protein 4, mitochondrial [Cucumis melo]
 ref|XP_008455842.1| PREDICTED: APO protein 4, mitochondrial [Cucumis melo]
Length=334

 Score =   359 bits (921),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 165/241 (68%), Positives = 195/241 (81%), Gaps = 3/241 (1%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L+C+YCPEVYVG  GHLIR+CGGY+   KNQ+H WI+G L+ I++PVE FHLH+MFQ+V
Sbjct  83    VLSCKYCPEVYVGAEGHLIRSCGGYKRGAKNQVHQWIRGDLNDIIVPVEAFHLHHMFQDV  142

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE--SNSKIVLPF-DQQMRLLGN  874
             IKH ERF++ R+ AVVELC QAG NP+D+ + +S         S +  PF D +M LL  
Sbjct  143   IKHDERFNFERVPAVVELCCQAGVNPDDKDLASSTQNSAEGGGSGMDEPFSDHEMMLLAT  202

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
             ET+ AWETLR+GV KLL+VYP KVCK+CSEVHVGPSGHKARLCGVFKYESWR  HFWEKA
Sbjct  203   ETIRAWETLRTGVQKLLMVYPTKVCKYCSEVHVGPSGHKARLCGVFKYESWRGSHFWEKA  262

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGL  514
              VDDLVPP IVWHRR QDPP+L+D+GR+YYGHAPAVV LC +AGAIAP KY CMMKV GL
Sbjct  263   DVDDLVPPKIVWHRRQQDPPVLVDKGRDYYGHAPAVVALCMQAGAIAPFKYHCMMKVQGL  322

Query  513   S  511
             S
Sbjct  323   S  323


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 58/110 (53%), Gaps = 0/110 (0%)
 Frame = -1

Query  891  MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
            M  +  + L A   L  GV  LL  +PV  CK+C EV+VG  GH  R CG +K  +  ++
Sbjct  56   MTPVAQQVLEARAMLIHGVSTLLKSFPVLSCKYCPEVYVGAEGHLIRSCGGYKRGAKNQV  115

Query  711  HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
            H W +  ++D++ P   +H       ++  + R  +   PAVV+LC +AG
Sbjct  116  HQWIRGDLNDIIVPVEAFHLHHMFQDVIKHDERFNFERVPAVVELCCQAG  165



>ref|XP_004151879.1| PREDICTED: APO protein 4, mitochondrial-like [Cucumis sativus]
 gb|KGN63269.1| hypothetical protein Csa_2G421010 [Cucumis sativus]
Length=330

 Score =   355 bits (912),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/241 (68%), Positives = 195/241 (81%), Gaps = 3/241 (1%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L+C++CPEVYVGE GHLIR+CGGY+   KNQ+H WI+G L  I++PVE FHLH+MFQ+V
Sbjct  83    VLSCKFCPEVYVGEEGHLIRSCGGYKRGAKNQVHQWIRGDLKDIIVPVEAFHLHHMFQDV  142

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE--SNSKIVLPF-DQQMRLLGN  874
             IKH ERF++ R+ AVVELC QAGANP+D+++ +S         S +  P  D +M LL  
Sbjct  143   IKHDERFNFERVPAVVELCSQAGANPDDKNLASSTQNSAEGGGSGMDEPLSDHEMMLLAT  202

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
             ET+ AWETLR+GV KLL+VYP KVCK+CSEVHVGPSGHKARLCGVF YESWR  HFWEKA
Sbjct  203   ETIRAWETLRTGVQKLLMVYPTKVCKYCSEVHVGPSGHKARLCGVFTYESWRGSHFWEKA  262

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGL  514
              VDDLVPP IVWHRR QDPP+L+D+G++YYGHAPAVV LCT+AG IAP KY CMMKV GL
Sbjct  263   DVDDLVPPKIVWHRRQQDPPVLVDKGKDYYGHAPAVVALCTQAGVIAPFKYHCMMKVQGL  322

Query  513   S  511
             S
Sbjct  323   S  323


 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 73/157 (46%), Gaps = 11/157 (7%)
 Frame = -1

Query  891  MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
            M  +  + L A   L  GV  LL  +PV  CK C EV+VG  GH  R CG +K  +  ++
Sbjct  56   MTPVAQQVLEARAMLIHGVSTLLKSFPVLSCKFCPEVYVGEEGHLIRSCGGYKRGAKNQV  115

Query  711  HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCM  532
            H W +  + D++ P   +H       ++  + R  +   PAVV+LC++AGA    K    
Sbjct  116  HQWIRGDLKDIIVPVEAFHLHHMFQDVIKHDERFNFERVPAVVELCSQAGANPDDKNLAS  175

Query  531  MKVD-------GLSAPISDKP*CHIAIIIYWSHVASW  442
               +       G+  P+SD    H  +++    + +W
Sbjct  176  STQNSAEGGGSGMDEPLSD----HEMMLLATETIRAW  208



>ref|XP_004158556.1| PREDICTED: APO protein 4, mitochondrial-like [Cucumis sativus]
Length=330

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 163/241 (68%), Positives = 194/241 (80%), Gaps = 3/241 (1%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L+C++CPEVYVGE GHLIR+CGGY+   KNQ+H WI+G L  I++PVE FHLH+MFQ+V
Sbjct  83    VLSCKFCPEVYVGEEGHLIRSCGGYKRGAKNQVHQWIRGDLKDIIVPVEAFHLHHMFQDV  142

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE--SNSKIVLPF-DQQMRLLGN  874
             IKH ERF++ R+ AVVELC QAGANP+D+ + +S         S +  P  D +M LL  
Sbjct  143   IKHDERFNFERVPAVVELCSQAGANPDDKDLASSTQNSAEGGGSGMDEPLSDHEMMLLAT  202

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
             ET+ AWETLR+GV KLL+VYP KVCK+CSEVHVGPSGHKARLCGVF YESWR  HFWEKA
Sbjct  203   ETIRAWETLRTGVQKLLMVYPTKVCKYCSEVHVGPSGHKARLCGVFTYESWRGSHFWEKA  262

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGL  514
              VDDLVPP IVWHRR QDPP+L+D+G++YYGHAPAVV LCT+AG IAP KY CMMKV GL
Sbjct  263   DVDDLVPPKIVWHRRQQDPPVLVDKGKDYYGHAPAVVALCTQAGVIAPFKYHCMMKVQGL  322

Query  513   S  511
             S
Sbjct  323   S  323


 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 73/157 (46%), Gaps = 11/157 (7%)
 Frame = -1

Query  891  MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
            M  +  + L A   L  GV  LL  +PV  CK C EV+VG  GH  R CG +K  +  ++
Sbjct  56   MTPVAQQVLEARAMLIHGVSTLLKSFPVLSCKFCPEVYVGEEGHLIRSCGGYKRGAKNQV  115

Query  711  HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCM  532
            H W +  + D++ P   +H       ++  + R  +   PAVV+LC++AGA    K    
Sbjct  116  HQWIRGDLKDIIVPVEAFHLHHMFQDVIKHDERFNFERVPAVVELCSQAGANPDDKDLAS  175

Query  531  MKVD-------GLSAPISDKP*CHIAIIIYWSHVASW  442
               +       G+  P+SD    H  +++    + +W
Sbjct  176  STQNSAEGGGSGMDEPLSD----HEMMLLATETIRAW  208



>gb|KDP41156.1| hypothetical protein JCGZ_03650 [Jatropha curcas]
Length=303

 Score =   350 bits (897),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 163/238 (68%), Positives = 188/238 (79%), Gaps = 6/238 (3%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C++CPEVY+GE GHLI+TC GYR   KNQ+H WI G L+ IL+PVETF L NMFQ +
Sbjct  69    VVACKFCPEVYIGEKGHLIKTCWGYRRGPKNQVHEWITGGLNDILVPVETFRLDNMFQKI  128

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLGNETL  865
             IKH +RFD+ R+ AVVELC QAGA  + E +     E +S S   L F      + N+TL
Sbjct  129   IKHDQRFDFDRVPAVVELCRQAGAEVSSEIVIGDSDEAQSLSPSDLVF------VANKTL  182

Query  864   NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
              AWETLRSGV KLL VYP KVCKHCSEVHVGPSGHKARLCG+FKYESWR  HFW+KA VD
Sbjct  183   RAWETLRSGVQKLLFVYPSKVCKHCSEVHVGPSGHKARLCGIFKYESWRGTHFWKKAGVD  242

Query  684   DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             DLVPP IVW RRPQDPP+LLDE RN+YGHAPAVVDLCTKAGAIAP+KY+CMMKV GL+
Sbjct  243   DLVPPKIVWRRRPQDPPVLLDEWRNFYGHAPAVVDLCTKAGAIAPTKYYCMMKVQGLT  300


 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/132 (29%), Positives = 61/132 (46%), Gaps = 1/132 (1%)
 Frame = -1

Query  939  MEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGH  760
            ++   N   V P  Q+M  L  E L     L  G+  L  V PV  CK C EV++G  GH
Sbjct  27   LKRVENRAKVYPI-QEMLPLAQEVLGVRMLLIQGISILTRVIPVVACKFCPEVYIGEKGH  85

Query  759  KARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVD  580
              + C  ++     ++H W    ++D++ P   +        ++  + R  +   PAVV+
Sbjct  86   LIKTCWGYRRGPKNQVHEWITGGLNDILVPVETFRLDNMFQKIIKHDQRFDFDRVPAVVE  145

Query  579  LCTKAGAIAPSK  544
            LC +AGA   S+
Sbjct  146  LCRQAGAEVSSE  157



>gb|KHN36547.1| APO protein 4, mitochondrial [Glycine soja]
Length=362

 Score =   351 bits (901),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 199/242 (82%), Gaps = 4/242 (2%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             L+ C++CPE+Y+GE GHLI+TC GY+HR KN++H WIKG L+ IL+PVETFHL NMFQ+V
Sbjct  78    LMACKFCPEIYIGEQGHLIQTCSGYKHRAKNRVHEWIKGGLNDILVPVETFHLDNMFQSV  137

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQ----QMRLLG  877
             I+H+ERFD+ RI AVVELC QAGA+ +DE++++S    E+++  V   +      +  + 
Sbjct  138   IRHNERFDFDRIPAVVELCWQAGADFHDENLNSSSWNLEADNGSVPETESLSPNDLTSIA  197

Query  876   NETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEK  697
             N+TL AWETLRSGV KLLLVYPVKVCK+CSEVHVGPSGHKARLCGVFKYESW+  HFW K
Sbjct  198   NKTLTAWETLRSGVEKLLLVYPVKVCKYCSEVHVGPSGHKARLCGVFKYESWKGAHFWMK  257

Query  696   ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDG  517
             A+VD+LVPP IVW RRPQDPP+LL+EGR +YG  PAV+DLC+KAGA+ P+KY CMMKV G
Sbjct  258   ANVDNLVPPKIVWRRRPQDPPVLLNEGRGFYGRVPAVLDLCSKAGAVVPAKYNCMMKVQG  317

Query  516   LS  511
             LS
Sbjct  318   LS  319


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + NE L     L  GV  LL   P+  CK C E+++G  GH  + C  +K+ +  R+H W
Sbjct  54   VANEVLQVRNDLIHGVSTLLNFLPLMACKFCPEIYIGEQGHLIQTCSGYKHRAKNRVHEW  113

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
             K  ++D++ P   +H       ++    R  +   PAVV+LC +AGA
Sbjct  114  IKGGLNDILVPVETFHLDNMFQSVIRHNERFDFDRIPAVVELCWQAGA  161



>ref|XP_010248529.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010248539.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010248547.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010248556.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010248565.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010248574.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
 ref|XP_010248582.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Nelumbo nucifera]
Length=347

 Score =   347 bits (891),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 196/242 (81%), Gaps = 6/242 (2%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++CPEV++GE GH+I+TC GY+ R KNQLH WI GSL+ IL+PV+ FHL +MFQ+VIKH
Sbjct  84    CKFCPEVFIGERGHMIQTCHGYKRRAKNQLHEWINGSLNDILVPVDAFHLKHMFQDVIKH  143

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDA-----SKMEHESNSKIVLPFDQQMRLLGNE  871
              +RFD+ RI AVVELC QAGA+ NDE++D+        +HE  + + L  D+ MR +  E
Sbjct  144   EQRFDFDRIPAVVELCCQAGAHINDENLDSIIWTPDTSKHEVFNAVPLSQDE-MRFVAKE  202

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             TL AWE LRSGV KLLLVYP KVCK+CSEVHVGPSGH+ARLCGVFK+E WR IHFW++A 
Sbjct  203   TLGAWERLRSGVQKLLLVYPAKVCKYCSEVHVGPSGHRARLCGVFKHEGWRGIHFWKRAK  262

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             VDD VPP IVW RRPQDPP+LLD+GR++YGHAPAVV+LC +AGAI P+KYFCMMK+ GL+
Sbjct  263   VDDFVPPKIVWRRRPQDPPVLLDKGRDFYGHAPAVVELCLQAGAIVPTKYFCMMKMQGLA  322

Query  510   AP  505
              P
Sbjct  323   PP  324


 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = -1

Query  891  MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
            M  +  E + A   L  G+  LL   PVK CK C EV +G  GH  + C  +K  +  ++
Sbjct  54   MVPVAYEVIRARARLIEGLSMLLKAIPVKACKFCPEVFIGERGHMIQTCHGYKRRAKNQL  113

Query  711  HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            H W   S++D++ P   +H +     ++  E R  +   PAVV+LC +AGA
Sbjct  114  HEWINGSLNDILVPVDAFHLKHMFQDVIKHEQRFDFDRIPAVVELCCQAGA  164



>ref|XP_007033060.1| APO protein 4 isoform 1 [Theobroma cacao]
 ref|XP_007033061.1| APO protein 4 isoform 1 [Theobroma cacao]
 ref|XP_007033062.1| APO protein 4 isoform 1 [Theobroma cacao]
 gb|EOY03986.1| APO protein 4 isoform 1 [Theobroma cacao]
 gb|EOY03987.1| APO protein 4 isoform 1 [Theobroma cacao]
 gb|EOY03988.1| APO protein 4 isoform 1 [Theobroma cacao]
Length=312

 Score =   346 bits (887),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/245 (65%), Positives = 193/245 (79%), Gaps = 4/245 (2%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++CPEVY+GE GHLI+TC GY+   KN++H W+ G L+ IL+PVE FHLHNMFQ V
Sbjct  68    VLACKFCPEVYIGEKGHLIKTCCGYKRIGKNRVHEWVNGGLNDILVPVEAFHLHNMFQGV  127

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQ----QMRLLG  877
             IKH +RFD+ R+ AVVELC QAGA+ NDE++++  +  +     V   +      + ++ 
Sbjct  128   IKHQQRFDFERVPAVVELCWQAGADLNDENLNSGSLVADEFYGGVRGIESLSHDDLTVIA  187

Query  876   NETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEK  697
             N TL AWETLRSGV KLLLVYP KVCK+CSEVHVGPSGH+ARLCGVF+YESWR  HFW+K
Sbjct  188   NGTLRAWETLRSGVMKLLLVYPAKVCKYCSEVHVGPSGHRARLCGVFRYESWRGAHFWKK  247

Query  696   ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDG  517
             A VDDLVPP IVW RRPQDP +LLDEGR+YYGHAPAVVDLC+ AGAI P+KY CMMKV G
Sbjct  248   AGVDDLVPPKIVWRRRPQDPLVLLDEGRDYYGHAPAVVDLCSGAGAIVPTKYSCMMKVSG  307

Query  516   LSAPI  502
             L AP+
Sbjct  308   LPAPL  312


 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E L A   L  GV  LL ++PV  CK C EV++G  GH  + C  +K     R+H W
Sbjct  44   VAQEVLMARALLFQGVSILLKLFPVLACKFCPEVYIGEKGHLIKTCCGYKRIGKNRVHEW  103

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
                ++D++ P   +H       ++  + R  +   PAVV+LC +AGA
Sbjct  104  VNGGLNDILVPVEAFHLHNMFQGVIKHQQRFDFERVPAVVELCWQAGA  151



>ref|XP_010248521.1| PREDICTED: APO protein 4, mitochondrial isoform X1 [Nelumbo nucifera]
Length=360

 Score =   348 bits (892),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 196/242 (81%), Gaps = 6/242 (2%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++CPEV++GE GH+I+TC GY+ R KNQLH WI GSL+ IL+PV+ FHL +MFQ+VIKH
Sbjct  97    CKFCPEVFIGERGHMIQTCHGYKRRAKNQLHEWINGSLNDILVPVDAFHLKHMFQDVIKH  156

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDA-----SKMEHESNSKIVLPFDQQMRLLGNE  871
              +RFD+ RI AVVELC QAGA+ NDE++D+        +HE  + + L  D+ MR +  E
Sbjct  157   EQRFDFDRIPAVVELCCQAGAHINDENLDSIIWTPDTSKHEVFNAVPLSQDE-MRFVAKE  215

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             TL AWE LRSGV KLLLVYP KVCK+CSEVHVGPSGH+ARLCGVFK+E WR IHFW++A 
Sbjct  216   TLGAWERLRSGVQKLLLVYPAKVCKYCSEVHVGPSGHRARLCGVFKHEGWRGIHFWKRAK  275

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             VDD VPP IVW RRPQDPP+LLD+GR++YGHAPAVV+LC +AGAI P+KYFCMMK+ GL+
Sbjct  276   VDDFVPPKIVWRRRPQDPPVLLDKGRDFYGHAPAVVELCLQAGAIVPTKYFCMMKMQGLA  335

Query  510   AP  505
              P
Sbjct  336   PP  337


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = -1

Query  891  MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
            M  +  E + A   L  G+  LL   PVK CK C EV +G  GH  + C  +K  +  ++
Sbjct  67   MVPVAYEVIRARARLIEGLSMLLKAIPVKACKFCPEVFIGERGHMIQTCHGYKRRAKNQL  126

Query  711  HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            H W   S++D++ P   +H +     ++  E R  +   PAVV+LC +AGA
Sbjct  127  HEWINGSLNDILVPVDAFHLKHMFQDVIKHEQRFDFDRIPAVVELCCQAGA  177



>ref|XP_006447520.1| hypothetical protein CICLE_v10015921mg [Citrus clementina]
 ref|XP_006469706.1| PREDICTED: APO protein 4, mitochondrial-like [Citrus sinensis]
 gb|ESR60760.1| hypothetical protein CICLE_v10015921mg [Citrus clementina]
Length=326

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 191/245 (78%), Gaps = 4/245 (2%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++CPEV++GE GHLI+TC G+R R KN++H WI GSLD IL+PVE FHL  MFQ VI+H
Sbjct  81    CKFCPEVFIGEKGHLIQTCRGFRRRAKNRVHEWISGSLDDILVPVEAFHLRKMFQPVIEH  140

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFD----QQMRLLGNET  868
             ++RFD+ R+ AVVELC QAGA+P D+ +  +    +     V   +    + + ++ N T
Sbjct  141   NQRFDFERVPAVVELCWQAGADPTDQDLHLNTRNSDGIVGGVHGVESLSPEDLTVIANGT  200

Query  867   LNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASV  688
             L AWETLRSGV +L LVYPVKVC+HCSEVHVGPSGHKARLCGVFKYESWR  HFW+KA V
Sbjct  201   LKAWETLRSGVQRLTLVYPVKVCEHCSEVHVGPSGHKARLCGVFKYESWRGTHFWKKAGV  260

Query  687   DDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSA  508
             DDLVPP IVWHRRPQDPP+LLDEGR YYGHAPAVVDLCTKAG + P+KYF M+KV G S 
Sbjct  261   DDLVPPKIVWHRRPQDPPVLLDEGRGYYGHAPAVVDLCTKAGVVPPTKYFTMIKVLGRSE  320

Query  507   PISDK  493
             P+  +
Sbjct  321   PVGSE  325


 Score = 77.0 bits (188),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  +  E L A   L  GV  L+ V+PV+ CK C EV +G  GH  + C  F+  +  
Sbjct  49   RDMVPVAREVLKARALLIRGVSTLIKVFPVQACKFCPEVFIGEKGHLIQTCRGFRRRAKN  108

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            R+H W   S+DD++ P   +H R    P++    R  +   PAVV+LC +AGA
Sbjct  109  RVHEWISGSLDDILVPVEAFHLRKMFQPVIEHNQRFDFERVPAVVELCWQAGA  161



>ref|XP_002273999.2| PREDICTED: APO protein 4, mitochondrial [Vitis vinifera]
Length=329

 Score =   345 bits (884),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 200/250 (80%), Gaps = 8/250 (3%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C++CPEVY+GE GHLI+TC GY+ R+KNQ+H WI GSL+ IL+PVETFHL  MFQ+V
Sbjct  81    VMACKFCPEVYIGEQGHLIQTCYGYKRRSKNQVHEWISGSLNDILVPVETFHLQKMFQDV  140

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESN------SKIVLPFDQQMRL  883
             IKHH+RFD+ R+ AV ELCLQAGA+ ++E++ +S  + ES       +K + P   +++ 
Sbjct  141   IKHHQRFDFDRVPAVFELCLQAGADLDEENLSSSSWKSESTFSGVHGTKSLSP--DELKF  198

Query  882   LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
             +   TL AWE LRSG+ +LLLVYP KVCK+CSEVHVGPSGHKARLCGVFKYESWR  HFW
Sbjct  199   VATGTLRAWEVLRSGIRRLLLVYPAKVCKYCSEVHVGPSGHKARLCGVFKYESWRGAHFW  258

Query  702   EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKV  523
             +KA VDDLVPP IVW +RPQDPP+L++EGR++YGHAPAVVDLCTKAGAIAP++Y  MMKV
Sbjct  259   KKADVDDLVPPKIVWRQRPQDPPVLVNEGRDFYGHAPAVVDLCTKAGAIAPARYHSMMKV  318

Query  522   DGLSAPISDK  493
              GL  P   K
Sbjct  319   QGLPGPTGVK  328


 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 56/108 (52%), Gaps = 0/108 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  + L A   L  GV  L+ V+PV  CK C EV++G  GH  + C  +K  S  ++H W
Sbjct  57   VAQDVLKARSLLIQGVSTLMNVFPVMACKFCPEVYIGEQGHLIQTCYGYKRRSKNQVHEW  116

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
               S++D++ P   +H +     ++    R  +   PAV +LC +AGA
Sbjct  117  ISGSLNDILVPVETFHLQKMFQDVIKHHQRFDFDRVPAVFELCLQAGA  164



>gb|EYU32798.1| hypothetical protein MIMGU_mgv1a010138mg [Erythranthe guttata]
Length=321

 Score =   344 bits (882),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/237 (66%), Positives = 192/237 (81%), Gaps = 5/237 (2%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+YC EVY+GE GHLIRTC G+    KN++H W+K + ++++IPVETFHL  MFQ+VIKH
Sbjct  89    CKYCSEVYIGEGGHLIRTCHGFHRHAKNKVHSWVKANTNNVVIPVETFHLQKMFQDVIKH  148

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLGNETLNAW  856
             HERFDY R+ A+VELCLQAGA+ N ++     +E  +N    L  D+ +R +  +TL AW
Sbjct  149   HERFDYDRVPAIVELCLQAGADSNHQN----GLEKNNNILNSLSEDE-LRFVATQTLRAW  203

Query  855   ETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLV  676
             E LRSGVH+LL VYP +VCKHCSEVHVGPSGHKAR+CGVFKY+S+R  HFWEKA VDDLV
Sbjct  204   EALRSGVHRLLFVYPARVCKHCSEVHVGPSGHKARMCGVFKYQSFRGAHFWEKAKVDDLV  263

Query  675   PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAP  505
             PPN+VW RR QDP +L+D+GR YYGHAPAVVDLC+KAGA+ PSKYFCMMK+DGL+AP
Sbjct  264   PPNMVWSRRRQDPQILVDKGREYYGHAPAVVDLCSKAGALVPSKYFCMMKLDGLTAP  320


 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 59/111 (53%), Gaps = 0/111 (0%)
 Frame = -1

Query  891  MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
            M  L +E L A   L  GV  L+   P+  CK+CSEV++G  GH  R C  F   +  ++
Sbjct  59   MLPLAHEVLQARTALYDGVSTLIHHIPIWACKYCSEVYIGEGGHLIRTCHGFHRHAKNKV  118

Query  711  HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            H W KA+ +++V P   +H +     ++    R  Y   PA+V+LC +AGA
Sbjct  119  HSWVKANTNNVVIPVETFHLQKMFQDVIKHHERFDYDRVPAIVELCLQAGA  169



>ref|XP_010052452.1| PREDICTED: APO protein 4, mitochondrial [Eucalyptus grandis]
 ref|XP_010052460.1| PREDICTED: APO protein 4, mitochondrial [Eucalyptus grandis]
 ref|XP_010052467.1| PREDICTED: APO protein 4, mitochondrial [Eucalyptus grandis]
 gb|KCW89605.1| hypothetical protein EUGRSUZ_A01889 [Eucalyptus grandis]
Length=328

 Score =   342 bits (876),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 162/245 (66%), Positives = 192/245 (78%), Gaps = 5/245 (2%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+ C EVYVGE GHLI+TC GYR R KN++H WI G +  IL+PVE FHL  MFQ+VIKH
Sbjct  84    CKLCSEVYVGEKGHLIQTCRGYRPRGKNRVHEWINGGIKDILVPVEAFHLKTMFQDVIKH  143

Query  1035  HERFDYSRISAVVELCLQAGANPNDESI----DASKMEHESNSKIVLPFDQQMRLLGNET  868
             H+RFDY RI AVVELC QAGA+ +DE++    ++   + E N   V+  D  M L+ N T
Sbjct  144   HQRFDYDRIPAVVELCYQAGADLHDENLQCMPESDDAQIEGNEAEVILADDLM-LIANGT  202

Query  867   LNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASV  688
             L AWETLRSGV KLLLVYP KVCK+CSEVHVGPSGHKAR+CGVFKY+SWR  HFW+KA V
Sbjct  203   LRAWETLRSGVQKLLLVYPAKVCKYCSEVHVGPSGHKARVCGVFKYQSWRGGHFWKKAEV  262

Query  687   DDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSA  508
             DDLVP NIVW  RPQDPP+L+DEGR++YGHAPAVV LC +AGAI P+KY CMMK+ G +A
Sbjct  263   DDLVPSNIVWFPRPQDPPVLVDEGRDFYGHAPAVVSLCVQAGAIPPAKYHCMMKIQGQTA  322

Query  507   PISDK  493
             P+S K
Sbjct  323   PVSTK  327


 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  891  MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
            M  +  E L A   L  GV  LL  +PV  CK CSEV+VG  GH  + C  ++     R+
Sbjct  54   MVPVAQEVLKARTLLIQGVSTLLRFFPVAACKLCSEVYVGEKGHLIQTCRGYRPRGKNRV  113

Query  711  HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            H W    + D++ P   +H +     ++    R  Y   PAVV+LC +AGA
Sbjct  114  HEWINGGIKDILVPVEAFHLKTMFQDVIKHHQRFDYDRIPAVVELCYQAGA  164



>ref|XP_011074514.1| PREDICTED: LOW QUALITY PROTEIN: APO protein 4, mitochondrial 
[Sesamum indicum]
Length=324

 Score =   340 bits (873),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/241 (65%), Positives = 187/241 (78%), Gaps = 10/241 (4%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+YCPEVY+GE GHLI+TC GYRH  KN++H W+KG+++ +++PV+TFHL  MFQNV+KH
Sbjct  89    CKYCPEVYIGEGGHLIQTCHGYRHHAKNKVHSWVKGNMNDVIVPVQTFHLQKMFQNVVKH  148

Query  1035  HERFDYSRISAVVELCLQAGANPNDE----SIDASKMEHESNSKIVLPFDQQMRLLGNET  868
             HERF           CLQAGA+ ND+    S+D       + +  V   D  +RL+   T
Sbjct  149   HERF------XXXXXCLQAGADDNDQRVSSSVDTPDGFGINTADRVSLSDDDLRLVATRT  202

Query  867   LNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASV  688
             L AWETLRSGVHKLL VYP +VCKHCSEVHVGPSGHKAR+CGVFKYESWR  HFWEKA V
Sbjct  203   LRAWETLRSGVHKLLFVYPARVCKHCSEVHVGPSGHKARMCGVFKYESWRGTHFWEKARV  262

Query  687   DDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSA  508
             DDLVPP +VW RR QDPP+L+D+GR YYG APAVVDLC+KAGA+ PSKYFCMMK+DGL+A
Sbjct  263   DDLVPPKLVWFRRRQDPPILVDKGREYYGRAPAVVDLCSKAGALVPSKYFCMMKMDGLTA  322

Query  507   P  505
             P
Sbjct  323   P  323


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = -1

Query  891  MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
            M  +  E L A   L  GV  L    P+  CK+C EV++G  GH  + C  +++ +  ++
Sbjct  59   MLTVAREVLQARPALYDGVSTLSQRIPIWACKYCPEVYIGEGGHLIQTCHGYRHHAKNKV  118

Query  711  HFWEKASVDDLVPPNIVWH  655
            H W K +++D++ P   +H
Sbjct  119  HSWVKGNMNDVIVPVQTFH  137



>emb|CDP07549.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   338 bits (868),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/241 (66%), Positives = 190/241 (79%), Gaps = 4/241 (2%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+YC EV++GE+GH IRTCGG+R R K  +H W  GSL++IL+PVE FHL  MFQNVI+H
Sbjct  88    CKYCQEVFIGESGHEIRTCGGFRRRPKVHVHEWTSGSLNNILVPVEAFHLKYMFQNVIEH  147

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPF----DQQMRLLGNET  868
             ++RFD+ RI AV+ELC QAGA  ND+ +D +    +     V       D++M L+ N T
Sbjct  148   NQRFDFDRIPAVLELCWQAGAYVNDKMLDLNSYSQDDILGAVAGAESLSDKEMMLVANAT  207

Query  867   LNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASV  688
             L AWET+RSGV KLLLVYP KVC+HCSEVHVGPSGHKARLCGVFKYE WR  HFW KA V
Sbjct  208   LKAWETVRSGVEKLLLVYPTKVCEHCSEVHVGPSGHKARLCGVFKYEGWRGKHFWRKARV  267

Query  687   DDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSA  508
             DDLV PNIVW+RR QDP +L +EGR+YYGHAPAVVDLCTKAGA+APSKY CMMK++GL+A
Sbjct  268   DDLVRPNIVWYRRLQDPAVLKNEGRDYYGHAPAVVDLCTKAGAVAPSKYHCMMKMEGLTA  327

Query  507   P  505
             P
Sbjct  328   P  328


 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  + NE + A  TL  GV  LL   PV  CK+C EV +G SGH+ R CG F+     
Sbjct  56   KAMVPVANEVVKARTTLYRGVSILLQRVPVWACKYCQEVFIGESGHEIRTCGGFRRRPKV  115

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
             +H W   S+++++ P   +H +     ++    R  +   PAV++LC +AGA    K  
Sbjct  116  HVHEWTSGSLNNILVPVEAFHLKYMFQNVIEHNQRFDFDRIPAVLELCWQAGAYVNDKML  175



>ref|XP_007149961.1| hypothetical protein PHAVU_005G114000g [Phaseolus vulgaris]
 gb|ESW21955.1| hypothetical protein PHAVU_005G114000g [Phaseolus vulgaris]
Length=335

 Score =   338 bits (868),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 199/249 (80%), Gaps = 8/249 (3%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             L  C++CPE+Y+GE GHLI+TC GY+HR KN++H WIKG L+ IL+PVETFHL+ MFQ+V
Sbjct  78    LTACKFCPEIYIGEQGHLIQTCWGYKHRAKNRVHEWIKGGLNDILVPVETFHLNYMFQSV  137

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIV------LPFDQQMRL  883
             I+H+ERFD+ RI AVVELC QAGA+  +E++++S    E+ S+ V      LP D  +  
Sbjct  138   IRHNERFDFDRIPAVVELCWQAGADLQEENLNSSSWNLEAASESVPESQHLLPDD--LAS  195

Query  882   LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
               N+TL AWETLRSGV KLLLVYPVKVCK+CSEVHVGPSGHKARLCGVFKYE W+  HFW
Sbjct  196   TANKTLTAWETLRSGVEKLLLVYPVKVCKYCSEVHVGPSGHKARLCGVFKYEGWKGAHFW  255

Query  702   EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKV  523
              KA+VD+LVPP +VW RRPQDPP+L++E +++YG  PAV+DLC++AGA+ P KY CMMK+
Sbjct  256   MKANVDNLVPPKMVWRRRPQDPPVLVNERKDFYGRVPAVLDLCSRAGAVVPKKYNCMMKL  315

Query  522   DGLSAPISD  496
              GLS P ++
Sbjct  316   QGLSGPANN  324


 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  + NE L A   L  G+  LL   P+  CK C E+++G  GH  + C  +K+ +  
Sbjct  49   RAMVPVANEVLQARNVLIHGISTLLDFLPLTACKFCPEIYIGEQGHLIQTCWGYKHRAKN  108

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            R+H W K  ++D++ P   +H       ++    R  +   PAVV+LC +AGA
Sbjct  109  RVHEWIKGGLNDILVPVETFHLNYMFQSVIRHNERFDFDRIPAVVELCWQAGA  161



>ref|XP_003597021.1| APO protein [Medicago truncatula]
 gb|AES67272.1| APO RNA-binding protein [Medicago truncatula]
Length=344

 Score =   338 bits (868),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 156/249 (63%), Positives = 198/249 (80%), Gaps = 5/249 (2%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             L+ C++CPE+Y+GE GHLI TC GY+ R KN++H W+KG L+ IL+PVETFHL+NMFQNV
Sbjct  85    LMACKFCPEIYIGEQGHLIPTCRGYKRRAKNRVHEWVKGGLNDILVPVETFHLNNMFQNV  144

Query  1044  IKHHERFDYSRISAVVELCLQAGAN-PNDESIDASKMEHESNSKIVLPFDQQ----MRLL  880
             I+H +RFD+ RI+AVVELC QAGA+ P+DE++  S    E+ +  V  F+      + ++
Sbjct  145   IRHDQRFDFDRIAAVVELCWQAGADVPHDENLSPSSSNLEAANGNVDGFESLSPNVLAVV  204

Query  879   GNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWE  700
               +TL AW+ LRSGV KLLLVYPVKVCK+CSEVHVGPSGHKARLCGVFK+ESW+  HFW 
Sbjct  205   AKKTLEAWDVLRSGVEKLLLVYPVKVCKYCSEVHVGPSGHKARLCGVFKHESWKGAHFWT  264

Query  699   KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             KA+VD+LVPP IVW RRPQDPP+L++EGR++YG  PAV+DLCTKAG I P+KY  +MKV 
Sbjct  265   KANVDNLVPPKIVWRRRPQDPPVLVNEGRDFYGRVPAVLDLCTKAGVIVPAKYNVLMKVQ  324

Query  519   GLSAPISDK  493
             GLS P + K
Sbjct  325   GLSGPANYK  333


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 58/116 (50%), Gaps = 0/116 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  + NE L A   L  GV  L+  +P+  CK C E+++G  GH    C  +K  +  
Sbjct  56   RAMIPVANEVLLARNVLIHGVSTLINSFPLMACKFCPEIYIGEQGHLIPTCRGYKRRAKN  115

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            R+H W K  ++D++ P   +H       ++  + R  +    AVV+LC +AGA  P
Sbjct  116  RVHEWVKGGLNDILVPVETFHLNNMFQNVIRHDQRFDFDRIAAVVELCWQAGADVP  171



>ref|XP_004487390.1| PREDICTED: APO protein 4, mitochondrial-like isoform X1 [Cicer 
arietinum]
Length=337

 Score =   334 bits (856),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 153/248 (62%), Positives = 198/248 (80%), Gaps = 8/248 (3%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C++CPE+Y+GE GHLI TC GY+ R KN++H W+KG L+ I++PVETFHL NMFQ+V
Sbjct  85    VMACKFCPEIYIGEQGHLIPTCWGYKRRAKNRVHEWVKGGLNDIIVPVETFHLKNMFQSV  144

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHES------NSKIVLPFDQQMRL  883
             I+H +RFD+ RI AVVELC QAGA+P+DE++++S    E+       ++ + P D  + L
Sbjct  145   IRHDQRFDFDRIPAVVELCWQAGADPHDENLNSSSWNMETANANADGTESLSPND--LAL  202

Query  882   LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
             + N+T  AWETLRSGV KL+L YPVKVCK+CSEVHVGPSGH+ARLCGVFKYES++  HFW
Sbjct  203   IANKTFKAWETLRSGVKKLVLAYPVKVCKYCSEVHVGPSGHQARLCGVFKYESFKGGHFW  262

Query  702   EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKV  523
              KA+VD+LVPP IVW RRPQDP +L+ EGR++YG  PAV+DLCTKAGAI P+KY  MMKV
Sbjct  263   MKANVDNLVPPKIVWRRRPQDPLVLVSEGRDFYGRVPAVLDLCTKAGAIVPAKYNYMMKV  322

Query  522   DGLSAPIS  499
              GLS P++
Sbjct  323   QGLSGPVN  330


 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  + NE L A   L +GV  LL  +PV  CK C E+++G  GH    C  +K  +  
Sbjct  56   RAMVPVANEVLLARNFLINGVSTLLKSFPVMACKFCPEIYIGEQGHLIPTCWGYKRRAKN  115

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            R+H W K  ++D++ P   +H +     ++  + R  +   PAVV+LC +AGA
Sbjct  116  RVHEWVKGGLNDIIVPVETFHLKNMFQSVIRHDQRFDFDRIPAVVELCWQAGA  168



>ref|XP_010694573.1| PREDICTED: APO protein 4, mitochondrial [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010694581.1| PREDICTED: APO protein 4, mitochondrial [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010694588.1| PREDICTED: APO protein 4, mitochondrial [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010694595.1| PREDICTED: APO protein 4, mitochondrial [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010694599.1| PREDICTED: APO protein 4, mitochondrial [Beta vulgaris subsp. 
vulgaris]
Length=340

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 190/249 (76%), Gaps = 5/249 (2%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C++CPEV+VGE GHLIRTC G+R   KNQ+H WI  SL+ IL+PVETFHL +M Q+V
Sbjct  89    VVACKFCPEVHVGEAGHLIRTCFGHRRCNKNQVHKWISASLNDILVPVETFHLDDMVQDV  148

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLP-----FDQQMRLL  880
             IKH +RFD+ R+ AVVELC QAGA+ ++  + +S    +S   + L          +R +
Sbjct  149   IKHQQRFDFERVPAVVELCSQAGASLHNLDLQSSNCMADSIEGLALSGPDSLSTNDLRTI  208

Query  879   GNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWE  700
             GN TL AWE LR GV KLLLVYP KVCK+CSEVHVGPSGHKARLCGVFKY+++R  HFWE
Sbjct  209   GNRTLRAWEALRQGVEKLLLVYPAKVCKYCSEVHVGPSGHKARLCGVFKYQNFRGNHFWE  268

Query  699   KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             KA VDDLVPP IVW+RRPQDPP+LL E RNYYGHAPAVVDLCTKAGA  P KY CMMKV 
Sbjct  269   KAGVDDLVPPKIVWYRRPQDPPVLLHEDRNYYGHAPAVVDLCTKAGAEPPLKYMCMMKVQ  328

Query  519   GLSAPISDK  493
             GL  P S+K
Sbjct  329   GLRGPPSEK  337


 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  +  E L A   +  GV  LL + PV  CK C EVHVG +GH  R C   +  +  
Sbjct  60   RSMIPVAEEILQARSIVIHGVSALLKMLPVVACKFCPEVHVGEAGHLIRTCFGHRRCNKN  119

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            ++H W  AS++D++ P   +H       ++  + R  +   PAVV+LC++AGA
Sbjct  120  QVHKWISASLNDILVPVETFHLDDMVQDVIKHQQRFDFERVPAVVELCSQAGA  172



>ref|XP_002527241.1| APO protein 4, mitochondrial precursor, putative [Ricinus communis]
 gb|EEF35167.1| APO protein 4, mitochondrial precursor, putative [Ricinus communis]
Length=325

 Score =   333 bits (853),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 153/248 (62%), Positives = 192/248 (77%), Gaps = 10/248 (4%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C++CPEV++GE GHLI+TC GYR   KN++H WI G L+ IL+PVETF L++ FQ V
Sbjct  81    VVACKFCPEVHIGERGHLIQTCWGYRRGAKNRVHEWIGGGLNDILVPVETFRLNSTFQKV  140

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFD-------QQMR  886
             IKH +RFD+ R+ A+VELC QAGA   DE++        S+  ++   D       + ++
Sbjct  141   IKHDQRFDFDRVPAIVELCRQAGAYVTDENLYYGL---RSSDNVINGVDKAESLSAEDLQ  197

Query  885   LLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHF  706
              + N TL AWETLRSGV +LLLVY  KVCK+CSE+HVGPSGHKAR CG+FKYESWR  HF
Sbjct  198   FVANGTLRAWETLRSGVQRLLLVYQAKVCKYCSEIHVGPSGHKARHCGIFKYESWRGSHF  257

Query  705   WEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMK  526
             WE+A VDDLVPP IVW RRPQDPP+LL+EGRN+YGHAPA+VDLCTKAGAIAP+KY+CMMK
Sbjct  258   WERARVDDLVPPKIVWRRRPQDPPVLLNEGRNFYGHAPAIVDLCTKAGAIAPTKYYCMMK  317

Query  525   VDGLSAPI  502
               GL+AP+
Sbjct  318   NQGLTAPV  325


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + +E L A   L  GV  L+ V PV  CK C EVH+G  GH  + C  ++  +  R+H W
Sbjct  57   VAHEVLQARMLLIQGVSTLIQVIPVVACKFCPEVHIGERGHLIQTCWGYRRGAKNRVHEW  116

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
                ++D++ P   +        ++  + R  +   PA+V+LC +AGA
Sbjct  117  IGGGLNDILVPVETFRLNSTFQKVIKHDQRFDFDRVPAIVELCRQAGA  164



>ref|XP_010089336.1| APO protein 4 [Morus notabilis]
 gb|EXB37661.1| APO protein 4 [Morus notabilis]
Length=347

 Score =   333 bits (853),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 156/250 (62%), Positives = 190/250 (76%), Gaps = 10/250 (4%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++CPEVY+GE GHLI+TC GYR R+KN++H WI G L+ IL+PV  FHL +MFQ+V
Sbjct  93    VLACKFCPEVYIGEEGHLIQTCHGYRRRSKNKVHQWIVGGLNDILVPVVAFHLQDMFQDV  152

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESI------DASKMEHESNS----KIVLPFDQ  895
             IKHHERFD  R+SAVVELC QAGA P+DE +             + NS    +I     Q
Sbjct  153   IKHHERFDLERVSAVVELCWQAGAAPSDEDLYPTTTIATITTNLDGNSVASDRIESLSPQ  212

Query  894   QMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRR  715
             +++ +   TL+AWETLRSGV +LLL YP KVCK+CSEVHVGPSGH AR CG+FK+ESWR 
Sbjct  213   ELQSVAKTTLDAWETLRSGVQRLLLAYPAKVCKYCSEVHVGPSGHLARNCGMFKFESWRG  272

Query  714   IHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFC  535
              HFWEKA VDDLVP  IVW RRP DPP+LL++GR++YGHAPA+VDLCTKAG +AP KY C
Sbjct  273   THFWEKAKVDDLVPRKIVWRRRPHDPPVLLEKGRDFYGHAPALVDLCTKAGIVAPVKYNC  332

Query  534   MMKVDGLSAP  505
             MMK+ GLS P
Sbjct  333   MMKIQGLSTP  342


 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 58/112 (52%), Gaps = 1/112 (1%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E L + + L  GV  LL  +PV  CK C EV++G  GH  + C  ++  S  ++H W
Sbjct  69   VAEEVLRSRKILFHGVSTLLKFFPVLACKFCPEVYIGEEGHLIQTCHGYRRRSKNKVHQW  128

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
                ++D++ P + +H +     ++    R       AVV+LC +AGA APS
Sbjct  129  IVGGLNDILVPVVAFHLQDMFQDVIKHHERFDLERVSAVVELCWQAGA-APS  179



>ref|XP_011037010.1| PREDICTED: APO protein 4, mitochondrial [Populus euphratica]
 ref|XP_011037011.1| PREDICTED: APO protein 4, mitochondrial [Populus euphratica]
 ref|XP_011037012.1| PREDICTED: APO protein 4, mitochondrial [Populus euphratica]
 ref|XP_011037013.1| PREDICTED: APO protein 4, mitochondrial [Populus euphratica]
Length=328

 Score =   332 bits (850),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 154/246 (63%), Positives = 191/246 (78%), Gaps = 4/246 (2%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++CPEVY+GE GHLI+TC GY+   + ++H WI G L+ IL+PVETF LHNMFQ+V
Sbjct  82    VLACKFCPEVYIGEKGHLIQTCYGYKRCGRKRVHEWIPGGLNDILVPVETFRLHNMFQDV  141

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVL---PFD-QQMRLLG  877
             I+H++RFD+ R+ AVVELC QAGAN +DE++    ++ +     +    PF    +    
Sbjct  142   IEHNQRFDFDRVPAVVELCRQAGANIDDENLHPGMLDLDGGIGHIDGGEPFSPSHLMHTA  201

Query  876   NETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEK  697
              E L+AWE LRSGV +LLLVYP KVCKHCSEVH+GPSGHKARLCGVFK+ESW   HFW+K
Sbjct  202   KEILDAWEKLRSGVQRLLLVYPSKVCKHCSEVHIGPSGHKARLCGVFKFESWHGKHFWKK  261

Query  696   ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDG  517
             A VDDLVPP IVW RRPQDPP+L++EGR++YGHAPAVVDLCTK G I P KY CMMK+ G
Sbjct  262   AEVDDLVPPKIVWWRRPQDPPVLVNEGRDFYGHAPAVVDLCTKTGIIVPPKYSCMMKIQG  321

Query  516   LSAPIS  499
             LSAP+S
Sbjct  322   LSAPVS  327


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 56/110 (51%), Gaps = 4/110 (4%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E L   + L  GV  L+ V+PV  CK C EV++G  GH  + C  +K    +R+H W
Sbjct  58   VAREVLEKRKLLIQGVSTLMEVFPVLACKFCPEVYIGEKGHLIQTCYGYKRCGRKRVHEW  117

Query  702  EKASVDDLVPP--NIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
                ++D++ P      H   QD  ++    R  +   PAVV+LC +AGA
Sbjct  118  IPGGLNDILVPVETFRLHNMFQD--VIEHNQRFDFDRVPAVVELCRQAGA  165



>ref|XP_006372950.1| hypothetical protein POPTR_0017s06490g [Populus trichocarpa]
 gb|ERP50747.1| hypothetical protein POPTR_0017s06490g [Populus trichocarpa]
Length=328

 Score =   329 bits (843),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 190/246 (77%), Gaps = 4/246 (2%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++CPEVY+GE GHLI+TC GY+   + ++H WI G L+ IL+PVETF L NMFQ+V
Sbjct  82    VLACKFCPEVYIGEKGHLIQTCYGYKRCGRKRVHEWIPGGLNDILVPVETFRLDNMFQDV  141

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVL---PFD-QQMRLLG  877
             I+H +RFD+ R+ AVVELC QAGAN +DE++    ++ +     +    PF    +  + 
Sbjct  142   IEHDQRFDFDRVPAVVELCRQAGANIDDENLHPGMLDLDGGIGHIDGGEPFSPSHLMYIA  201

Query  876   NETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEK  697
              E L+AWE LRSGV +LLLVYP KVCKHCSEVH+GPSGHKARLCGVFK+ESW   HFW+K
Sbjct  202   KEILDAWEKLRSGVQRLLLVYPSKVCKHCSEVHIGPSGHKARLCGVFKFESWHGKHFWKK  261

Query  696   ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDG  517
             A VDDLVPP IVW RRPQDP +L++EGR++YGHAPAVVDLCTK G I P+KY CMMK+ G
Sbjct  262   AEVDDLVPPKIVWRRRPQDPLVLVNEGRDFYGHAPAVVDLCTKTGIIVPTKYSCMMKIQG  321

Query  516   LSAPIS  499
             LSAP+S
Sbjct  322   LSAPVS  327


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E L   + L  GV  L+ V+PV  CK C EV++G  GH  + C  +K    +R+H W
Sbjct  58   VAREVLEKRKLLIQGVSTLMEVFPVLACKFCPEVYIGEKGHLIQTCYGYKRCGRKRVHEW  117

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
                ++D++ P   +        ++  + R  +   PAVV+LC +AGA
Sbjct  118  IPGGLNDILVPVETFRLDNMFQDVIEHDQRFDFDRVPAVVELCRQAGA  165



>ref|XP_009365158.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009365159.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009365160.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
Length=333

 Score =   327 bits (838),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 191/252 (76%), Gaps = 16/252 (6%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++CPEVY+GE GHLI+TC G++ R KN++H WI G L  +L+PVE FHL +MFQ+V
Sbjct  81    VLACKFCPEVYIGEKGHLIQTCCGFKRRGKNRVHEWIVGGLKDVLVPVEAFHLKHMFQDV  140

Query  1044  IKHHERFDYSRISAVVELCLQAGANP------NDES--IDASKMEHESNSKIVLPFDQQM  889
             IKHH+RFD+ R+ AVVELC QAGAN       N ES  +     E  S+ +++L      
Sbjct  141   IKHHQRFDFERVPAVVELCWQAGANDGNHLNWNSESDCVGVDGAESLSSDELIL------  194

Query  888   RLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIH  709
               + + TL AWE LR+GV KLL+VYP K+CKHCSEVHVGPSGHKARLCG+FKYESW+  H
Sbjct  195   --VASGTLRAWEILRNGVEKLLMVYPAKICKHCSEVHVGPSGHKARLCGIFKYESWQGTH  252

Query  708   FWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMM  529
             FW KA+VDDLVPP  VW RRPQDP +LL+EGR +YGHAPAVV+LCT+AGAIAP KY CMM
Sbjct  253   FWRKANVDDLVPPKTVWRRRPQDPQVLLNEGRGFYGHAPAVVELCTQAGAIAPPKYHCMM  312

Query  528   KVDGLSAPISDK  493
             K+ G+S  + D+
Sbjct  313   KLQGVSTILGDQ  324


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  891  MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
            M  +  E L++   +  GV  LL + PV  CK C EV++G  GH  + C  FK     R+
Sbjct  54   MLPVAQEVLDSRRLVMQGVSTLLKMVPVLACKFCPEVYIGEKGHLIQTCCGFKRRGKNRV  113

Query  711  HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            H W    + D++ P   +H +     ++    R  +   PAVV+LC +AGA
Sbjct  114  HEWIVGGLKDVLVPVEAFHLKHMFQDVIKHHQRFDFERVPAVVELCWQAGA  164



>ref|XP_009337730.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009337732.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009337733.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
 ref|XP_009337734.1| PREDICTED: APO protein 4, mitochondrial-like [Pyrus x bretschneideri]
Length=333

 Score =   324 bits (830),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 153/252 (61%), Positives = 191/252 (76%), Gaps = 16/252 (6%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++CPEVY+GE GHLI+TC G++ R KN++H WI G L  +L+PVE FHL +MFQ+V
Sbjct  81    VLACKFCPEVYIGEKGHLIQTCCGFKRRGKNRVHEWIVGGLKDVLVPVEAFHLEHMFQDV  140

Query  1044  IKHHERFDYSRISAVVELCLQAGANP------NDES--IDASKMEHESNSKIVLPFDQQM  889
             IKHH+RFD+ R+ AVVELC QAGAN       N ES  +     E  S+ +++L      
Sbjct  141   IKHHQRFDFERVPAVVELCWQAGANDGNYLNWNSESDCVGVDGAESLSSDELIL------  194

Query  888   RLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIH  709
               + + TL AWE LR+GV KLL+VYP KVCK+CSEVHVGPSGHKARLCG+FKYESW+  H
Sbjct  195   --VASGTLRAWEILRNGVEKLLMVYPGKVCKNCSEVHVGPSGHKARLCGIFKYESWQGTH  252

Query  708   FWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMM  529
             FW KA+VDDLVPP  VW RRPQDP +LL+EGR +YGHAPAVV+LCT+AGAIAP KY CMM
Sbjct  253   FWRKANVDDLVPPKTVWRRRPQDPQVLLNEGRGFYGHAPAVVELCTQAGAIAPPKYHCMM  312

Query  528   KVDGLSAPISDK  493
             K+ G+S  + D+
Sbjct  313   KLQGVSTILGDQ  324


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 53/108 (49%), Gaps = 0/108 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E L++   +  GV  LL + PV  CK C EV++G  GH  + C  FK     R+H W
Sbjct  57   VAQEVLDSRRLVMQGVSTLLKMVPVLACKFCPEVYIGEKGHLIQTCCGFKRRGKNRVHEW  116

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
                + D++ P   +H       ++    R  +   PAVV+LC +AGA
Sbjct  117  IVGGLKDVLVPVEAFHLEHMFQDVIKHHQRFDFERVPAVVELCWQAGA  164



>ref|XP_004287928.1| PREDICTED: APO protein 4, mitochondrial-like [Fragaria vesca 
subsp. vesca]
Length=348

 Score =   324 bits (831),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 195/246 (79%), Gaps = 6/246 (2%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C++CPEVY+G+ GHLI+TC G++ R +N++H WI GS+  +L+PVE FHL +MFQ+V
Sbjct  82    VVACKFCPEVYIGDKGHLIQTCPGFKRRGRNRVHEWITGSMKDVLVPVEAFHLKHMFQDV  141

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQ----QMRLLG  877
             IKH++RFDY R+SAVVELC QAGAN  DE++ +   + E++   +   +     ++ L+ 
Sbjct  142   IKHNQRFDYDRVSAVVELCWQAGAN--DENLYSGTWDPENDCVALDGAESLSPAELTLVA  199

Query  876   NETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEK  697
             N TL AWE LR+GV KLL+VYP KVCK CSEVHVGPSGHKARLCG+FKYE W+  HFW K
Sbjct  200   NGTLRAWEVLRNGVKKLLMVYPAKVCKDCSEVHVGPSGHKARLCGLFKYERWQGTHFWRK  259

Query  696   ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDG  517
              SVDDLVPPNIVW +R QDPP+LL+EG+ YYGHAPAVV+LC++AGA+ P+KY CMMK+DG
Sbjct  260   PSVDDLVPPNIVWRKRHQDPPVLLNEGKGYYGHAPAVVELCSQAGAVVPTKYHCMMKMDG  319

Query  516   LSAPIS  499
             L+  ++
Sbjct  320   LTGNVN  325


 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = -1

Query  894  QMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRR  715
            +M  +  E LN+   L  GV  LL   PV  CK C EV++G  GH  + C  FK     R
Sbjct  54   RMIPVAEEVLNSRRLLIQGVSTLLKAVPVVACKFCPEVYIGDKGHLIQTCPGFKRRGRNR  113

Query  714  IHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            +H W   S+ D++ P   +H +     ++    R  Y    AVV+LC +AGA
Sbjct  114  VHEWITGSMKDVLVPVEAFHLKHMFQDVIKHNQRFDYDRVSAVVELCWQAGA  165



>ref|XP_007215688.1| hypothetical protein PRUPE_ppa008702mg [Prunus persica]
 gb|EMJ16887.1| hypothetical protein PRUPE_ppa008702mg [Prunus persica]
Length=322

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/248 (60%), Positives = 186/248 (75%), Gaps = 17/248 (7%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C++CPEVY+GE GH+I+TC G++ R KN++H WI G L+ +L PVE FHL +MFQ+V
Sbjct  82    VMACKFCPEVYIGEKGHVIQTCCGFKRRGKNRVHEWITGGLNDVLAPVEAFHLKHMFQDV  141

Query  1044  IKHHERFDYSRISAVVELCLQAGAN---------PNDESIDASKMEHESNSKIVLPFDQQ  892
             IKHH+RFD+ R+ AVVELC QAGAN         P  +       E  S  ++V+     
Sbjct  142   IKHHQRFDFERVPAVVELCWQAGANDGNQYSNWSPESDCCSVDGAESLSPDELVM-----  196

Query  891   MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
                + + TL AWE LR+GV KLL+VYP KVCKHCSEVHVGPSGHKARLCG+FKYESW+  
Sbjct  197   ---IASGTLKAWEVLRNGVEKLLMVYPAKVCKHCSEVHVGPSGHKARLCGIFKYESWQGT  253

Query  711   HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCM  532
             HFW KA+VDDLVPP IVW RRPQDP +LL+EGR +YGHAPAVV+LCT+AGAIAP KY C+
Sbjct  254   HFWRKANVDDLVPPKIVWRRRPQDPQVLLNEGRGFYGHAPAVVELCTQAGAIAPKKYHCL  313

Query  531   MKVDGLSA  508
             MK+ G++ 
Sbjct  314   MKLQGVAT  321


 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 58/114 (51%), Gaps = 0/114 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E LN+   L  GV  LL V PV  CK C EV++G  GH  + C  FK     R+H W
Sbjct  58   VAQEVLNSRRLLMQGVSTLLKVLPVMACKFCPEVYIGEKGHVIQTCCGFKRRGKNRVHEW  117

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKY  541
                ++D++ P   +H +     ++    R  +   PAVV+LC +AGA   ++Y
Sbjct  118  ITGGLNDVLAPVEAFHLKHMFQDVIKHHQRFDFERVPAVVELCWQAGANDGNQY  171



>ref|XP_008230090.1| PREDICTED: APO protein 4, mitochondrial [Prunus mume]
 ref|XP_008230091.1| PREDICTED: APO protein 4, mitochondrial [Prunus mume]
Length=330

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 186/248 (75%), Gaps = 17/248 (7%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C++CPEVY+GE GH+I+TC G++ R KN++H WI G L+ +L PVE FHL +MFQ+V
Sbjct  90    VMACKFCPEVYIGEKGHVIQTCCGFKRRGKNRVHEWITGGLNDVLAPVEAFHLKHMFQDV  149

Query  1044  IKHHERFDYSRISAVVELCLQAGAN---------PNDESIDASKMEHESNSKIVLPFDQQ  892
             IKHH+RFD+ R+ AVVELC QAGAN         P  +       E  S  ++V+     
Sbjct  150   IKHHQRFDFERVPAVVELCWQAGANDGNQYSNWSPESDCCSVDGAESLSPDELVM-----  204

Query  891   MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
                + + TL AWE LR+GV KLL+VYP KVCKHCSEVHVGPSGHKARLCG+FKYESW+  
Sbjct  205   ---IASGTLKAWEVLRNGVEKLLMVYPAKVCKHCSEVHVGPSGHKARLCGIFKYESWQGT  261

Query  711   HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCM  532
             HFW KA+VDDLVPP IVW RRPQDP +LL+EGR +YGHAPAV++LCT+AGAIAP KY C+
Sbjct  262   HFWGKANVDDLVPPKIVWRRRPQDPQVLLNEGRGFYGHAPAVIELCTQAGAIAPRKYHCL  321

Query  531   MKVDGLSA  508
             MK+ G++ 
Sbjct  322   MKLQGVAT  329


 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 58/114 (51%), Gaps = 0/114 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E LN+   L  GV  LL V PV  CK C EV++G  GH  + C  FK     R+H W
Sbjct  66   VAQEVLNSRRLLMQGVSTLLKVLPVMACKFCPEVYIGEKGHVIQTCCGFKRRGKNRVHEW  125

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKY  541
                ++D++ P   +H +     ++    R  +   PAVV+LC +AGA   ++Y
Sbjct  126  ITGGLNDVLAPVEAFHLKHMFQDVIKHHQRFDFERVPAVVELCWQAGANDGNQY  179



>ref|XP_009417984.1| PREDICTED: APO protein 4, mitochondrial [Musa acuminata subsp. 
malaccensis]
 ref|XP_009417992.1| PREDICTED: APO protein 4, mitochondrial [Musa acuminata subsp. 
malaccensis]
 ref|XP_009417999.1| PREDICTED: APO protein 4, mitochondrial [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418008.1| PREDICTED: APO protein 4, mitochondrial [Musa acuminata subsp. 
malaccensis]
Length=324

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/241 (61%), Positives = 183/241 (76%), Gaps = 4/241 (2%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CPEVYVGE GH I+TC G++H  K+Q H W +G L+ IL PVE+FHL +M Q++IK
Sbjct  83    SCKFCPEVYVGETGHQIKTCYGFKHIIKDQPHHWTEGKLNDILTPVESFHLQDMHQSIIK  142

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESI----DASKMEHESNSKIVLPFDQQMRLLGNE  871
             H +RFD+ R+ A+VELC QAG   +DE +      S     +  K  +  D+ ++L+   
Sbjct  143   HDQRFDFHRVPAIVELCYQAGVEISDEVLYNCSPESPRSQGNTVKAGVSSDKDIKLVAQV  202

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             TL+AWETLR GV KLLLVYPVKVCK+CSEVHVGPSGHKARLCGVFK+E W+  H W+KA 
Sbjct  203   TLDAWETLRLGVQKLLLVYPVKVCKYCSEVHVGPSGHKARLCGVFKFERWKGSHMWKKAE  262

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             VDDLVPP +VWHRRP DPP+L+D GR +YGHAPAVV+LC +AGA  P KYFCMMKV GL+
Sbjct  263   VDDLVPPKMVWHRRPHDPPVLVDSGRGFYGHAPAVVELCMQAGARVPMKYFCMMKVHGLT  322

Query  510   A  508
             A
Sbjct  323   A  323


 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 60/112 (54%), Gaps = 0/112 (0%)
 Frame = -1

Query  894  QMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRR  715
            +M  +  + L + E L  G+  LL   PVK CK C EV+VG +GH+ + C  FK+    +
Sbjct  53   RMIPIAQDVLKSREMLAEGISTLLKFIPVKSCKFCPEVYVGETGHQIKTCYGFKHIIKDQ  112

Query  714  IHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
             H W +  ++D++ P   +H +     ++  + R  +   PA+V+LC +AG 
Sbjct  113  PHHWTEGKLNDILTPVESFHLQDMHQSIIKHDQRFDFHRVPAIVELCYQAGV  164



>ref|XP_008776099.1| PREDICTED: APO protein 4, mitochondrial isoform X2 [Phoenix dactylifera]
Length=324

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 181/241 (75%), Gaps = 4/241 (2%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C+YCPEVY+G+ GH I +C GY+   K++ H W+ G L+ IL PVE FHL NMFQ++IK
Sbjct  83    SCKYCPEVYIGDTGHQINSCYGYKRIIKDRPHRWVDGHLNDILAPVEAFHLQNMFQSIIK  142

Query  1038  HHERFDYSRISAVVELCLQAGANPNDES----IDASKMEHESNSKIVLPFDQQMRLLGNE  871
             H +RFD+ R+ AVVELC QAGA+ +D++    I  S      +        +++ L+   
Sbjct  143   HDQRFDFDRVPAVVELCYQAGADVSDDALYNHIPVSNSSKGDDGVTFSGSSEELSLVAQR  202

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             TL+AWE LR GV KLLLVYP KVC+HCSEVHVGPSGHKARLCGVFK+ESWR  H W+KA 
Sbjct  203   TLDAWERLRIGVQKLLLVYPAKVCEHCSEVHVGPSGHKARLCGVFKFESWRGSHMWKKAE  262

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             VDDL+PP +VWHRRP DPP+L+D GR +YGHAPAVV+LC +AGA  PSKYFCMMKV GL+
Sbjct  263   VDDLMPPTMVWHRRPHDPPVLVDGGRGFYGHAPAVVELCMQAGARVPSKYFCMMKVHGLT  322

Query  510   A  508
             A
Sbjct  323   A  323


 Score = 70.5 bits (171),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  + NE L A E L  GV  LL V  +K CK+C EV++G +GH+   C  +K     
Sbjct  52   KSMIPVANEVLKARELLTKGVSALLQVIAIKSCKYCPEVYIGDTGHQINSCYGYKRIIKD  111

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            R H W    ++D++ P   +H +     ++  + R  +   PAVV+LC +AGA
Sbjct  112  RPHRWVDGHLNDILAPVEAFHLQNMFQSIIKHDQRFDFDRVPAVVELCYQAGA  164



>ref|XP_008776097.1| PREDICTED: APO protein 4, mitochondrial isoform X1 [Phoenix dactylifera]
 ref|XP_008776098.1| PREDICTED: APO protein 4, mitochondrial isoform X1 [Phoenix dactylifera]
Length=336

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 145/241 (60%), Positives = 181/241 (75%), Gaps = 4/241 (2%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C+YCPEVY+G+ GH I +C GY+   K++ H W+ G L+ IL PVE FHL NMFQ++IK
Sbjct  95    SCKYCPEVYIGDTGHQINSCYGYKRIIKDRPHRWVDGHLNDILAPVEAFHLQNMFQSIIK  154

Query  1038  HHERFDYSRISAVVELCLQAGANPNDES----IDASKMEHESNSKIVLPFDQQMRLLGNE  871
             H +RFD+ R+ AVVELC QAGA+ +D++    I  S      +        +++ L+   
Sbjct  155   HDQRFDFDRVPAVVELCYQAGADVSDDALYNHIPVSNSSKGDDGVTFSGSSEELSLVAQR  214

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             TL+AWE LR GV KLLLVYP KVC+HCSEVHVGPSGHKARLCGVFK+ESWR  H W+KA 
Sbjct  215   TLDAWERLRIGVQKLLLVYPAKVCEHCSEVHVGPSGHKARLCGVFKFESWRGSHMWKKAE  274

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             VDDL+PP +VWHRRP DPP+L+D GR +YGHAPAVV+LC +AGA  PSKYFCMMKV GL+
Sbjct  275   VDDLMPPTMVWHRRPHDPPVLVDGGRGFYGHAPAVVELCMQAGARVPSKYFCMMKVHGLT  334

Query  510   A  508
             A
Sbjct  335   A  335


 Score = 70.1 bits (170),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  + NE L A E L  GV  LL V  +K CK+C EV++G +GH+   C  +K     
Sbjct  64   KSMIPVANEVLKARELLTKGVSALLQVIAIKSCKYCPEVYIGDTGHQINSCYGYKRIIKD  123

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            R H W    ++D++ P   +H +     ++  + R  +   PAVV+LC +AGA
Sbjct  124  RPHRWVDGHLNDILAPVEAFHLQNMFQSIIKHDQRFDFDRVPAVVELCYQAGA  176



>ref|XP_008379620.1| PREDICTED: LOW QUALITY PROTEIN: APO protein 4, mitochondrial 
[Malus domestica]
Length=343

 Score =   318 bits (814),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 151/252 (60%), Positives = 188/252 (75%), Gaps = 16/252 (6%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EVY+GE GHLI+TC G++ R KN +H WI G L  +L+PVETFHL +MFQ+V
Sbjct  81    VLACKFCLEVYIGEKGHLIQTCCGFKRRGKNXVHEWIVGGLKDVLVPVETFHLKHMFQDV  140

Query  1044  IKHHERFDYSRISAVVELCLQAGANP------NDES--IDASKMEHESNSKIVLPFDQQM  889
             IKHH+RFD+ R+ AVVELC QAGAN       N ES  +     E  S+ +++L      
Sbjct  141   IKHHQRFDFERVPAVVELCWQAGANDGNHLNWNXESDCVGVDGAESLSSDELIL------  194

Query  888   RLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIH  709
               + + TL AW+ LR+GV KLL+VYP KVCKHCSE+HVGPSGHKARLCG+FKYES +  H
Sbjct  195   --VASGTLRAWDILRNGVEKLLMVYPAKVCKHCSEIHVGPSGHKARLCGIFKYESXQGTH  252

Query  708   FWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMM  529
             FW KA+VDDLVPP  VW RRPQDP  LL+EGR +YGHAPAVV+LCT+AGAIAP KY CMM
Sbjct  253   FWRKANVDDLVPPKTVWRRRPQDPQXLLNEGRGFYGHAPAVVELCTQAGAIAPPKYHCMM  312

Query  528   KVDGLSAPISDK  493
             K+ G+S  + D+
Sbjct  313   KLQGVSTTLGDQ  324


 Score = 61.2 bits (147),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 53/108 (49%), Gaps = 0/108 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E L++   +  GV  LL + PV  CK C EV++G  GH  + C  FK      +H W
Sbjct  57   VAXEVLDSRRLVMQGVSTLLKMVPVLACKFCLEVYIGEKGHLIQTCCGFKRRGKNXVHEW  116

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
                + D++ P   +H +     ++    R  +   PAVV+LC +AGA
Sbjct  117  IVGGLKDVLVPVETFHLKHMFQDVIKHHQRFDFERVPAVVELCWQAGA  164



>gb|EPS60487.1| hypothetical protein M569_14314, partial [Genlisea aurea]
Length=295

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/237 (61%), Positives = 181/237 (76%), Gaps = 9/237 (4%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++CPEVY+GE+GHLI+TC GYRH  KN+ H WI+    ++L+PVETFHL   FQ VIKH
Sbjct  68    CKFCPEVYIGESGHLIQTCRGYRHHAKNKRHQWIEAQPHNVLLPVETFHLDKSFQTVIKH  127

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLGNETLNAW  856
               RFD+ RI AVVELCLQAGA  +  + D        N + V   + ++RL+G  TL AW
Sbjct  128   DRRFDFDRIPAVVELCLQAGAASDHRASD-------RNGEAV--SEDELRLVGMHTLKAW  178

Query  855   ETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLV  676
             E+LR+GVH+LL  YP +VC+HCSEVHVG SGH+AR CG+FK++ WR  HFWEKA VDDLV
Sbjct  179   ESLRTGVHRLLCAYPARVCRHCSEVHVGGSGHEARTCGLFKFQRWRGSHFWEKAKVDDLV  238

Query  675   PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAP  505
             PPN+VW RR QDPP+L++EGRNYYG  PAVVDLC+KAGA+ PSKYFC+MK +G + P
Sbjct  239   PPNLVWCRRRQDPPVLVEEGRNYYGRCPAVVDLCSKAGALVPSKYFCIMKFEGATPP  295


 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/110 (31%), Positives = 58/110 (53%), Gaps = 0/110 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + +E L A E L  GV  L+   P+  CK C EV++G SGH  + C  +++ +  + H W
Sbjct  41   VADEVLRAREILHCGVSALITRIPIWACKFCPEVYIGESGHLIQTCRGYRHHAKNKRHQW  100

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIA  553
             +A   +++ P   +H       ++  + R  +   PAVV+LC +AGA +
Sbjct  101  IEAQPHNVLLPVETFHLDKSFQTVIKHDRRFDFDRIPAVVELCLQAGAAS  150



>ref|XP_009353258.1| PREDICTED: LOW QUALITY PROTEIN: APO protein 4, mitochondrial 
[Pyrus x bretschneideri]
Length=333

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/252 (58%), Positives = 186/252 (74%), Gaps = 16/252 (6%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             LL C+ CPEVY+GE GHLI+TC G++ R KN++H WI G L  +L+PV+ FHL +MFQ V
Sbjct  81    LLACKLCPEVYIGEKGHLIQTCCGFKRRGKNRVHEWIIGGLKDVLVPVKAFHLRHMFQXV  140

Query  1044  IKHHERFDYSRISAVVELCLQAGANP------NDES--IDASKMEHESNSKIVLPFDQQM  889
             IKHH+RFD+ R+ AVVELC QAGAN       N ES  +    +E  S+ +++L      
Sbjct  141   IKHHQRFDFERVPAVVELCWQAGANDGNHLNWNSESDCVGVDGVESLSSDELIL------  194

Query  888   RLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIH  709
               + + TL AWE LR+G+ KLL+VYP K+CKHCSEVHV PSGHK RLCG+FKYESW+  H
Sbjct  195   --VASGTLRAWEILRNGMEKLLMVYPAKICKHCSEVHVRPSGHKVRLCGIFKYESWQGTH  252

Query  708   FWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMM  529
             FW KA+VDDLVPP  +W R PQDP +LL+EGR YYGHAPAVV+LCT+A AIAP KY CMM
Sbjct  253   FWRKANVDDLVPPKTLWRRCPQDPQVLLNEGRGYYGHAPAVVELCTRASAIAPPKYHCMM  312

Query  528   KVDGLSAPISDK  493
             ++ G+S  + D+
Sbjct  313   RLQGVSTTLGDQ  324


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 52/108 (48%), Gaps = 0/108 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E L+    +  GV  LL +  +  CK C EV++G  GH  + C  FK     R+H W
Sbjct  57   VAQEVLDTGRLVMQGVSTLLKMVRLLACKLCPEVYIGEKGHLIQTCCGFKRRGKNRVHEW  116

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
                + D++ P   +H R     ++    R  +   PAVV+LC +AGA
Sbjct  117  IIGGLKDVLVPVKAFHLRHMFQXVIKHHQRFDFERVPAVVELCWQAGA  164



>gb|KDP41149.1| hypothetical protein JCGZ_03643 [Jatropha curcas]
Length=449

 Score =   315 bits (808),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 170/220 (77%), Gaps = 6/220 (3%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C++CPEVY+GE GHLI+TC GYR   KNQ+H WI G L+ IL+PVETF L NMFQ +
Sbjct  123   VVACKFCPEVYIGEKGHLIKTCWGYRRGPKNQVHEWITGGLNDILVPVETFRLDNMFQKI  182

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLGNETL  865
             IKH +RFD+ R+ AVVELC QAG   + E +     E +S S   L F      + N+TL
Sbjct  183   IKHDQRFDFDRVPAVVELCRQAGTEVSSEIVIGDFDEAQSLSPSDLVF------VANKTL  236

Query  864   NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
              AWETLRSGV KLL VYP KVCKHCSEVHVGPSGHKARLCG+FKYESWR  HFW+KA VD
Sbjct  237   RAWETLRSGVQKLLFVYPSKVCKHCSEVHVGPSGHKARLCGIFKYESWRGTHFWKKAGVD  296

Query  684   DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKA  565
             DLVPP +VW RRPQDPP+LLDE RN+YGHAPAVVDLCTKA
Sbjct  297   DLVPPKMVWRRRPQDPPVLLDEWRNFYGHAPAVVDLCTKA  336


 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 70/164 (43%), Gaps = 6/164 (4%)
 Frame = -1

Query  1020  YSRISAVVELCLQAGANPNDESIDASKM-----EHESNSKIVLPFDQQMRLLGNETLNAW  856
             Y R S +V   L   A      +D  K+     +   N   V P  Q+M  L  E L   
Sbjct  49    YDRASEMVVGILGNFAGFYSSKVDWKKLRPMILKRVENRAKVYPI-QEMLPLAQEVLGVR  107

Query  855   ETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLV  676
               L  G+  L  V PV  CK C EV++G  GH  + C  ++     ++H W    ++D++
Sbjct  108   MLLIQGISILTRVIPVVACKFCPEVYIGEKGHLIKTCWGYRRGPKNQVHEWITGGLNDIL  167

Query  675   PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSK  544
              P   +        ++  + R  +   PAVV+LC +AG    S+
Sbjct  168   VPVETFRLDNMFQKIIKHDQRFDFDRVPAVVELCRQAGTEVSSE  211



>ref|XP_010488194.1| PREDICTED: APO protein 4, mitochondrial-like [Camelina sativa]
Length=338

 Score =   306 bits (785),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 179/246 (73%), Gaps = 3/246 (1%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EV+VG+ GHLI TC  Y  R  N+LH W+ GS++ IL+PVE++HLHN+ Q V
Sbjct  85    VLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEWVPGSINDILVPVESYHLHNISQGV  144

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE---SNSKIVLPFDQQMRLLGN  874
             I+H +RFDY R+ AV+ELC QAGA   +E +  SK+      S+  I       ++ +G 
Sbjct  145   IRHQQRFDYDRVPAVLELCCQAGAIHPEEILQYSKIHDNPRISDVDIRSLSAGDLKYVGA  204

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
               L AWE LR+GV KLLLVYP KVCK C EVHVGPSGHKARLCGVFKYESWR  H+WEKA
Sbjct  205   NALMAWEKLRAGVKKLLLVYPSKVCKRCKEVHVGPSGHKARLCGVFKYESWRGTHYWEKA  264

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGL  514
              V+DLVP  +VWHRRPQDP +LL++GRN+YGHAPA+V LC+ AGAI P KY C MK  GL
Sbjct  265   GVNDLVPEKVVWHRRPQDPMVLLNDGRNHYGHAPAIVSLCSHAGAIVPVKYACKMKPQGL  324

Query  513   SAPISD  496
             S P S 
Sbjct  325   SFPFSS  330


 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  + L A + L S V  LL V+PV  CK CSEV VG  GH    C  +      R+H W
Sbjct  61   VAEDILIARKNLISNVTALLKVFPVLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEW  120

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKV  523
               S++D++ P   +H       ++  + R  Y   PAV++LC +AGAI P +     K+
Sbjct  121  VPGSINDILVPVESYHLHNISQGVIRHQQRFDYDRVPAVLELCCQAGAIHPEEILQYSKI  180



>gb|KFK39492.1| hypothetical protein AALP_AA3G251000 [Arabis alpina]
Length=341

 Score =   305 bits (781),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/247 (59%), Positives = 184/247 (74%), Gaps = 5/247 (2%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EV+VG+ GHLI+TC  Y  R  N+LH W+ GS++ IL+PVE+FHL +M Q V
Sbjct  89    VLTCKFCSEVFVGKEGHLIQTCRSYIRRGNNRLHEWVPGSVNDILVPVESFHLDHMSQGV  148

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE---SNSKIV-LPFDQQMRLLG  877
             IKH +RFDY R+ AV+ELC QAGA   +E +  S++      S+  I  LP    ++ +G
Sbjct  149   IKHQQRFDYDRVPAVLELCCQAGAIHPEEILQYSEVHDNPQVSDEDIKNLPVGD-LQYVG  207

Query  876   NETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEK  697
                LNAWE +R+G+ KLLLVYP KVCK C+EVHVGPSGHKARLCGVFKYESWR  H+WEK
Sbjct  208   ANALNAWERVRAGLKKLLLVYPSKVCKRCNEVHVGPSGHKARLCGVFKYESWRGTHYWEK  267

Query  696   ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDG  517
             A V+DLVP  +VWHRRPQDP +L+DEGR+YYGHAPA+V LC+ AGAI P+KY C MK  G
Sbjct  268   AGVNDLVPEKVVWHRRPQDPVVLVDEGRSYYGHAPAIVSLCSHAGAIVPTKYACEMKPQG  327

Query  516   LSAPISD  496
             LS P + 
Sbjct  328   LSFPFTS  334


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E L A   L + V  LL V+PV  CK CSEV VG  GH  + C  +      R+H W
Sbjct  65   VAEEILKARHNLITNVTALLKVFPVLTCKFCSEVFVGKEGHLIQTCRSYIRRGNNRLHEW  124

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSK  544
               SV+D++ P   +H       ++  + R  Y   PAV++LC +AGAI P +
Sbjct  125  VPGSVNDILVPVESFHLDHMSQGVIKHQQRFDYDRVPAVLELCCQAGAIHPEE  177



>ref|XP_004976898.1| PREDICTED: APO protein 4, mitochondrial-like [Setaria italica]
Length=328

 Score =   303 bits (776),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 140/245 (57%), Positives = 181/245 (74%), Gaps = 8/245 (3%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CPEV++G  GH ++TC G++   K++ H W  G+L+ ILIPV+ FHL  MFQ+ IK
Sbjct  85    SCKFCPEVHIGATGHEMKTCHGFKRMIKDRPHKWGPGNLNDILIPVQAFHLREMFQDEIK  144

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESIDASKM------EHESNSKIVLPFDQQMRLLG  877
             H +RFDY+R+ AV+ELC QAGA+  DE +  S+        H      +LP   Q+R +G
Sbjct  145   HDQRFDYARVPAVLELCHQAGADIPDEVLYRSEQLSTTVRGHSQQPAPILP--DQLRYIG  202

Query  876   NETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEK  697
               TL+AWE+LR GV KLLLVYP KVC+HCSEVHVGPSGHKAR+CGVFK+E W+ +H W+K
Sbjct  203   QTTLDAWESLRLGVTKLLLVYPSKVCEHCSEVHVGPSGHKARMCGVFKFEGWKGMHKWKK  262

Query  696   ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDG  517
             A VDDLVP  IVWHRRP DPP+L+D GR+YYGHAPAV++LC + GA  P KY CMMK  G
Sbjct  263   AGVDDLVPQKIVWHRRPHDPPVLVDGGRDYYGHAPAVIELCMQVGARVPPKYHCMMKTHG  322

Query  516   LSAPI  502
             L+ P+
Sbjct  323   LAPPV  327


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 61/120 (51%), Gaps = 0/120 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            ++M  +  E + A E +  GV  LL   PV  CK C EVH+G +GH+ + C  FK     
Sbjct  54   KRMIPVAEEVMRAREIVTEGVSTLLKAVPVHSCKFCPEVHIGATGHEMKTCHGFKRMIKD  113

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            R H W   +++D++ P   +H R      +  + R  Y   PAV++LC +AGA  P +  
Sbjct  114  RPHKWGPGNLNDILIPVQAFHLREMFQDEIKHDQRFDYARVPAVLELCHQAGADIPDEVL  173



>ref|XP_010466431.1| PREDICTED: APO protein 4, mitochondrial [Camelina sativa]
Length=338

 Score =   303 bits (775),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 178/246 (72%), Gaps = 3/246 (1%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EV+VG+ GHLI TC  Y  R  N+LH W+ GS++ IL+PVE++HLHN+ Q V
Sbjct  85    VLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEWVPGSINDILVPVESYHLHNISQGV  144

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE---SNSKIVLPFDQQMRLLGN  874
             I+H +RFDY R+ A++ELC QAGA   +E +  SK+      S+  +       ++ +G 
Sbjct  145   IRHQQRFDYDRVPAILELCCQAGAVHPEEILQYSKIHDNPQISDEDVRSLPAGDLKYVGA  204

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
               L AWE LR+GV KLLLVYP KVCK C EVHVGPSGHKARLCGVFKYESW   H+WEKA
Sbjct  205   NALMAWEKLRAGVKKLLLVYPSKVCKRCKEVHVGPSGHKARLCGVFKYESWHGTHYWEKA  264

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGL  514
              V+DLVP  +VWHRRPQDP +LL++GRN+YGHAPA+V LC+ AGAI P KY C MK  GL
Sbjct  265   GVNDLVPEKVVWHRRPQDPMVLLNDGRNHYGHAPAIVSLCSHAGAIVPVKYACKMKPQGL  324

Query  513   SAPISD  496
             S P S 
Sbjct  325   SFPFSS  330


 Score = 70.5 bits (171),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  + L A + L S V  LL V+PV  CK CSEV VG  GH    C  +      R+H W
Sbjct  61   VAEDILIARKNLLSNVTALLKVFPVLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEW  120

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKV  523
               S++D++ P   +H       ++  + R  Y   PA+++LC +AGA+ P +     K+
Sbjct  121  VPGSINDILVPVESYHLHNISQGVIRHQQRFDYDRVPAILELCCQAGAVHPEEILQYSKI  180



>ref|XP_002885464.1| hypothetical protein ARALYDRAFT_318914 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61723.1| hypothetical protein ARALYDRAFT_318914 [Arabidopsis lyrata subsp. 
lyrata]
Length=337

 Score =   301 bits (771),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 178/246 (72%), Gaps = 3/246 (1%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EV+VG+ GHLI TC  Y  R  N+LH W+ GS++ IL+PVE++HLHN+ Q V
Sbjct  85    VLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEWVPGSINDILVPVESYHLHNISQGV  144

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE---SNSKIVLPFDQQMRLLGN  874
             I+H +RFDY R+ A++ELC QAGA   +E +  SK+      S+  I       ++ +G 
Sbjct  145   IRHQQRFDYDRVPAILELCCQAGAIHPEEILQYSKIHDNPQISDEDIRSLPAGDLKYVGT  204

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
                 AWE +R+GV KLLLVYP KVCK C EVHVGPSGHKARLCGVFKYESWR  H+WEKA
Sbjct  205   NAQMAWEKVRAGVKKLLLVYPSKVCKRCKEVHVGPSGHKARLCGVFKYESWRGTHYWEKA  264

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGL  514
              V+DLVP  +VWHRRPQDP +L+DEGR+YYGHAPA+V LC+ AGAI P KY C MK  GL
Sbjct  265   GVNDLVPEKVVWHRRPQDPVVLVDEGRSYYGHAPAIVSLCSHAGAIVPVKYACKMKPQGL  324

Query  513   SAPISD  496
             S   ++
Sbjct  325   SFSFTN  330


 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E L A + L S V  LL V+PV  CK CSEV VG  GH    C  +      R+H W
Sbjct  61   VAEEILIARKNLLSNVTALLKVFPVLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEW  120

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKV  523
               S++D++ P   +H       ++  + R  Y   PA+++LC +AGAI P +     K+
Sbjct  121  VPGSINDILVPVESYHLHNISQGVIRHQQRFDYDRVPAILELCCQAGAIHPEEILQYSKI  180



>ref|NP_001053956.1| Os04g0628000 [Oryza sativa Japonica Group]
 dbj|BAF15870.1| Os04g0628000 [Oryza sativa Japonica Group]
 gb|EAY95662.1| hypothetical protein OsI_17528 [Oryza sativa Indica Group]
 dbj|BAG89110.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE61737.1| hypothetical protein OsJ_16258 [Oryza sativa Japonica Group]
Length=327

 Score =   300 bits (769),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 179/244 (73%), Gaps = 4/244 (2%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CPEV++G  GH +++C G++   KNQ H W  G L+ ILIPVE+FHL N FQ+ IK
Sbjct  84    SCKFCPEVHIGAVGHEMQSCHGFKRMIKNQPHKWGPGCLNDILIPVESFHLENTFQDEIK  143

Query  1038  HHERFDYSRISAVVELCLQAGANPNDE----SIDASKMEHESNSKIVLPFDQQMRLLGNE  871
             H +RFD+ R+ AV+ELC QAGA+  DE    S  +S +  E++ K      +++R +G  
Sbjct  144   HDQRFDFPRVPAVLELCHQAGADIPDEVWHRSGTSSAIVRENDEKPAAFLPEELRFIGQR  203

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             T+ AWE LR GV KLLLVYP KVC+ CSEVHVG SGHKAR+CGVFK+E WR  H W+KA 
Sbjct  204   TIEAWERLRLGVTKLLLVYPSKVCERCSEVHVGLSGHKARMCGVFKFEGWRGKHKWKKAD  263

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             VDDLVPP IVWH+RP DPP+L+D GR+YYGHAPAV++LC + GA AP KY CMMK  GL+
Sbjct  264   VDDLVPPKIVWHQRPHDPPVLVDAGRDYYGHAPAVIELCMQVGARAPPKYHCMMKAQGLA  323

Query  510   APIS  499
              PI 
Sbjct  324   PPIK  327


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            ++M  +  E + A E +  GV  LL V P+  CK C EVH+G  GH+ + C  FK     
Sbjct  53   KRMIPVAEEVVKAREIVTKGVSTLLQVVPIHSCKFCPEVHIGAVGHEMQSCHGFKRMIKN  112

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            + H W    ++D++ P   +H        +  + R  +   PAV++LC +AGA  P + +
Sbjct  113  QPHKWGPGCLNDILIPVESFHLENTFQDEIKHDQRFDFPRVPAVLELCHQAGADIPDEVW  172



>emb|CAJ86368.1| OSIGBa0117N13.12 [Oryza sativa Indica Group]
 emb|CAJ86418.1| H0303G06.7 [Oryza sativa Indica Group]
Length=327

 Score =   300 bits (767),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 179/244 (73%), Gaps = 4/244 (2%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CPEV++G  GH +++C G++   KNQ H W  G L+ IL+PVE+FHL N FQ+ IK
Sbjct  84    SCKFCPEVHIGAVGHEMQSCHGFKRMIKNQPHKWGPGCLNDILVPVESFHLENTFQDEIK  143

Query  1038  HHERFDYSRISAVVELCLQAGANPNDE----SIDASKMEHESNSKIVLPFDQQMRLLGNE  871
             H +RFD+ R+ AV+ELC QAGA+  DE    S  +S +  E++ K      +++R +G  
Sbjct  144   HDQRFDFPRVPAVLELCHQAGADIPDEVWHRSGTSSAIVRENDEKPAAFLPEELRFIGQR  203

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             T+ AWE LR GV KLLLVYP KVC+ CSEVHVG SGHKAR+CGVFK+E WR  H W+KA 
Sbjct  204   TIEAWERLRLGVTKLLLVYPSKVCERCSEVHVGLSGHKARMCGVFKFEGWRGKHKWKKAD  263

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             VDDLVPP IVWH+RP DPP+L+D GR+YYGHAPAV++LC + GA AP KY CMMK  GL+
Sbjct  264   VDDLVPPKIVWHQRPHDPPVLVDAGRDYYGHAPAVIELCMQVGARAPPKYHCMMKAQGLA  323

Query  510   APIS  499
              PI 
Sbjct  324   PPIK  327


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            ++M  +  E + A E +  GV  LL V P+  CK C EVH+G  GH+ + C  FK     
Sbjct  53   KRMIPVAEEVVKAREIVTKGVSTLLQVVPIHSCKFCPEVHIGAVGHEMQSCHGFKRMIKN  112

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            + H W    ++D++ P   +H        +  + R  +   PAV++LC +AGA  P + +
Sbjct  113  QPHKWGPGCLNDILVPVESFHLENTFQDEIKHDQRFDFPRVPAVLELCHQAGADIPDEVW  172



>ref|NP_188811.2| APO protein 4 [Arabidopsis thaliana]
 sp|Q9LSZ0.2|APO4_ARATH RecName: Full=APO protein 4, mitochondrial; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAC42155.1| unknown protein [Arabidopsis thaliana]
 gb|ABF85786.1| At3g21740 [Arabidopsis thaliana]
 gb|AEE76547.1| APO protein 4 [Arabidopsis thaliana]
Length=337

 Score =   300 bits (768),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 177/246 (72%), Gaps = 3/246 (1%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EV+VG+ GHLI TC  Y  R  N+LH W+ GS++ IL+PVE++HLHN+ Q V
Sbjct  85    VLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEWVPGSINDILVPVESYHLHNISQGV  144

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE---SNSKIVLPFDQQMRLLGN  874
             I+H ERFDY R+ A++ELC QAGA   +E +  S++      S   I       ++ +G 
Sbjct  145   IRHQERFDYDRVPAILELCCQAGAIHPEEILQYSEIHDNPQISEEDIRSLPAGDLKYVGA  204

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
               L AWE +R+GV KLLLVYP KVCK C EVHVGPSGHKARLCGVFKYESWR  H+WEKA
Sbjct  205   NALMAWEKVRAGVKKLLLVYPSKVCKRCKEVHVGPSGHKARLCGVFKYESWRGTHYWEKA  264

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGL  514
              V+DLVP  +VWHRRPQDP +L+DEGR+YYGHAPA+V LC+  GAI P KY C MK  GL
Sbjct  265   GVNDLVPEKMVWHRRPQDPVVLVDEGRSYYGHAPAIVSLCSHTGAIVPVKYACKMKPQGL  324

Query  513   SAPISD  496
             S   ++
Sbjct  325   SFSFTN  330


 Score = 70.5 bits (171),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E L A + L S +  LL V+PV  CK CSEV VG  GH    C  +      R+H W
Sbjct  61   VAEEILIARKNLISNIAALLKVFPVLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEW  120

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSK  544
               S++D++ P   +H       ++  + R  Y   PA+++LC +AGAI P +
Sbjct  121  VPGSINDILVPVESYHLHNISQGVIRHQERFDYDRVPAILELCCQAGAIHPEE  173



>ref|XP_009145455.1| PREDICTED: APO protein 4, mitochondrial [Brassica rapa]
Length=331

 Score =   298 bits (764),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 185/247 (75%), Gaps = 4/247 (2%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EV+VG+ GHLI+TC  Y  R  N+LH W+ GS++ +L+PVE+FHLHNM Q V
Sbjct  85    VLRCKFCSEVFVGKEGHLIQTCRSYIRRGNNRLHEWVPGSINDVLVPVESFHLHNMSQGV  144

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE---SNSKIVLPFDQQMRLLGN  874
             I+H +RFDY R+ A++ELC QAGA   +E ++ +K+      S+  I     + ++ +G 
Sbjct  145   IRHQQRFDYDRVPAILELCCQAGAIHPEEILEYAKVHDNPQISDEDIRSIPTEDLKYVGA  204

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
               L AWE +R+G+ KLLLVYP KVCK C EVHVGPSGHKARLCGVFKYES++  H+WEKA
Sbjct  205   NALTAWEKVRAGLKKLLLVYPSKVCKRCKEVHVGPSGHKARLCGVFKYESYQGTHYWEKA  264

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA-IAPSKYFCMMKVDG  517
              V+DLVP  +VWHRRPQDP +L++EGRNYYGHAPAVV LC+ AGA ++ ++Y C MK  G
Sbjct  265   GVNDLVPEKVVWHRRPQDPLVLVNEGRNYYGHAPAVVSLCSHAGALVSNTRYACEMKPQG  324

Query  516   LSAPISD  496
             LS P+S+
Sbjct  325   LSYPLSN  331


 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            Q++  +  + L A + L + V  LL  +PV  CK CSEV VG  GH  + C  +      
Sbjct  56   QEIVPVAKDILKARQNLLTNVTVLLKAFPVLRCKFCSEVFVGKEGHLIQTCRSYIRRGNN  115

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            R+H W   S++D++ P   +H       ++  + R  Y   PA+++LC +AGAI P +  
Sbjct  116  RLHEWVPGSINDVLVPVESFHLHNMSQGVIRHQQRFDYDRVPAILELCCQAGAIHPEEIL  175

Query  537  CMMKV  523
               KV
Sbjct  176  EYAKV  180



>ref|XP_006652862.1| PREDICTED: APO protein 4, mitochondrial-like [Oryza brachyantha]
Length=327

 Score =   298 bits (763),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/246 (56%), Positives = 180/246 (73%), Gaps = 8/246 (3%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CPEV++G  GH +++C G++   K+Q H W  G L+ IL+PVE+FHL N FQ+ IK
Sbjct  84    SCKFCPEVHIGALGHQMKSCHGFKRMIKDQPHKWGPGCLNDILVPVESFHLENTFQDEIK  143

Query  1038  HHERFDYSRISAVVELCLQAGANPNDE------SIDASKMEHESNSKIVLPFDQQMRLLG  877
             H +RFD+ R+ AV+ELC QAGA+  DE      ++  +   ++ N    LP  +++R +G
Sbjct  144   HDQRFDFPRVPAVLELCNQAGADIPDEVWHTDGTLSTTVRGNDENPATFLP--EELRFIG  201

Query  876   NETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEK  697
               T+ AWE LR GV KLLLVYP KVC+HCSEVHVG SGHKAR+CGVFK++ WR  H W+K
Sbjct  202   QRTIEAWERLRLGVTKLLLVYPSKVCEHCSEVHVGLSGHKARMCGVFKFQGWRGKHKWKK  261

Query  696   ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDG  517
             A VDDLVPP IVWH+RP DPP+L+D GR+YYGHAPAV++LC + GA AP KY CMMK  G
Sbjct  262   AGVDDLVPPKIVWHQRPHDPPVLVDSGRDYYGHAPAVIELCMQVGARAPPKYHCMMKAQG  321

Query  516   LSAPIS  499
             L+ PI 
Sbjct  322   LAPPIK  327


 Score = 64.7 bits (156),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            ++M  +  E   A E +  GV  LL V PV  CK C EVH+G  GH+ + C  FK     
Sbjct  53   KRMIPVAEEVFEAREIVTRGVSALLQVVPVHSCKFCPEVHIGALGHQMKSCHGFKRMIKD  112

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            + H W    ++D++ P   +H        +  + R  +   PAV++LC +AGA  P + +
Sbjct  113  QPHKWGPGCLNDILVPVESFHLENTFQDEIKHDQRFDFPRVPAVLELCNQAGADIPDEVW  172



>emb|CDY38637.1| BnaA05g19500D [Brassica napus]
Length=331

 Score =   298 bits (763),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 185/247 (75%), Gaps = 4/247 (2%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EV+VG+ GHLI+TC  Y  R  N+LH W+ GS++ +L+PVE+FHLHNM Q V
Sbjct  85    VLRCKFCSEVFVGKEGHLIQTCRSYIRRGNNRLHEWVPGSINDVLVPVESFHLHNMSQGV  144

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE---SNSKIVLPFDQQMRLLGN  874
             I+H +RFDY R+ A++ELC QAGA   +E ++ +K+      S+  I     + ++ +G 
Sbjct  145   IRHQQRFDYDRVPAILELCCQAGAIHPEEILEYAKVHDNPQISDEDIRSIPTEDLKYVGA  204

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
               L AWE +R+G+ KLLLVYP KVCK C EVHVGPSGHKARLCGVFKYES++  H+WEKA
Sbjct  205   NALTAWEKVRAGLKKLLLVYPSKVCKRCKEVHVGPSGHKARLCGVFKYESYQGTHYWEKA  264

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA-IAPSKYFCMMKVDG  517
              V+DL+P  +VWHRRPQDP +L++EGRNYYGHAPAVV LC+ AGA ++ ++Y C MK  G
Sbjct  265   GVNDLIPEKVVWHRRPQDPLVLVNEGRNYYGHAPAVVSLCSHAGALVSNTRYACEMKPQG  324

Query  516   LSAPISD  496
             LS P+S+
Sbjct  325   LSYPLSN  331


 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 63/125 (50%), Gaps = 0/125 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            Q++  +  + L A + L + V  LL  +PV  CK CSEV VG  GH  + C  +      
Sbjct  56   QEIVPVAKDILKARQNLLTNVTVLLKAFPVLRCKFCSEVFVGKEGHLIQTCRSYIRRGNN  115

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            R+H W   S++D++ P   +H       ++  + R  Y   PA+++LC +AGAI P +  
Sbjct  116  RLHEWVPGSINDVLVPVESFHLHNMSQGVIRHQQRFDYDRVPAILELCCQAGAIHPEEIL  175

Query  537  CMMKV  523
               KV
Sbjct  176  EYAKV  180



>dbj|BAB02836.1| unnamed protein product [Arabidopsis thaliana]
Length=429

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 177/246 (72%), Gaps = 3/246 (1%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EV+VG+ GHLI TC  Y  R  N+LH W+ GS++ IL+PVE++HLHN+ Q V
Sbjct  177   VLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEWVPGSINDILVPVESYHLHNISQGV  236

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE---SNSKIVLPFDQQMRLLGN  874
             I+H ERFDY R+ A++ELC QAGA   +E +  S++      S   I       ++ +G 
Sbjct  237   IRHQERFDYDRVPAILELCCQAGAIHPEEILQYSEIHDNPQISEEDIRSLPAGDLKYVGA  296

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
               L AWE +R+GV KLLLVYP KVCK C EVHVGPSGHKARLCGVFKYESWR  H+WEKA
Sbjct  297   NALMAWEKVRAGVKKLLLVYPSKVCKRCKEVHVGPSGHKARLCGVFKYESWRGTHYWEKA  356

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGL  514
              V+DLVP  +VWHRRPQDP +L+DEGR+YYGHAPA+V LC+  GAI P KY C MK  GL
Sbjct  357   GVNDLVPEKMVWHRRPQDPVVLVDEGRSYYGHAPAIVSLCSHTGAIVPVKYACKMKPQGL  416

Query  513   SAPISD  496
             S   ++
Sbjct  417   SFSFTN  422


 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 58/113 (51%), Gaps = 0/113 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E L A + L S +  LL V+PV  CK CSEV VG  GH    C  +      R+H W
Sbjct  153  VAEEILIARKNLISNIAALLKVFPVLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEW  212

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSK  544
               S++D++ P   +H       ++  + R  Y   PA+++LC +AGAI P +
Sbjct  213  VPGSINDILVPVESYHLHNISQGVIRHQERFDYDRVPAILELCCQAGAIHPEE  265



>ref|XP_010510550.1| PREDICTED: APO protein 4, mitochondrial-like [Camelina sativa]
Length=338

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 176/246 (72%), Gaps = 3/246 (1%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EV+VG+ GHLI TC  Y  R  N+LH W+ GS++ IL PVE++HLHN+ Q V
Sbjct  85    VLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEWVPGSINDILAPVESYHLHNISQGV  144

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE---SNSKIVLPFDQQMRLLGN  874
             I+H +RFDY R+ A++ELC QAGA   +E +  SK+      S+  +       ++ +G 
Sbjct  145   IRHQQRFDYDRVPAILELCCQAGAIHPEEILQYSKIHDNPQISDEDVRSLPAGDLKYVGA  204

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
               L AWE LR+GV KLLLVYP KVCK C EVHVGPSGHKARLCGVFKYESW   H+WEKA
Sbjct  205   NALMAWEKLRAGVKKLLLVYPSKVCKRCKEVHVGPSGHKARLCGVFKYESWHGTHYWEKA  264

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGL  514
              V+DLVP  +VWHRRPQDP +LL++GRN+YGHAPA+V LC+ AGAI P KY   MK  GL
Sbjct  265   GVNDLVPEKVVWHRRPQDPMVLLNDGRNHYGHAPAIVRLCSHAGAIVPVKYARKMKPQGL  324

Query  513   SAPISD  496
             S P S 
Sbjct  325   SFPFSS  330


 Score = 72.0 bits (175),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 0/120 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  + L A + L S V  LL V+PV  CK CSEV VG  GH    C  +      R+H W
Sbjct  61   VAEDILIARKNLISNVTALLKVFPVLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEW  120

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKV  523
               S++D++ P   +H       ++  + R  Y   PA+++LC +AGAI P +     K+
Sbjct  121  VPGSINDILAPVESYHLHNISQGVIRHQQRFDYDRVPAILELCCQAGAIHPEEILQYSKI  180



>ref|XP_006279193.1| hypothetical protein CARUB_v10016518mg, partial [Capsella rubella]
 gb|EOA12091.1| hypothetical protein CARUB_v10016518mg, partial [Capsella rubella]
Length=332

 Score =   296 bits (757),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 140/243 (58%), Positives = 177/243 (73%), Gaps = 3/243 (1%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EV+VG+ GHLI TC  Y  R  N+LH W+ GS++ IL+PVE++HL N+ Q V
Sbjct  89    VLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEWVPGSINDILVPVESYHLDNISQGV  148

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE---SNSKIVLPFDQQMRLLGN  874
             I+H ERFDY R+ A++ELC QAGA   +E +  S++      S+  I      +++ +G 
Sbjct  149   IRHQERFDYDRVPAILELCCQAGAIHPEEILQYSQVHDNPQISDEDIRSLPAGELKYVGA  208

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
               L AWE LR+GV KLLLVY  KVCK C EVH+GPSGHKARLCGVFKYESWR  H+WEKA
Sbjct  209   NALMAWEKLRAGVKKLLLVYRSKVCKRCKEVHIGPSGHKARLCGVFKYESWRGTHYWEKA  268

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGL  514
              V+DLVP  +VWHRRPQDP +LL+EGR++YGHAPA+V LC+ AGAI P KY C MK  GL
Sbjct  269   GVNDLVPEKVVWHRRPQDPVVLLNEGRHHYGHAPAIVSLCSHAGAIVPVKYACKMKPQGL  328

Query  513   SAP  505
             S P
Sbjct  329   SFP  331


 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 59/120 (49%), Gaps = 0/120 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  + L A + L S V  LL V PV  CK CSEV VG  GH    C  +      R+H W
Sbjct  65   VAEDVLIARKYLLSDVTALLKVIPVLTCKFCSEVFVGKEGHLIETCRSYIRRGNNRLHEW  124

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKV  523
               S++D++ P   +H       ++  + R  Y   PA+++LC +AGAI P +     +V
Sbjct  125  VPGSINDILVPVESYHLDNISQGVIRHQERFDYDRVPAILELCCQAGAIHPEEILQYSQV  184



>ref|XP_010551030.1| PREDICTED: APO protein 4, mitochondrial-like [Tarenaya hassleriana]
 ref|XP_010551031.1| PREDICTED: APO protein 4, mitochondrial-like [Tarenaya hassleriana]
Length=303

 Score =   295 bits (754),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/241 (57%), Positives = 176/241 (73%), Gaps = 1/241 (0%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L+C+ CPEV+VG  GHLI TC  Y  R   +LH W++GS++ IL+PVE +HLH M Q +
Sbjct  59    VLSCKSCPEVFVGNEGHLIETCRCYLRRGNTRLHEWVQGSINDILVPVEAYHLHKMSQGI  118

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQ-MRLLGNET  868
             I+H +RFDY R+ AV+ELC QAGA  ++E ++ SK   + N+ +     ++ +  +   T
Sbjct  119   IRHQQRFDYDRVPAVLELCCQAGAIQHEEILELSKTYEDPNAPLHEDLSREDLTYVAAGT  178

Query  867   LNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASV  688
             L AWE LR+GV KLLL YP KVCK+CSEVHVGPSGHKARLCG+FKYE+WR  HFW+KA V
Sbjct  179   LRAWEALRAGVGKLLLAYPSKVCKNCSEVHVGPSGHKARLCGIFKYENWRGAHFWQKAGV  238

Query  687   DDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSA  508
             +DLVP   VWHRRP DP +LL+ GR+YYGHAPA+V LC+ AGA  P+KY   MK  GLS 
Sbjct  239   NDLVPRKQVWHRRPHDPRILLNGGRDYYGHAPAIVSLCSHAGAAVPTKYATEMKPHGLSF  298

Query  507   P  505
             P
Sbjct  299   P  299


 Score = 70.5 bits (171),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 55/112 (49%), Gaps = 0/112 (0%)
 Frame = -1

Query  891  MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
            M  +  E L A   L  GV  LL  +PV  CK C EV VG  GH    C  +      R+
Sbjct  32   MVPVAKEVLEARRVLIQGVSMLLKAFPVLSCKSCPEVFVGNEGHLIETCRCYLRRGNTRL  91

Query  711  HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAI  556
            H W + S++D++ P   +H       ++  + R  Y   PAV++LC +AGAI
Sbjct  92   HEWVQGSINDILVPVEAYHLHKMSQGIIRHQQRFDYDRVPAVLELCCQAGAI  143



>emb|CDY33138.1| BnaCnng07090D [Brassica napus]
Length=336

 Score =   295 bits (756),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 182/247 (74%), Gaps = 4/247 (2%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EV+VG+ GHLI+TC  Y  R  N+LH W+ GS+  +L PVE+FHLHNM Q V
Sbjct  85    VLRCKFCSEVFVGKEGHLIQTCRSYIRRGNNRLHEWVPGSIHDVLFPVESFHLHNMSQGV  144

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHE---SNSKIVLPFDQQMRLLGN  874
             I+H +RFDY R+ A++ELC QAGA   +E ++ +K+      S+  I     + ++ +G 
Sbjct  145   IRHQQRFDYDRVPAILELCCQAGAIHPEEILEYAKVHDNPQISDEDIRSIPTEDLKYVGA  204

Query  873   ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
               L AWE +R+G+ KLLLVYP KVCK C EVHVGPSGHKARLCGVFKYES++  H+WEKA
Sbjct  205   NALTAWEKVRAGLKKLLLVYPSKVCKRCKEVHVGPSGHKARLCGVFKYESYQGTHYWEKA  264

Query  693   SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA-IAPSKYFCMMKVDG  517
              V+DLVP  +VWHRRPQDP +L++EGRNYYGHAPAVV LC  AGA ++ ++Y C MK  G
Sbjct  265   GVNDLVPEKVVWHRRPQDPVVLVNEGRNYYGHAPAVVSLCIHAGALVSNTRYACEMKPQG  324

Query  516   LSAPISD  496
             LS P+S+
Sbjct  325   LSYPLSN  331


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 62/125 (50%), Gaps = 0/125 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            Q++  +  + L A + L + V  LL  +PV  CK CSEV VG  GH  + C  +      
Sbjct  56   QEIVPVAKDILKARQNLLTNVTVLLKAFPVLRCKFCSEVFVGKEGHLIQTCRSYIRRGNN  115

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            R+H W   S+ D++ P   +H       ++  + R  Y   PA+++LC +AGAI P +  
Sbjct  116  RLHEWVPGSIHDVLFPVESFHLHNMSQGVIRHQQRFDYDRVPAILELCCQAGAIHPEEIL  175

Query  537  CMMKV  523
               KV
Sbjct  176  EYAKV  180



>ref|XP_002447052.1| hypothetical protein SORBIDRAFT_06g027590 [Sorghum bicolor]
 gb|EES11380.1| hypothetical protein SORBIDRAFT_06g027590 [Sorghum bicolor]
Length=328

 Score =   295 bits (754),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 178/243 (73%), Gaps = 4/243 (2%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CPE ++G  GH ++TC G++   K++ H W  G+L+ IL+PV+ FH  NMF++ IK
Sbjct  85    SCKFCPEAHIGATGHQMKTCYGFKCMIKDRPHEWQPGNLNDILVPVQAFHQKNMFEDEIK  144

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESIDASKMEHES----NSKIVLPFDQQMRLLGNE  871
             H +RFD++R+ AV+ELC  AGA+  DE +  S+   ++    N +  L    ++R +G  
Sbjct  145   HDQRFDFTRVPAVLELCHHAGADIPDEILYKSEQISDTLKTNNQQSALILPDELRYIGQR  204

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             TL+AWE LR GV KLLLVYP KVCKHCSEVH+G SGHKAR+CGVFK+E W+ +H W KA 
Sbjct  205   TLDAWEYLRLGVTKLLLVYPSKVCKHCSEVHIGQSGHKARMCGVFKFEGWKGMHKWNKAG  264

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             VDDLVP  IVWHRRP DPP+L+D GR+YYGHAPAV++LC + GAI P KY CMMK  GL+
Sbjct  265   VDDLVPQKIVWHRRPHDPPVLVDGGRDYYGHAPAVIELCMQVGAIVPPKYHCMMKTHGLA  324

Query  510   API  502
              P+
Sbjct  325   PPV  327


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/120 (32%), Positives = 64/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            ++M  +  E + A E +  GV +LL V PV+ CK C E H+G +GH+ + C  FK     
Sbjct  54   KRMIPVAEEVVRAREIVNEGVSRLLKVVPVQSCKFCPEAHIGATGHQMKTCYGFKCMIKD  113

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            R H W+  +++D++ P   +H++      +  + R  +   PAV++LC  AGA  P +  
Sbjct  114  RPHEWQPGNLNDILVPVQAFHQKNMFEDEIKHDQRFDFTRVPAVLELCHHAGADIPDEIL  173



>ref|XP_010909792.1| PREDICTED: APO protein 4, mitochondrial [Elaeis guineensis]
Length=285

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 175/239 (73%), Gaps = 4/239 (2%)
 Frame = -1

Query  1212  RYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKHH  1033
             R+CPEV +G+ G+ I++  GY+   K+Q H W+ G L+ IL PVE FHL NMFQ++IKH 
Sbjct  46    RFCPEVNIGDTGYQIKSYYGYKRIIKDQPHRWVDGHLNDILAPVEAFHLQNMFQSIIKHD  105

Query  1032  ERFDYSRISAVVELCLQAGANPNDESI-DASKMEHESNSKIVLPFD---QQMRLLGNETL  865
             +RFD+ R+  VVELC  AGA+ +DE + +   + + S     + F    ++  L+   TL
Sbjct  106   QRFDFDRVPTVVELCYHAGADVSDEVLHNHIPVPNSSKDDASVTFSGSLEEWSLVAQRTL  165

Query  864   NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
             +AWE LR GV KLLLVYP KVC+HC EVHVGPSGHKARLCGVFK+ESWR  H W+KA VD
Sbjct  166   DAWERLRIGVQKLLLVYPAKVCEHCLEVHVGPSGHKARLCGVFKFESWRGSHMWKKAEVD  225

Query  684   DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSA  508
             DLVPP +VWH RP DPP+L+D  R++YGHAPAVV+LC +AGA  PSKYFCMMKV GL+ 
Sbjct  226   DLVPPKLVWHPRPHDPPVLVDSERSFYGHAPAVVELCMQAGARVPSKYFCMMKVHGLTT  284


 Score = 60.8 bits (146),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C EV+VG +GH  R CG ++  +    H+W K  +D ++ P   +H       V+  
Sbjct  187   CEHCLEVHVGPSGHKARLCGVFKFESWRGSHMWKKAEVDDLVPPKLVWHPRPHDPPVLVD  246

Query  1035  HERFDYSRISAVVELCLQAGA  973
              ER  Y    AVVELC+QAGA
Sbjct  247   SERSFYGHAPAVVELCMQAGA  267



>gb|AGT17276.1| hypothetical protein SHCRBa_020_L15_F_200 [Saccharum hybrid cultivar 
R570]
Length=328

 Score =   293 bits (750),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 179/243 (74%), Gaps = 4/243 (2%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CPE ++G  GH ++TC G++   K++ H W  G+L+ IL+PV+ FH  NMF++ IK
Sbjct  85    SCKFCPEAHIGATGHQMKTCYGFKRMIKDRPHEWQPGNLNDILVPVQAFHQKNMFEDEIK  144

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESIDASKM---EHESNSKIVLPF-DQQMRLLGNE  871
             H +RFD++R+ AV+ELC  AGA+  DE +  S+      +SN++   PF   ++R +G  
Sbjct  145   HDQRFDFTRVPAVLELCHHAGADIPDEILYKSEQIFNTLKSNNQQSAPFLPDELRYIGQR  204

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             TL+AWE LR GV KLLLVYP KVCKHCSEVH+G SGHKAR+CGVF +E W+ +H W KA 
Sbjct  205   TLDAWEYLRLGVTKLLLVYPSKVCKHCSEVHIGQSGHKARMCGVFNFEGWKGMHKWNKAG  264

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             VDDLVP  IVWHRRP DPP+L+D GR+YYGHAPAV++LC + GA+ P KY CMMK  GL+
Sbjct  265   VDDLVPQKIVWHRRPHDPPVLVDGGRDYYGHAPAVIELCMQVGAVVPPKYHCMMKTHGLA  324

Query  510   API  502
              P+
Sbjct  325   PPV  327


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 64/118 (54%), Gaps = 0/118 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            ++M  +  E + A E +  GV +LL V PV+ CK C E H+G +GH+ + C  FK     
Sbjct  54   KRMIPVAEEVVRAREIVNEGVSRLLKVVPVQSCKFCPEAHIGATGHQMKTCYGFKRMIKD  113

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSK  544
            R H W+  +++D++ P   +H++      +  + R  +   PAV++LC  AGA  P +
Sbjct  114  RPHEWQPGNLNDILVPVQAFHQKNMFEDEIKHDQRFDFTRVPAVLELCHHAGADIPDE  171



>ref|XP_002448571.1| hypothetical protein SORBIDRAFT_06g029350 [Sorghum bicolor]
 gb|EES12899.1| hypothetical protein SORBIDRAFT_06g029350 [Sorghum bicolor]
Length=328

 Score =   293 bits (749),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/245 (55%), Positives = 178/245 (73%), Gaps = 8/245 (3%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CPEV++G  GH ++TC G++   K++ H W   +L+ IL+PV+ FH  NMF+  IK
Sbjct  85    SCKFCPEVHIGATGHQMKTCYGFKRMIKDRPHEWDPSNLNDILVPVQAFHQKNMFETEIK  144

Query  1038  HHERFDYSRISAVVELCLQAGANPNDE------SIDASKMEHESNSKIVLPFDQQMRLLG  877
             H++RFD++R+ AV+ELC  AGAN  DE       I  +   +   S  +LP   ++R +G
Sbjct  145   HNQRFDFTRVPAVLELCHHAGANIPDEILYKSEQIPTTLKTNNQQSSPILP--DELRYIG  202

Query  876   NETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEK  697
               TL+AWE+LR GV KLLLVYP KVCKHCSEVH+G SGHKAR+CGVFK+E W+ +H W+K
Sbjct  203   QRTLDAWESLRLGVTKLLLVYPSKVCKHCSEVHIGQSGHKARMCGVFKFEGWKGMHRWDK  262

Query  696   ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDG  517
             A VDDLV   IVWHRRP DPP+L+D GR+YYGHAPAV++LC + GAI P KY CMMK  G
Sbjct  263   AGVDDLVHQKIVWHRRPHDPPVLVDGGRDYYGHAPAVIELCMQVGAIVPPKYHCMMKTHG  322

Query  516   LSAPI  502
             L+ P+
Sbjct  323   LAPPV  327


 Score = 73.2 bits (178),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 65/120 (54%), Gaps = 0/120 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            ++M  +  E + A E +  GV +LL V PV+ CK C EVH+G +GH+ + C  FK     
Sbjct  54   KRMIPVAEEVVRAREVVYEGVSRLLKVVPVQSCKFCPEVHIGATGHQMKTCYGFKRMIKD  113

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            R H W+ ++++D++ P   +H++      +    R  +   PAV++LC  AGA  P +  
Sbjct  114  RPHEWDPSNLNDILVPVQAFHQKNMFETEIKHNQRFDFTRVPAVLELCHHAGANIPDEIL  173



>gb|ACR37735.1| unknown [Zea mays]
 gb|ACR37849.1| unknown [Zea mays]
 tpg|DAA36165.1| TPA: hypothetical protein ZEAMMB73_204749 [Zea mays]
Length=250

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 176/244 (72%), Gaps = 8/244 (3%)
 Frame = -1

Query  1212  RYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKHH  1033
             R+C EV++G  GH ++TC G++   K++ H W  G+L+ IL+PV+ FH  NMF++ IKH 
Sbjct  9     RFCHEVHIGTTGHQMKTCYGFKRMIKDRPHEWEPGNLNDILVPVQAFHQKNMFEHEIKHD  68

Query  1032  ERFDYSRISAVVELCLQAGANPNDE------SIDASKMEHESNSKIVLPFDQQMRLLGNE  871
             +RFD++R+ AV+ELC  AGA+  DE       +  +   +   S  +LP   ++R +G +
Sbjct  69    QRFDFTRVPAVLELCHHAGADIPDEILYRSGQMSTTLKTNNQQSAPILP--DELRYIGQK  126

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             TL+AWE LR G  KLLLVYP KVCKHCSEVH+G SGHKAR+CGVFK+E W+ +H W KA 
Sbjct  127   TLDAWENLRLGATKLLLVYPSKVCKHCSEVHIGQSGHKARMCGVFKFEGWKGMHKWNKAG  186

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             VDDLVP NIVWHRRP DPP+L+D GR+YYGHAPAVV+LC + GAI P KY CMMK  GL+
Sbjct  187   VDDLVPQNIVWHRRPHDPPVLVDGGRDYYGHAPAVVELCMQVGAIVPPKYHCMMKTHGLA  246

Query  510   APIS  499
              P+ 
Sbjct  247   PPVG  250


 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 42/81 (52%), Gaps = 0/81 (0%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++C EV++G++GH  R CG ++      +H W K  +D ++     +H       V+  
Sbjct  150   CKHCSEVHIGQSGHKARMCGVFKFEGWKGMHKWNKAGVDDLVPQNIVWHRRPHDPPVLVD  209

Query  1035  HERFDYSRISAVVELCLQAGA  973
               R  Y    AVVELC+Q GA
Sbjct  210   GGRDYYGHAPAVVELCMQVGA  230



>ref|NP_001143703.1| hypothetical protein [Zea mays]
 gb|ACG34370.1| hypothetical protein [Zea mays]
 gb|ACN34039.1| unknown [Zea mays]
 tpg|DAA36166.1| TPA: hypothetical protein ZEAMMB73_204749 [Zea mays]
Length=328

 Score =   292 bits (747),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 178/246 (72%), Gaps = 8/246 (3%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++C EV++G  GH ++TC G++   K++ H W  G+L+ IL+PV+ FH  NMF++ IK
Sbjct  85    SCKFCHEVHIGTTGHQMKTCYGFKRMIKDRPHEWEPGNLNDILVPVQAFHQKNMFEHEIK  144

Query  1038  HHERFDYSRISAVVELCLQAGANPNDE------SIDASKMEHESNSKIVLPFDQQMRLLG  877
             H +RFD++R+ AV+ELC  AGA+  DE       +  +   +   S  +LP   ++R +G
Sbjct  145   HDQRFDFTRVPAVLELCHHAGADIPDEILYRSGQMSTTLKTNNQQSAPILP--DELRYIG  202

Query  876   NETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEK  697
              +TL+AWE LR G  KLLLVYP KVCKHCSEVH+G SGHKAR+CGVFK+E W+ +H W K
Sbjct  203   QKTLDAWENLRLGATKLLLVYPSKVCKHCSEVHIGQSGHKARMCGVFKFEGWKGMHKWNK  262

Query  696   ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDG  517
             A VDDLVP NIVWHRRP DPP+L+D GR+YYGHAPAVV+LC + GAI P KY CMMK  G
Sbjct  263   AGVDDLVPQNIVWHRRPHDPPVLVDGGRDYYGHAPAVVELCMQVGAIVPPKYHCMMKTHG  322

Query  516   LSAPIS  499
             L+ P+ 
Sbjct  323   LAPPVG  328


 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 64/120 (53%), Gaps = 0/120 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  +  E + A E +  GV +LL V PV+ CK C EVH+G +GH+ + C  FK     
Sbjct  54   KSMIPVAEEVVRAREIVNEGVSRLLKVVPVQSCKFCHEVHIGTTGHQMKTCYGFKRMIKD  113

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
            R H WE  +++D++ P   +H++      +  + R  +   PAV++LC  AGA  P +  
Sbjct  114  RPHEWEPGNLNDILVPVQAFHQKNMFEHEIKHDQRFDFTRVPAVLELCHHAGADIPDEIL  173



>ref|XP_006836549.1| hypothetical protein AMTR_s00131p00039570 [Amborella trichopoda]
 gb|ERM99402.1| hypothetical protein AMTR_s00131p00039570 [Amborella trichopoda]
Length=373

 Score =   292 bits (748),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 144/287 (50%), Positives = 179/287 (62%), Gaps = 53/287 (18%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++C EVYVGE GH IRTC GYR   K QLH WI G  + IL+PV+ +HL  MFQ+VIKH
Sbjct  84    CKFCSEVYVGEEGHQIRTCCGYRRGAKKQLHRWINGGFEHILVPVDAYHLRTMFQDVIKH  143

Query  1035  HERFDYSRISAVVELCLQAGANP----------------------------------NDE  958
              ERFDY RI AV+ELC QAGA+                                   N  
Sbjct  144   DERFDYERIPAVLELCDQAGASISSAHDNHSMSSNGLNHSHSHSHSGDGLSLIIEQCNQT  203

Query  957   SIDASKMEHESNSK-------------------IVLPFDQQMRLLGNETLNAWETLRSGV  835
               D SK  H  +SK                    ++   ++++ +   TL+AWE +R G+
Sbjct  204   VADISKTLHNFSSKESSHDLHHSNGSSSVKSFGDLVGLPEELQSIAQRTLDAWERMRLGI  263

Query  834   HKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH  655
              KL+LVYPVKVCK+C EVHVGPSGHK RLCG+F++E WR  HFW+KA +DDLVPP +VWH
Sbjct  264   KKLMLVYPVKVCKYCGEVHVGPSGHKVRLCGLFRHEPWRGGHFWKKADLDDLVPPQVVWH  323

Query  654   RRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGL  514
             RRPQDP +LLD GR++YGHAPAVV+LC + GA  P+KYFCMMK +GL
Sbjct  324   RRPQDPCVLLDNGRSFYGHAPAVVELCAQGGATVPTKYFCMMKNNGL  370


 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/119 (32%), Positives = 62/119 (52%), Gaps = 0/119 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  + N+ L A   +  GV  L+   PVK CK CSEV+VG  GH+ R C  ++  + +
Sbjct  52   RNMVPVANDVLKARGEVVDGVSTLIKFIPVKACKFCSEVYVGEEGHQIRTCCGYRRGAKK  111

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKY  541
            ++H W     + ++ P   +H R     ++  + R  Y   PAV++LC +AGA   S +
Sbjct  112  QLHRWINGGFEHILVPVDAYHLRTMFQDVIKHDERFDYERIPAVLELCDQAGASISSAH  170



>ref|XP_007199896.1| hypothetical protein PRUPE_ppa007230mg [Prunus persica]
 gb|EMJ01095.1| hypothetical protein PRUPE_ppa007230mg [Prunus persica]
Length=377

 Score =   291 bits (746),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 141/245 (58%), Positives = 180/245 (73%), Gaps = 16/245 (7%)
 Frame = -1

Query  1209  YCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKHHE  1030
             +CPEVY+GE GHLI+TC G++HR KN++H WI G L+ +L PVE FHL +MF++VIKHH+
Sbjct  80    FCPEVYIGEKGHLIQTCCGFKHRDKNRVHEWITGGLNDVLAPVEAFHLKHMFKDVIKHHQ  139

Query  1029  RFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIV-----LPFDQQMRLLGNETL  865
             RFD+ R+ AVVELC QAGAN  ++    S    ES+   V     LP D ++ ++ + TL
Sbjct  140   RFDFERVPAVVELCWQAGANDENQY---SNWNPESDCFSVDGAESLPSD-ELLMIASGTL  195

Query  864   NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
              AWE LR+GV KLL VYP KVC HCSEVH+GPSGHKARL       SW+  HFW KA+VD
Sbjct  196   RAWEILRNGVEKLLTVYPAKVCNHCSEVHIGPSGHKARL-------SWQGTHFWRKANVD  248

Query  684   DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAP  505
             DL+PP IVW RR QDP +LL+EGR +YGHAPAVV+LCT+AGA+AP KY C+MK+ G++  
Sbjct  249   DLMPPKIVWRRRLQDPQVLLNEGRGFYGHAPAVVELCTQAGAVAPLKYHCLMKLQGVATL  308

Query  504   ISDKP  490
              +  P
Sbjct  309   GNQTP  313



>ref|XP_006406612.1| hypothetical protein EUTSA_v10021082mg [Eutrema salsugineum]
 ref|XP_006406613.1| hypothetical protein EUTSA_v10021082mg [Eutrema salsugineum]
 gb|ESQ48065.1| hypothetical protein EUTSA_v10021082mg [Eutrema salsugineum]
 gb|ESQ48066.1| hypothetical protein EUTSA_v10021082mg [Eutrema salsugineum]
Length=338

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 179/248 (72%), Gaps = 8/248 (3%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C++C EV+VG+ GHLI+TC  Y  R   +LH W+ GS++ IL+PVE+FHL NM Q V
Sbjct  85    VLTCKFCSEVFVGKEGHLIQTCRSYIRRGNTKLHEWVPGSINDILVPVESFHLRNMHQGV  144

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKME-----HESNSKIVLPFDQQMRLL  880
             I+H +RFDY R+ AV+ELC QAGA   +E +  S+        + + + + P D  ++ +
Sbjct  145   IRHQQRFDYDRVPAVLELCCQAGAIHPEEILQYSRFHDNPQISDEDMRSISPED--LKYV  202

Query  879   GNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWE  700
             G   L AWE +R+G+ KLLLVYP KVCK C EVHVGPSGHKARLCGVFKYES+   H+WE
Sbjct  203   GASALMAWERVRAGLKKLLLVYPSKVCKRCKEVHVGPSGHKARLCGVFKYESYHGTHYWE  262

Query  699   KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA-IAPSKYFCMMKV  523
             KA V+DLVP  +VWHRRPQDP +L+DEGR+YYGHAPA+V LC+ AGA +  +KY C MK 
Sbjct  263   KAGVNDLVPEKVVWHRRPQDPVVLVDEGRSYYGHAPAIVSLCSHAGALVCNTKYACEMKP  322

Query  522   DGLSAPIS  499
              GLS P +
Sbjct  323   QGLSFPFT  330


 Score = 72.8 bits (177),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 60/113 (53%), Gaps = 0/113 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  + L A   L + V+ LL V+PV  CK CSEV VG  GH  + C  +      ++H W
Sbjct  61   VAQDILEARRNLLANVNVLLKVFPVLTCKFCSEVFVGKEGHLIQTCRSYIRRGNTKLHEW  120

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSK  544
               S++D++ P   +H R     ++  + R  Y   PAV++LC +AGAI P +
Sbjct  121  VPGSINDILVPVESFHLRNMHQGVIRHQQRFDYDRVPAVLELCCQAGAIHPEE  173



>ref|XP_008237745.1| PREDICTED: APO protein 4, mitochondrial-like [Prunus mume]
Length=327

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 180/244 (74%), Gaps = 16/244 (7%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C++CPEVY+GE GHLI+TC G++HR KN++H WI G L+ +L PVE FHL +MF++V
Sbjct  82    VMACKFCPEVYIGEKGHLIQTCCGFKHRDKNRVHEWITGGLNDVLAPVEAFHLKHMFKDV  141

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIV-----LPFDQQMRLL  880
             IKHH+RFD+ R+ AVVELC QAGAN  +     S    ES+   V     LP D+ + ++
Sbjct  142   IKHHQRFDFERVPAVVELCWQAGANDENRY---SNWNPESDCFSVDGAESLPSDELL-MI  197

Query  879   GNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWE  700
              + TL A E LR+GV KLL VYP KVC HCSEVH+GPSGHKARL       SW+  HFW 
Sbjct  198   ASGTLRAREILRNGVEKLLTVYPAKVCNHCSEVHIGPSGHKARL-------SWQGTHFWR  250

Query  699   KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             KA+VDDL+PP IVW RR QDP +LL+EGR +YGHAPAVV+LCT+AGA+AP KY C+MK+ 
Sbjct  251   KANVDDLMPPKIVWRRRLQDPHVLLNEGRGFYGHAPAVVELCTQAGAVAPLKYHCLMKLQ  310

Query  519   GLSA  508
             G++ 
Sbjct  311   GVAT  314


 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/119 (34%), Positives = 61/119 (51%), Gaps = 0/119 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            Q M  +  E LN+   +  GV  LL V PV  CK C EV++G  GH  + C  FK+    
Sbjct  53   QGMIPVAQEVLNSRRLIMQGVSTLLKVLPVMACKFCPEVYIGEKGHLIQTCCGFKHRDKN  112

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKY  541
            R+H W    ++D++ P   +H +     ++    R  +   PAVV+LC +AGA   ++Y
Sbjct  113  RVHEWITGGLNDVLAPVEAFHLKHMFKDVIKHHQRFDFERVPAVVELCWQAGANDENRY  171



>ref|XP_003580603.1| PREDICTED: APO protein 4, mitochondrial [Brachypodium distachyon]
 ref|XP_010240466.1| PREDICTED: APO protein 4, mitochondrial [Brachypodium distachyon]
Length=332

 Score =   288 bits (738),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/244 (56%), Positives = 177/244 (73%), Gaps = 4/244 (2%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CPE++VG   H ++TC G++H  K++ H W  G L++IL+PVE FHL NMFQ+ IK
Sbjct  84    SCKFCPEIHVGAEAHQMKTCHGFKHMIKDRPHTWGPGCLNNILVPVEAFHLENMFQDEIK  143

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESI---DASKMEHESNSKIVLPFD-QQMRLLGNE  871
             H +RFD++R+ AV+ELC QAGA   D  +          +SNS+   P    ++RL+G  
Sbjct  144   HDQRFDFNRVPAVLELCHQAGAEIPDGVLYRRGELSTTAKSNSQNHAPLSLDELRLIGQR  203

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             TL AWE LR GV KLLLVYP KVC++CSEVHVG SGHKAR+CGVFK+E WR  H W+KA 
Sbjct  204   TLEAWERLRLGVTKLLLVYPSKVCENCSEVHVGLSGHKARMCGVFKFEGWRGKHKWKKAG  263

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             V+DLVP NIVWH+RP DP +L+D GR+YYGHAPAV++LC + GA AP +Y CMMK  GL+
Sbjct  264   VEDLVPQNIVWHQRPHDPLILVDSGRDYYGHAPAVIELCVQVGARAPRQYRCMMKEHGLA  323

Query  510   APIS  499
              P  
Sbjct  324   PPFQ  327


 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 58/116 (50%), Gaps = 0/116 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            ++M  +  E + A E L  GV  LL V PV  CK C E+HVG   H+ + C  FK+    
Sbjct  53   KRMIPVAEEVVRAREILTEGVSTLLRVVPVHSCKFCPEIHVGAEAHQMKTCHGFKHMIKD  112

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            R H W    +++++ P   +H        +  + R  +   PAV++LC +AGA  P
Sbjct  113  RPHTWGPGCLNNILVPVEAFHLENMFQDEIKHDQRFDFNRVPAVLELCHQAGAEIP  168



>gb|EMT11106.1| hypothetical protein F775_07337 [Aegilops tauschii]
Length=332

 Score =   283 bits (725),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 177/247 (72%), Gaps = 10/247 (4%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CPE++VG   H +++C G++   K++ H W  G L++IL+PVE FH  NMFQ+ I+
Sbjct  84    SCKFCPEIHVGAMAHQMKSCHGFKRMIKDRPHQWGPGGLNNILVPVEAFHQENMFQDEIR  143

Query  1038  HHERFDYSRISAVVELCLQAGAN-------PNDESIDASKMEHESNSKIVLPFDQQMRLL  880
             H +RFD++R+ AV+ELC QAGA          DE   A++  +++ + +      ++RL+
Sbjct  144   HDQRFDFTRVPAVLELCHQAGAELPEGLLYRRDELCTAAEANNQNPAPL---LSSELRLV  200

Query  879   GNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWE  700
             G  TL AWE LR GV KLLLVYP KVC++CSEVHVG SGHKAR+CGVFK+E WR  H W+
Sbjct  201   GQRTLEAWERLRLGVTKLLLVYPSKVCENCSEVHVGISGHKARMCGVFKFEGWRGKHKWK  260

Query  699   KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             KA VDDLVP  IVWH+RP DPP+L+D GR+YYGHAPAVV+LC + GA A  KY CMMK  
Sbjct  261   KAGVDDLVPQKIVWHQRPHDPPILVDSGRDYYGHAPAVVELCVQVGARASPKYNCMMKEH  320

Query  519   GLSAPIS  499
             GL+ P+ 
Sbjct  321   GLAPPVQ  327


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 58/117 (50%), Gaps = 0/117 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            ++M  +  E + A E L  GV  LL   PV+ CK C E+HVG   H+ + C  FK     
Sbjct  53   KRMIPVAQEVVRAREILTEGVSILLRAVPVQSCKFCPEIHVGAMAHQMKSCHGFKRMIKD  112

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            R H W    +++++ P   +H+       +  + R  +   PAV++LC +AGA  P 
Sbjct  113  RPHQWGPGGLNNILVPVEAFHQENMFQDEIRHDQRFDFTRVPAVLELCHQAGAELPE  169



>gb|EMS51284.1| hypothetical protein TRIUR3_05793 [Triticum urartu]
Length=332

 Score =   283 bits (723),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 132/247 (53%), Positives = 176/247 (71%), Gaps = 10/247 (4%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CP ++VG   H ++TC G++   K++ H W  G L++IL+PVE FH  NMFQ+ I+
Sbjct  84    SCKFCPAIHVGAMAHQMKTCHGFKRMIKDRPHQWGPGGLNNILVPVEAFHQENMFQDEIR  143

Query  1038  HHERFDYSRISAVVELCLQAGAN-------PNDESIDASKMEHESNSKIVLPFDQQMRLL  880
             H +RFD++R+ AV+ELC QAGA          DE   A++  +++ + +      ++RL+
Sbjct  144   HDQRFDFTRVPAVLELCHQAGAELPEGLLYRRDELCTAAEANNQNPAPL---LSSELRLV  200

Query  879   GNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWE  700
             G  TL AWE LR GV KLLLVYP KVC++CSEVHVG SGHKAR+CGVFK+E WR  H W+
Sbjct  201   GQRTLEAWERLRLGVTKLLLVYPSKVCENCSEVHVGISGHKARMCGVFKFEGWRGKHKWK  260

Query  699   KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             KA VDDLVP  IVWH+RP DPP+L+D GR+YYGHAPAVV+LC + GA A  KY CMMK  
Sbjct  261   KAGVDDLVPQKIVWHQRPHDPPILVDSGRDYYGHAPAVVELCVQVGARASPKYNCMMKEH  320

Query  519   GLSAPIS  499
             GL+ P+ 
Sbjct  321   GLAPPVQ  327


 Score = 62.0 bits (149),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 56/117 (48%), Gaps = 0/117 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            ++M  +  E + A E L  GV  LL   PV  CK C  +HVG   H+ + C  FK     
Sbjct  53   KRMIPVAQEVVRAREILTEGVSILLRAVPVHSCKFCPAIHVGAMAHQMKTCHGFKRMIKD  112

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            R H W    +++++ P   +H+       +  + R  +   PAV++LC +AGA  P 
Sbjct  113  RPHQWGPGGLNNILVPVEAFHQENMFQDEIRHDQRFDFTRVPAVLELCHQAGAELPE  169



>ref|XP_010248590.1| PREDICTED: APO protein 4, mitochondrial isoform X3 [Nelumbo nucifera]
Length=324

 Score =   279 bits (714),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/242 (56%), Positives = 166/242 (69%), Gaps = 42/242 (17%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++CPEV++GE GH+I+TC GY+ R KNQLH WI                          
Sbjct  97    CKFCPEVFIGERGHMIQTCHGYKRRAKNQLHEWIN-------------------------  131

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDA-----SKMEHESNSKIVLPFDQQMRLLGNE  871
                        VVELC QAGA+ NDE++D+        +HE  + + L  D+ MR +  E
Sbjct  132   -----------VVELCCQAGAHINDENLDSIIWTPDTSKHEVFNAVPLSQDE-MRFVAKE  179

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             TL AWE LRSGV KLLLVYP KVCK+CSEVHVGPSGH+ARLCGVFK+E WR IHFW++A 
Sbjct  180   TLGAWERLRSGVQKLLLVYPAKVCKYCSEVHVGPSGHRARLCGVFKHEGWRGIHFWKRAK  239

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             VDD VPP IVW RRPQDPP+LLD+GR++YGHAPAVV+LC +AGAI P+KYFCMMK+ GL+
Sbjct  240   VDDFVPPKIVWRRRPQDPPVLLDKGRDFYGHAPAVVELCLQAGAIVPTKYFCMMKMQGLA  299

Query  510   AP  505
              P
Sbjct  300   PP  301



>dbj|BAK06104.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=331

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/247 (54%), Positives = 176/247 (71%), Gaps = 11/247 (4%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CPE++VG   H + TC G++   K++ H W  G L++I++PVE FH  NMFQ+ I+
Sbjct  84    SCKFCPEIHVGAMAHQMNTCHGFKRMIKDRPHQWGPGGLNNIIVPVEAFHQENMFQDEIR  143

Query  1038  HHERFDYSRISAVVELCLQAGAN-------PNDESIDASKMEHESNSKIVLPFDQQMRLL  880
             H +RFD++R+ AV+ELC QAGA          DE   A+K  ++S +  + P   ++RL+
Sbjct  144   HDQRFDFTRVPAVLELCHQAGAELPEGLLYRRDELCTAAKANNQSPA--LRP--DELRLV  199

Query  879   GNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWE  700
             G  TL AWE LR GV KLLLVYP KVC++CSEVHVG SGHKAR+CGVFK+E WR  H W+
Sbjct  200   GQRTLEAWERLRLGVTKLLLVYPSKVCENCSEVHVGISGHKARMCGVFKFEGWRGKHRWK  259

Query  699   KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             KA VDDLVP  IVWH+RP DPP+L+  GR+YYGHAPAVV+LC + GA A  KY CMMK  
Sbjct  260   KAGVDDLVPQKIVWHQRPHDPPILVYSGRDYYGHAPAVVELCVQVGARASPKYNCMMKEH  319

Query  519   GLSAPIS  499
             GL+ P+ 
Sbjct  320   GLAPPVQ  326


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/117 (32%), Positives = 56/117 (48%), Gaps = 0/117 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            ++M  +  E + A E L  GV  LL   PV  CK C E+HVG   H+   C  FK     
Sbjct  53   KRMIPVAQEVVRAREILTEGVSILLRAVPVHSCKFCPEIHVGAMAHQMNTCHGFKRMIKD  112

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            R H W    +++++ P   +H+       +  + R  +   PAV++LC +AGA  P 
Sbjct  113  RPHQWGPGGLNNIIVPVEAFHQENMFQDEIRHDQRFDFTRVPAVLELCHQAGAELPE  169



>gb|ACU15542.1| unknown [Glycine max]
Length=210

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 151/187 (81%), Gaps = 4/187 (2%)
 Frame = -1

Query  1059  MFQNVIKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFD----QQ  892
             MFQ+VI+H+ERFD+ RI AVV LC QAGA+ +DE++++S    E+++  V   +      
Sbjct  1     MFQSVIRHNERFDFDRIPAVVALCWQAGADFHDENLNSSSWNLEADNGSVPETESLSPND  60

Query  891   MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI  712
             +  + N+TL AWETLRSGV KLLLVYPVKVCK+CSEVHVGPSGHKARLCGVFKYESW+  
Sbjct  61    LTSIANKTLTAWETLRSGVEKLLLVYPVKVCKYCSEVHVGPSGHKARLCGVFKYESWKGA  120

Query  711   HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCM  532
             HFW KA+VD+LVPP IVW RRPQDPP+LL+EGR +YG  PAV+DLC+KAGA+ P+KY CM
Sbjct  121   HFWMKANVDNLVPPKIVWRRRPQDPPVLLNEGRGFYGRVPAVLDLCSKAGAVVPAKYNCM  180

Query  531   MKVDGLS  511
             MKV GLS
Sbjct  181   MKVQGLS  187


 Score = 62.4 bits (150),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+YC EV+VG +GH  R CG +++ +    H W+K ++D+++ P   +        V+ +
Sbjct  91    CKYCSEVHVGPSGHKARLCGVFKYESWKGAHFWMKANVDNLVPPKIVWRRRPQDPPVLLN  150

Query  1035  HERFDYSRISAVVELCLQAGA  973
               R  Y R+ AV++LC +AGA
Sbjct  151   EGRGFYGRVPAVLDLCSKAGA  171



>ref|XP_006300272.1| hypothetical protein CARUB_v100143371mg, partial [Capsella rubella]
 gb|EOA33170.1| hypothetical protein CARUB_v100143371mg, partial [Capsella rubella]
Length=212

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 155/211 (73%), Gaps = 3/211 (1%)
 Frame = -1

Query  1128  LHVWIKGSLDSILIPVETFHLHNMFQNVIKHHERFDYSRISAVVELCLQAGANPNDESID  949
             LH W+ GS++ IL+PVE++HL N+ Q VI+H ERFDY R+ A++ELC QAGA   +E + 
Sbjct  1     LHEWVPGSINDILVPVESYHLDNISQGVIRHQERFDYDRVPAILELCCQAGAIHPEEILQ  60

Query  948   ASKMEHE---SNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVH  778
              SK+      S+  I      +++ +G   L AWE LR+GV KLLLVY  KVCK C EVH
Sbjct  61    YSKIHDNPQISDEDIRSLPAGELKYVGANALMAWEKLRAGVKKLLLVYRSKVCKRCKEVH  120

Query  777   VGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGH  598
             +GPSGHKARLCGVFKYESWR  H+WEKA V+DLVP  +VWHRRPQDP +LL+EGR++YGH
Sbjct  121   IGPSGHKARLCGVFKYESWRGTHYWEKAGVNDLVPEKVVWHRRPQDPVVLLNEGRHHYGH  180

Query  597   APAVVDLCTKAGAIAPSKYFCMMKVDGLSAP  505
             APA+V LC+ AGAI P KY C MK  GLS P
Sbjct  181   APAIVSLCSHAGAIVPVKYACKMKPQGLSFP  211



>emb|CAE04242.3| OSJNBa0089N06.3 [Oryza sativa Japonica Group]
Length=580

 Score =   265 bits (678),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 161/221 (73%), Gaps = 4/221 (2%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++CPEV++G  GH +++C G++   KNQ H W  G L+ ILIPVE+FHL N FQ+ IK
Sbjct  84    SCKFCPEVHIGAVGHEMQSCHGFKRMIKNQPHKWGPGCLNDILIPVESFHLENTFQDEIK  143

Query  1038  HHERFDYSRISAVVELCLQAGANPNDE----SIDASKMEHESNSKIVLPFDQQMRLLGNE  871
             H +RFD+ R+ AV+ELC QAGA+  DE    S  +S +  E++ K      +++R +G  
Sbjct  144   HDQRFDFPRVPAVLELCHQAGADIPDEVWHRSGTSSAIVRENDEKPAAFLPEELRFIGQR  203

Query  870   TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             T+ AWE LR GV KLLLVYP KVC+ CSEVHVG SGHKAR+CGVFK+E WR  H W+KA 
Sbjct  204   TIEAWERLRLGVTKLLLVYPSKVCERCSEVHVGLSGHKARMCGVFKFEGWRGKHKWKKAD  263

Query  690   VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTK  568
             VDDLVPP IVWH+RP DPP+L+D GR+YYGHAPA+ +   K
Sbjct  264   VDDLVPPKIVWHQRPHDPPVLVDAGRDYYGHAPAINEWMVK  304


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 0/118 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            ++M  +  E + A E +  GV  LL V P+  CK C EVH+G  GH+ + C  FK     
Sbjct  53   KRMIPVAEEVVKAREIVTKGVSTLLQVVPIHSCKFCPEVHIGAVGHEMQSCHGFKRMIKN  112

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSK  544
            + H W    ++D++ P   +H        +  + R  +   PAV++LC +AGA  P +
Sbjct  113  QPHKWGPGCLNDILIPVESFHLENTFQDEIKHDQRFDFPRVPAVLELCHQAGADIPDE  170



>gb|KHN25778.1| APO protein 4, mitochondrial [Glycine soja]
Length=203

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/194 (61%), Positives = 150/194 (77%), Gaps = 8/194 (4%)
 Frame = -1

Query  1059  MFQNVIKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHES------NSKIVLPFD  898
             MFQ+VI+H ERFD+ RI AVVELC QA  + ++E++++S    E+       +K + P  
Sbjct  1     MFQSVIRHDERFDFDRIPAVVELCWQARDDLHEENLNSSSWNLEAANGSVPGAKSLSP--  58

Query  897   QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
               +  + N+TL AWETLRSGV KLLLVYPVKVCK+CS+VH GPSGHKARLCGVFKYESW+
Sbjct  59    NNLTSIANKTLTAWETLRSGVEKLLLVYPVKVCKYCSKVHAGPSGHKARLCGVFKYESWK  118

Query  717   RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
               HFW KA+VD+LVPP IVW RRPQDPP+LL+EGR +YG  PAV+D C+KAGA+ P+KY 
Sbjct  119   SAHFWMKANVDNLVPPKIVWRRRPQDPPVLLNEGRGFYGGVPAVLDQCSKAGAVVPAKYN  178

Query  537   CMMKVDGLSAPISD  496
             CMMKV GLS  +++
Sbjct  179   CMMKVQGLSGQVNN  192


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/81 (30%), Positives = 45/81 (56%), Gaps = 0/81 (0%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+YC +V+ G +GH  R CG +++ +    H W+K ++D+++ P   +        V+ +
Sbjct  91    CKYCSKVHAGPSGHKARLCGVFKYESWKSAHFWMKANVDNLVPPKIVWRRRPQDPPVLLN  150

Query  1035  HERFDYSRISAVVELCLQAGA  973
               R  Y  + AV++ C +AGA
Sbjct  151   EGRGFYGGVPAVLDQCSKAGA  171



>ref|XP_010532481.1| PREDICTED: APO protein 4, mitochondrial [Tarenaya hassleriana]
 ref|XP_010532482.1| PREDICTED: APO protein 4, mitochondrial [Tarenaya hassleriana]
 ref|XP_010532483.1| PREDICTED: APO protein 4, mitochondrial [Tarenaya hassleriana]
Length=300

 Score =   241 bits (614),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/249 (51%), Positives = 163/249 (65%), Gaps = 17/249 (7%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C+ CPEV++G  GHLI++C GY     NQLH W  GS++ IL+PVE +HL  M + +
Sbjct  58    VLACKSCPEVFIGNEGHLIQSCRGYSGCGDNQLHEWGPGSINDILVPVEAYHLQKMSRGI  117

Query  1044  IKHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLGNE--  871
              KHH+RFD+ R+ AV+ELC +A A  ++E ++ SK   E N  +   F++  R L  E  
Sbjct  118   TKHHQRFDHDRVPAVLELCCRACAIQHEEILELSKTS-EKNPYV---FNEDHRTLSGENL  173

Query  870   ------TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPS-GHKARLCGVFKYESWRRI  712
                   T+ AWET+R+ V KLL  YP KVC+HCSEVH+G + G KARLC   +      I
Sbjct  174   RYVAEGTVMAWETVRACVKKLLWAYPSKVCRHCSEVHIGHNVGGKARLCCGLQGG----I  229

Query  711   HFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCM  532
             H WE A V+DLVP  +VWHRRPQDP +LL+E R YYGHAPAVV LC  AGA+ PSKY   
Sbjct  230   HVWENAHVNDLVPEKLVWHRRPQDPSVLLNECREYYGHAPAVVSLCRHAGAVVPSKYLIR  289

Query  531   MKVDGLSAP  505
             MK  GLS P
Sbjct  290   MKPKGLSHP  298


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  + L A   L  GV  LL V+PV  CK C EV +G  GH  + C  +      ++H W
Sbjct  34   VAKKVLEARRVLIQGVSLLLKVFPVLACKSCPEVFIGNEGHLIQSCRGYSGCGDNQLHEW  93

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAI  556
               S++D++ P   +H +     +     R  +   PAV++LC +A AI
Sbjct  94   GPGSINDILVPVEAYHLQKMSRGITKHHQRFDHDRVPAVLELCCRACAI  142



>ref|XP_010263261.1| PREDICTED: APO protein 1, chloroplastic isoform X2 [Nelumbo nucifera]
Length=442

 Score =   213 bits (542),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 159/272 (58%), Gaps = 38/272 (14%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  CPEV+VG+ GH I+ C G  +  +   H W+KGS++ +LIP+E++HL++ F   
Sbjct  159   VYGCSNCPEVHVGQAGHEIQDCHGPDNVHRRSFHSWVKGSINDVLIPIESYHLYDPFGRR  218

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PN--------------------------DES  955
             IKH  RFDY RI AVVELC+QAG +    P+                          D S
Sbjct  219   IKHENRFDYDRIPAVVELCIQAGVDIPEYPSRRRTKPIRMIGKKVIDRGGFVEEPKLDRS  278

Query  954   IDASKMEHESNS------KIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
             +D+S +  E ++      K   P    +  +  ETL A+ET+R GV KL+  Y VKVC +
Sbjct  279   VDSSSLLMELDTYGAHIGKFPPPAAADVPKVAQETLKAYETVRWGVRKLMQKYTVKVCGY  338

Query  792   CSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEG  616
             CSEVHVGP GH A+LCG FK++     H W+ A+VD++VPPN VWH R P DPP+     
Sbjct  339   CSEVHVGPWGHNAKLCGAFKHQWRDGKHGWQDATVDEVVPPNYVWHVRDPADPPMRSALK  398

Query  615   RNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             R +YG APAVV++C  AGA  P KY  MM++D
Sbjct  399   R-FYGKAPAVVEMCIHAGAEIPDKYKPMMRLD  429


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 57/109 (52%), Gaps = 0/109 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW+ L  G+ +LL V PV  C +C EVHVG +GH+ + C        R  H W K 
Sbjct  138  EVLDAWKVLIKGLAQLLHVVPVYGCSNCPEVHVGQAGHEIQDCHGPDNVHRRSFHSWVKG  197

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P 
Sbjct  198  SINDVLIPIESYHLYDPFGRRIKHENRFDYDRIPAVVELCIQAGVDIPE  246


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 60/113 (53%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D ++ P   +H+ +     ++ 
Sbjct  336   CGYCSEVHVGPWGHNAKLCGAFKHQWRDGKHGWQDATVDEVVPPNYVWHVRDPADPPMRS  395

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+ AGA   D+     +++      IV+P  ++ RL+ 
Sbjct  396   ALKRFYGKAPAVVEMCIHAGAEIPDKYKPMMRLD------IVIPDTEEARLVA  442



>ref|XP_010263260.1| PREDICTED: APO protein 1, chloroplastic isoform X1 [Nelumbo nucifera]
Length=444

 Score =   213 bits (542),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 117/272 (43%), Positives = 159/272 (58%), Gaps = 38/272 (14%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  CPEV+VG+ GH I+ C G  +  +   H W+KGS++ +LIP+E++HL++ F   
Sbjct  161   VYGCSNCPEVHVGQAGHEIQDCHGPDNVHRRSFHSWVKGSINDVLIPIESYHLYDPFGRR  220

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PN--------------------------DES  955
             IKH  RFDY RI AVVELC+QAG +    P+                          D S
Sbjct  221   IKHENRFDYDRIPAVVELCIQAGVDIPEYPSRRRTKPIRMIGKKVIDRGGFVEEPKLDRS  280

Query  954   IDASKMEHESNS------KIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
             +D+S +  E ++      K   P    +  +  ETL A+ET+R GV KL+  Y VKVC +
Sbjct  281   VDSSSLLMELDTYGAHIGKFPPPAAADVPKVAQETLKAYETVRWGVRKLMQKYTVKVCGY  340

Query  792   CSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEG  616
             CSEVHVGP GH A+LCG FK++     H W+ A+VD++VPPN VWH R P DPP+     
Sbjct  341   CSEVHVGPWGHNAKLCGAFKHQWRDGKHGWQDATVDEVVPPNYVWHVRDPADPPMRSALK  400

Query  615   RNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             R +YG APAVV++C  AGA  P KY  MM++D
Sbjct  401   R-FYGKAPAVVEMCIHAGAEIPDKYKPMMRLD  431


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 57/109 (52%), Gaps = 0/109 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW+ L  G+ +LL V PV  C +C EVHVG +GH+ + C        R  H W K 
Sbjct  140  EVLDAWKVLIKGLAQLLHVVPVYGCSNCPEVHVGQAGHEIQDCHGPDNVHRRSFHSWVKG  199

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P 
Sbjct  200  SINDVLIPIESYHLYDPFGRRIKHENRFDYDRIPAVVELCIQAGVDIPE  248


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 60/113 (53%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D ++ P   +H+ +     ++ 
Sbjct  338   CGYCSEVHVGPWGHNAKLCGAFKHQWRDGKHGWQDATVDEVVPPNYVWHVRDPADPPMRS  397

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+ AGA   D+     +++      IV+P  ++ RL+ 
Sbjct  398   ALKRFYGKAPAVVEMCIHAGAEIPDKYKPMMRLD------IVIPDTEEARLVA  444



>ref|XP_009411316.1| PREDICTED: APO protein 2, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=413

 Score =   205 bits (522),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/267 (41%), Positives = 150/267 (56%), Gaps = 33/267 (12%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C+YC E++VG  GH  +TC G R   +  LH WI  +++ +L P+ETFHL +     
Sbjct  134   VLACKYCNEIHVGATGHPFKTCRGLRADHRKGLHEWITATVEDVLTPIETFHLSDRLGKR  193

Query  1044  IKHHERFDYSRISAVVELCLQAGANPND----------------ESIDASK---------  940
             I H ERF   RI AVVELC+QAG +  D                E IDA +         
Sbjct  194   ISHEERFSIPRIPAVVELCVQAGVDLPDFPIKRRRKPVIRLGRSEIIDADEDDLPDPRPC  253

Query  939   ------MEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
                   ++   + +IV P + ++   L   TL AWETLR G  KL+  YPV+VC +C EV
Sbjct  254   KFKKPILDEVPDCEIVPPANAEETASLSEATLEAWETLRQGAAKLMRKYPVRVCGYCPEV  313

Query  780   HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYG  601
             HVGPSGHKA+ CG +K++     H W+ A++DDL+PP  VWH  P+    L  + RN+YG
Sbjct  314   HVGPSGHKAQNCGAYKHQQRNGQHGWQSATLDDLIPPRYVWH-VPETVLELQRDLRNFYG  372

Query  600   HAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              APAVV+LC + GA  P  Y   M++D
Sbjct  373   QAPAVVELCVQGGAAVPECYKPTMRLD  399


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 62/116 (53%), Gaps = 0/116 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            Q +  +  E +NA   L + + +L+ V PV  CK+C+E+HVG +GH  + C   + +  +
Sbjct  105  QSLIPVAYEVMNARILLTNNLKRLMKVIPVLACKYCNEIHVGATGHPFKTCRGLRADHRK  164

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +H W  A+V+D++ P   +H   +    +  E R      PAVV+LC +AG   P
Sbjct  165  GLHEWITATVEDVLTPIETFHLSDRLGKRISHEERFSIPRIPAVVELCVQAGVDLP  220



>gb|KHG21282.1| APO 2, chloroplastic -like protein [Gossypium arboreum]
Length=452

 Score =   206 bits (524),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/264 (40%), Positives = 151/264 (57%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             CRYC E++VG  GH  ++C G+R   +  LH W   +++ + +PV+++HL++     I+H
Sbjct  175   CRYCNEIHVGPIGHPFKSCRGHRASIRKGLHEWTYATVEDVFVPVDSYHLYDRLGKRIRH  234

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHES-------  925
              ERF   R+ AVVELC+QAG                     E +DA + E          
Sbjct  235   DERFSIPRLPAVVELCIQAGVEVPEFPTKRRRKPIIRIGKSEFVDADESELPDPVPEPPL  294

Query  924   --------NSKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +++IV P DQ+ ++ L  ETL AWE +R G  KL+ +YPV+VC +C EVHVG
Sbjct  295   KPILTEILDTEIVAPRDQEEKIQLAEETLQAWEQMRRGAKKLMRMYPVRVCGYCPEVHVG  354

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG  K++     H W+ A VDDL+PP  VWH    + P L  E R++YG AP
Sbjct  355   PSGHKAQNCGAHKHQQRNGQHGWQSAVVDDLIPPRYVWHVPDVNGPPLQRELRSFYGQAP  414

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M++D
Sbjct  415   AVVEICVQAGADVPDQYKPTMRLD  438



>ref|XP_001757664.1| predicted protein [Physcomitrella patens]
 gb|EDQ77721.1| predicted protein [Physcomitrella patens]
Length=336

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/273 (37%), Positives = 151/273 (55%), Gaps = 41/273 (15%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             CR+C EVYVG+ GH I+TC G     ++  H+W+ G L+ I++P+E FHL +  Q  I+H
Sbjct  51    CRWCTEVYVGKEGHTIKTCRGKHCTGRSGEHLWVAGLLEDIVVPLEAFHLVDRLQKPIRH  110

Query  1035  HERFDYSRISAVVELCLQAGA---------------------NPNDESIDASKMEHESNS  919
              +RF++ RI A+VELC+QAG                      + +DE  + S    E  S
Sbjct  111   EDRFNHDRIPAIVELCIQAGVDLPEFPTVRRTVPIDRPEEIIDTDDEKAETSVSGGEEQS  170

Query  918   KIV--------------------LPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVC  799
              +V                    +  D  ++ +  +T+ AW  +R+G ++L+  YPV+ C
Sbjct  171   MVVGTEDSDDRERSSESKFDVQAINDDDDLKTIAEKTMRAWTKMRAGANQLIQTYPVRAC  230

Query  798   KHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDE  619
              +C EVH+G  GHK +LCG FK++     H W+ A++DDL+PP  VWH R  + P L + 
Sbjct  231   GYCPEVHIGRRGHKLQLCGAFKHQWRNGQHGWQDAALDDLIPPRYVWHVRDVNGPPLNNS  290

Query  618   GRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
                YYG APA+V+LC +AGA  P KY  +M++D
Sbjct  291   LSKYYGKAPAIVELCVQAGAAIPMKYKPLMRLD  323


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 53/108 (49%), Gaps = 4/108 (4%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
             A++ +  GV +LL   PV+ C+ C+EV+VG  GH  + C           H W    ++
Sbjct  30   KAYQVVLDGVSRLLKHIPVRACRWCTEVYVGKEGHTIKTCRGKHCTGRSGEHLWVAGLLE  89

Query  684  DLVPPNIVWH--RRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            D+V P   +H   R Q P  +  E R  +   PA+V+LC +AG   P 
Sbjct  90   DIVVPLEAFHLVDRLQKP--IRHEDRFNHDRIPAIVELCIQAGVDLPE  135



>ref|XP_011040100.1| PREDICTED: APO protein 1, chloroplastic isoform X2 [Populus euphratica]
Length=445

 Score =   204 bits (518),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/279 (39%), Positives = 158/279 (57%), Gaps = 37/279 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V   GH I+ C G   R ++ LH W++GS+D IL+P+E++HL++ F   
Sbjct  164   VYGCSECSEVHVALEGHQIKDCLGPTSRDRHSLHSWVRGSIDDILVPIESYHLYDPFGRR  223

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM--------------------  937
             IKH  RF+Y RI AVVELC+QAG +    P+   +   +M                    
Sbjct  224   IKHETRFEYDRIPAVVELCIQAGVDIPEYPSRRRMKPIRMMGKKVIDRGGFLEEPKPWRL  283

Query  936   ----------EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
                        + +N +   P  + +  +  ET++A++ +RSGV KL+  Y VK C +CS
Sbjct  284   GNPSTPVDFDTYRANERFPPPLSEDIPRIAQETMDAYDFVRSGVMKLMKKYTVKACGYCS  343

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVHVGP GH A+ CG FK++     H W+ A VD++ PPN VWH R P+ PP L    + 
Sbjct  344   EVHVGPWGHNAKFCGAFKHQWRDGKHGWQDAIVDEVFPPNCVWHVRDPRGPP-LRSALKR  402

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAPISDK  493
             +YG APAVV++C +AGA  P +Y  MM++D +  P SD+
Sbjct  403   FYGKAPAVVEVCMQAGAQVPDRYKPMMRLD-IIVPESDE  440


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  E L+AW+ L  GV +LL   PV  C  CSEVHV   GH+ + C          +H W
Sbjct  140  LAYEVLDAWKVLIKGVAQLLHTIPVYGCSECSEVHVALEGHQIKDCLGPTSRDRHSLHSW  199

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             + S+DD++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  200  VRGSIDDILVPIESYHLYDPFGRRIKHETRFEYDRIPAVVELCIQAGVDIP  250


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 57/113 (50%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W    +D +  P   +H+ +     ++ 
Sbjct  339   CGYCSEVHVGPWGHNAKFCGAFKHQWRDGKHGWQDAIVDEVFPPNCVWHVRDPRGPPLRS  398

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA   D      +++      I++P   + +L+ 
Sbjct  399   ALKRFYGKAPAVVEVCMQAGAQVPDRYKPMMRLD------IIVPESDEAKLVA  445



>ref|XP_011040094.1| PREDICTED: APO protein 1, chloroplastic isoform X1 [Populus euphratica]
 ref|XP_011040095.1| PREDICTED: APO protein 1, chloroplastic isoform X1 [Populus euphratica]
 ref|XP_011040096.1| PREDICTED: APO protein 1, chloroplastic isoform X1 [Populus euphratica]
 ref|XP_011040098.1| PREDICTED: APO protein 1, chloroplastic isoform X1 [Populus euphratica]
 ref|XP_011040099.1| PREDICTED: APO protein 1, chloroplastic isoform X1 [Populus euphratica]
Length=447

 Score =   204 bits (518),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/279 (39%), Positives = 158/279 (57%), Gaps = 37/279 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V   GH I+ C G   R ++ LH W++GS+D IL+P+E++HL++ F   
Sbjct  166   VYGCSECSEVHVALEGHQIKDCLGPTSRDRHSLHSWVRGSIDDILVPIESYHLYDPFGRR  225

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM--------------------  937
             IKH  RF+Y RI AVVELC+QAG +    P+   +   +M                    
Sbjct  226   IKHETRFEYDRIPAVVELCIQAGVDIPEYPSRRRMKPIRMMGKKVIDRGGFLEEPKPWRL  285

Query  936   ----------EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
                        + +N +   P  + +  +  ET++A++ +RSGV KL+  Y VK C +CS
Sbjct  286   GNPSTPVDFDTYRANERFPPPLSEDIPRIAQETMDAYDFVRSGVMKLMKKYTVKACGYCS  345

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVHVGP GH A+ CG FK++     H W+ A VD++ PPN VWH R P+ PP L    + 
Sbjct  346   EVHVGPWGHNAKFCGAFKHQWRDGKHGWQDAIVDEVFPPNCVWHVRDPRGPP-LRSALKR  404

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAPISDK  493
             +YG APAVV++C +AGA  P +Y  MM++D +  P SD+
Sbjct  405   FYGKAPAVVEVCMQAGAQVPDRYKPMMRLD-IIVPESDE  442


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  E L+AW+ L  GV +LL   PV  C  CSEVHV   GH+ + C          +H W
Sbjct  142  LAYEVLDAWKVLIKGVAQLLHTIPVYGCSECSEVHVALEGHQIKDCLGPTSRDRHSLHSW  201

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             + S+DD++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  202  VRGSIDDILVPIESYHLYDPFGRRIKHETRFEYDRIPAVVELCIQAGVDIP  252


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 57/113 (50%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W    +D +  P   +H+ +     ++ 
Sbjct  341   CGYCSEVHVGPWGHNAKFCGAFKHQWRDGKHGWQDAIVDEVFPPNCVWHVRDPRGPPLRS  400

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA   D      +++      I++P   + +L+ 
Sbjct  401   ALKRFYGKAPAVVEVCMQAGAQVPDRYKPMMRLD------IIVPESDEAKLVA  447



>ref|XP_003548251.1| PREDICTED: APO protein 1, chloroplastic-like [Glycine max]
 gb|KHN24430.1| APO protein 1, chloroplastic [Glycine soja]
Length=438

 Score =   203 bits (517),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/268 (40%), Positives = 151/268 (56%), Gaps = 36/268 (13%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C  C EV+V + GH IR C G   R +   H W+KGS++ IL+P+E++HL + F   IK
Sbjct  159   GCSECSEVHVAQTGHHIRDCSGTNGRQRRSSHAWVKGSVNDILVPIESYHLFDPFGRRIK  218

Query  1038  HHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------------------  937
             H  RF+Y RI AVVELC+QAG +    P+    +  +M                      
Sbjct  219   HDTRFEYDRIPAVVELCIQAGVDIPEYPSRRRTNPIRMLGRRVIDRGGNLEEPKPWRFAD  278

Query  936   --------EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
                      + ++ +   P    +  +  ET++A+ET++ GV KL+  Y VK C +C+EV
Sbjct  279   PSSLNDFDTYRASERFPRPSLSDLPKIAQETMSAYETVKKGVKKLMRKYTVKACGYCTEV  338

Query  780   HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYY  604
             HVGP GH A+LCG FK++     H W+ A+VD++ PPN VWH R P+ PP L    R YY
Sbjct  339   HVGPWGHNAKLCGAFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPRGPP-LASALRRYY  397

Query  603   GHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             G APAVV++C +AGA  P +Y  MM++D
Sbjct  398   GKAPAVVEVCMQAGAQIPEEYKPMMRLD  425


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 53/108 (49%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E  +AW+ L  G+ +LL V P   C  CSEVHV  +GH  R C        R  H W K 
Sbjct  136  EVFDAWKLLIEGLAQLLHVIPAHGCSECSEVHVAQTGHHIRDCSGTNGRQRRSSHAWVKG  195

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            SV+D++ P   +H        +  + R  Y   PAVV+LC +AG   P
Sbjct  196  SVNDILVPIESYHLFDPFGRRIKHDTRFEYDRIPAVVELCIQAGVDIP  243


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     +  
Sbjct  332   CGYCTEVHVGPWGHNAKLCGAFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPRGPPLAS  391

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               R  Y +  AVVE+C+QAGA   +E     +++      I++P  ++ R++ 
Sbjct  392   ALRRYYGKAPAVVEVCMQAGAQIPEEYKPMMRLD------IIIPDTEEARMIA  438



>ref|XP_003533257.1| PREDICTED: APO protein 1, chloroplastic-like [Glycine max]
 gb|KHN27866.1| APO protein 1, chloroplastic [Glycine soja]
Length=438

 Score =   203 bits (516),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/268 (41%), Positives = 152/268 (57%), Gaps = 36/268 (13%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C  C EV+V + GH IR C G   R +   H W+KGS++ IL+P+E++HL + F   IK
Sbjct  159   GCSECTEVHVAQTGHHIRDCSGTNGRQRRSSHAWVKGSVNDILVPIESYHLFDPFGRRIK  218

Query  1038  HHERFDYSRISAVVELCLQAG-----------ANP-------------NDES------ID  949
             H  RF+Y RI AVVELC+QAG            NP             N E        D
Sbjct  219   HDTRFEYDRIPAVVELCVQAGVDIPEYPSRRRTNPIRILGRRVIDRGGNLEEPKPWRFAD  278

Query  948   ASKME----HESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
              S +     + ++ +  LP    +  +  ET++A+ET++ GV KL+  Y VK C +C+EV
Sbjct  279   PSSLNDFDTYRASERFPLPSLSDLPKIAQETMSAYETVKKGVKKLMRKYTVKACGYCTEV  338

Query  780   HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYY  604
             HVGP GH A+LCG FK++     H W+ A+VD++ PPN VWH R P+ PP L    R YY
Sbjct  339   HVGPWGHNAKLCGAFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPRGPP-LASALRRYY  397

Query  603   GHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             G APAVV++C +AGA  P  Y  MM++D
Sbjct  398   GKAPAVVEVCMQAGAQIPEDYKPMMRLD  425


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 53/108 (49%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E   AW+ L  G+ +LL V PV  C  C+EVHV  +GH  R C        R  H W K 
Sbjct  136  EVFGAWKLLIKGLAQLLHVIPVHGCSECTEVHVAQTGHHIRDCSGTNGRQRRSSHAWVKG  195

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            SV+D++ P   +H        +  + R  Y   PAVV+LC +AG   P
Sbjct  196  SVNDILVPIESYHLFDPFGRRIKHDTRFEYDRIPAVVELCVQAGVDIP  243


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     +  
Sbjct  332   CGYCTEVHVGPWGHNAKLCGAFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPRGPPLAS  391

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               R  Y +  AVVE+C+QAGA   ++     +++      I++P  ++ R++ 
Sbjct  392   ALRRYYGKAPAVVEVCMQAGAQIPEDYKPMMRLD------IIIPDTEEARMIA  438



>ref|XP_006373554.1| hypothetical protein POPTR_0016s00340g [Populus trichocarpa]
 gb|ERP51351.1| hypothetical protein POPTR_0016s00340g [Populus trichocarpa]
Length=410

 Score =   202 bits (513),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 113/255 (44%), Positives = 157/255 (62%), Gaps = 14/255 (5%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V   GH I+ C G   R ++ LH W++GS+D IL+P+E++HL++ F   
Sbjct  154   VYGCSECSEVHVALEGHQIKDCLGPTSRDRHSLHSWVRGSIDDILVPIESYHLYDPFGRR  213

Query  1044  IKHHERFDYSRISAVVELCLQAGAN-PNDESIDASKMEHESNSKIV-----LPFDQQMRL  883
             IKH  RF+Y RI AVVELC+QAG + P   S    K       K++     L   +  RL
Sbjct  214   IKHETRFEYDRIPAVVELCIQAGVDIPEYPSRRRMKPIRMIGKKVIDRGGFLEEPKPWRL  273

Query  882   LGN----ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRR  715
              GN    ET++A++ +RSGV KL+  Y VK C +CSEVHVGP GH A+ CG FK++    
Sbjct  274   -GNPSSPETMDAYDFVRSGVMKLMKKYTVKACGYCSEVHVGPWGHNAKFCGAFKHQWRDG  332

Query  714   IHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYF  538
              H W+ A VD++ PPN VWH R P+ PP L    + +YG APAVV++C +AGA  P +Y 
Sbjct  333   KHGWQDAIVDEVFPPNCVWHVRDPRGPP-LRSALKRFYGKAPAVVEVCMQAGAQVPDRYK  391

Query  537   CMMKVDGLSAPISDK  493
              MM++D +  P SD+
Sbjct  392   PMMRLD-IIVPESDE  405


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  E L+AW+ L  GV +LL   PV  C  CSEVHV   GH+ + C          +H W
Sbjct  130  LAYEVLDAWKVLIKGVAQLLHTIPVYGCSECSEVHVALEGHQIKDCLGPTSRDRHSLHSW  189

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             + S+DD++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  190  VRGSIDDILVPIESYHLYDPFGRRIKHETRFEYDRIPAVVELCIQAGVDIP  240



>ref|NP_001053869.2| Os04g0615500 [Oryza sativa Japonica Group]
 dbj|BAF15783.2| Os04g0615500, partial [Oryza sativa Japonica Group]
Length=287

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 108/270 (40%), Positives = 148/270 (55%), Gaps = 34/270 (13%)
 Frame = -1

Query  1227  WLLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQN  1048
             WL+ CR CP+V+VG  GH I+ C G   + +N  H W++GS++ +LIP+E++H  + F  
Sbjct  5     WLVVCRKCPQVHVGPVGHQIQDCYGTGSQRRNSHHSWVRGSVNDVLIPIESYHQFDPFGW  64

Query  1047  VIKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------------EHE  928
              +KH  RFDY RI A+VELC+QAG      P+       +M                 H 
Sbjct  65    RVKHETRFDYDRIPAIVELCIQAGVELPQYPSRRRTAPVRMIGKKVIDRGGFVDGPKPHR  124

Query  927   SNSKIVL-----PFDQQ---------MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHC  790
             S   I L      F  Q         +  L  +TL A+  ++ GV +L+  Y VK C +C
Sbjct  125   SEDCISLLAELDTFSNQQGQSSTPSNVEELAEKTLKAYLNVQRGVARLMRKYTVKTCGYC  184

Query  789   SEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRN  610
             SEVHVGP GH  +LCG FK++     H W+ A VDD++PPN VWH R    P L    R+
Sbjct  185   SEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDDVIPPNYVWHVRDPTGPPLRSSLRS  244

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             +YG APAVV+LC +AGA  P +Y  MM+ D
Sbjct  245   FYGKAPAVVELCVQAGAEIPEEYRPMMRAD  274


 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 59/112 (53%), Gaps = 6/112 (5%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C YC EV+VG  GH ++ CG ++H+ ++  H W    +D ++ P   +H+ +     ++
Sbjct  180   TCGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDDVIPPNYVWHVRDPTGPPLR  239

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRL  883
                R  Y +  AVVELC+QAGA   +E     + +      +V+P  ++ RL
Sbjct  240   SSLRSFYGKAPAVVELCVQAGAEIPEEYRPMMRAD------VVIPDSEEARL  285



>ref|NP_001169188.1| hypothetical protein [Zea mays]
 ref|XP_008668370.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668371.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668372.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668373.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668374.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN31891.1| unknown [Zea mays]
 tpg|DAA36018.1| TPA: hypothetical protein ZEAMMB73_436168 [Zea mays]
 tpg|DAA36019.1| TPA: hypothetical protein ZEAMMB73_436168 [Zea mays]
 tpg|DAA36020.1| TPA: hypothetical protein ZEAMMB73_436168 [Zea mays]
 tpg|DAA36021.1| TPA: hypothetical protein ZEAMMB73_436168 [Zea mays]
Length=422

 Score =   201 bits (510),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/279 (39%), Positives = 149/279 (53%), Gaps = 40/279 (14%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              LS LLN      CR CP+V+VG  GH I+ C G   + +N  H W +GS++ +LIP+E+
Sbjct  131   GLSQLLNVVSVYGCRKCPQVHVGPVGHQIQDCYGSGSQRRNSHHSWARGSINDVLIPIES  190

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN---------------------PNDE  958
             +HL + F   +KH  RFDY RI A+VELC+QAG +                        E
Sbjct  191   YHLFDPFGRRVKHDTRFDYDRIPAIVELCIQAGVDLPQYPSRRRTAPVRMIGKKVIDRGE  250

Query  957   SIDASKMEHE-------------SNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLV  817
              +D  K +               SN ++  P    M+ L   TL A+  +R GV +L+  
Sbjct  251   FVDEPKPQRSEHCVSLLAELDTFSNQQVQSPSPSNMKELAKRTLKAYLNVRRGVEQLMSK  310

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDP  637
             Y VK C +CSEVHVGP GH  +LCG FK++     H W+ A VD+++PPN VWH      
Sbjct  311   YTVKACGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDEVIPPNYVWHVPDPSG  370

Query  636   PLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
               L    R++YG APAVV+LC +AGA  P +Y  MM+ D
Sbjct  371   SPLRSSLRSFYGKAPAVVELCVQAGAEIPDEYRAMMRTD  409


 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI--H  709
            + +E L+ W+ L  G+ +LL V  V  C+ C +VHVGP GH+ + C  +   S RR   H
Sbjct  117  VAHEVLDNWKVLIRGLSQLLNVVSVYGCRKCPQVHVGPVGHQIQDC--YGSGSQRRNSHH  174

Query  708  FWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             W + S++D++ P   +H        +  + R  Y   PA+V+LC +AG   P
Sbjct  175  SWARGSINDVLIPIESYHLFDPFGRRVKHDTRFDYDRIPAIVELCIQAGVDLP  227



>gb|KHG25157.1| APO 1, chloroplastic -like protein [Gossypium arboreum]
Length=444

 Score =   201 bits (510),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/273 (41%), Positives = 158/273 (58%), Gaps = 40/273 (15%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V  +GH I+ C G     +  LH W+KGS++ ILIP+E++HL++ F   
Sbjct  161   VYGCSECSEVHVAHSGHNIQDCKGPSSSKRRGLHSWVKGSINDILIPIESYHLYDPFGRR  220

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM--------------------  937
             IKH  RFDY RI AVVELC+QAG +    P+    +  +M                    
Sbjct  221   IKHETRFDYDRIPAVVELCIQAGVDIPEYPSRRRTNPIRMIGKKIIDRGGYVEEPKPWRA  280

Query  936   -EHESNSKIVL-----------PFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
              +  S+S I L           P  + + ++  ET+NA ET+++GV KL+  Y VK C +
Sbjct  281   VDPSSSSIIDLDTCGACERFPPPSPEDVPIIAQETMNAHETVQTGVTKLMKKYTVKACGY  340

Query  792   CSEVHVGPSGHKARLCGVFKYESWRR-IHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDE  619
             CSEVHVGP GH A+LCG FK++ WR   H W+ A+V ++ PPN VWH + P+ PP +   
Sbjct  341   CSEVHVGPWGHNAKLCGEFKHQ-WRDGKHGWQDATVSEVFPPNYVWHVQDPKGPP-MRSA  398

Query  618   GRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              + YYG APAVV+LC +AGA  P +Y  MM++D
Sbjct  399   LKRYYGKAPAVVELCMQAGAQVPRRYKPMMRLD  431


 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/108 (39%), Positives = 56/108 (52%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW+ L  G+ +LL V PV  C  CSEVHV  SGH  + C        R +H W K 
Sbjct  140  EVLDAWKLLIKGLAQLLYVIPVYGCSECSEVHVAHSGHNIQDCKGPSSSKRRGLHSWVKG  199

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  200  SINDILIPIESYHLYDPFGRRIKHETRFDYDRIPAVVELCIQAGVDIP  247



>ref|XP_004293776.1| PREDICTED: APO protein 1, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=445

 Score =   200 bits (509),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 106/274 (39%), Positives = 154/274 (56%), Gaps = 41/274 (15%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V ++GH ++ C G  + T+   H W+KGS++ +L+P+E +HL++ F   
Sbjct  161   VYGCLECSEVHVAQSGHQMQDCLGPSNATRRSFHSWMKGSINDVLVPIEAYHLYDPFGRR  220

Query  1044  IKHHERFDYSRISAVVELCLQAG-------------------------------------  976
             IKH  RF Y RI A+VELC+QAG                                     
Sbjct  221   IKHETRFQYDRIPAIVELCIQAGVDIPEYPSRRRTKPIRMIGKKVIDRGGFVEEPVQWHA  280

Query  975   ANPNDESIDASKMEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCK  796
             ANP+  +I A    H ++ +   P    +  +  ETL+A+ET++SGV KL+    VK C 
Sbjct  281   ANPSSLAI-ADLDTHGASERFPPPLSSDIPKIAQETLDAYETVKSGVTKLMKKCSVKACG  339

Query  795   HCSEVHVGPSGHKARLCGVFKYESWRR-IHFWEKASVDDLVPPNIVWH-RRPQDPPLLLD  622
             +C EVHVGP GH A+LCG FK++ WR   H W+ A+VD++ PPN VWH + P+ PP+   
Sbjct  340   YCPEVHVGPWGHNAKLCGEFKHQ-WRDGKHGWQDATVDEVFPPNYVWHVKDPKGPPMKGG  398

Query  621   EGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
               + +YG  PAVV+LC +AGA  P KY  MM++D
Sbjct  399   ALKKFYGKVPAVVELCLQAGAQIPEKYKPMMRLD  432


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 62/118 (53%), Gaps = 0/118 (0%)
 Frame = -1

Query  903  FDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYES  724
             D  +  + ++ L+AW+TL  G+ +LL V PV  C  CSEVHV  SGH+ + C      +
Sbjct  130  LDPDLIPVAHQVLDAWKTLIKGLAQLLHVVPVYGCLECSEVHVAQSGHQMQDCLGPSNAT  189

Query  723  WRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             R  H W K S++D++ P   +H        +  E R  Y   PA+V+LC +AG   P
Sbjct  190  RRSFHSWMKGSINDVLVPIEAYHLYDPFGRRIKHETRFQYDRIPAIVELCIQAGVDIP  247



>ref|XP_008443853.1| PREDICTED: APO protein 2, chloroplastic [Cucumis melo]
Length=451

 Score =   199 bits (507),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/264 (39%), Positives = 147/264 (56%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W K +L+ I +PVE +HL++     I H
Sbjct  174   CGFCNEIHVGPVGHPFKSCRGQDANFRKGLHEWTKATLEDIFLPVEAYHLYDRLGRRISH  233

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKMEHES-------  925
              ER+   RI AVVELC+QAG +  D                E IDA + E          
Sbjct  234   QERYSIPRIPAVVELCIQAGVDLPDYPAKRRRKPIVRISKSEYIDADESELPDPEPEVPL  293

Query  924   --------NSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +S  V P D + +  L ++TL AWE +R G  +L+ +YPV+VC +C EVHVG
Sbjct  294   KPLLTEILDSDAVAPSDVEDIAWLADQTLQAWEQMRRGAKRLMKMYPVRVCGYCPEVHVG  353

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
              SGHKA+ CG FK++     H W++A +DDL+PP  VWH    + P L  E RN+YG AP
Sbjct  354   SSGHKAQNCGAFKHQQRNGQHGWQRAVLDDLIPPRYVWHVPDINGPPLQRELRNFYGQAP  413

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             A+V++C +AGA  P +Y   M++D
Sbjct  414   AIVEMCIQAGAAIPDQYKSTMRMD  437


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 57/116 (49%), Gaps = 0/116 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  +     NA  TL + + KLL V PV  C  C+E+HVGP GH  + C        +
Sbjct  142  KSMIPIAYNVFNARITLLNNLKKLLKVVPVHACGFCNEIHVGPVGHPFKSCRGQDANFRK  201

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +H W KA+++D+  P   +H   +    +  + R      PAVV+LC +AG   P
Sbjct  202  GLHEWTKATLEDIFLPVEAYHLYDRLGRRISHQERYSIPRIPAVVELCIQAGVDLP  257



>ref|XP_004976806.1| PREDICTED: APO protein 1, chloroplastic-like [Setaria italica]
Length=422

 Score =   198 bits (504),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 110/280 (39%), Positives = 151/280 (54%), Gaps = 42/280 (15%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              LS LLN      CR CP+V+VG  GH I+ C G   + +N  H W  GS++ +LIP+E+
Sbjct  131   GLSQLLNVVTVYGCRKCPQVHVGPVGHQIQDCYGSGSQRRNSHHSWASGSINDVLIPIES  190

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN---------------------PNDE  958
             +HL + F   +KH  RFDY RI A+VELC+QAG +                        E
Sbjct  191   YHLFDPFGRRVKHETRFDYDRIPAIVELCIQAGVDLPQYPSRRRTSPVRMIGKKVISRGE  250

Query  957   SIDASK-------------MEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLV  817
              +D  K             ++  +N +   P    ++ L   TL A+  +R GV +L+  
Sbjct  251   FVDEPKPHRSEDCVSLLAELDTFNNQQGQSPSPSNVKELAERTLKAYLNVRQGVEQLMSK  310

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRR-IHFWEKASVDDLVPPNIVWHRRPQD  640
             Y VK C +CSEVHVGP GH  +LCG FK++ WR   H W+ A VD+++PPN VWH     
Sbjct  311   YTVKACGYCSEVHVGPWGHNVKLCGAFKHQ-WRDGKHGWQDAVVDEVIPPNYVWHVPDPS  369

Query  639   PPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              P L    R++YG APAVV+LC +AGA  P +Y  MM+ D
Sbjct  370   GPPLRSSLRSFYGKAPAVVELCVQAGAAIPDEYRPMMRTD  409


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 57/110 (52%), Gaps = 4/110 (4%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI--HFWE  700
            E L+ W+ L  G+ +LL V  V  C+ C +VHVGP GH+ + C  +   S RR   H W 
Sbjct  120  EVLDNWKVLIRGLSQLLNVVTVYGCRKCPQVHVGPVGHQIQDC--YGSGSQRRNSHHSWA  177

Query  699  KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              S++D++ P   +H        +  E R  Y   PA+V+LC +AG   P
Sbjct  178  SGSINDVLIPIESYHLFDPFGRRVKHETRFDYDRIPAIVELCIQAGVDLP  227



>ref|XP_010058004.1| PREDICTED: APO protein 1, chloroplastic [Eucalyptus grandis]
 ref|XP_010058005.1| PREDICTED: APO protein 1, chloroplastic [Eucalyptus grandis]
 gb|KCW75467.1| hypothetical protein EUGRSUZ_E04229 [Eucalyptus grandis]
Length=441

 Score =   199 bits (506),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 106/279 (38%), Positives = 156/279 (56%), Gaps = 37/279 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V E GH I+ C G  +  +   H W++GS++ +L+PVE++HL++ F   
Sbjct  160   VYGCSKCSEVHVAETGHKIQDCLGSSNAQRRSFHSWVRGSINDVLLPVESYHLYDPFGKR  219

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM--------------------  937
             +KH  RFDY RI AVVELC+QAG +    P+       +M                    
Sbjct  220   VKHETRFDYDRIPAVVELCIQAGVDIPEYPSRRRTKPIRMIGKKVFNRGEYVEEPRPWRT  279

Query  936   ----------EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
                        H +  +   P   ++  +  ET++A+ T+RSGV +L+  Y VK C +CS
Sbjct  280   ADLSALVEFDTHGACERFPPPLLSEVPSIAQETMDAYRTVRSGVKRLMKSYTVKACGYCS  339

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVHVGP GH A+LCG FK++     H W+ A+ D++ PPN VWH R P+ PP L    ++
Sbjct  340   EVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATPDEVFPPNYVWHVRDPKGPP-LTGALKS  398

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAPISDK  493
             YYG APA+V++C +AGA  P  Y  MM++D +  P SD+
Sbjct  399   YYGKAPAIVEICMQAGAQIPEIYKPMMRLD-IIIPESDE  436


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 56/108 (52%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + L+AW+ L  GV +LL V PV  C  CSEVHV  +GHK + C        R  H W + 
Sbjct  139  DVLDAWKVLIKGVAQLLHVIPVYGCSKCSEVHVAETGHKIQDCLGSSNAQRRSFHSWVRG  198

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  199  SINDVLLPVESYHLYDPFGKRVKHETRFDYDRIPAVVELCIQAGVDIP  246



>ref|XP_004146678.1| PREDICTED: APO protein 2, chloroplastic-like [Cucumis sativus]
 ref|XP_004161867.1| PREDICTED: APO protein 2, chloroplastic-like [Cucumis sativus]
 gb|KGN65165.1| hypothetical protein Csa_1G256740 [Cucumis sativus]
Length=451

 Score =   199 bits (506),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 147/264 (56%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W K +L+ I +PVE +HL++     I H
Sbjct  174   CGFCNEIHVGPVGHPFKSCRGKNASLRKGLHEWTKATLEDIFLPVEAYHLYDRLGRRISH  233

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKMEHES-------  925
              ER+   RI AVVELC+QAG +  D                E IDA + E          
Sbjct  234   QERYSIPRIPAVVELCIQAGVDLPDYPAKRRRKPVIRISKSEYIDADESELPDPEPEVPL  293

Query  924   --------NSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +S  V P D + +  L ++T+ AWE +R G  +L+ +YPV+VC +C EVHVG
Sbjct  294   KPLLTEIPDSDAVAPSDVEDIAWLADQTIQAWEQMRRGAKRLIKMYPVRVCGYCPEVHVG  353

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
              SGHKA+ CG FK++     H W++A +DDL+PP  VWH    + P L  E RN+YG AP
Sbjct  354   SSGHKAQNCGAFKHQQRNGQHGWQRAVLDDLIPPRYVWHVPDVNGPPLQRELRNFYGQAP  413

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             A+V++C +AGA  P +Y   M++D
Sbjct  414   AIVEMCIQAGAAIPDEYKSTMRMD  437


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/116 (33%), Positives = 58/116 (50%), Gaps = 0/116 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            + M  +  +  NA  TL + + KLL V PV  C  C+E+HVGP GH  + C        +
Sbjct  142  KSMIPIAYKVFNARITLINNLKKLLKVIPVHACGFCNEIHVGPVGHPFKSCRGKNASLRK  201

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +H W KA+++D+  P   +H   +    +  + R      PAVV+LC +AG   P
Sbjct  202  GLHEWTKATLEDIFLPVEAYHLYDRLGRRISHQERYSIPRIPAVVELCIQAGVDLP  257



>gb|KDO59472.1| hypothetical protein CISIN_1g013860mg [Citrus sinensis]
 gb|KDO59473.1| hypothetical protein CISIN_1g013860mg [Citrus sinensis]
Length=435

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 147/264 (56%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W   +L+ IL+ VE +HL +     I+H
Sbjct  158   CVFCNEIHVGPVGHRFKSCKGPDSAFRKGLHEWTNAALEDILLQVEAYHLFDRLGKRIRH  217

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASK------------  940
              ERF   RI AV ELC+QAG    +                E IDA +            
Sbjct  218   DERFSIPRIPAVTELCIQAGVEIPEFPTKRRRKPIIRIGRKEFIDADESDLPEPDPPVPL  277

Query  939   ---MEHESNSKIVLPF-DQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                +    +S+IV P  +++  LL  ETL  WE +R G  +L+++YPV+VC +C EVHVG
Sbjct  278   KPILTEIPDSEIVAPSNEEETVLLAEETLQVWEKMRGGARRLMMMYPVRVCGYCPEVHVG  337

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P L  E +++YG AP
Sbjct  338   PSGHKAQNCGAFKHQQRNGQHGWQAAVLDDLIPPRYVWHVPDVNGPPLRREFKSFYGQAP  397

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA AP +Y   M++D
Sbjct  398   AVVEICVQAGAAAPEQYKPTMRLD  421


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + LNA  TL + + KL  V PV  C  C+E+HVGP GH+ + C        + +H W  A
Sbjct  134  DVLNARITLINNLKKLWKVVPVHACVFCNEIHVGPVGHRFKSCKGPDSAFRKGLHEWTNA  193

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            +++D++     +H   +    +  + R      PAV +LC +AG   P 
Sbjct  194  ALEDILLQVEAYHLFDRLGKRIRHDERFSIPRIPAVTELCIQAGVEIPE  242



>ref|XP_004512596.1| PREDICTED: APO protein 1, chloroplastic-like [Cicer arietinum]
Length=419

 Score =   198 bits (503),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 153/269 (57%), Gaps = 34/269 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V + GH I  C G    T++  H W+KGS++ IL+P+E++HL + F   
Sbjct  138   VYGCSECSEVHVAQTGHCILDCEGRTSSTRHSSHAWVKGSVNDILVPIESYHLFDPFGKR  197

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKMEHE-----------------  928
             IKH  RF+Y RI AVVELC+QAG +    P+    +  +M  +                 
Sbjct  198   IKHDTRFEYDRIPAVVELCIQAGVDIPEYPSRRRTNPIRMVGKKVIERGGHLEEPKPLPI  257

Query  927   SNSKIVLPFD-------------QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
             + S  ++ FD              ++  +  ET++A+E +R GV KL+  Y VK C +CS
Sbjct  258   AESSPIIDFDTYRACERFPRPPLSEVPKIAQETIDAYEIVRKGVKKLMKKYTVKACGYCS  317

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNY  607
             EVHVGP GH A+LCG FK++     H W+ A++D+++PPN VWH R  + P +    + Y
Sbjct  318   EVHVGPWGHNAKLCGSFKHQWRDGKHGWQDATLDEVLPPNFVWHVRDTNGPPINAALKRY  377

Query  606   YGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             YG APAVV++C +AGA  P +Y  MM++D
Sbjct  378   YGKAPAVVEVCVQAGARIPVEYKPMMRLD  406


 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 56/116 (48%), Gaps = 0/116 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            Q +  +  E  +AW+ L  G+ +LL V PV  C  CSEVHV  +GH    C      +  
Sbjct  109  QNLVPVAYEVFDAWKLLIKGLSQLLHVIPVYGCSECSEVHVAQTGHCILDCEGRTSSTRH  168

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              H W K SV+D++ P   +H        +  + R  Y   PAVV+LC +AG   P
Sbjct  169  SSHAWVKGSVNDILVPIESYHLFDPFGKRIKHDTRFEYDRIPAVVELCIQAGVDIP  224



>ref|XP_006474008.1| PREDICTED: APO protein 2, chloroplastic-like [Citrus sinensis]
Length=435

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 147/264 (56%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W   +L+ IL+ VE +HL +     I+H
Sbjct  158   CVFCNEIHVGPVGHRFKSCKGPDSAFRKGLHEWTNAALEDILLQVEAYHLFDRLGKRIRH  217

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASK------------  940
              ERF   RI AV ELC+QAG    +                E IDA +            
Sbjct  218   DERFSIPRIPAVTELCIQAGVEIPEFPTKRRRKPIIRIGRKEFIDADESDLPDPDPPVPL  277

Query  939   ---MEHESNSKIVLPF-DQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                +    +S+IV P  +++  LL  ETL  WE +R G  +L+++YPV+VC +C EVHVG
Sbjct  278   KPILTEIPDSEIVAPSNEEETVLLAEETLQVWEKMRGGARRLMMMYPVRVCGYCPEVHVG  337

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P L  E +++YG AP
Sbjct  338   PSGHKAQNCGAFKHQQRNGQHGWQAAVLDDLIPPRYVWHVPDVNGPPLRREFKSFYGQAP  397

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA AP +Y   M++D
Sbjct  398   AVVEICVQAGAAAPEQYKPTMRLD  421


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + LNA  TL + + KL  V PV  C  C+E+HVGP GH+ + C        + +H W  A
Sbjct  134  DVLNARITLINNLKKLWKVVPVHACVFCNEIHVGPVGHRFKSCKGPDSAFRKGLHEWTNA  193

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            +++D++     +H   +    +  + R      PAV +LC +AG   P 
Sbjct  194  ALEDILLQVEAYHLFDRLGKRIRHDERFSIPRIPAVTELCIQAGVEIPE  242



>ref|XP_008810393.1| PREDICTED: APO protein 2, chloroplastic [Phoenix dactylifera]
Length=467

 Score =   199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/264 (39%), Positives = 146/264 (55%), Gaps = 33/264 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+YC E++VG++GH  ++C G     +  LH W   +++ + +PVE +H+ +     I H
Sbjct  191   CKYCNEIHVGQSGHPFKSCRGLHADKRRSLHEWTNATVEDVFLPVEAYHIFDRLGRRISH  250

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASK------------  940
              ERF   R+ AVVELC+QAG +  D                E IDA++            
Sbjct  251   EERFSIPRVPAVVELCVQAGVDLPDLPTKRRRKPVIRIRKSEIIDANEDDLPDPMPDKFK  310

Query  939   ---MEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                ++   +S    P   ++   L  ETL AWETLR G  +L+  Y V+VC +C E+HVG
Sbjct  311   KPILDEIPDSDAFPPSSAEETASLAEETLEAWETLRQGAGRLMRKYAVRVCGYCPELHVG  370

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG FK++     H W+ A +DDL+PP  VWH  P+  P L  E RN+YG AP
Sbjct  371   PSGHKAQNCGAFKHQQRNGQHGWQAAVIDDLIPPRYVWH-VPETEPELQRELRNFYGQAP  429

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV+LC + GA  P +Y   M++D
Sbjct  430   AVVELCVQGGARVPEQYKPTMRLD  453


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E +NA   L + + +L+ V PV+ CK+C+E+HVG SGH  + C     +  R +H W  A
Sbjct  167  EVMNARILLINNLKRLMKVVPVQACKYCNEIHVGQSGHPFKSCRGLHADKRRSLHEWTNA  226

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            +V+D+  P   +H   +    +  E R      PAVV+LC +AG   P
Sbjct  227  TVEDVFLPVEAYHIFDRLGRRISHEERFSIPRVPAVVELCVQAGVDLP  274



>ref|XP_004487892.1| PREDICTED: APO protein 2, chloroplastic-like isoform X1 [Cicer 
arietinum]
Length=469

 Score =   199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/264 (39%), Positives = 146/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  R+C G +   +  LH W    ++ ILIP+E FHL++     I H
Sbjct  192   CGWCSEIHVGPVGHPFRSCKGTQANYRKGLHEWTNAHVEDILIPIEAFHLYDRLGRRITH  251

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKME----------  934
              ERF  SRI A++ELC+QAG                     E +DA + E          
Sbjct  252   EERFSISRIPAMIELCIQAGVEIPEFPTKRRRKPIIRIGRKEFVDADESELPDKVPENPL  311

Query  933   -----HESNSKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +S++V P D++  + L  ETL AWE +R G  +L+ +Y V+VC +C E+HVG
Sbjct  312   KPLLTELPDSEVVAPVDKEEVIHLAEETLQAWEQMRRGTKRLMRMYHVRVCGYCPEIHVG  371

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG  K++     H W+ A +DDL+PP  VWH    + P L  E RN+YG AP
Sbjct  372   PTGHKAQNCGAHKHQQRNGQHGWQSAVLDDLIPPRFVWHVPDVNGPPLERELRNFYGQAP  431

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M++D
Sbjct  432   AVVEMCIQAGAALPEQYKSTMRLD  455


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 66/138 (48%), Gaps = 7/138 (5%)
 Frame = -1

Query  942  KMEHESNSKIVLPFDQQMRLLGN------ETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
            KM+ E   K  LP  +   L+ N      +  NA  TL + + KLL V PV  C  CSE+
Sbjct  140  KMKDEPKRK-PLPAPKNGLLVKNLIPDAYDVYNARITLINNLKKLLKVVPVHACGWCSEI  198

Query  780  HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYG  601
            HVGP GH  R C   +    + +H W  A V+D++ P   +H   +    +  E R    
Sbjct  199  HVGPVGHPFRSCKGTQANYRKGLHEWTNAHVEDILIPIEAFHLYDRLGRRITHEERFSIS  258

Query  600  HAPAVVDLCTKAGAIAPS  547
              PA+++LC +AG   P 
Sbjct  259  RIPAMIELCIQAGVEIPE  276



>ref|XP_004487893.1| PREDICTED: APO protein 2, chloroplastic-like isoform X2 [Cicer 
arietinum]
Length=468

 Score =   199 bits (506),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 102/264 (39%), Positives = 146/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  R+C G +   +  LH W    ++ ILIP+E FHL++     I H
Sbjct  191   CGWCSEIHVGPVGHPFRSCKGTQANYRKGLHEWTNAHVEDILIPIEAFHLYDRLGRRITH  250

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKME----------  934
              ERF  SRI A++ELC+QAG                     E +DA + E          
Sbjct  251   EERFSISRIPAMIELCIQAGVEIPEFPTKRRRKPIIRIGRKEFVDADESELPDKVPENPL  310

Query  933   -----HESNSKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +S++V P D++  + L  ETL AWE +R G  +L+ +Y V+VC +C E+HVG
Sbjct  311   KPLLTELPDSEVVAPVDKEEVIHLAEETLQAWEQMRRGTKRLMRMYHVRVCGYCPEIHVG  370

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG  K++     H W+ A +DDL+PP  VWH    + P L  E RN+YG AP
Sbjct  371   PTGHKAQNCGAHKHQQRNGQHGWQSAVLDDLIPPRFVWHVPDVNGPPLERELRNFYGQAP  430

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M++D
Sbjct  431   AVVEMCIQAGAALPEQYKSTMRLD  454


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/138 (33%), Positives = 66/138 (48%), Gaps = 7/138 (5%)
 Frame = -1

Query  942  KMEHESNSKIVLPFDQQMRLLGN------ETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
            KM+ E   K  LP  +   L+ N      +  NA  TL + + KLL V PV  C  CSE+
Sbjct  139  KMKDEPKRK-PLPAPKNGLLVKNLIPDAYDVYNARITLINNLKKLLKVVPVHACGWCSEI  197

Query  780  HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYG  601
            HVGP GH  R C   +    + +H W  A V+D++ P   +H   +    +  E R    
Sbjct  198  HVGPVGHPFRSCKGTQANYRKGLHEWTNAHVEDILIPIEAFHLYDRLGRRITHEERFSIS  257

Query  600  HAPAVVDLCTKAGAIAPS  547
              PA+++LC +AG   P 
Sbjct  258  RIPAMIELCIQAGVEIPE  275



>ref|XP_009628505.1| PREDICTED: APO protein 1, chloroplastic [Nicotiana tomentosiformis]
 ref|XP_009628506.1| PREDICTED: APO protein 1, chloroplastic [Nicotiana tomentosiformis]
Length=446

 Score =   198 bits (504),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 103/266 (39%), Positives = 154/266 (58%), Gaps = 35/266 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C E++V ++GH I+ C G  + ++   H W+KGS++ +LIP+E++H+++ F   IKH
Sbjct  169   CSECSEIHVAQSGHDIQDCLGTTNSSRRSFHSWVKGSINDVLIPIESYHMYDPFGTRIKH  228

Query  1035  HERFDYSRISAVVELCLQAGAN----------------------------PNDESIDASK  940
               RF+Y RI AVVELC+QAG +                             +  S+D S 
Sbjct  229   ETRFNYDRIPAVVELCIQAGVDLPGYPSRRRTKPIRMIGKKVIDIGGLVEEHRPSVDTSS  288

Query  939   M-----EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
             +      H S  +   P + ++  +  ET++A+E ++ GV +L+  Y VK C +CSEVHV
Sbjct  289   VIMDFDTHRSFERFAPPLESEVPRIAQETIDAYEKVKWGVTRLMKKYTVKACGYCSEVHV  348

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGH  598
             GP GH A+LCG FK++     H W+ A+VD++ PPN VWH R P+  PL     R +YG 
Sbjct  349   GPCGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPKGTPLRSALKR-FYGK  407

Query  597   APAVVDLCTKAGAIAPSKYFCMMKVD  520
             APAVV++C +AGA  P KY  MM++D
Sbjct  408   APAVVEVCMQAGAQIPHKYKPMMRLD  433


 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW+ L  G+ +LL   PV  C  CSE+HV  SGH  + C      S R  H W K 
Sbjct  145  EVLDAWKLLIKGLAQLLHYVPVHACSECSEIHVAQSGHDIQDCLGTTNSSRRSFHSWVKG  204

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  205  SINDVLIPIESYHMYDPFGTRIKHETRFNYDRIPAVVELCIQAGVDLP  252



>ref|XP_010918484.1| PREDICTED: APO protein 2, chloroplastic isoform X2 [Elaeis guineensis]
Length=415

 Score =   197 bits (501),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 144/264 (55%), Gaps = 33/264 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+YC E++VG+ GH  ++C G     +  LH W   +++ + +P+E +HL +     I H
Sbjct  139   CKYCNEIHVGQTGHPFKSCRGLHADKRRGLHEWTNATVEDVFLPIEAYHLFDRLGKRISH  198

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASK------------  940
              ERF   R+ A+VELC+QAG +  D                E IDA +            
Sbjct  199   EERFSIPRVPAIVELCVQAGVDLPDLPTKRRRKPVIRIRKSEIIDADEDDLPDPKPDKFN  258

Query  939   ---MEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                ++   +S  + P   ++   L  ETL AW+TLR G  +L+  Y V+VC +C EVHVG
Sbjct  259   KPILDEIPDSDAIPPSSAEETASLSEETLEAWDTLRQGTGRLMRKYAVRVCGYCPEVHVG  318

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG FK++     H W+ A +DDL+PP  VWH  P   P L  E RN+YG AP
Sbjct  319   PSGHKAQNCGAFKHQQRNGQHGWQAAVLDDLIPPRFVWH-VPATEPELQRELRNFYGQAP  377

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV+LC + GA  P +Y   M++D
Sbjct  378   AVVELCVQGGARVPEQYKPTMRLD  401


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E +NA   L + + +L+ V PV+ CK+C+E+HVG +GH  + C     +  R +H W  A
Sbjct  115  EVMNARILLINNLKRLMKVVPVRACKYCNEIHVGQTGHPFKSCRGLHADKRRGLHEWTNA  174

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            +V+D+  P   +H   +    +  E R      PA+V+LC +AG   P
Sbjct  175  TVEDVFLPIEAYHLFDRLGKRISHEERFSIPRVPAIVELCVQAGVDLP  222



>ref|XP_010918480.1| PREDICTED: APO protein 2, chloroplastic isoform X1 [Elaeis guineensis]
Length=466

 Score =   198 bits (504),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 144/264 (55%), Gaps = 33/264 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+YC E++VG+ GH  ++C G     +  LH W   +++ + +P+E +HL +     I H
Sbjct  190   CKYCNEIHVGQTGHPFKSCRGLHADKRRGLHEWTNATVEDVFLPIEAYHLFDRLGKRISH  249

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASK------------  940
              ERF   R+ A+VELC+QAG +  D                E IDA +            
Sbjct  250   EERFSIPRVPAIVELCVQAGVDLPDLPTKRRRKPVIRIRKSEIIDADEDDLPDPKPDKFN  309

Query  939   ---MEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                ++   +S  + P   ++   L  ETL AW+TLR G  +L+  Y V+VC +C EVHVG
Sbjct  310   KPILDEIPDSDAIPPSSAEETASLSEETLEAWDTLRQGTGRLMRKYAVRVCGYCPEVHVG  369

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG FK++     H W+ A +DDL+PP  VWH  P   P L  E RN+YG AP
Sbjct  370   PSGHKAQNCGAFKHQQRNGQHGWQAAVLDDLIPPRFVWH-VPATEPELQRELRNFYGQAP  428

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV+LC + GA  P +Y   M++D
Sbjct  429   AVVELCVQGGARVPEQYKPTMRLD  452


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E +NA   L + + +L+ V PV+ CK+C+E+HVG +GH  + C     +  R +H W  A
Sbjct  166  EVMNARILLINNLKRLMKVVPVRACKYCNEIHVGQTGHPFKSCRGLHADKRRGLHEWTNA  225

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            +V+D+  P   +H   +    +  E R      PA+V+LC +AG   P
Sbjct  226  TVEDVFLPIEAYHLFDRLGKRISHEERFSIPRVPAIVELCVQAGVDLP  273



>ref|XP_002529388.1| APO protein 2, chloroplast precursor, putative [Ricinus communis]
 gb|EEF32984.1| APO protein 2, chloroplast precursor, putative [Ricinus communis]
Length=616

 Score =   201 bits (511),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 106/264 (40%), Positives = 146/264 (55%), Gaps = 33/264 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +   H W   +++ +L+P+E +HL +     I H
Sbjct  340   CGWCNEIHVGAVGHPFKSCKGKYATLRKGHHEWTNAAIEDVLLPIEAYHLFDRLGKRIPH  399

Query  1035  HERFDYSRISAVVELCLQAGAN-------------------------------PNDESID  949
              ERF   RI AVVELC+QAG N                               P  E  D
Sbjct  400   EERFSIPRIPAVVELCIQAGVNIPEYPTKRRRKPIIRISKSEFVDADESDLPDPIPEEYD  459

Query  948   ASKMEHESNSKIVLPFDQQ-MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                +   SNS+IV P D++ ++LL +ETL AWE +R G  KL+ VY V+VC +C EVHVG
Sbjct  460   KPLLTEISNSEIVAPSDEEDIKLLADETLRAWEKMRKGAKKLMKVYYVRVCGYCPEVHVG  519

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG  K++     H W+ A +DDL+PP  VWH    + P L  E RN+YG AP
Sbjct  520   PSGHKAQNCGAHKHQQRNGQHGWQAAVLDDLIPPRYVWHVPNINEP-LHRELRNFYGQAP  578

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C + GAI P +Y   M++D
Sbjct  579   AVVEICIQVGAIVPEEYKSTMRLD  602


 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 58/112 (52%), Gaps = 2/112 (2%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHF-  706
            L  +  NA  TL + + KLL V PV  C  C+E+HVG  GH  + C   KY + R+ H  
Sbjct  313  LAYDVYNARITLINNLKKLLKVVPVHACGWCNEIHVGAVGHPFKSCK-GKYATLRKGHHE  371

Query  705  WEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            W  A+++D++ P   +H   +    +  E R      PAVV+LC +AG   P
Sbjct  372  WTNAAIEDVLLPIEAYHLFDRLGKRIPHEERFSIPRIPAVVELCIQAGVNIP  423



>gb|KHN41432.1| APO protein 2, chloroplastic, partial [Glycine soja]
Length=276

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/263 (38%), Positives = 142/263 (54%), Gaps = 32/263 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             CR+C E++VG  GH  ++C G +   +  LH W    ++ ILIP+E +HL +     I H
Sbjct  1     CRWCSEIHVGPVGHPFKSCKGTQANIRKGLHEWTNAHVEDILIPIEAYHLFDRLGKRITH  60

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASK------------  940
              ERF   RI AVVELC+QAG                     E IDA +            
Sbjct  61    EERFSIPRIPAVVELCIQAGVEIPEFPTKRRRKPIIRIGRKEFIDADESDLPDKISEGPL  120

Query  939   ---MEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGP  769
                +    +S+IV P D ++  L  ETL AWE +R G  +L+ +Y V+VC +C E+HVG 
Sbjct  121   KPLLAEIHDSEIVAPLDNEVAPLAEETLQAWERMRKGAKRLMRMYNVRVCGYCPEIHVGA  180

Query  768   SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPA  589
              GHKA+ CG  K++     H W+ A ++DL+PP  VWH    + P L  E RN+YG APA
Sbjct  181   QGHKAQNCGAHKHQQRNGQHGWQSAVLNDLIPPRFVWHVPDVNAP-LERELRNFYGQAPA  239

Query  588   VVDLCTKAGAIAPSKYFCMMKVD  520
             VV++C +AGA  P +Y   M++D
Sbjct  240   VVEMCIQAGAGLPEQYKSTMRLD  262



>ref|XP_010679592.1| PREDICTED: APO protein 1, chloroplastic isoform X2 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010679593.1| PREDICTED: APO protein 1, chloroplastic isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=456

 Score =   197 bits (502),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/266 (41%), Positives = 151/266 (57%), Gaps = 35/266 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C EV V E GH ++ C G     +   H+W+KGS++ +LIP+E++HL + F   IKH
Sbjct  179   CSECSEVLVAEAGHQLKNCLGSSSNKRQGSHLWVKGSINDVLIPMESYHLFDPFGRRIKH  238

Query  1035  HERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------------EHESNSK  916
               RF+Y RI A+VELC+QAG +    P+   I+  +M                    +S 
Sbjct  239   ETRFNYDRIPAIVELCIQAGVDIPGYPSRRRINPIRMIGKKIIDRGGFLEDPTPEPRDSS  298

Query  915   IVLPFDQQMRLL-------------GNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
              +L +D Q  LL               ET+NA+ET+  GV KL+  Y VK C +C EVHV
Sbjct  299   ALLNYDTQGALLRFPPPAPSDLPRIAQETMNAYETVAVGVRKLMSKYSVKACGYCPEVHV  358

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGH  598
             GP GH A+LCG FK++     H W+ A+VD++ PPN V H R P+ PP L  E + +YG 
Sbjct  359   GPWGHDAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVLHVRDPRGPP-LTTELKRFYGK  417

Query  597   APAVVDLCTKAGAIAPSKYFCMMKVD  520
             APAVV++C +AGA  P KY  MM++D
Sbjct  418   APAVVEVCWQAGAEVPKKYKPMMRLD  443


 Score = 68.2 bits (165),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + +E LNAWE L  G+ +LL V PV  C  CSEV V  +GH+ + C        +  H W
Sbjct  152  IAHEVLNAWEGLIRGLAQLLHVIPVHACSECSEVLVAEAGHQLKNCLGSSSNKRQGSHLW  211

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
             K S++D++ P   +H        +  E R  Y   PA+V+LC +AG   P 
Sbjct  212  VKGSINDVLIPMESYHLFDPFGRRIKHETRFNYDRIPAIVELCIQAGVDIPG  263



>ref|XP_006652824.1| PREDICTED: APO protein 1, chloroplastic-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006652825.1| PREDICTED: APO protein 1, chloroplastic-like isoform X2 [Oryza 
brachyantha]
Length=424

 Score =   196 bits (499),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 111/279 (40%), Positives = 151/279 (54%), Gaps = 40/279 (14%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              LS LLN      CR CP+V+VG  GH I+ C G   + +N  H W++GS++ ILIP+E+
Sbjct  133   GLSQLLNTVTVYGCRKCPQVHVGPIGHQIQDCYGTGSQHRNSHHSWVRGSINDILIPIES  192

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN-PNDES-------------------  955
             +HL + F   +KH  RF+Y RI A+VELC+QAG + P   S                   
Sbjct  193   YHLFDPFGWRVKHDTRFNYDRIPAIVELCIQAGVDLPQYPSRRRTAPVRMIGKKVIDRGG  252

Query  954   -IDASKMEHE-------------SNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLV  817
              +D  K  H              SN +   P    +  L  +TL  +  LR GV +L+  
Sbjct  253   FVDEPKPHHAQDCTSLLAELDTFSNQQGQQPTPSNVTELAEKTLKTYLDLRRGVKQLMRK  312

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDP  637
             Y VK C +CSEVHVGP GH  +LCG FK++     H W+ A +DD++PPN VWH R    
Sbjct  313   YTVKTCGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVLDDVIPPNYVWHVRDPAG  372

Query  636   PLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             P L    R++YG APA+V+LC +AGA  P +Y  MM+ D
Sbjct  373   PPLRSSLRSFYGKAPAIVELCVQAGAKIPEEYRPMMRDD  411


 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 54/108 (50%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+ W+ L  G+ +LL    V  C+ C +VHVGP GH+ + C     +     H W + 
Sbjct  122  EVLDNWKVLIRGLSQLLNTVTVYGCRKCPQVHVGPIGHQIQDCYGTGSQHRNSHHSWVRG  181

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  + R  Y   PA+V+LC +AG   P
Sbjct  182  SINDILIPIESYHLFDPFGWRVKHDTRFNYDRIPAIVELCIQAGVDLP  229



>ref|XP_008225867.1| PREDICTED: APO protein 1, chloroplastic [Prunus mume]
Length=443

 Score =   197 bits (500),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/270 (38%), Positives = 148/270 (55%), Gaps = 35/270 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V  +GH ++ C G  +  +   H WIKGS++ IL+P+E +HL++ F   
Sbjct  161   VYGCNECSEVHVSHSGHHMQDCLGPTNSKRRSFHSWIKGSINDILVPIEAYHLYDPFGRR  220

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM--------------------  937
             IKH  RF Y RI A+VELC+QAG      P+       +M                    
Sbjct  221   IKHETRFQYDRIPAIVELCIQAGVEITEYPSRRRTKPIRMIGRKVIDRGGLVEEPQPWRA  280

Query  936   ----------EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
                        H +  +   P    +  +  ET++A+ET+R GV KL+  Y VK C +C+
Sbjct  281   ANPSSLVDLDTHGACERFPPPLPSDIPKIAQETMDAYETVRFGVTKLMKKYTVKACGYCT  340

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVHVGP GH A+LCG FK++     H W+ A+VD++ PPN VWH + P+ PP+     + 
Sbjct  341   EVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVKDPKGPPMKGGALKK  400

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             +YG APAVV++C +AGA  P KY  MM++D
Sbjct  401   FYGKAPAVVEVCLQAGAQIPEKYKPMMRLD  430


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + L+AW+ L  G+ +LL V PV  C  CSEVHV  SGH  + C        R  H W K 
Sbjct  140  QVLDAWKVLIKGLGQLLHVIPVYGCNECSEVHVSHSGHHMQDCLGPTNSKRRSFHSWIKG  199

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
            S++D++ P   +H        +  E R  Y   PA+V+LC +AG
Sbjct  200  SINDILVPIEAYHLYDPFGRRIKHETRFQYDRIPAIVELCIQAG  243


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 62/115 (54%), Gaps = 9/115 (8%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     +K 
Sbjct  336   CGYCTEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVKDPKGPPMKG  395

Query  1035  H--ERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
                ++F Y +  AVVE+CLQAGA   ++     +++      IV+P  ++ +L+ 
Sbjct  396   GALKKF-YGKAPAVVEVCLQAGAQIPEKYKPMMRLD------IVVPDSEEAQLVA  443



>ref|XP_006453603.1| hypothetical protein CICLE_v10008334mg [Citrus clementina]
 ref|XP_006453604.1| hypothetical protein CICLE_v10008334mg [Citrus clementina]
 gb|ESR66843.1| hypothetical protein CICLE_v10008334mg [Citrus clementina]
 gb|ESR66844.1| hypothetical protein CICLE_v10008334mg [Citrus clementina]
Length=435

 Score =   196 bits (499),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/264 (39%), Positives = 146/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W   +L+ IL+ VE +HL +     I+H
Sbjct  158   CVFCNEIHVGPVGHRFKSCKGPDSAFRKGLHEWTNAALEDILLQVEAYHLFDRLGKRIRH  217

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASK------------  940
              ERF   RI AV ELC+QAG    +                E IDA +            
Sbjct  218   DERFSIPRIPAVTELCIQAGVEIPEFPTKRRRKPIIRIGRKEFIDADESDLPEPDPPVPL  277

Query  939   ---MEHESNSKIVLPF-DQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                +    +S+IV P  +++  LL  ETL  WE +R G  +L+++YPV+VC +C EVHVG
Sbjct  278   KPILTEIPDSEIVAPSNEEETVLLAEETLQVWEKMRGGARRLMMMYPVRVCGYCPEVHVG  337

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P L  E +++YG AP
Sbjct  338   PSGHKAQNCGAFKHQQRNGQHGWQAAVLDDLIPPRYVWHVPDVNGPPLRREFKSFYGQAP  397

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M++D
Sbjct  398   AVVEICVQAGAAVPEQYKPTMRLD  421


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + LNA  TL + + KL  V PV  C  C+E+HVGP GH+ + C        + +H W  A
Sbjct  134  DVLNARITLINNLKKLWKVVPVHACVFCNEIHVGPVGHRFKSCKGPDSAFRKGLHEWTNA  193

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            +++D++     +H   +    +  + R      PAV +LC +AG   P 
Sbjct  194  ALEDILLQVEAYHLFDRLGKRIRHDERFSIPRIPAVTELCIQAGVEIPE  242



>ref|XP_007211631.1| hypothetical protein PRUPE_ppa005803mg [Prunus persica]
 gb|EMJ12830.1| hypothetical protein PRUPE_ppa005803mg [Prunus persica]
Length=443

 Score =   197 bits (500),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/270 (38%), Positives = 148/270 (55%), Gaps = 35/270 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V  +GH ++ C G  +  +   H WIKGS++ IL+P+E +HL++ F   
Sbjct  161   VYGCNECSEVHVSHSGHHMQDCLGPTNSKRRSFHSWIKGSINDILVPIEAYHLYDPFGRR  220

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM--------------------  937
             IKH  RF Y RI A+VELC+QAG      P+       +M                    
Sbjct  221   IKHETRFQYDRIPAIVELCIQAGVEIPEYPSRRRTKPIRMIGRKVIDRGGLVEEPQPWRA  280

Query  936   ----------EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
                        H +  +   P    +  +  ET++A+ET+R GV KL+  Y VK C +C+
Sbjct  281   ANPSSLVDLDTHGACERFPPPLPSDIPKIAQETMDAYETVRFGVTKLMKKYTVKACGYCT  340

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVHVGP GH A+LCG FK++     H W+ A+VD++ PPN VWH + P+ PP+     + 
Sbjct  341   EVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVKDPKGPPMKGGALKK  400

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             +YG APAVV++C +AGA  P KY  MM++D
Sbjct  401   FYGKAPAVVEVCLQAGAQIPEKYKPMMRLD  430


 Score = 67.8 bits (164),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + L+AW+ L  G+ +LL V PV  C  CSEVHV  SGH  + C        R  H W K 
Sbjct  140  QVLDAWKVLIKGLGQLLYVIPVYGCNECSEVHVSHSGHHMQDCLGPTNSKRRSFHSWIKG  199

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PA+V+LC +AG   P
Sbjct  200  SINDILVPIEAYHLYDPFGRRIKHETRFQYDRIPAIVELCIQAGVEIP  247



>ref|XP_004290815.1| PREDICTED: APO protein 2, chloroplastic-like [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   197 bits (502),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/263 (39%), Positives = 146/263 (56%), Gaps = 31/263 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWI-KGSLDSILIPVETFHLHNMFQNVIK  1039
             CR+C E++VG  GH  ++C G    ++  +H W+   ++D I +PVE FHL +     I 
Sbjct  207   CRFCNEIHVGPVGHPFKSCKGPDSGSRKGVHDWLMNATVDDIFLPVEAFHLFDRLGKRIP  266

Query  1038  HHERFDYSRISAVVELCLQAGAN-----------------------------PNDESIDA  946
             H ERF   RI AVVELC+QAG                               P  E    
Sbjct  267   HEERFAIPRIPAVVELCIQAGVEIPEYPTKRRRKPIIRIAKSEFVDADESELPEPEGPRG  326

Query  945   SKMEHESNSKIVLPFDQQMR-LLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGP  769
             + +    +S+IV P +++ R LL  ETL AWE +R G  +L+ +Y V+VC +C E+HVGP
Sbjct  327   TVLAELDDSEIVAPCNEEERILLAEETLQAWEQMRKGAKRLMKMYLVRVCGYCPEIHVGP  386

Query  768   SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPA  589
             SGHKA+ CG FK++     H W+ A ++DL+PP  VWH    + P L  E R++YG APA
Sbjct  387   SGHKAQNCGAFKHQQRNGQHGWQAAVLNDLIPPRYVWHVPDVNGPPLQRELRSFYGQAPA  446

Query  588   VVDLCTKAGAIAPSKYFCMMKVD  520
             VV++C +AGA  P +Y   M++D
Sbjct  447   VVEMCVQAGAAVPDEYRPTMRLD  469


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 56/109 (51%), Gaps = 1/109 (1%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW-EK  697
            +  NA  TL + + KLL V PV  C+ C+E+HVGP GH  + C      S + +H W   
Sbjct  183  DVYNARVTLINNLKKLLKVVPVHACRFCNEIHVGPVGHPFKSCKGPDSGSRKGVHDWLMN  242

Query  696  ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            A+VDD+  P   +H   +    +  E R      PAVV+LC +AG   P
Sbjct  243  ATVDDIFLPVEAFHLFDRLGKRIPHEERFAIPRIPAVVELCIQAGVEIP  291



>ref|XP_010679590.1| PREDICTED: APO protein 1, chloroplastic isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010679591.1| PREDICTED: APO protein 1, chloroplastic isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=469

 Score =   197 bits (501),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 109/266 (41%), Positives = 151/266 (57%), Gaps = 35/266 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C EV V E GH ++ C G     +   H+W+KGS++ +LIP+E++HL + F   IKH
Sbjct  192   CSECSEVLVAEAGHQLKNCLGSSSNKRQGSHLWVKGSINDVLIPMESYHLFDPFGRRIKH  251

Query  1035  HERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------------EHESNSK  916
               RF+Y RI A+VELC+QAG +    P+   I+  +M                    +S 
Sbjct  252   ETRFNYDRIPAIVELCIQAGVDIPGYPSRRRINPIRMIGKKIIDRGGFLEDPTPEPRDSS  311

Query  915   IVLPFDQQMRLL-------------GNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
              +L +D Q  LL               ET+NA+ET+  GV KL+  Y VK C +C EVHV
Sbjct  312   ALLNYDTQGALLRFPPPAPSDLPRIAQETMNAYETVAVGVRKLMSKYSVKACGYCPEVHV  371

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGH  598
             GP GH A+LCG FK++     H W+ A+VD++ PPN V H R P+ PP L  E + +YG 
Sbjct  372   GPWGHDAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVLHVRDPRGPP-LTTELKRFYGK  430

Query  597   APAVVDLCTKAGAIAPSKYFCMMKVD  520
             APAVV++C +AGA  P KY  MM++D
Sbjct  431   APAVVEVCWQAGAEVPKKYKPMMRLD  456


 Score = 68.2 bits (165),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 57/112 (51%), Gaps = 0/112 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + +E LNAWE L  G+ +LL V PV  C  CSEV V  +GH+ + C        +  H W
Sbjct  165  IAHEVLNAWEGLIRGLAQLLHVIPVHACSECSEVLVAEAGHQLKNCLGSSSNKRQGSHLW  224

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
             K S++D++ P   +H        +  E R  Y   PA+V+LC +AG   P 
Sbjct  225  VKGSINDVLIPMESYHLFDPFGRRIKHETRFNYDRIPAIVELCIQAGVDIPG  276



>ref|XP_009340319.1| PREDICTED: APO protein 1, chloroplastic-like isoform X2 [Pyrus 
x bretschneideri]
Length=438

 Score =   196 bits (498),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 107/270 (40%), Positives = 147/270 (54%), Gaps = 35/270 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V  +GH I+ C G     +   H WIKGS++ +L+P+E +HL + F   
Sbjct  156   VYGCTECSEVHVSHSGHHIQDCLGSTSAKRRSFHSWIKGSINDVLVPIEAYHLFDPFGRR  215

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDE--------------------------S  955
             IKH  RF Y RI AVVELC+QAG      P+                            S
Sbjct  216   IKHETRFQYDRIPAVVELCIQAGVEIPEYPSRRRTKPIRMIGRKVIDRGGLLEEPQPGCS  275

Query  954   IDASKM----EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
              D S +     H +  +   P    +  +  ET++A+ET+R GV +L+  Y VK C +CS
Sbjct  276   ADPSSLIDLDTHGACERFPPPLPVDIPRIAQETMDAYETVRLGVTRLMKKYTVKACGYCS  335

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVHVGP GH A+LCG FK++     H W+ ASVD++ PPN VWH   P+ PPL     + 
Sbjct  336   EVHVGPWGHNAKLCGEFKHQWRDGKHGWQDASVDEVFPPNYVWHVEDPKGPPLKGGALKK  395

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             +YG APAVV++C +AGA  P KY  MM++D
Sbjct  396   FYGKAPAVVEVCLQAGAQIPEKYKPMMRLD  425


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + L++W+ L  G+ +LL + PV  C  CSEVHV  SGH  + C        R  H W K 
Sbjct  135  QVLDSWKVLIKGIAQLLHIIPVYGCTECSEVHVSHSGHHIQDCLGSTSAKRRSFHSWIKG  194

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  195  SINDVLVPIEAYHLFDPFGRRIKHETRFQYDRIPAVVELCIQAGVEIP  242


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (54%), Gaps = 9/115 (8%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   S+D +  P   +H+ +     +K 
Sbjct  331   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDASVDEVFPPNYVWHVEDPKGPPLKG  390

Query  1035  H--ERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
                ++F Y +  AVVE+CLQAGA   ++     +++      IV+P  ++ +L+ 
Sbjct  391   GALKKF-YGKAPAVVEVCLQAGAQIPEKYKPMMRLD------IVVPESEEAQLVA  438



>ref|XP_002520827.1| APO protein 3, mitochondrial precursor, putative [Ricinus communis]
 gb|EEF41536.1| APO protein 3, mitochondrial precursor, putative [Ricinus communis]
Length=400

 Score =   195 bits (495),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 109/271 (40%), Positives = 151/271 (56%), Gaps = 36/271 (13%)
 Frame = -1

Query  1227  WLLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQN  1048
             ++L    C EV+V   GH I+ C G     ++  H WIKGS+D +L+PVE++HL++ F  
Sbjct  118   YILAGNECSEVHVAHTGHCIQDCLGQTSAKRHSFHSWIKGSIDDVLVPVESYHLYDPFGR  177

Query  1047  VIKHHERFDYSRISAVVELCLQAG-----------ANP----NDESIDASKMEHE-----  928
              IKH  RFDY RI AVVELC+QAG            NP      + ID      E     
Sbjct  178   RIKHETRFDYDRIPAVVELCIQAGVDKPEYPSRRRTNPVRMIGKKVIDRGGYVEEPTPWR  237

Query  927   -SNSKIVLPFD-------------QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHC  790
               N    + FD             + +  +  ET++A+E +RSGV KL+  Y VK C +C
Sbjct  238   SGNPTAPIDFDTYRACERFSPPSLEYVPRIAQETIDAFEIVRSGVRKLMRKYTVKACGYC  297

Query  789   SEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGR  613
             SEVHVGP GH  +LCG FK++     H W+ A+++++ PP  VWH R P+ PP L    +
Sbjct  298   SEVHVGPWGHNVKLCGEFKHQWRDGKHGWQDATLEEVFPPKYVWHVRDPKGPP-LKGALK  356

Query  612   NYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              +YG APAVV++C +AGA  P KY  MM++D
Sbjct  357   KFYGKAPAVVEMCMQAGAEIPEKYKPMMRLD  387



>ref|XP_008383289.1| PREDICTED: APO protein 1, chloroplastic-like [Malus domestica]
 ref|XP_008383290.1| PREDICTED: APO protein 1, chloroplastic-like [Malus domestica]
 ref|XP_008383291.1| PREDICTED: APO protein 1, chloroplastic-like [Malus domestica]
Length=443

 Score =   196 bits (498),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 148/270 (55%), Gaps = 35/270 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V  +GH I+ C G     +   H WIKGS++ +L+P+E +HL + F   
Sbjct  161   VYGCTECSEVHVSHSGHHIQDCLGSTSAKRRSFHSWIKGSINDVLVPIEAYHLFDPFGRR  220

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDE--------------------------S  955
             IKH  RF Y RI AVVELC+QAG      P+                            S
Sbjct  221   IKHETRFQYDRIPAVVELCIQAGVEIPEYPSRRRTKPIRMIGRKVIDRGGLLEEPQPGCS  280

Query  954   IDASKM----EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
              D S +     H +  +   P    +  +  +T++A+ET+R GV KL+  Y VK C +CS
Sbjct  281   ADPSSLVDLDTHGACERFPPPLPTDIPRIAQDTMDAYETVRLGVTKLMKKYTVKACGYCS  340

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVHVGP GH A+LCG FK++     H W+ A+VD+++PPN VWH   P+ PPL     + 
Sbjct  341   EVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVLPPNYVWHVEDPKGPPLKGGALKK  400

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             +YG APAVV++C +AGA  P KY  MM++D
Sbjct  401   FYGKAPAVVEVCLQAGARIPEKYKPMMRLD  430


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + ++ L++W+ L  G+ +LL V PV  C  CSEVHV  SGH  + C        R  H W
Sbjct  137  VAHQVLDSWKVLIKGMAQLLHVIPVYGCTECSEVHVSHSGHHIQDCLGSTSAKRRSFHSW  196

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             K S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  197  IKGSINDVLVPIEAYHLFDPFGRRIKHETRFQYDRIPAVVELCIQAGVEIP  247


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 63/115 (55%), Gaps = 9/115 (8%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +L P   +H+ +     +K 
Sbjct  336   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVLPPNYVWHVEDPKGPPLKG  395

Query  1035  H--ERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
                ++F Y +  AVVE+CLQAGA   ++     +++      IV+P  ++ +L+ 
Sbjct  396   GALKKF-YGKAPAVVEVCLQAGARIPEKYKPMMRLD------IVVPKSEEAQLVA  443



>ref|XP_009340317.1| PREDICTED: APO protein 1, chloroplastic-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009340318.1| PREDICTED: APO protein 1, chloroplastic-like isoform X1 [Pyrus 
x bretschneideri]
Length=443

 Score =   196 bits (498),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 107/270 (40%), Positives = 147/270 (54%), Gaps = 35/270 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V  +GH I+ C G     +   H WIKGS++ +L+P+E +HL + F   
Sbjct  161   VYGCTECSEVHVSHSGHHIQDCLGSTSAKRRSFHSWIKGSINDVLVPIEAYHLFDPFGRR  220

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDE--------------------------S  955
             IKH  RF Y RI AVVELC+QAG      P+                            S
Sbjct  221   IKHETRFQYDRIPAVVELCIQAGVEIPEYPSRRRTKPIRMIGRKVIDRGGLLEEPQPGCS  280

Query  954   IDASKM----EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
              D S +     H +  +   P    +  +  ET++A+ET+R GV +L+  Y VK C +CS
Sbjct  281   ADPSSLIDLDTHGACERFPPPLPVDIPRIAQETMDAYETVRLGVTRLMKKYTVKACGYCS  340

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVHVGP GH A+LCG FK++     H W+ ASVD++ PPN VWH   P+ PPL     + 
Sbjct  341   EVHVGPWGHNAKLCGEFKHQWRDGKHGWQDASVDEVFPPNYVWHVEDPKGPPLKGGALKK  400

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             +YG APAVV++C +AGA  P KY  MM++D
Sbjct  401   FYGKAPAVVEVCLQAGAQIPEKYKPMMRLD  430


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + L++W+ L  G+ +LL + PV  C  CSEVHV  SGH  + C        R  H W K 
Sbjct  140  QVLDSWKVLIKGIAQLLHIIPVYGCTECSEVHVSHSGHHIQDCLGSTSAKRRSFHSWIKG  199

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  200  SINDVLVPIEAYHLFDPFGRRIKHETRFQYDRIPAVVELCIQAGVEIP  247


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (54%), Gaps = 9/115 (8%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   S+D +  P   +H+ +     +K 
Sbjct  336   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDASVDEVFPPNYVWHVEDPKGPPLKG  395

Query  1035  H--ERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
                ++F Y +  AVVE+CLQAGA   ++     +++      IV+P  ++ +L+ 
Sbjct  396   GALKKF-YGKAPAVVEVCLQAGAQIPEKYKPMMRLD------IVVPESEEAQLVA  443



>ref|XP_004149527.1| PREDICTED: APO protein 1, chloroplastic-like [Cucumis sativus]
 ref|XP_004162576.1| PREDICTED: APO protein 1, chloroplastic-like [Cucumis sativus]
 gb|KGN54971.1| hypothetical protein Csa_4G617380 [Cucumis sativus]
Length=443

 Score =   196 bits (497),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 151/267 (57%), Gaps = 36/267 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             CR C EV+V  +GH I+ C G    T+   H W+ GS++ +L+P+E++HL++ F   IKH
Sbjct  165   CRECSEVHVAHSGHHIQDCLGATSATRRSFHSWVTGSINDVLVPIESYHLYDPFGRRIKH  224

Query  1035  HERFDYSRISAVVELCLQAGAN-PNDESIDASKMEHESNSKIV-----------------  910
               RF+Y RI AVVELC+QAG + P   S   +K       K++                 
Sbjct  225   ETRFEYDRIPAVVELCIQAGVDIPEYPSRRRTKPIQMIGKKVIDRGGNMEEPKPWKSCDS  284

Query  909   ---LPFDQQ-------------MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVH  778
                L FD Q             +  +  ET+ A+ET+R GV  L+  Y VK C +C EVH
Sbjct  285   YPLLDFDTQGAPQRFAPPLPEDVPRIAQETIAAYETVRYGVRMLMKKYTVKACGYCPEVH  344

Query  777   VGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYG  601
             VGP GH A+LCG FK++     H W+ A++D+++P N VWH R P+ PPL+    R +YG
Sbjct  345   VGPWGHNAKLCGEFKHQWRDGKHGWQDATLDEVLPRNYVWHVRDPKGPPLIGTLKR-FYG  403

Query  600   HAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              APAVV++C +AGA  P KY  MM++D
Sbjct  404   KAPAVVEVCIQAGATIPKKYLPMMRLD  430


 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + ++ ++AW+ L  G+  LL V PV  C+ CSEVHV  SGH  + C      + R  H W
Sbjct  138  VAHQVMDAWKILIKGLSHLLHVIPVYACRECSEVHVAHSGHHIQDCLGATSATRRSFHSW  197

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
               S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  198  VTGSINDVLVPIESYHLYDPFGRRIKHETRFEYDRIPAVVELCIQAGVDIP  248


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 61/111 (55%), Gaps = 8/111 (7%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVIK  1039
             C YCPEV+VG  GH  + CG ++H+ ++  H W   +LD +L     +H+ +     +I 
Sbjct  337   CGYCPEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATLDEVLPRNYVWHVRDPKGPPLIG  396

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMR  886
               +RF Y +  AVVE+C+QAGA    + +   +++      IVLP  ++ R
Sbjct  397   TLKRF-YGKAPAVVEVCIQAGATIPKKYLPMMRLD------IVLPDSEEAR  440



>ref|XP_011083963.1| PREDICTED: APO protein 2, chloroplastic [Sesamum indicum]
 ref|XP_011083964.1| PREDICTED: APO protein 2, chloroplastic [Sesamum indicum]
Length=437

 Score =   196 bits (497),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 148/264 (56%), Gaps = 33/264 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++C E++VG  GH  ++C G +   +   H W++  ++ +L+PVE +HL++     I H
Sbjct  161   CKWCSEIHVGPVGHPFKSCRGPQASIRKGAHEWVEAVVEDMLVPVEAYHLYDRLGKRISH  220

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKMEHES-------  925
              ERF   RI AVVELC+QAG +  +                E +DA + E          
Sbjct  221   EERFSIPRIPAVVELCIQAGVDLTEYPTKRRRKPVIRIGRKEFVDADESELPDPDPDAPK  280

Query  924   --------NSKIVLPFDQQ-MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +S+IV P  ++   LL  ETL  WE +R G  +L+ +YPV+VC +C EVHVG
Sbjct  281   PEILAEILDSEIVPPSGKEDTALLAEETLTVWEEMREGAKRLMKMYPVRVCGYCPEVHVG  340

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG  K++     H W+ A +DDL+PP  VWH    + P L  E RN+YG AP
Sbjct  341   PTGHKAQNCGAHKHQQRNGQHGWQAAVLDDLIPPKFVWHVPDVNKP-LERELRNFYGQAP  399

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV+LC +AGA  P KY   M++D
Sbjct  400   AVVELCVQAGAAVPEKYKPTMRLD  423


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + LNA  TL + + KLL V PV  CK CSE+HVGP GH  + C   +    +  H W +A
Sbjct  137  KVLNARITLINNLKKLLKVMPVNACKWCSEIHVGPVGHPFKSCRGPQASIRKGAHEWVEA  196

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
             V+D++ P   +H   +    +  E R      PAVV+LC +AG
Sbjct  197  VVEDMLVPVEAYHLYDRLGKRISHEERFSIPRIPAVVELCIQAG  240



>emb|CDP10244.1| unnamed protein product [Coffea canephora]
Length=438

 Score =   195 bits (496),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/265 (38%), Positives = 148/265 (56%), Gaps = 33/265 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C++C E++VG+ GH  R+C G     +   H W    ++ IL+P+E +HL++  Q  I 
Sbjct  161   GCKWCNEIHVGQFGHPFRSCKGPTASIRKGEHEWGDAVIEDILVPIEAYHLYDRLQRRIT  220

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDASKME-HESNSKIV  910
             H ERF   RI A+VELC+QAG +                   E IDA + +  +  ++  
Sbjct  221   HDERFSIPRIPALVELCIQAGVDLPEYPTKRRRKPIIRIGKSEFIDADESDLPDPETEAP  280

Query  909   LP---------------FDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
             +P                 +++ +L  ETL AWE +R G  +L+ +YPV+VC +C EVHV
Sbjct  281   MPRILTEIPDGEINPPSSAEEIAVLAEETLQAWEKMRKGAKRLMKMYPVRVCGYCPEVHV  340

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GPSGHKA++CG +K++     H W+ A +DDL+PP  VWH    + P L  E RN+YG A
Sbjct  341   GPSGHKAQVCGAYKHQQRNGQHGWQTAVLDDLIPPRYVWHVPDVNKP-LARELRNFYGQA  399

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV++C +AGA  P  Y   M++D
Sbjct  400   PAVVEICIQAGAAVPEHYKPTMRLD  424


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L    LNA  TL + + KLL V PV+ CK C+E+HVG  GH  R C        +  H W
Sbjct  135  LAYSVLNARITLINNLKKLLKVVPVQGCKWCNEIHVGQFGHPFRSCKGPTASIRKGEHEW  194

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              A ++D++ P   +H   +    +  + R      PA+V+LC +AG   P
Sbjct  195  GDAVIEDILVPIEAYHLYDRLQRRITHDERFSIPRIPALVELCIQAGVDLP  245



>ref|XP_010106787.1| APO protein 2 [Morus notabilis]
 gb|EXC11815.1| APO protein 2 [Morus notabilis]
Length=443

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/264 (39%), Positives = 147/264 (56%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             CR+C E++VG  GH  R+C G     +  +H W   ++D I +P+E +HL++     I H
Sbjct  166   CRWCNEIHVGPTGHPFRSCRGQNASIRKGIHDWATATVDDIFLPIEAYHLYDRLGKRIPH  225

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKME---HESNS--  919
              +RF   RI AVVELC+QAG +  D                E +DA + E    + N+  
Sbjct  226   AQRFSIPRIPAVVELCIQAGVDIPDFPAKRRRKPIIRIGKSEFVDADESELPDPDPNAPK  285

Query  918   ----------KIVLP-FDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                       +IV P  +++  LL  ETL AWE +R G  +L+ +YPV+VC +C EVHVG
Sbjct  286   RPVLTEIPGFEIVGPSSEEETTLLAKETLQAWEQMRKGAQRLMKLYPVRVCGYCPEVHVG  345

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG  K++     H W+ A +DDL+ P  VWH    +   L  E RN+YG AP
Sbjct  346   PSGHKAQNCGAHKHQQRNGQHGWQAAVLDDLIAPRYVWHVPDVNGLTLERELRNFYGQAP  405

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M++D
Sbjct  406   AVVEMCIQAGAAVPDQYKGTMRLD  429


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  +  NA  TL + + KLL V PV  C+ C+E+HVGP+GH  R C        + IH W
Sbjct  139  LAYDVYNARITLINNLKKLLKVVPVHACRWCNEIHVGPTGHPFRSCRGQNASIRKGIHDW  198

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              A+VDD+  P   +H   +    +    R      PAVV+LC +AG   P
Sbjct  199  ATATVDDIFLPIEAYHLYDRLGKRIPHAQRFSIPRIPAVVELCIQAGVDIP  249



>ref|XP_007021823.1| APO protein 1, chloroplastic isoform 2 [Theobroma cacao]
 gb|EOY13348.1| APO protein 1, chloroplastic isoform 2 [Theobroma cacao]
Length=403

 Score =   194 bits (493),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 159/281 (57%), Gaps = 39/281 (14%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V   GH I+ C G     ++ LH W+KGS++ +LIP+E++HL++ F   
Sbjct  120   VYGCSECSEVHVAHTGHHIQDCKGPSSSKRHGLHSWVKGSINDVLIPIESYHLYDPFGRR  179

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKMEHE-----------------  928
             IKH  RF+Y RI AVVELC+QAG +    P+       +M  +                 
Sbjct  180   IKHDTRFEYDRIPAVVELCIQAGVDIPEYPSRRRTKPIRMMGKKVIDRGGYVDEPKPWRS  239

Query  927   ---SNSKIV------------LPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
                S+S IV             P  + +  +  ET+NA E +RSGV KL+  Y VK C +
Sbjct  240   VDPSSSSIVDLDTCGACGRFPAPPLEDVPSIAQETMNAHEIVRSGVTKLMRKYTVKACGY  299

Query  792   CSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEG  616
             CSEVHVGP GH A+LCG FK++     H W+ A+V ++ PPN VWH + P+ PPL     
Sbjct  300   CSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVAEVFPPNYVWHVQDPKGPPLRGALT  359

Query  615   RNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAPISDK  493
             R +YG APAVV++C +AGA  PS+Y  MM++D +  P SD+
Sbjct  360   R-FYGKAPAVVEVCMQAGAQVPSRYKPMMRLD-IIVPESDE  398


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + L+AW+ L  G+ +LL V PV  C  CSEVHV  +GH  + C          +H W K 
Sbjct  99   DVLDAWKVLIKGLAQLLHVIPVYGCSECSEVHVAHTGHHIQDCKGPSSSKRHGLHSWVKG  158

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  + R  Y   PAVV+LC +AG   P
Sbjct  159  SINDVLIPIESYHLYDPFGRRIKHDTRFEYDRIPAVVELCIQAGVDIP  206



>gb|EYU27201.1| hypothetical protein MIMGU_mgv1a007941mg [Erythranthe guttata]
Length=390

 Score =   194 bits (492),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/262 (39%), Positives = 145/262 (55%), Gaps = 30/262 (11%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C E++VG  GH I+ C G     +   H+WIK S++ +LIP+E++H+ + F   IKH
Sbjct  116   CSECSEIHVGLIGHDIQDCRGTTSGARRSHHLWIKASINDVLIPIESYHMFDPFGRRIKH  175

Query  1035  HERFDYSRISAVVELCLQAGAN----PNDESIDASKM-----------------------  937
               RF+Y RI AVVELC+QAG      P+    +  +M                       
Sbjct  176   ETRFNYDRIPAVVELCIQAGVELQEYPSRRRTEPIRMIGRKVIEMGGIVEEPPLCGSLVA  235

Query  936   ---EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPS  766
                 H ++ +   P  +++  +  ETL A+E ++ GV KL+  Y VK C +CSEVHVGP 
Sbjct  236   ELDTHSASGRFPPPSKEEVPAVARETLFAYERVKWGVRKLMRKYTVKACGYCSEVHVGPW  295

Query  765   GHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAV  586
             GH A+LCG FK++     H W+ A+VD++ PPN VWH      P L    + +YG APAV
Sbjct  296   GHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVEDPTGPALTSGLKRFYGKAPAV  355

Query  585   VDLCTKAGAIAPSKYFCMMKVD  520
             V++C +AGA  P KY  MM++D
Sbjct  356   VEVCVQAGASVPEKYKPMMRLD  377


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 59/112 (53%), Gaps = 0/112 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            Q +  +  + L++W+ L  G+ +L+ V PV  C  CSE+HVG  GH  + C      + R
Sbjct  84   QDLIPVAYQVLDSWKVLIKGLAQLMHVVPVHACSECSEIHVGLIGHDIQDCRGTTSGARR  143

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
              H W KAS++D++ P   +H        +  E R  Y   PAVV+LC +AG
Sbjct  144  SHHLWIKASINDVLIPIESYHMFDPFGRRIKHETRFNYDRIPAVVELCIQAG  195


 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     +  
Sbjct  284   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVEDPTGPALTS  343

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA+  ++     +++      IV+P D++ RL+ 
Sbjct  344   GLKRFYGKAPAVVEVCVQAGASVPEKYKPMMRLD------IVVPEDEEARLIA  390



>gb|EEE61681.1| hypothetical protein OsJ_16150 [Oryza sativa Japonica Group]
Length=424

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/279 (40%), Positives = 150/279 (54%), Gaps = 40/279 (14%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              LS LLN      CR CP+V+VG  GH I+ C G   + +N  H W++GS++ +LIP+E+
Sbjct  133   GLSQLLNVGTVYGCRKCPQVHVGPVGHQIQDCYGTGSQRRNSHHSWVRGSVNDVLIPIES  192

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------  937
             +H  + F   +KH  RFDY RI A+VELC+QAG      P+       +M          
Sbjct  193   YHQFDPFGWRVKHETRFDYDRIPAIVELCIQAGVELPQYPSRRRTAPVRMIGKKVIDRGG  252

Query  936   ------EHESNSKIVL-----PFDQQ---------MRLLGNETLNAWETLRSGVHKLLLV  817
                    H S   I L      F  Q         +  L  +TL A+  ++ GV +L+  
Sbjct  253   FVDGPKPHRSEDCISLLAELDTFSNQQGQSSTPSNVEELAEKTLKAYLNVQRGVARLMRK  312

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDP  637
             Y VK C +CSEVHVGP GH  +LCG FK++     H W+ A VDD++PPN VWH R    
Sbjct  313   YTVKTCGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDDVIPPNYVWHVRDPTG  372

Query  636   PLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             P L    R++YG APAVV+LC +AGA  P +Y  MM+ D
Sbjct  373   PPLRSSLRSFYGKAPAVVELCVQAGAEIPEEYRPMMRAD  411


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 59/112 (53%), Gaps = 6/112 (5%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C YC EV+VG  GH ++ CG ++H+ ++  H W    +D ++ P   +H+ +     ++
Sbjct  317   TCGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDDVIPPNYVWHVRDPTGPPLR  376

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRL  883
                R  Y +  AVVELC+QAGA   +E     + +      +V+P  ++ RL
Sbjct  377   SSLRSFYGKAPAVVELCVQAGAEIPEEYRPMMRAD------VVIPDSEEARL  422


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 4/110 (4%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI--HFWE  700
            E L+ W+ L  G+ +LL V  V  C+ C +VHVGP GH+ + C  +   S RR   H W 
Sbjct  122  EVLDNWKVLIRGLSQLLNVGTVYGCRKCPQVHVGPVGHQIQDC--YGTGSQRRNSHHSWV  179

Query  699  KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            + SV+D++ P   +H+       +  E R  Y   PA+V+LC +AG   P
Sbjct  180  RGSVNDVLIPIESYHQFDPFGWRVKHETRFDYDRIPAIVELCIQAGVELP  229



>ref|XP_010273620.1| PREDICTED: APO protein 2, chloroplastic [Nelumbo nucifera]
Length=452

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 149/264 (56%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++C E++VG  GH  ++C G +   +  LH W K +++ +L+P+E +HL +     I H
Sbjct  175   CKWCNEIHVGPVGHPFKSCRGQKAGARKGLHEWTKATVEDVLLPIEAYHLFDRLGRRIAH  234

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKME-----HESNS  919
              ERF   R+ A+VELC+QAG +  D                E IDA + +      ++N 
Sbjct  235   EERFSIPRVPAIVELCVQAGLDLPDLPTKRRRKPVIRVGKSEIIDADEDDLPDPIPDTNR  294

Query  918   KIVL-----------PFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
             K +L              +++ LL   TL AW+ +R G  KL+  YPV+VC +C EVHVG
Sbjct  295   KPILTEIPDLEIIPPSTSEEVALLSEATLKAWQKMRDGALKLMKKYPVRVCGYCPEVHVG  354

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG +K++     H W+ A +DDL+PP  VWH    + P L  E R++YG AP
Sbjct  355   PSGHKAQNCGAYKHQQRNGQHGWQAAVLDDLIPPRYVWHVLDVNGPPLQVELRSFYGQAP  414

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C + GA+ P +Y   M++D
Sbjct  415   AVVEMCVQGGAVVPEQYKPTMRLD  438


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 59/108 (55%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E  NA  TL + + KL+ V PV  CK C+E+HVGP GH  + C   K  + + +H W KA
Sbjct  151  EVFNARITLINNLKKLIKVVPVHACKWCNEIHVGPVGHPFKSCRGQKAGARKGLHEWTKA  210

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            +V+D++ P   +H   +    +  E R      PA+V+LC +AG   P
Sbjct  211  TVEDVLLPIEAYHLFDRLGRRIAHEERFSIPRVPAIVELCVQAGLDLP  258



>gb|EEC78001.1| hypothetical protein OsI_17394 [Oryza sativa Indica Group]
Length=438

 Score =   195 bits (495),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/279 (40%), Positives = 150/279 (54%), Gaps = 40/279 (14%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              LS LLN      CR CP+V+VG  GH I+ C G   + +N  H W++GS++ +LIP+E+
Sbjct  147   GLSQLLNVGTVYGCRKCPQVHVGPVGHQIQDCYGTGSQRRNSHHSWVRGSVNDVLIPIES  206

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------  937
             +H  + F   +KH  RFDY RI A+VELC+QAG      P+       +M          
Sbjct  207   YHQFDPFGWRVKHETRFDYDRIPAIVELCIQAGVELPQYPSRRRTAPVRMIGKKVIDRGG  266

Query  936   ------EHESNSKIVL-----PFDQQ---------MRLLGNETLNAWETLRSGVHKLLLV  817
                    H S   I L      F  Q         +  L  +TL A+  ++ GV +L+  
Sbjct  267   FVDGPKPHRSEDCISLLAELDTFSNQQGQSSMPSNVEELAEKTLKAYLNVQRGVARLMRK  326

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDP  637
             Y VK C +CSEVHVGP GH  +LCG FK++     H W+ A VDD++PPN VWH R    
Sbjct  327   YTVKTCGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDDVIPPNYVWHVRDPTG  386

Query  636   PLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             P L    R++YG APAVV+LC +AGA  P +Y  MM+ D
Sbjct  387   PPLRSSLRSFYGKAPAVVELCVQAGAEIPEEYRPMMRAD  425


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 59/112 (53%), Gaps = 6/112 (5%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C YC EV+VG  GH ++ CG ++H+ ++  H W    +D ++ P   +H+ +     ++
Sbjct  331   TCGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDDVIPPNYVWHVRDPTGPPLR  390

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRL  883
                R  Y +  AVVELC+QAGA   +E     + +      +V+P  ++ RL
Sbjct  391   SSLRSFYGKAPAVVELCVQAGAEIPEEYRPMMRAD------VVIPDSEEARL  436


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 4/110 (4%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI--HFWE  700
            E L+ W+ L  G+ +LL V  V  C+ C +VHVGP GH+ + C  +   S RR   H W 
Sbjct  136  EVLDNWKVLIRGLSQLLNVGTVYGCRKCPQVHVGPVGHQIQDC--YGTGSQRRNSHHSWV  193

Query  699  KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            + SV+D++ P   +H+       +  E R  Y   PA+V+LC +AG   P
Sbjct  194  RGSVNDVLIPIESYHQFDPFGWRVKHETRFDYDRIPAIVELCIQAGVELP  243



>gb|KEH38305.1| APO RNA-binding protein [Medicago truncatula]
Length=329

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 145/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G +   +  +H W    ++ ILIP++ FHL++     I H
Sbjct  52    CGWCSEIHVGPVGHPFKSCKGTQSNIRKGIHEWTNAHVEDILIPIDAFHLYDRLGKRITH  111

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKME----------  934
              +RF   RI AVVELC+QAG    +                E +DA + E          
Sbjct  112   EQRFSIPRIPAVVELCIQAGVKIREFPTKRRRKPIIRIGKKEFVDADESELPDEVPDNPT  171

Query  933   -----HESNSKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +S IV P +++  + L  ETL AWE +R G  +L+ +Y V+VC +C E+HVG
Sbjct  172   QPLIAEIPDSDIVAPVNKEEVVHLAEETLQAWEQMRKGTKRLMRMYHVRVCGYCPEIHVG  231

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG  K++     H W+ A +DDL+PP  VWH    + P L  E +N+YG AP
Sbjct  232   PSGHKAQNCGAHKHQQRNGQHGWQSAVLDDLIPPRFVWHVPDVNGPPLERELKNFYGQAP  291

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M++D
Sbjct  292   AVVEMCIQAGAALPEQYKSTMRLD  315


 Score = 64.7 bits (156),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            +  NA  TL + + KLL V PV  C  CSE+HVGP GH  + C   +    + IH W  A
Sbjct  28   DVYNARITLINNLKKLLKVVPVHACGWCSEIHVGPVGHPFKSCKGTQSNIRKGIHEWTNA  87

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
             V+D++ P   +H   +    +  E R      PAVV+LC +AG
Sbjct  88   HVEDILIPIDAFHLYDRLGKRITHEQRFSIPRIPAVVELCIQAG  131



>ref|XP_007021822.1| APO protein 1, chloroplastic isoform 1 [Theobroma cacao]
 gb|EOY13347.1| APO protein 1, chloroplastic isoform 1 [Theobroma cacao]
Length=441

 Score =   194 bits (493),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 113/281 (40%), Positives = 159/281 (57%), Gaps = 39/281 (14%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V   GH I+ C G     ++ LH W+KGS++ +LIP+E++HL++ F   
Sbjct  158   VYGCSECSEVHVAHTGHHIQDCKGPSSSKRHGLHSWVKGSINDVLIPIESYHLYDPFGRR  217

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKMEHE-----------------  928
             IKH  RF+Y RI AVVELC+QAG +    P+       +M  +                 
Sbjct  218   IKHDTRFEYDRIPAVVELCIQAGVDIPEYPSRRRTKPIRMMGKKVIDRGGYVDEPKPWRS  277

Query  927   ---SNSKIV------------LPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
                S+S IV             P  + +  +  ET+NA E +RSGV KL+  Y VK C +
Sbjct  278   VDPSSSSIVDLDTCGACGRFPAPPLEDVPSIAQETMNAHEIVRSGVTKLMRKYTVKACGY  337

Query  792   CSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEG  616
             CSEVHVGP GH A+LCG FK++     H W+ A+V ++ PPN VWH + P+ PPL     
Sbjct  338   CSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVAEVFPPNYVWHVQDPKGPPLRGALT  397

Query  615   RNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAPISDK  493
             R +YG APAVV++C +AGA  PS+Y  MM++D +  P SD+
Sbjct  398   R-FYGKAPAVVEVCMQAGAQVPSRYKPMMRLD-IIVPESDE  436


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + L+AW+ L  G+ +LL V PV  C  CSEVHV  +GH  + C          +H W K 
Sbjct  137  DVLDAWKVLIKGLAQLLHVIPVYGCSECSEVHVAHTGHHIQDCKGPSSSKRHGLHSWVKG  196

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  + R  Y   PAVV+LC +AG   P
Sbjct  197  SINDVLIPIESYHLYDPFGRRIKHDTRFEYDRIPAVVELCIQAGVDIP  244



>ref|XP_007011910.1| APO protein 2, chloroplast, putative [Theobroma cacao]
 gb|EOY29529.1| APO protein 2, chloroplast, putative [Theobroma cacao]
Length=454

 Score =   194 bits (494),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/264 (39%), Positives = 146/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC E++VG  GH  ++C G     +  LH W   +++ +L+PV+ +HL++     I+H
Sbjct  177   CGYCNEIHVGPVGHPFKSCRGQHASFRKGLHEWTYATVEDVLLPVDAYHLYDRLGKRIRH  236

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKMEHES-------  925
              ERF   RI AVVELC+QAG N  +                E IDA + E          
Sbjct  237   DERFSIPRIPAVVELCIQAGVNLPEFLTKRRRKTIIRIGKREFIDADESELPDPVPEVPL  296

Query  924   --------NSKIVLPFDQQMR-LLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     + ++V P D++   LL  ETL AWE +R G  KL+ +YPV+VC +C EVHVG
Sbjct  297   KAILTEIPDPEVVAPCDEEETILLAEETLQAWEQMRRGAKKLMRMYPVRVCGYCPEVHVG  356

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG  K++     H W+ A +DDL+PP  VWH        L  E R++YG AP
Sbjct  357   PSGHKAQNCGAHKHQQRNGQHGWQAAVLDDLIPPRYVWHVPDVKGLPLQRELRSFYGQAP  416

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M++D
Sbjct  417   AVVEICVQAGAAVPDQYKPTMRLD  440


 Score = 52.0 bits (123),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 62/112 (55%), Gaps = 2/112 (2%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRR-IHF  706
            L  + LNA  TL + + KLL V  V  C +C+E+HVGP GH  + C   ++ S+R+ +H 
Sbjct  150  LAYDVLNARVTLINNLKKLLKVVKVHACGYCNEIHVGPVGHPFKSCR-GQHASFRKGLHE  208

Query  705  WEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            W  A+V+D++ P   +H   +    +  + R      PAVV+LC +AG   P
Sbjct  209  WTYATVEDVLLPVDAYHLYDRLGKRIRHDERFSIPRIPAVVELCIQAGVNLP  260



>ref|XP_008464665.1| PREDICTED: APO protein 1, chloroplastic [Cucumis melo]
Length=443

 Score =   194 bits (492),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/267 (40%), Positives = 150/267 (56%), Gaps = 36/267 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             CR C EV+V  +GH I+ C G     +   H W+ GS++ +L+P+E++HL++ F   IKH
Sbjct  165   CRECSEVHVAHSGHHIQDCLGSTSAMRRSFHSWVTGSINDVLVPIESYHLYDPFGRRIKH  224

Query  1035  HERFDYSRISAVVELCLQAGAN-PNDESIDASKMEHESNSKIV-----------------  910
               RF+Y RI AVVELC+QAG + P   S   +K       K++                 
Sbjct  225   ETRFEYDRIPAVVELCIQAGVDIPEYPSRRRTKPIRMIGKKVIDRGGNMEEPKPWQSCES  284

Query  909   ---LPFDQQ-------------MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVH  778
                L FD Q             +  +  ET+ A+ET+R GV  L+  Y VK C +C EVH
Sbjct  285   YPLLDFDTQGASQRFAPPLPDDVPRIAQETIEAYETVRYGVRMLMKKYTVKACGYCPEVH  344

Query  777   VGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYG  601
             VGP GH A+LCG FK++     H W+ A++D+++P N VWH R P+ PPL+    R +YG
Sbjct  345   VGPWGHNAKLCGEFKHQWRDGKHGWQDATLDEVLPRNYVWHVRDPKGPPLIGTLKR-FYG  403

Query  600   HAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              APAVV++C +AGA  P KY  MM++D
Sbjct  404   KAPAVVEVCMQAGATIPKKYLPMMRLD  430


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + ++ L+AW+ L  G+  LL V PV  C+ CSEVHV  SGH  + C        R  H W
Sbjct  138  VAHQVLDAWKILIKGLSHLLHVIPVYACRECSEVHVAHSGHHIQDCLGSTSAMRRSFHSW  197

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
               S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  198  VTGSINDVLVPIESYHLYDPFGRRIKHETRFEYDRIPAVVELCIQAGVDIP  248


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 61/111 (55%), Gaps = 8/111 (7%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVIK  1039
             C YCPEV+VG  GH  + CG ++H+ ++  H W   +LD +L     +H+ +     +I 
Sbjct  337   CGYCPEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATLDEVLPRNYVWHVRDPKGPPLIG  396

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMR  886
               +RF Y +  AVVE+C+QAGA    + +   +++      IVLP  ++ R
Sbjct  397   TLKRF-YGKAPAVVEVCMQAGATIPKKYLPMMRLD------IVLPDGEEAR  440



>ref|XP_010536974.1| PREDICTED: APO protein 2, chloroplastic [Tarenaya hassleriana]
Length=436

 Score =   194 bits (492),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 146/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G +   +  LH W K +++ ++IP+E +HL++     I+H
Sbjct  159   CGWCNEIHVGPYGHPFKSCKGQKASQRKGLHEWTKAAIEDVIIPLEAYHLYDRLGKRIRH  218

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASK------------  940
              ERF   RI A+VELC+QAG   ++                E IDA +            
Sbjct  219   EERFSVPRIPAIVELCIQAGVELHEFPAKRRRKPIIRIGKSEFIDADESELPDPEPQAPP  278

Query  939   ----MEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                 ME   +  +    +++   L  ETL AWE +R+G  KL+ +Y V+VC +C EVH+G
Sbjct  279   MPLLMELPDSEAVAPSSEEETIFLAEETLRAWEEMRNGTKKLMRMYKVRVCGYCPEVHIG  338

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG +K++     H W+ A +DDL+P   VWH    + P L  E RN+YG AP
Sbjct  339   PTGHKAQNCGAYKHQQRNGQHGWQSAVLDDLIPTRYVWHLPDINGPPLQRELRNFYGQAP  398

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P  Y   M+++
Sbjct  399   AVVEICVQAGAAVPETYKPTMRLE  422


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 54/107 (50%), Gaps = 0/107 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L     NA   L + + +L+ V  V  C  C+E+HVGP GH  + C   K    + +H W
Sbjct  132  LAYRVYNARIRLINNLKRLMKVVRVHACGWCNEIHVGPYGHPFKSCKGQKASQRKGLHEW  191

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
             KA+++D++ P   +H   +    +  E R      PA+V+LC +AG
Sbjct  192  TKAAIEDVIIPLEAYHLYDRLGKRIRHEERFSVPRIPAIVELCIQAG  238



>ref|XP_010483349.1| PREDICTED: APO protein 2, chloroplastic [Camelina sativa]
Length=444

 Score =   194 bits (492),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 97/264 (37%), Positives = 145/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W    ++ +++P+E +HL++     I+H
Sbjct  167   CGWCNEIHVGPYGHPFKSCKGPNASQRKGLHEWTNSVIEDVIVPLEAYHLYDRLGKRIRH  226

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHESN------  922
              ERF   R+ AVVELC+Q G                     E +DA + E          
Sbjct  227   DERFSIPRVPAVVELCIQGGVEIPEFPTKRRRKPIIRIGKSEFVDADETELPDPEPQPPP  286

Query  921   ---------SKIVLPF-DQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                      S+I  P  +++M  L  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  287   VPLLTELPVSEITPPSSEEEMVSLAEETLQAWEEMRAGAKKLMRLYRVRVCGYCPEVHVG  346

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P L  E R++YG AP
Sbjct  347   PTGHKAQNCGAFKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVNGPPLQRELRSFYGQAP  406

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA+ P +Y   M+++
Sbjct  407   AVVEICAQAGAVVPEQYRATMRLE  430


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  +  NA   L + +H+L+ V  V  C  C+E+HVGP GH  + C        + +H W
Sbjct  140  LAYKVYNARIRLINNLHRLMKVVRVNACGWCNEIHVGPYGHPFKSCKGPNASQRKGLHEW  199

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              + ++D++ P   +H   +    +  + R      PAVV+LC + G   P
Sbjct  200  TNSVIEDVIVPLEAYHLYDRLGKRIRHDERFSIPRVPAVVELCIQGGVEIP  250



>ref|XP_006358862.1| PREDICTED: APO protein 1, chloroplastic-like [Solanum tuberosum]
Length=438

 Score =   193 bits (491),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 151/266 (57%), Gaps = 35/266 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C +++V ++GH I+ C G  + ++   H W+ GS++ +LIP+E++H+++ F   IKH
Sbjct  161   CSECSQIHVAQSGHEIQDCLGPTNSSRRSFHSWVTGSINDVLIPIESYHMYDPFGTRIKH  220

Query  1035  HERFDYSRISAVVELCLQAGAN----PNDESIDASKM-----------------------  937
               RF+Y RI AVVELC+QAG +    P+       +M                       
Sbjct  221   ETRFNYDRIPAVVELCIQAGVDLPGYPSRRRTKPIRMMGKKVIDIGGLVEEPRPTVDTNS  280

Query  936   ------EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                    H S  +   P + ++  +  ET++A+E ++ GV KL+  Y VK C +CSEVHV
Sbjct  281   AIMDLDTHRSFERFAPPLESEVPRIAQETIDAYEKVKWGVTKLMKKYTVKACGYCSEVHV  340

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGH  598
             GP GH A+LCG FK++     H W+ A+VD++ PPN VWH + P+  P L    + +YG 
Sbjct  341   GPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVQDPKGTP-LRSALKRFYGK  399

Query  597   APAVVDLCTKAGAIAPSKYFCMMKVD  520
             APAVV++C +AGA  P KY  MM++D
Sbjct  400   APAVVEVCMQAGAQIPQKYKPMMRLD  425


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     ++ 
Sbjct  332   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVQDPKGTPLRS  391

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA    +     +++      IVLP  ++ RL+ 
Sbjct  392   ALKRFYGKAPAVVEVCMQAGAQIPQKYKPMMRLD------IVLPESEESRLVA  438


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 53/109 (49%), Gaps = 0/109 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+ W+    G+ +LL   PV  C  CS++HV  SGH+ + C      S R  H W   
Sbjct  137  ELLDDWKLFIKGLAQLLHFIPVHACSECSQIHVAQSGHEIQDCLGPTNSSRRSFHSWVTG  196

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P 
Sbjct  197  SINDVLIPIESYHMYDPFGTRIKHETRFNYDRIPAVVELCIQAGVDLPG  245



>ref|XP_010452955.1| PREDICTED: APO protein 2, chloroplastic-like [Camelina sativa]
Length=444

 Score =   193 bits (491),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/264 (36%), Positives = 143/264 (54%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W    ++ +++P+E +HL++     I+H
Sbjct  167   CGWCNEIHVGPYGHPFKSCKGPNASQRKGLHEWTNSVIEDVIVPLEAYHLYDRLGKRIRH  226

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHESNSKIVLP  904
              ERF   R+ AVVELC+Q G                     E +DA + E       + P
Sbjct  227   DERFSIPRVPAVVELCIQGGVEIPEFPTKRRRKPIIRIGKSEFVDADETELPDPEPQLPP  286

Query  903   F----------------DQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                              +++M  L  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  287   VALLTELPVSEITPPSSEEEMVSLAEETLQAWEEMRAGAKKLMRLYRVRVCGYCPEVHVG  346

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P L  E R++YG AP
Sbjct  347   PTGHKAQNCGAFKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVNGPPLQRELRSFYGQAP  406

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA+ P +Y   M+++
Sbjct  407   AVVEICAQAGAVVPEQYRATMRLE  430


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  +  NA   L + +H+L+ V  V  C  C+E+HVGP GH  + C        + +H W
Sbjct  140  LAYKVYNARIRLINNLHRLMKVVRVNACGWCNEIHVGPYGHPFKSCKGPNASQRKGLHEW  199

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              + ++D++ P   +H   +    +  + R      PAVV+LC + G   P
Sbjct  200  TNSVIEDVIVPLEAYHLYDRLGKRIRHDERFSIPRVPAVVELCIQGGVEIP  250



>ref|XP_009786956.1| PREDICTED: APO protein 1, chloroplastic isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009786957.1| PREDICTED: APO protein 1, chloroplastic isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009786958.1| PREDICTED: APO protein 1, chloroplastic isoform X3 [Nicotiana 
sylvestris]
Length=446

 Score =   193 bits (490),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/266 (38%), Positives = 151/266 (57%), Gaps = 35/266 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C +++V ++G+ I+ C G  + ++   H W+KGS++ +LIP+E++H+++ F   IKH
Sbjct  169   CSECSQIHVAQSGNDIQDCLGPTNSSRRSFHSWVKGSINDVLIPIESYHMYDPFGTRIKH  228

Query  1035  HERFDYSRISAVVELCLQAGAN---------------------------------PNDES  955
               RF+Y RI AVVELC+QAG +                                  N  S
Sbjct  229   ETRFNYDRIPAVVELCIQAGVDLPGYPSRRRTKPIRMMGKKVIDIGGLVEEPRPSVNSSS  288

Query  954   IDASKMEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
             +      H S  +   P + ++  +  ET++A+E ++ GV +L+  Y VK C +CSEVHV
Sbjct  289   VIMDLDTHRSFERFTPPLESEVPRIAQETIDAYEKVKWGVTRLMKKYTVKACGYCSEVHV  348

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGH  598
             GP GH A+LCG FK++     H W+ A+VD++ PPN VWH R P+  PL     R +YG 
Sbjct  349   GPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPKGTPLRSALKR-FYGK  407

Query  597   APAVVDLCTKAGAIAPSKYFCMMKVD  520
             APAVV++C +AGA  P KY  MM++D
Sbjct  408   APAVVEVCMQAGAQIPHKYKPMMRLD  433


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 55/109 (50%), Gaps = 0/109 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW+ L  G+ +LL   PV  C  CS++HV  SG+  + C      S R  H W K 
Sbjct  145  EVLDAWKLLIKGLSQLLHYVPVHACSECSQIHVAQSGNDIQDCLGPTNSSRRSFHSWVKG  204

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P 
Sbjct  205  SINDVLIPIESYHMYDPFGTRIKHETRFNYDRIPAVVELCIQAGVDLPG  253


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 58/111 (52%), Gaps = 6/111 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     ++ 
Sbjct  340   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPKGTPLRS  399

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRL  883
               +  Y +  AVVE+C+QAGA    +     +++      IVLP  ++ RL
Sbjct  400   ALKRFYGKAPAVVEVCMQAGAQIPHKYKPMMRLD------IVLPESEESRL  444



>ref|XP_011091964.1| PREDICTED: APO protein 2, chloroplastic-like [Sesamum indicum]
Length=437

 Score =   192 bits (489),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 146/264 (55%), Gaps = 33/264 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++C E++VG  GH  ++C G +   +   H W++  ++ +L+P+E +HL++     I H
Sbjct  161   CKWCSEIHVGPVGHPFKSCRGPQASIRKGAHEWVEAVVEDMLVPIEAYHLYDRLGKRISH  220

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHES-------  925
              ERF   RI AV+ELC+QAG +                   E IDA + E          
Sbjct  221   EERFSVPRIPAVLELCIQAGVDLPEYPTKRRRKPVIRIGRKEFIDADESELPDPDPDAPK  280

Query  924   --------NSKIVLPFDQQ-MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +S+IV P  ++   LL  ETL  WE +R G  +L+ +YPV+VC +C EVHVG
Sbjct  281   PEILAEILDSEIVPPSSEEDTALLAEETLEMWEEMREGAKRLMKMYPVRVCGYCPEVHVG  340

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG  K++     H W+ A +DDL+PP  VWH    + P L  E RN+YG AP
Sbjct  341   PTGHKAQNCGAHKHQQRNGQHGWQSAVLDDLIPPKFVWHVPDVNKP-LERELRNFYGQAP  399

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV+LC +AG   P KY   M++D
Sbjct  400   AVVELCVQAGTAVPEKYKPTMRLD  423


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/109 (37%), Positives = 57/109 (52%), Gaps = 0/109 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + LNA  TL + + KLL V PV  CK CSE+HVGP GH  + C   +    +  H W +A
Sbjct  137  KVLNARITLINNLKKLLKVMPVNACKWCSEIHVGPVGHPFKSCRGPQASIRKGAHEWVEA  196

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
             V+D++ P   +H   +    +  E R      PAV++LC +AG   P 
Sbjct  197  VVEDMLVPIEAYHLYDRLGKRISHEERFSVPRIPAVLELCIQAGVDLPE  245



>ref|XP_009385478.1| PREDICTED: APO protein 1, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=460

 Score =   193 bits (490),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 150/280 (54%), Gaps = 41/280 (15%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              LS L+N      C  CPEV+VG  GH I+ C G     +   H W+KGS++ +LIP+E+
Sbjct  168   GLSQLMNVVTVYGCSKCPEVHVGPVGHQIQDCHGTGSEQRRSYHSWVKGSINDVLIPIES  227

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------  937
             +HL + F   IKH  RFDY RI AVVELC+QAG +    P+       +M          
Sbjct  228   YHLFDPFGRRIKHETRFDYDRIPAVVELCIQAGVDFPEYPSRRRTSPIRMLGKKVIDRGG  287

Query  936   ------EHESNSKIVL---------PFDQ------QMRLLGNETLNAWETLRSGVHKLLL  820
                    H S + + L          F+Q        R L   TL A+ ++R GV +L+ 
Sbjct  288   YVEEPKPHLSENCMSLLAELDTYGAQFEQPPLSASDTRRLAERTLKAYSSVRRGVRQLMK  347

Query  819   VYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQD  640
              Y VK C +CSEVHVGP GH A+LCG FK++     H W+ A +D+++P N VWH R   
Sbjct  348   KYSVKACGYCSEVHVGPWGHNAKLCGAFKHQWRDGKHGWQDAILDEVIPQNYVWHLRDPH  407

Query  639   PPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              P L    R Y+G APAVV++C +AGA  P  Y  MM++D
Sbjct  408   GPPLQTALRRYHGKAPAVVEVCVQAGAEIPESYKPMMRLD  447


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+ W+ L  G+ +L+ V  V  C  C EVHVGP GH+ + C     E  R  H W K 
Sbjct  157  EVLDHWKVLIKGLSQLMNVVTVYGCSKCPEVHVGPVGHQIQDCHGTGSEQRRSYHSWVKG  216

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  217  SINDVLIPIESYHLFDPFGRRIKHETRFDYDRIPAVVELCIQAGVDFP  264


 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 58/113 (51%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W    LD ++     +HL +     ++ 
Sbjct  354   CGYCSEVHVGPWGHNAKLCGAFKHQWRDGKHGWQDAILDEVIPQNYVWHLRDPHGPPLQT  413

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               R  + +  AVVE+C+QAGA   +      +++      I++P  ++ RL+ 
Sbjct  414   ALRRYHGKAPAVVEVCVQAGAEIPESYKPMMRLD------IIIPDTEEARLVA  460



>ref|XP_002864538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=434

 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/295 (35%), Positives = 156/295 (53%), Gaps = 35/295 (12%)
 Frame = -1

Query  1308  PFLIYLYYKRLELQ*EKCDL*KR*ALSWLLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQ  1129
             P    +YY R+ L     +L +   +  +  C +C E++VG  GH  ++C G     +  
Sbjct  129   PLAYKVYYARIRL---INNLHRLMKVVRVNACGWCNEIHVGPYGHPFKSCKGPNASQRKG  185

Query  1128  LHVWIKGSLDSILIPVETFHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN-------  970
             LH W    ++ +++P+E +HL++     I+H ERF   R+ AVVELC+Q G         
Sbjct  186   LHEWTNSVIEDVIVPLEAYHLYDRLGKRIRHDERFSIPRVPAVVELCIQGGVEIPEFPTK  245

Query  969   ---------PNDESIDASKMEHESN---------------SKIVLPFDQQMRL-LGNETL  865
                         E +DA + E                   S+I  P  ++  + L  ETL
Sbjct  246   RRRKPIIRIGKSEFVDADETELPDPEPQPPPVPLLTELPVSEITPPSSEEETVSLAEETL  305

Query  864   NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
              AWE +R+G  KL+ +Y V+VC +C EVHVGP+GHKA+ CG FK++     H W+ A +D
Sbjct  306   QAWEEMRAGAKKLMRMYRVRVCGYCPEVHVGPTGHKAQNCGAFKHQQRNGQHGWQSAVLD  365

Query  684   DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             DL+PP  VWH    + P L  E R++YG APAVV++C +AGA+ P +Y   M+++
Sbjct  366   DLIPPRYVWHVPDVNGPPLQRELRSFYGQAPAVVEICAQAGAVVPEQYRATMRLE  420



>ref|XP_010096510.1| APO protein 1 [Morus notabilis]
 gb|EXB64630.1| APO protein 1 [Morus notabilis]
Length=470

 Score =   193 bits (491),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 143/266 (54%), Gaps = 34/266 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C EV+V + GH I+ C G     +   H WIKGS++ ILIP+E++HL++ F   IKH
Sbjct  192   CSECSEVHVAQAGHQIKDCKGRTSGKRQSFHSWIKGSINDILIPIESYHLYDPFGRRIKH  251

Query  1035  HERFDYSRISAVVELCLQAGAN----PNDESIDASKM-----------------------  937
               RF Y RI A++ELC+QAG +    P+       +M                       
Sbjct  252   ESRFQYDRIPAIMELCIQAGVDIPEYPSRRRTKPIRMIGRKMIDNGGNVEEPKPCRSANP  311

Query  936   -------EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVH  778
                     H ++ +   P    +  +  ET++A+E +R GV +L+  Y VK C +CSEVH
Sbjct  312   SSLVDLDTHGASLRFPPPLPADVPRIAQETMDAYEVVRLGVTRLMKKYTVKACGYCSEVH  371

Query  777   VGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGH  598
             VGP GH  +LCG FK++     H W+ A V+++ PPN VWH R    P L    + +YG 
Sbjct  372   VGPWGHNVKLCGEFKHQWRDGKHGWQDAIVEEVFPPNYVWHARDPKGPPLRSALKRFYGK  431

Query  597   APAVVDLCTKAGAIAPSKYFCMMKVD  520
              PAVV+LC +AGA  P++Y  MM++D
Sbjct  432   VPAVVELCLQAGAKIPARYIPMMRLD  457


 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 55/107 (51%), Gaps = 0/107 (0%)
 Frame = -1

Query  870  TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
             L+AW+ L  GV +LL V PV  C  CSEVHV  +GH+ + C        +  H W K S
Sbjct  169  VLDAWKILIKGVAQLLHVVPVYACSECSEVHVAQAGHQIKDCKGRTSGKRQSFHSWIKGS  228

Query  690  VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            ++D++ P   +H        +  E R  Y   PA+++LC +AG   P
Sbjct  229  INDILIPIESYHLYDPFGRRIKHESRFQYDRIPAIMELCIQAGVDIP  275


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH ++ CG ++H+ ++  H W    ++ +  P   +H  +     ++ 
Sbjct  364   CGYCSEVHVGPWGHNVKLCGEFKHQWRDGKHGWQDAIVEEVFPPNYVWHARDPKGPPLRS  423

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y ++ AVVELCLQAGA      I   +++      IV+P  ++  L+ 
Sbjct  424   ALKRFYGKVPAVVELCLQAGAKIPARYIPMMRLD------IVVPDTEESNLVA  470



>dbj|BAJ89992.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=424

 Score =   192 bits (487),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/279 (38%), Positives = 148/279 (53%), Gaps = 40/279 (14%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              +S LLN      CR CP+V+VG  GH I+ C G   + +N  H W++GS++ +LIP+E+
Sbjct  133   GISQLLNVVTVYGCRKCPQVHVGPVGHQIQDCYGSGSQRRNSHHSWVRGSINDVLIPIES  192

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------  937
             +HL + F   +KH  RFD+ RI A+VELC+QAG +    P        +M          
Sbjct  193   YHLFDPFGRRVKHDTRFDFDRIPAIVELCIQAGVDLPQYPTRRRTAPVRMIGKKVIDRGG  252

Query  936   ------EHESNSKIVL--------------PFDQQMRLLGNETLNAWETLRSGVHKLLLV  817
                    H S   I L              P    ++     TL A+  +R GV +L+  
Sbjct  253   VVDEPKPHRSEDCISLLAELDTFSNQQGQSPVPSNVKEHAERTLKAYCDVRRGVAQLMSK  312

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDP  637
             Y VK C +CSEVH+GP GH  +LCG FK++     H W+ A VD+++PPN VWH      
Sbjct  313   YTVKACGYCSEVHIGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDEVIPPNYVWHVPDPAG  372

Query  636   PLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             P L    R++YG APAVV+LC +AGA  P +Y  MM+ D
Sbjct  373   PPLRSSLRSFYGKAPAVVELCVQAGAEIPEEYRPMMRTD  411


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 58/111 (52%), Gaps = 4/111 (4%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI--HFWE  700
            E L+ W+ L  G+ +LL V  V  C+ C +VHVGP GH+ + C  +   S RR   H W 
Sbjct  122  EVLDNWKILIRGISQLLNVVTVYGCRKCPQVHVGPVGHQIQDC--YGSGSQRRNSHHSWV  179

Query  699  KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            + S++D++ P   +H        +  + R  +   PA+V+LC +AG   P 
Sbjct  180  RGSINDVLIPIESYHLFDPFGRRVKHDTRFDFDRIPAIVELCIQAGVDLPQ  230



>ref|XP_009786954.1| PREDICTED: APO protein 1, chloroplastic isoform X1 [Nicotiana 
sylvestris]
Length=481

 Score =   193 bits (491),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 153/267 (57%), Gaps = 37/267 (14%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C +++V ++G+ I+ C G  + ++   H W+KGS++ +LIP+E++H+++ F   IKH
Sbjct  204   CSECSQIHVAQSGNDIQDCLGPTNSSRRSFHSWVKGSINDVLIPIESYHMYDPFGTRIKH  263

Query  1035  HERFDYSRISAVVELCLQAGAN---------------------------------PNDES  955
               RF+Y RI AVVELC+QAG +                                  N  S
Sbjct  264   ETRFNYDRIPAVVELCIQAGVDLPGYPSRRRTKPIRMMGKKVIDIGGLVEEPRPSVNSSS  323

Query  954   IDASKMEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
             +      H S  +   P + ++  +  ET++A+E ++ GV +L+  Y VK C +CSEVHV
Sbjct  324   VIMDLDTHRSFERFTPPLESEVPRIAQETIDAYEKVKWGVTRLMKKYTVKACGYCSEVHV  383

Query  774   GPSGHKARLCGVFKYESWRR-IHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYG  601
             GP GH A+LCG FK++ WR   H W+ A+VD++ PPN VWH R P+  PL     R +YG
Sbjct  384   GPWGHNAKLCGEFKHQ-WRDGKHGWQDATVDEVFPPNYVWHVRDPKGTPLRSALKR-FYG  441

Query  600   HAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              APAVV++C +AGA  P KY  MM++D
Sbjct  442   KAPAVVEVCMQAGAQIPHKYKPMMRLD  468


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW+ L  G+ +LL   PV  C  CS++HV  SG+  + C      S R  H W K 
Sbjct  180  EVLDAWKLLIKGLSQLLHYVPVHACSECSQIHVAQSGNDIQDCLGPTNSSRRSFHSWVKG  239

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  240  SINDVLIPIESYHMYDPFGTRIKHETRFNYDRIPAVVELCIQAGVDLP  287


 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 58/111 (52%), Gaps = 6/111 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     ++ 
Sbjct  375   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPKGTPLRS  434

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRL  883
               +  Y +  AVVE+C+QAGA    +     +++      IVLP  ++ RL
Sbjct  435   ALKRFYGKAPAVVEVCMQAGAQIPHKYKPMMRLD------IVLPESEESRL  479



>ref|XP_009786955.1| PREDICTED: APO protein 1, chloroplastic isoform X2 [Nicotiana 
sylvestris]
Length=478

 Score =   193 bits (491),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 153/267 (57%), Gaps = 37/267 (14%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C +++V ++G+ I+ C G  + ++   H W+KGS++ +LIP+E++H+++ F   IKH
Sbjct  201   CSECSQIHVAQSGNDIQDCLGPTNSSRRSFHSWVKGSINDVLIPIESYHMYDPFGTRIKH  260

Query  1035  HERFDYSRISAVVELCLQAGAN---------------------------------PNDES  955
               RF+Y RI AVVELC+QAG +                                  N  S
Sbjct  261   ETRFNYDRIPAVVELCIQAGVDLPGYPSRRRTKPIRMMGKKVIDIGGLVEEPRPSVNSSS  320

Query  954   IDASKMEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
             +      H S  +   P + ++  +  ET++A+E ++ GV +L+  Y VK C +CSEVHV
Sbjct  321   VIMDLDTHRSFERFTPPLESEVPRIAQETIDAYEKVKWGVTRLMKKYTVKACGYCSEVHV  380

Query  774   GPSGHKARLCGVFKYESWRR-IHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYG  601
             GP GH A+LCG FK++ WR   H W+ A+VD++ PPN VWH R P+  PL     R +YG
Sbjct  381   GPWGHNAKLCGEFKHQ-WRDGKHGWQDATVDEVFPPNYVWHVRDPKGTPLRSALKR-FYG  438

Query  600   HAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              APAVV++C +AGA  P KY  MM++D
Sbjct  439   KAPAVVEVCMQAGAQIPHKYKPMMRLD  465


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW+ L  G+ +LL   PV  C  CS++HV  SG+  + C      S R  H W K 
Sbjct  177  EVLDAWKLLIKGLSQLLHYVPVHACSECSQIHVAQSGNDIQDCLGPTNSSRRSFHSWVKG  236

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  237  SINDVLIPIESYHMYDPFGTRIKHETRFNYDRIPAVVELCIQAGVDLP  284


 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 58/111 (52%), Gaps = 6/111 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     ++ 
Sbjct  372   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPKGTPLRS  431

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRL  883
               +  Y +  AVVE+C+QAGA    +     +++      IVLP  ++ RL
Sbjct  432   ALKRFYGKAPAVVEVCMQAGAQIPHKYKPMMRLD------IVLPESEESRL  476



>ref|XP_010443503.1| PREDICTED: APO protein 2, chloroplastic-like [Camelina sativa]
Length=444

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/264 (36%), Positives = 145/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W    ++ +++P+E +HL++     I+H
Sbjct  167   CGWCNEIHVGPYGHPFKSCKGPNASQRKGLHEWTNSVIEDVIVPLEAYHLYDRLGKRIRH  226

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKMEHESNSKIVLP  904
              ERF   R+ AVVELC+Q G   ++                E +DA + E       + P
Sbjct  227   DERFSIPRVPAVVELCIQGGVEISEFPTKRRRKPIIRIGKSEFVDADETELPDPEPQLPP  286

Query  903   F----------------DQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                              +++M  L  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  287   VALLTELPVSEITPPSSEEEMVSLAEETLQAWEEMRAGAKKLMRLYRVRVCGYCPEVHVG  346

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHK++ CG FK++     H W+ A +DDL+PP  VWH    + P L  E R++YG AP
Sbjct  347   PTGHKSQNCGAFKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVNGPPLQRELRSFYGQAP  406

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGAI P +Y   M+++
Sbjct  407   AVVEICAQAGAIVPEQYRATMRLE  430


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 52/107 (49%), Gaps = 0/107 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  +  NA   L + +H+L+ V  V  C  C+E+HVGP GH  + C        + +H W
Sbjct  140  LAYKVYNARIRLINNLHRLMKVVRVNACGWCNEIHVGPYGHPFKSCKGPNASQRKGLHEW  199

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
              + ++D++ P   +H   +    +  + R      PAVV+LC + G
Sbjct  200  TNSVIEDVIVPLEAYHLYDRLGKRIRHDERFSIPRVPAVVELCIQGG  246



>ref|XP_007152418.1| hypothetical protein PHAVU_004G128500g [Phaseolus vulgaris]
 gb|ESW24412.1| hypothetical protein PHAVU_004G128500g [Phaseolus vulgaris]
Length=439

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/267 (39%), Positives = 146/267 (55%), Gaps = 34/267 (13%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C  C EV+V + GH I  C     R +   H W+KGS++ IL+P+E++HL + F   IK
Sbjct  160   GCSECSEVHVAQTGHHIWDCSSPYGRQRRSAHAWVKGSVNDILVPIESYHLFDPFGKRIK  219

Query  1038  HHERFDYSRISAVVELCLQAGAN----PNDESIDASKM------------EHESNSKIVL  907
             H  RF+Y RI AVVELC+QAG +    P+    +  +M            E     +   
Sbjct  220   HDTRFEYDRIPAVVELCIQAGVDIPEYPSRRRTNPIRMLGKRVIDIGGNLEEPKPWRFAD  279

Query  906   P-----FD-------------QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
             P     FD               +  +  +T+NA+E ++ GV KL+  Y VK C +C+EV
Sbjct  280   PSSLNDFDTYRSFERFPRTSLSDLPKIAQDTMNAYEIVKKGVRKLMKKYTVKACGYCTEV  339

Query  780   HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYG  601
             HVGP GH A+LCG FK++     H W+ A+VD++ PPN VWH R  + P L    R YYG
Sbjct  340   HVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPNGPPLASALRRYYG  399

Query  600   HAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              APAVV++C +AGA  P +Y  MM++D
Sbjct  400   KAPAVVEVCMQAGAQIPDEYKPMMRLD  426


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     +  
Sbjct  333   CGYCTEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPNGPPLAS  392

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               R  Y +  AVVE+C+QAGA   DE     +++      I++P  ++ R++ 
Sbjct  393   ALRRYYGKAPAVVEVCMQAGAQIPDEYKPMMRLD------IIIPDPEEARMIA  439


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 51/111 (46%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E   AW+ L   + ++L   PV  C  CSEVHV  +GH    C        R  H W
Sbjct  134  VAYEVFEAWKLLIKCLAQVLHHIPVHGCSECSEVHVAQTGHHIWDCSSPYGRQRRSAHAW  193

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             K SV+D++ P   +H        +  + R  Y   PAVV+LC +AG   P
Sbjct  194  VKGSVNDILVPIESYHLFDPFGKRIKHDTRFEYDRIPAVVELCIQAGVDIP  244



>ref|XP_006280470.1| hypothetical protein CARUB_v10026405mg [Capsella rubella]
 gb|EOA13368.1| hypothetical protein CARUB_v10026405mg [Capsella rubella]
Length=444

 Score =   192 bits (488),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 143/264 (54%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W    ++ +++P+E +HL++     I+H
Sbjct  167   CGWCNEIHVGPYGHPFKSCKGPNASQRKGLHEWTNSVIEDVIVPLEAYHLYDRLGKRIRH  226

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHESNSKIV--  910
              ERF   RI AVVELC+Q G                     E +DA + E          
Sbjct  227   DERFSIPRIPAVVELCIQGGVEIPEFPTKRRRKPIIRIGKSEFVDADETELPDPEPQPPP  286

Query  909   ------LPF--------DQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                   LP         +++M  L  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  287   VPLLTELPVSESTPPSSEEEMVSLAEETLQAWEEMRAGAKKLMRMYRVRVCGYCPEVHVG  346

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P +  E R++YG AP
Sbjct  347   PTGHKAQNCGAFKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVNGPPMQRELRSFYGQAP  406

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA+ P +Y   M+++
Sbjct  407   AVVEICAQAGAVVPEQYRATMRLE  430


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  +  NA   L + +H+L+ V  V  C  C+E+HVGP GH  + C        + +H W
Sbjct  140  LAYKVYNARIRLINNLHRLMKVVRVNACGWCNEIHVGPYGHPFKSCKGPNASQRKGLHEW  199

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              + ++D++ P   +H   +    +  + R      PAVV+LC + G   P
Sbjct  200  TNSVIEDVIVPLEAYHLYDRLGKRIRHDERFSIPRIPAVVELCIQGGVEIP  250



>emb|CDO98690.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   192 bits (489),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/268 (38%), Positives = 151/268 (56%), Gaps = 37/268 (14%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C EV+V + GH I+ C G    ++   H W+KGS++ +L+P+E++H+++ F   IKH
Sbjct  174   CSECSEVHVAQVGHDIQDCHGSTSGSRKGFHSWVKGSINDVLLPIESYHMYDPFGRRIKH  233

Query  1035  HERFDYSRISAVVELCLQAGAN----PNDESIDASKM------------------EHESN  922
               RF+Y RI AVVELC+QAG +    P+       +M                  +H   
Sbjct  234   ETRFNYDRIPAVVELCIQAGVDLPEFPSRRRTQPVRMIGKKVIDRGGFVEEPELEKHVDR  293

Query  921   SKIVLPFDQQMRL-------------LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
                V+  D    L             +  ET+NA+E ++ GV++L+  Y VK C +CSEV
Sbjct  294   KSQVIDLDTHRSLEHFPPPDISEVPKIAQETINAYEKVKWGVNRLMKKYTVKACGYCSEV  353

Query  780   HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYY  604
             HVGP GH A+LCG FK++     H W+ A+VD++ PPN VWH R P+ PP+     R +Y
Sbjct  354   HVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPKGPPMRRGLKR-FY  412

Query  603   GHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             G APAVV++C +AGA  P +Y  MM++D
Sbjct  413   GKAPAVVEVCMQAGAQVPERYKPMMRLD  440


 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 53/108 (49%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW  L  G+ ++L   P+  C  CSEVHV   GH  + C      S +  H W K 
Sbjct  150  EVLDAWRILIRGLTQILHTVPIHACSECSEVHVAQVGHDIQDCHGSTSGSRKGFHSWVKG  209

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  210  SINDVLLPIESYHMYDPFGRRIKHETRFNYDRIPAVVELCIQAGVDLP  257


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     ++ 
Sbjct  347   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVRDPKGPPMRR  406

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA   +      +++      IV+P  ++ +L+ 
Sbjct  407   GLKRFYGKAPAVVEVCMQAGAQVPERYKPMMRLD------IVVPESEEAQLVA  453



>ref|XP_003580549.1| PREDICTED: APO protein 1, chloroplastic [Brachypodium distachyon]
Length=429

 Score =   191 bits (486),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 108/279 (39%), Positives = 149/279 (53%), Gaps = 40/279 (14%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
             +L  LLN      CR CP+V+VG  GH I+ C G   + +N  H W++GS++ +LIP+E+
Sbjct  138   SLPQLLNVVTVYGCRKCPQVHVGPVGHQIQDCYGSGSQRRNSHHSWVRGSINDVLIPIES  197

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------  937
             +HL + F   +KH  RFDY RI A+VELC+QAG +    P+       +M          
Sbjct  198   YHLFDPFGRRVKHETRFDYHRIPAIVELCIQAGVDLPQYPSRRRTAPVRMIGKKVIDRGG  257

Query  936   ------EHESNSKIVL--------------PFDQQMRLLGNETLNAWETLRSGVHKLLLV  817
                    H S   I L              P    ++     TL A+  +R GV +L+  
Sbjct  258   VVDEPEPHRSEDCISLLAELDTFSNQQGQSPAPFNVKEHAERTLKAYCNVRQGVGQLMSK  317

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDP  637
             Y VK C +CSEVHVGP GH  +LCG FK++     H W+ A VD+++PPN VWH      
Sbjct  318   YTVKACGYCSEVHVGPWGHNVQLCGAFKHQWRDGKHGWQDAVVDEVIPPNYVWHVPDPAG  377

Query  636   PLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             P L    R++YG APAVV+LC +AGA  P +Y  MM+ D
Sbjct  378   PPLRSSLRSFYGKAPAVVELCVQAGAEIPDEYRPMMRTD  416


 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/111 (32%), Positives = 59/111 (53%), Gaps = 6/111 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH ++ CG ++H+ ++  H W    +D ++ P   +H+ +     ++ 
Sbjct  323   CGYCSEVHVGPWGHNVQLCGAFKHQWRDGKHGWQDAVVDEVIPPNYVWHVPDPAGPPLRS  382

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRL  883
               R  Y +  AVVELC+QAGA   DE     + +      IV+P  ++ R+
Sbjct  383   SLRSFYGKAPAVVELCVQAGAEIPDEYRPMMRTD------IVIPDSKEARM  427


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 57/110 (52%), Gaps = 4/110 (4%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI--HFWE  700
            E L+ W+ L   + +LL V  V  C+ C +VHVGP GH+ + C  +   S RR   H W 
Sbjct  127  EVLDNWKMLIRSLPQLLNVVTVYGCRKCPQVHVGPVGHQIQDC--YGSGSQRRNSHHSWV  184

Query  699  KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            + S++D++ P   +H        +  E R  Y   PA+V+LC +AG   P
Sbjct  185  RGSINDVLIPIESYHLFDPFGRRVKHETRFDYHRIPAIVELCIQAGVDLP  234



>ref|XP_004245655.1| PREDICTED: APO protein 1, chloroplastic [Solanum lycopersicum]
Length=438

 Score =   191 bits (486),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/266 (37%), Positives = 150/266 (56%), Gaps = 35/266 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C +++V ++GH I+ C G  + ++   H W+KGS++ +LIP+E++H+++ F   IKH
Sbjct  161   CSECSQIHVAQSGHEIQDCLGPTNSSRRSFHSWVKGSINDVLIPIESYHMYDPFGTRIKH  220

Query  1035  HERFDYSRISAVVELCLQAGAN----PNDESIDASKM-----------------------  937
               RF+Y RI A VELC+QAG +    P+       +M                       
Sbjct  221   ETRFNYDRIPAAVELCIQAGVDLPGYPSRRRTKPIRMMGKKVIDIGGLVGEPRPTIDTNS  280

Query  936   ------EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                    H S  +   P   ++  +  ET++A+E ++ GV  L+  Y VK C +CSEVHV
Sbjct  281   AIMDLDTHRSFERFAPPLGSEVPRIAQETIDAYERVKQGVTILMKKYTVKACGYCSEVHV  340

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGH  598
             GP GH A+LCG FK++     H W+ A+VD+++PPN VWH + P+  P L    + +YG 
Sbjct  341   GPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVLPPNYVWHVQDPKGTP-LRSALKRFYGK  399

Query  597   APAVVDLCTKAGAIAPSKYFCMMKVD  520
             APAVV++C +AGA  P KY  MM++D
Sbjct  400   APAVVEVCMQAGAQIPQKYKPMMRLD  425


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 54/109 (50%), Gaps = 0/109 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+ W+ L  G+ +LL   PV  C  CS++HV  SGH+ + C      S R  H W K 
Sbjct  137  ELLDDWKLLIKGLAQLLHYVPVHACSECSQIHVAQSGHEIQDCLGPTNSSRRSFHSWVKG  196

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            S++D++ P   +H        +  E R  Y   PA V+LC +AG   P 
Sbjct  197  SINDVLIPIESYHMYDPFGTRIKHETRFNYDRIPAAVELCIQAGVDLPG  245


 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 60/113 (53%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +L P   +H+ +     ++ 
Sbjct  332   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVLPPNYVWHVQDPKGTPLRS  391

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA    +     +++      IVLP  ++ RL+ 
Sbjct  392   ALKRFYGKAPAVVEVCMQAGAQIPQKYKPMMRLD------IVLPESEESRLVA  438



>ref|XP_003596991.1| APO protein [Medicago truncatula]
 gb|AES67242.1| APO RNA-binding protein [Medicago truncatula]
Length=447

 Score =   192 bits (487),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 145/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G +   +  +H W    ++ ILIP++ FHL++     I H
Sbjct  170   CGWCSEIHVGPVGHPFKSCKGTQSNIRKGIHEWTNAHVEDILIPIDAFHLYDRLGKRITH  229

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKMEHES-------  925
              +RF   RI AVVELC+QAG    +                E +DA + E          
Sbjct  230   EQRFSIPRIPAVVELCIQAGVKIREFPTKRRRKPIIRIGKKEFVDADESELPDEVPDNPT  289

Query  924   --------NSKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +S IV P +++  + L  ETL AWE +R G  +L+ +Y V+VC +C E+HVG
Sbjct  290   QPLIAEIPDSDIVAPVNKEEVVHLAEETLQAWEQMRKGTKRLMRMYHVRVCGYCPEIHVG  349

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG  K++     H W+ A +DDL+PP  VWH    + P L  E +N+YG AP
Sbjct  350   PSGHKAQNCGAHKHQQRNGQHGWQSAVLDDLIPPRFVWHVPDVNGPPLERELKNFYGQAP  409

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M++D
Sbjct  410   AVVEMCIQAGAALPEQYKSTMRLD  433


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            +  NA  TL + + KLL V PV  C  CSE+HVGP GH  + C   +    + IH W  A
Sbjct  146  DVYNARITLINNLKKLLKVVPVHACGWCSEIHVGPVGHPFKSCKGTQSNIRKGIHEWTNA  205

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
             V+D++ P   +H   +    +  E R      PAVV+LC +AG
Sbjct  206  HVEDILIPIDAFHLYDRLGKRITHEQRFSIPRIPAVVELCIQAG  249



>gb|EMT18800.1| hypothetical protein F775_17967 [Aegilops tauschii]
Length=422

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/279 (38%), Positives = 149/279 (53%), Gaps = 40/279 (14%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              +S LLN      CR CP+V+VG  GH I+ C G   + +N  H W++GS++ +L+P+E+
Sbjct  131   GISQLLNVVTVYGCRKCPQVHVGPVGHQIQDCYGSGSQRRNSHHSWVRGSINDVLLPIES  190

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------  937
             +HL + F   +KH  RFD+ RI A++ELC+QAG +    P        +M          
Sbjct  191   YHLFDPFGRRVKHDTRFDFDRIPAILELCIQAGVDLPQYPTRRRTAPVRMIGKKVIDRGG  250

Query  936   ------EHESNSKIVL--------------PFDQQMRLLGNETLNAWETLRSGVHKLLLV  817
                    H S   I L              P    ++     TL A+  +R GV +L+  
Sbjct  251   VVDEPKPHRSEDCISLLAELDTFSNQQGQSPVPANVKEHAERTLKAYCDVRQGVAQLMSK  310

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDP  637
             Y VK C +CSEVHVGP GH  +LCG FK++     H W+ A VD+++PPN VWH      
Sbjct  311   YTVKACGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDEVIPPNYVWHVPDPTG  370

Query  636   PLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             P L    R++YG APAVV+LC +AGA  P++Y  MM+ D
Sbjct  371   PPLRSSLRSFYGKAPAVVELCVQAGAEIPAEYRPMMRTD  409


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 58/111 (52%), Gaps = 4/111 (4%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI--HFWE  700
            E L+ W+ L  G+ +LL V  V  C+ C +VHVGP GH+ + C  +   S RR   H W 
Sbjct  120  EVLDNWKVLIRGISQLLNVVTVYGCRKCPQVHVGPVGHQIQDC--YGSGSQRRNSHHSWV  177

Query  699  KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            + S++D++ P   +H        +  + R  +   PA+++LC +AG   P 
Sbjct  178  RGSINDVLLPIESYHLFDPFGRRVKHDTRFDFDRIPAILELCIQAGVDLPQ  228



>ref|XP_010928994.1| PREDICTED: APO protein 1, chloroplastic [Elaeis guineensis]
 ref|XP_010928995.1| PREDICTED: APO protein 1, chloroplastic [Elaeis guineensis]
 ref|XP_010928996.1| PREDICTED: APO protein 1, chloroplastic [Elaeis guineensis]
 ref|XP_010928997.1| PREDICTED: APO protein 1, chloroplastic [Elaeis guineensis]
Length=433

 Score =   191 bits (485),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 108/279 (39%), Positives = 145/279 (52%), Gaps = 40/279 (14%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              LS LLN      C  C EV+VG  GH I+ C G     +   H W++GS++ +LIP+E+
Sbjct  142   GLSQLLNVVTVYGCSKCSEVHVGPAGHRIQDCRGTGSEQRRNQHCWVRGSINDVLIPIES  201

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN-PNDES--------------IDASK  940
             +HL + F   IKH  RF+Y RI AVVELC+QAG + P   S              ID   
Sbjct  202   YHLFDPFGRRIKHETRFNYDRIPAVVELCIQAGVDLPEYPSRRRTTPIRMLGKKVIDRGG  261

Query  939   MEHESNSKIV-------------------LPFDQQMRLLGNETLNAWETLRSGVHKLLLV  817
               HE                          P     R L   TL A+ T+R GV +L+  
Sbjct  262   YVHEPKPYGAEDCMSLLAELDTYGAQAGQSPLPSDTRKLAERTLKAYSTVRRGVRQLMKK  321

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDP  637
             Y VK C +CSEVHVGP GH  +LCG FK++     H W+ A++D+++PPN VWH R  + 
Sbjct  322   YTVKACGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDATLDEVIPPNHVWHVRDPNG  381

Query  636   PLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             P L    + + G APAVV++C +AGA  P  Y  MM++D
Sbjct  382   PPLTTALKRFCGKAPAVVEVCVQAGAEIPESYRPMMRLD  420


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 56/108 (52%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L  W+ L  G+ +LL V  V  C  CSEVHVGP+GH+ + C     E  R  H W + 
Sbjct  131  EVLEHWKVLIKGLSQLLNVVTVYGCSKCSEVHVGPAGHRIQDCRGTGSEQRRNQHCWVRG  190

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  191  SINDVLIPIESYHLFDPFGRRIKHETRFNYDRIPAVVELCIQAGVDLP  238


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH ++ CG ++H+ ++  H W   +LD ++ P   +H+ +     +  
Sbjct  327   CGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDATLDEVIPPNHVWHVRDPNGPPLTT  386

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +    +  AVVE+C+QAGA   +      +++      IVLP  ++ RL+ 
Sbjct  387   ALKRFCGKAPAVVEVCVQAGAEIPESYRPMMRLD------IVLPDSEEARLVA  433



>ref|XP_006401151.1| hypothetical protein EUTSA_v10013543mg [Eutrema salsugineum]
 gb|ESQ42604.1| hypothetical protein EUTSA_v10013543mg [Eutrema salsugineum]
Length=446

 Score =   191 bits (486),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 145/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W    ++ +++P+E++HL++     I+H
Sbjct  169   CGWCNEIHVGPYGHPFKSCKGPNASQRKGLHEWTNSVIEDVIVPLESYHLYDRLGKRIRH  228

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHESN------  922
              ERF   R+ AVVELC+Q G +                   E +DA + E          
Sbjct  229   DERFSIPRVPAVVELCIQGGVDIPEFPTKRRRKPIIRIGKSEFVDADETELPDPEPQLPQ  288

Query  921   ---------SKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                      S+I  P  ++  + L  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  289   VPLLTELPISEITPPSSEEETVSLAEETLQAWEEMRAGAKKLMRMYRVRVCGYCPEVHVG  348

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P L  E R++YG AP
Sbjct  349   PTGHKAQNCGAFKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVNGPPLQRELRSFYGQAP  408

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M+++
Sbjct  409   AVVEICAQAGATVPEQYRATMRLE  432


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/111 (30%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  +  NA   L + +H+LL V  V  C  C+E+HVGP GH  + C        + +H W
Sbjct  142  LAYKVYNARIRLINNLHRLLKVVRVNACGWCNEIHVGPYGHPFKSCKGPNASQRKGLHEW  201

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              + ++D++ P   +H   +    +  + R      PAVV+LC + G   P
Sbjct  202  TNSVIEDVIVPLESYHLYDRLGKRIRHDERFSIPRVPAVVELCIQGGVDIP  252



>emb|CAE04336.2| OSJNBa0008M17.9 [Oryza sativa Japonica Group]
Length=585

 Score =   194 bits (494),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/279 (40%), Positives = 150/279 (54%), Gaps = 40/279 (14%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              LS LLN      CR CP+V+VG  GH I+ C G   + +N  H W++GS++ +LIP+E+
Sbjct  294   GLSQLLNVGTVYGCRKCPQVHVGPVGHQIQDCYGTGSQRRNSHHSWVRGSVNDVLIPIES  353

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------  937
             +H  + F   +KH  RFDY RI A+VELC+QAG      P+       +M          
Sbjct  354   YHQFDPFGWRVKHETRFDYDRIPAIVELCIQAGVELPQYPSRRRTAPVRMIGKKVIDRGG  413

Query  936   ------EHESNSKIVL-----PFDQQ---------MRLLGNETLNAWETLRSGVHKLLLV  817
                    H S   I L      F  Q         +  L  +TL A+  ++ GV +L+  
Sbjct  414   FVDGPKPHRSEDCISLLAELDTFSNQQGQSSTPSNVEELAEKTLKAYLNVQRGVARLMRK  473

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDP  637
             Y VK C +CSEVHVGP GH  +LCG FK++     H W+ A VDD++PPN VWH R    
Sbjct  474   YTVKTCGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDDVIPPNYVWHVRDPTG  533

Query  636   PLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             P L    R++YG APAVV+LC +AGA  P +Y  MM+ D
Sbjct  534   PPLRSSLRSFYGKAPAVVELCVQAGAEIPEEYRPMMRAD  572


 Score = 65.5 bits (158),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 59/112 (53%), Gaps = 6/112 (5%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C YC EV+VG  GH ++ CG ++H+ ++  H W    +D ++ P   +H+ +     ++
Sbjct  478   TCGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDDVIPPNYVWHVRDPTGPPLR  537

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRL  883
                R  Y +  AVVELC+QAGA   +E     + +      +V+P  ++ RL
Sbjct  538   SSLRSFYGKAPAVVELCVQAGAEIPEEYRPMMRAD------VVIPDSEEARL  583


 Score = 62.0 bits (149),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 4/110 (4%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI--HFWE  700
            E L+ W+ L  G+ +LL V  V  C+ C +VHVGP GH+ + C  +   S RR   H W 
Sbjct  283  EVLDNWKVLIRGLSQLLNVGTVYGCRKCPQVHVGPVGHQIQDC--YGTGSQRRNSHHSWV  340

Query  699  KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            + SV+D++ P   +H+       +  E R  Y   PA+V+LC +AG   P
Sbjct  341  RGSVNDVLIPIESYHQFDPFGWRVKHETRFDYDRIPAIVELCIQAGVELP  390



>gb|EMS53738.1| hypothetical protein TRIUR3_16129 [Triticum urartu]
Length=492

 Score =   192 bits (489),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/279 (37%), Positives = 152/279 (54%), Gaps = 40/279 (14%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              +S LLN      CR CP+V+VG  GH I+ C G   + +N  H W++GS++ +LIP+E+
Sbjct  201   GISQLLNVVTVYGCRKCPQVHVGPVGHQIQDCYGSGSQRRNSHHSWVRGSINDVLIPIES  260

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN-------------------------  970
             +HL + F   +KH  RFD+ RI A+VELC+QAG +                         
Sbjct  261   YHLFDPFGRRVKHDTRFDFDRIPAIVELCIQAGVDLPQYPTRRRTAPVRMIGKKVIDRGG  320

Query  969   ----PNDESID-----ASKMEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLV  817
                 P    ++      ++++  SN +   P    ++     TL A+  +R GV +L+  
Sbjct  321   VVDEPKPHRLEDCISLLAELDTFSNQQGQSPAPANVKEHAERTLKAYCDVRRGVTQLMSK  380

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDP  637
             Y VK C +CSEVHVGP GH  +LCG FK++     H W+ A VD+++PPN VWH      
Sbjct  381   YTVKACGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDEVIPPNYVWHVPDPTG  440

Query  636   PLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             P L    R++YG APAVV+LC +AGA  P++Y  MM+ D
Sbjct  441   PPLRSSLRSFYGKAPAVVELCVQAGAEIPAEYRPMMRTD  479


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 57/110 (52%), Gaps = 4/110 (4%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI--HFWE  700
            E L  W+ L  G+ +LL V  V  C+ C +VHVGP GH+ + C  +   S RR   H W 
Sbjct  190  EVLENWKVLIRGISQLLNVVTVYGCRKCPQVHVGPVGHQIQDC--YGSGSQRRNSHHSWV  247

Query  699  KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            + S++D++ P   +H        +  + R  +   PA+V+LC +AG   P
Sbjct  248  RGSINDVLIPIESYHLFDPFGRRVKHDTRFDFDRIPAIVELCIQAGVDLP  297



>ref|XP_002264685.1| PREDICTED: APO protein 1, chloroplastic isoform X2 [Vitis vinifera]
 ref|XP_010661441.1| PREDICTED: APO protein 1, chloroplastic isoform X2 [Vitis vinifera]
 ref|XP_010661442.1| PREDICTED: APO protein 1, chloroplastic isoform X2 [Vitis vinifera]
 emb|CBI16741.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   191 bits (486),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/269 (39%), Positives = 150/269 (56%), Gaps = 37/269 (14%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C  C E++V ++GH I+ C G     +  LH W+KGS++ +LIP+E++HL++ F   IK
Sbjct  164   GCSECSEIHVAQSGHHIQDCTGPSSVKRRGLHSWVKGSINDVLIPIESYHLYDPFGRRIK  223

Query  1038  HHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------------------  937
             H  RF Y RI AVVELC+QAG +    P+       +M                      
Sbjct  224   HETRFSYDRIPAVVELCVQAGVDLPEYPSRRRTIPIRMIGKKVIDRGGFVEEPEPFHSSD  283

Query  936   ---------EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSE  784
                       H +  +   P    +  +  ET++A+E +R GV KL+  Y VK C +CSE
Sbjct  284   SSSLLMDIDTHGAFGRFPPPPLSDIPRIAQETIDAYEVVRWGVRKLMRKYTVKACGYCSE  343

Query  783   VHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNY  607
             VHVGP GH A+LCG FK++     H W+ A+V++++PPN V+H R P+ PPL     R +
Sbjct  344   VHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVEEVIPPNYVYHLRDPKGPPLRSGLKR-F  402

Query  606   YGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             YG APAVV++C +AGA  P KY  MM++D
Sbjct  403   YGKAPAVVEVCMQAGAQVPDKYKPMMRLD  431


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 56/108 (52%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW+ L  G+ +LL V PV  C  CSE+HV  SGH  + C        R +H W K 
Sbjct  141  EVLDAWKVLIKGLAQLLHVIPVHGCSECSEIHVAQSGHHIQDCTGPSSVKRRGLHSWVKG  200

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  201  SINDVLIPIESYHLYDPFGRRIKHETRFSYDRIPAVVELCVQAGVDLP  248


 Score = 64.7 bits (156),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   +++ ++ P   +HL +     ++ 
Sbjct  338   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVEEVIPPNYVYHLRDPKGPPLRS  397

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA   D+     +++      IV+P  ++ RL+ 
Sbjct  398   GLKRFYGKAPAVVEVCMQAGAQVPDKYKPMMRLD------IVIPDTEESRLVA  444



>ref|XP_004953830.1| PREDICTED: APO protein 2, chloroplastic-like [Setaria italica]
Length=442

 Score =   191 bits (485),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 139/265 (52%), Gaps = 33/265 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C+YC E++VG  GH  RTC G     +   H W     +++ +PVE +HL +   N I 
Sbjct  165   GCKYCSEIHVGSVGHPFRTCRGMLSNQRRGEHEWGSTLAEAVFLPVEAYHLEDRLGNRIP  224

Query  1038  HHERFDYSRISAVVELCLQAGAN-------------------------------PNDESI  952
             H +RF   RI A+VELC+QAG +                               P  +  
Sbjct  225   HDQRFAVPRIPALVELCIQAGVDLPEYPTKRRRKPIIKIGRNEFVDADEDDLPEPEPDRF  284

Query  951   DASKMEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
               + +E   + +IV P   ++   L  ETL AWET+R G  KL+  Y V+VC +C EVH+
Sbjct  285   KQTLLEELQSDEIVSPSSPEETVALAEETLEAWETVRDGALKLMKGYAVRVCGYCPEVHI  344

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GP+GHKAR CG FK++     H W+ A +DDL+PP  VWH  P+    L  E + +YG A
Sbjct  345   GPTGHKARNCGAFKHQQRNGQHGWQAAVLDDLIPPRYVWH-MPESGEELQRELKTFYGQA  403

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV++C + GA  P KY   M++D
Sbjct  404   PAVVEICIQGGAKVPEKYKATMRLD  428


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 47/100 (47%), Gaps = 0/100 (0%)
 Frame = -1

Query  849  LRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPP  670
            L + + KL+ V PVK CK+CSE+HVG  GH  R C        R  H W     + +  P
Sbjct  150  LINNLRKLMKVVPVKGCKYCSEIHVGSVGHPFRTCRGMLSNQRRGEHEWGSTLAEAVFLP  209

Query  669  NIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
               +H   +    +  + R      PA+V+LC +AG   P
Sbjct  210  VEAYHLEDRLGNRIPHDQRFAVPRIPALVELCIQAGVDLP  249



>emb|CAJ86305.1| H0525G02.2 [Oryza sativa Indica Group]
Length=597

 Score =   194 bits (493),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 111/279 (40%), Positives = 150/279 (54%), Gaps = 40/279 (14%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              LS LLN      CR CP+V+VG  GH I+ C G   + +N  H W++GS++ +LIP+E+
Sbjct  306   GLSQLLNVGTVYGCRKCPQVHVGPVGHQIQDCYGTGSQRRNSHHSWVRGSVNDVLIPIES  365

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------  937
             +H  + F   +KH  RFDY RI A+VELC+QAG      P+       +M          
Sbjct  366   YHQFDPFGWRVKHETRFDYDRIPAIVELCIQAGVELPQYPSRRRTAPVRMIGKKVIDRGG  425

Query  936   ------EHESNSKIVL-----PFDQQ---------MRLLGNETLNAWETLRSGVHKLLLV  817
                    H S   I L      F  Q         +  L  +TL A+  ++ GV +L+  
Sbjct  426   FVDGPKPHRSEDCISLLAELDTFSNQQGQSSMPSNVEELAEKTLKAYLNVQRGVARLMRK  485

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDP  637
             Y VK C +CSEVHVGP GH  +LCG FK++     H W+ A VDD++PPN VWH R    
Sbjct  486   YTVKTCGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDDVIPPNYVWHVRDPTG  545

Query  636   PLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             P L    R++YG APAVV+LC +AGA  P +Y  MM+ D
Sbjct  546   PPLRSSLRSFYGKAPAVVELCVQAGAEIPEEYRPMMRAD  584


 Score = 65.5 bits (158),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 59/112 (53%), Gaps = 6/112 (5%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C YC EV+VG  GH ++ CG ++H+ ++  H W    +D ++ P   +H+ +     ++
Sbjct  490   TCGYCSEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDDVIPPNYVWHVRDPTGPPLR  549

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRL  883
                R  Y +  AVVELC+QAGA   +E     + +      +V+P  ++ RL
Sbjct  550   SSLRSFYGKAPAVVELCVQAGAEIPEEYRPMMRAD------VVIPDSEEARL  595


 Score = 62.0 bits (149),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 4/110 (4%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRI--HFWE  700
            E L+ W+ L  G+ +LL V  V  C+ C +VHVGP GH+ + C  +   S RR   H W 
Sbjct  295  EVLDNWKVLIRGLSQLLNVGTVYGCRKCPQVHVGPVGHQIQDC--YGTGSQRRNSHHSWV  352

Query  699  KASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            + SV+D++ P   +H+       +  E R  Y   PA+V+LC +AG   P
Sbjct  353  RGSVNDVLIPIESYHQFDPFGWRVKHETRFDYDRIPAIVELCIQAGVELP  402



>gb|KEH26436.1| APO RNA-binding protein [Medicago truncatula]
Length=419

 Score =   190 bits (483),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 150/267 (56%), Gaps = 34/267 (13%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C  C EV+V + GH I  C G    T++  H W++G+++ IL+P+E++HL + F   I 
Sbjct  140   GCSECSEVHVAQTGHSILDCEGRTSSTRHSSHAWVRGNVNDILVPIESYHLFDPFGKRIM  199

Query  1038  HHERFDYSRISAVVELCLQAGAN----PNDESIDASKME-----------------HESN  922
             H  RF+Y RI AVVELC+QAG +    P+    +  +M                    + 
Sbjct  200   HDTRFEYDRIPAVVELCIQAGVDIPEYPSRRRTNPIRMVGRRVLDRGGHLEEPKPLRTAE  259

Query  921   SKIVLPFD-------------QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
                V+ FD               +  +  ET++A++T+R GV KL+  Y VK C +CSEV
Sbjct  260   FSSVIDFDTYRACERFPPPPLSDVPKIAQETIDAYQTVRKGVRKLMKKYTVKACGYCSEV  319

Query  780   HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYG  601
             HVGP GH A+LCG FK++     H W+ A++D+++PPN VWH R  + P +    + YYG
Sbjct  320   HVGPWGHNAKLCGSFKHQWRDGKHGWQDATLDEVLPPNYVWHVRDTNGPPIKAALKRYYG  379

Query  600   HAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              APAVV++C +AGA  P++Y  +M++D
Sbjct  380   KAPAVVEVCVQAGARIPAEYKPLMRLD  406


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 65/142 (46%), Gaps = 9/142 (6%)
 Frame = -1

Query  948  ASKMEHESNSK-IVLPFDQQMRLL--------GNETLNAWETLRSGVHKLLLVYPVKVCK  796
            A+KME +  SK I  P +     L          E  +AW+ L  G+ +LL V P   C 
Sbjct  83   AAKMERKLASKGIEKPLEPPKNGLLVPDLVPVAYEVFDAWKLLIKGLSQLLHVIPAYGCS  142

Query  795  HCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEG  616
             CSEVHV  +GH    C      +    H W + +V+D++ P   +H        ++ + 
Sbjct  143  ECSEVHVAQTGHSILDCEGRTSSTRHSSHAWVRGNVNDILVPIESYHLFDPFGKRIMHDT  202

Query  615  RNYYGHAPAVVDLCTKAGAIAP  550
            R  Y   PAVV+LC +AG   P
Sbjct  203  RFEYDRIPAVVELCIQAGVDIP  224



>gb|KDP21687.1| hypothetical protein JCGZ_03358 [Jatropha curcas]
Length=443

 Score =   191 bits (484),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 150/270 (56%), Gaps = 36/270 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+VG+ GH I+ C G  +  ++  H WI+GS++ +L+P+E++HL++ F   
Sbjct  162   VFACSACSEVHVGDTGHQIQNCLGPTNDNRHSHHSWIRGSINDVLVPIESYHLYDPFGRR  221

Query  1044  IKHHERFDYSRISAVVELCLQAGA-----------NP----NDESIDASKMEHE------  928
             IKH  RFDY RI AVVELC+QAG            NP      + ID      E      
Sbjct  222   IKHETRFDYDRIPAVVELCIQAGVDIPEYPSRRRKNPIRMIGKKVIDRGGYVEEPRPWRF  281

Query  927   SNSKIVLPFD-------------QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
              N    + FD             + +  +  ET++A+E +R GV KL+  Y VK C +C 
Sbjct  282   GNPSTSIDFDTYRASERFSPPPLEDLPRIAQETIDAYEKVRWGVRKLMRKYTVKACGYCP  341

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVHVGP GH  +LCG  K++     H W+ A+V+++ PPN VWH R P+ PP L    + 
Sbjct  342   EVHVGPWGHNVKLCGEHKHQWRDGKHGWQDATVEEVFPPNYVWHVRDPKGPP-LKSALKK  400

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             +YG APAVV++C + GA  P KY  MM++D
Sbjct  401   FYGKAPAVVEMCMQVGAQIPEKYKPMMRLD  430


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 58/108 (54%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW+ L  GV +LL + PV  C  CSEVHVG +GH+ + C     ++    H W + 
Sbjct  141  EVLDAWKILIKGVAELLHLVPVFACSACSEVHVGDTGHQIQNCLGPTNDNRHSHHSWIRG  200

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  201  SINDVLVPIESYHLYDPFGRRIKHETRFDYDRIPAVVELCIQAGVDIP  248



>ref|XP_002308405.1| hypothetical protein POPTR_0006s19750g [Populus trichocarpa]
 gb|EEE91928.1| hypothetical protein POPTR_0006s19750g [Populus trichocarpa]
Length=418

 Score =   190 bits (482),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/264 (38%), Positives = 146/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W   +++ +L+P+E +HL++     IKH
Sbjct  141   CGWCNELHVGPEGHPFKSCKGKHATLRKGLHQWTNAAVEDVLVPIEAYHLYDPLGKRIKH  200

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASK------------  940
              ERF   RI AV+ELC+QAG   ++                E +DA +            
Sbjct  201   EERFSIPRIPAVMELCIQAGVYVSEYPTKRRRKPIIRIGKREFVDADESDLPDPVPEVPL  260

Query  939   ---MEHESNSKIVLPFDQQMR-LLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                +     S+ V P +++ + LL  ETL AWE +R G  KL+ +Y V+VC +C EVHVG
Sbjct  261   KPLLTELPISEAVAPTNEEEKTLLAEETLQAWEKMRKGAKKLMQMYRVRVCGYCPEVHVG  320

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
              SGHKA+ CG  K++     H W+ A +D+L+PP  VWH    D P L  E RN+YG AP
Sbjct  321   HSGHKAQNCGAHKHQQRNGQHGWQSAVLDNLIPPRYVWHVPDVDGPPLRRELRNFYGQAP  380

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M++D
Sbjct  381   AVVEICVQAGAAVPDQYKSTMRLD  404


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 58/108 (54%), Gaps = 2/108 (2%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRR-IHF  706
            L  +  NA  TL + + KLL V PV  C  C+E+HVGP GH  + C   K+ + R+ +H 
Sbjct  114  LAYDVFNARITLINNLKKLLKVVPVHACGWCNELHVGPEGHPFKSCK-GKHATLRKGLHQ  172

Query  705  WEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
            W  A+V+D++ P   +H        +  E R      PAV++LC +AG
Sbjct  173  WTNAAVEDVLVPIEAYHLYDPLGKRIKHEERFSIPRIPAVMELCIQAG  220



>gb|ADE76138.1| unknown [Picea sitchensis]
Length=442

 Score =   191 bits (484),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 103/272 (38%), Positives = 149/272 (55%), Gaps = 42/272 (15%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             CR C EV++G  GH ++TC G      ++ HVW KG++D IL+ VE+FHL++     + H
Sbjct  160   CRNCSEVHIGSQGHQLKTCEGPMS-CSSKKHVWRKGTVDDILVTVESFHLYDRVGRAVTH  218

Query  1035  HERFDYSRISAVVELCLQAGANPND---------------ESIDASKME--HESNSKIV-  910
              ERF   R+ A++ELC+QAG +  D               + +D  K     +SNS  V 
Sbjct  219   KERFMVDRLPAIIELCIQAGLDLPDFPTKRRAYPVYMVAGKIVDFEKCSPPKDSNSMDVD  278

Query  909   ---------------------LPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
                                  L   + ++ +  +TL AWE ++SG  KL+  Y VK C +
Sbjct  279   EDFESRDFWDSKKQPKRDESPLSTAEDIQRMAQQTLEAWEDMKSGARKLMEKYAVKTCAY  338

Query  792   CSEVHVGPSGHKARLCGVFKYESWRR-IHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEG  616
             C EV VGP GH+AR+C   K++ WR   H W++A+ DDL+PP  VWH R  + P L ++ 
Sbjct  339   CPEVQVGPKGHRARICQAHKHQ-WRDGQHGWQEATFDDLIPPKYVWHVRDPNGPPLENKM  397

Query  615   RNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             R YYG APAVV+LC + GA  P +Y  MM++D
Sbjct  398   RKYYGMAPAVVELCVQGGATVPDEYKSMMRLD  429


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 58/112 (52%), Gaps = 3/112 (3%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLC-GVFKYESWRRIHF  706
            + ++   A   L  GV KL+ V PV+ C++CSEVH+G  GH+ + C G     S +  H 
Sbjct  133  VAHQVYQAKTALYEGVAKLVDVIPVQACRNCSEVHIGSQGHQLKTCEGPMSCSSKK--HV  190

Query  705  WEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            W K +VDD++     +H   +    +  + R      PA+++LC +AG   P
Sbjct  191  WRKGTVDDILVTVESFHLYDRVGRAVTHKERFMVDRLPAIIELCIQAGLDLP  242



>ref|XP_010680775.1| PREDICTED: APO protein 2, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=464

 Score =   191 bits (485),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 105/273 (38%), Positives = 154/273 (56%), Gaps = 33/273 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C+ C E++VG  GH  ++C G    +++ LH W    ++ IL+PV+ +HL++  +  I H
Sbjct  187   CKCCNEIHVGPVGHPFKSCRGAGASSRHGLHDWGSAMVEDILVPVDAYHLYDRLRKRIAH  246

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASK------------  940
              ERF   R+ AVVELC+QAG N                  +E IDA +            
Sbjct  247   DERFSIPRLPAVVELCIQAGVNLPEYPAKRRRKAIIRIGKNEFIDADESDLPDPEAQSPT  306

Query  939   ---MEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                +     S+IV P   +++ LL  ETL AWE +R G +KL+ +YPV+VC +C EVHVG
Sbjct  307   VPILSEIPESEIVPPSSAEEIVLLAEETLLAWERMRKGANKLMKMYPVRVCGYCPEVHVG  366

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
              SGHKA+ CG  K++     H W++A +DDL+PP  VWH    + P +  E R++YG AP
Sbjct  367   SSGHKAQNCGAHKHQQRNGQHGWQRAVLDDLIPPRYVWHVPDINGPPMKRELRSFYGQAP  426

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD-GLSAPISD  496
              VV+LC +AGA  P +Y   M++D G+ A I +
Sbjct  427   IVVELCGQAGAEVPDQYKPTMRLDIGIPASIEE  459


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 54/108 (50%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + LNA   L + + KL+ V  V  CK C+E+HVGP GH  + C      S   +H W  A
Sbjct  163  DVLNARILLINNLRKLMKVVIVHACKCCNEIHVGPVGHPFKSCRGAGASSRHGLHDWGSA  222

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             V+D++ P   +H   +    +  + R      PAVV+LC +AG   P
Sbjct  223  MVEDILVPVDAYHLYDRLRKRIAHDERFSIPRLPAVVELCIQAGVNLP  270



>ref|XP_006587114.1| PREDICTED: APO protein 2, chloroplastic-like [Glycine max]
Length=438

 Score =   190 bits (483),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/263 (38%), Positives = 142/263 (54%), Gaps = 32/263 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G +   +  LH W    ++ ILIP+E +HL +     I H
Sbjct  163   CGWCSEIHVGPVGHPFKSCKGTQANIRKGLHEWTNAHVEDILIPIEAYHLFDRLGKRITH  222

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKMEHES-------  925
              ERF   RI AVVELC+QAG    +                E IDA + +          
Sbjct  223   EERFSIPRIPAVVELCIQAGVEIPEFPTKRRRKPIIRIGRKEFIDADESDLPDKISEGPL  282

Query  924   --------NSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGP  769
                     +S+IV P D ++  L  ETL AWE +R G  +L+ +Y V+VC +C E+HVG 
Sbjct  283   KPLLAEIHDSEIVAPLDNEVAPLAEETLQAWERMRKGAKRLMRMYNVRVCGYCPEIHVGA  342

Query  768   SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPA  589
              GHKA+ CG  K++     H W+ A ++DL+PP  VWH    + P L  E RN+YG APA
Sbjct  343   QGHKAQNCGAHKHQQRNGQHGWQSAVLNDLIPPRFVWHVPDVNAP-LERELRNFYGQAPA  401

Query  588   VVDLCTKAGAIAPSKYFCMMKVD  520
             VV++C +AGA  P +Y   M++D
Sbjct  402   VVEMCIQAGAGLPEQYKSTMRLD  424


 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 54/105 (51%), Gaps = 0/105 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            NA  TL + + KLL V PV  C  CSE+HVGP GH  + C   +    + +H W  A V+
Sbjct  142  NARITLINNLKKLLKVVPVHACGWCSEIHVGPVGHPFKSCKGTQANIRKGLHEWTNAHVE  201

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            D++ P   +H   +    +  E R      PAVV+LC +AG   P
Sbjct  202  DILIPIEAYHLFDRLGKRITHEERFSIPRIPAVVELCIQAGVEIP  246



>gb|KDO78636.1| hypothetical protein CISIN_1g013320mg [Citrus sinensis]
Length=417

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 146/270 (54%), Gaps = 36/270 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V  +GH I+ C G     +   H W++GS++ IL+PVE++HL++ F   
Sbjct  136   VYGCSECSEVHVAHSGHHIQNCQGATAAKRRSFHSWVRGSINDILLPVESYHLYDPFGRR  195

Query  1044  IKHHERFDYSRISAVVELCLQAGAN-PNDESIDASKMEHESNSKIV--------------  910
             IKH  RFDY RI AVVELC+QAG + P   S   +K       K++              
Sbjct  196   IKHESRFDYDRIPAVVELCIQAGVDIPEYPSRRRTKPIRTLGKKVIDRGGFVEEPRPWRS  255

Query  909   -------------------LPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
                                 P    +  +  ET++A+E +RSGV KL+  Y VK C +C 
Sbjct  256   RGSSALSDLDTDGACGRLPPPSLADVPRIAQETMDAYEVVRSGVTKLMRKYSVKACGYCP  315

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVH+GP GH  +LCG FK++     H W+ A VD++ PPN VWH + P+ PP L    + 
Sbjct  316   EVHIGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDEVFPPNYVWHVQDPKGPP-LRSALKR  374

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             YYG APAVV++C +AGA  P +Y   M++D
Sbjct  375   YYGKAPAVVEVCMQAGAQVPEQYKPTMRLD  404


 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E ++AW+ L  G+ +LL V PV  C  CSEVHV  SGH  + C        R  H W + 
Sbjct  115  EVIDAWKLLIKGLAQLLHVIPVYGCSECSEVHVAHSGHHIQNCQGATAAKRRSFHSWVRG  174

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  175  SINDILLPVESYHLYDPFGRRIKHESRFDYDRIPAVVELCIQAGVDIP  222


 Score = 64.7 bits (156),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YCPEV++G  GH ++ CG ++H+ ++  H W    +D +  P   +H+ +     ++ 
Sbjct  311   CGYCPEVHIGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDEVFPPNYVWHVQDPKGPPLRS  370

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA   ++     +++      I++P  +++ L+ 
Sbjct  371   ALKRYYGKAPAVVEVCMQAGAQVPEQYKPTMRLD------IIVPESEEVDLVA  417



>gb|KDP38686.1| hypothetical protein JCGZ_04039 [Jatropha curcas]
Length=330

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/264 (38%), Positives = 139/264 (53%), Gaps = 33/264 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  RTC       +   H W   +++ I +P+E++HL +     I H
Sbjct  54    CGWCNEIHVGPEGHPFRTCRSKYANLRKGQHEWTNAAIEDIFVPIESYHLFDRLGKRIPH  113

Query  1035  HERFDYSRISAVVELCLQAGAN-----------------------------PNDESIDAS  943
              ERF   RI AVVELC+QAG                               P+ E +   
Sbjct  114   AERFSVPRIPAVVELCIQAGVEIPEYPTKRRRKPIIRINRSEFVDADESDLPDPEPVVPV  173

Query  942   K--MEHESNSKIVLPF-DQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
             K  +    NS+IV P  +++ + L  ETL AWE +R G  KL+ VY V+VC +C EVHVG
Sbjct  174   KPLLTEIPNSEIVAPSNEEETKFLAEETLQAWENMRKGAKKLMRVYTVRVCGYCPEVHVG  233

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P GHKA+ CG  K++     H W+ A +DDL+PP  VWH      P L  E R +YG AP
Sbjct  234   PRGHKAQNCGANKHQQRNGQHGWQAAVLDDLIPPRYVWHLPDVGSP-LHRELRRFYGQAP  292

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M++D
Sbjct  293   AVVEMCIQAGAAVPDEYKPTMRLD  316


 Score = 59.7 bits (143),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/121 (35%), Positives = 57/121 (47%), Gaps = 18/121 (15%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRR-IHF  706
            L  +  NA   L + + KL+ V PV  C  C+E+HVGP GH  R C   KY + R+  H 
Sbjct  27   LAYDVYNARIVLINNLKKLMTVVPVHACGWCNEIHVGPEGHPFRTCR-SKYANLRKGQHE  85

Query  705  WEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA--------PAVVDLCTKAGAIAP  550
            W  A+++D+  P   +H        L D       HA        PAVV+LC +AG   P
Sbjct  86   WTNAAIEDIFVPIESYH--------LFDRLGKRIPHAERFSVPRIPAVVELCIQAGVEIP  137

Query  549  S  547
             
Sbjct  138  E  138



>ref|XP_003619598.1| APO protein [Medicago truncatula]
 gb|AES75816.1| APO RNA-binding protein [Medicago truncatula]
Length=451

 Score =   190 bits (483),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/267 (37%), Positives = 150/267 (56%), Gaps = 34/267 (13%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C  C EV+V + GH I  C G    T++  H W++G+++ IL+P+E++HL + F   I 
Sbjct  172   GCSECSEVHVAQTGHSILDCEGRTSSTRHSSHAWVRGNVNDILVPIESYHLFDPFGKRIM  231

Query  1038  HHERFDYSRISAVVELCLQAGAN----PNDESIDASKME-----------------HESN  922
             H  RF+Y RI AVVELC+QAG +    P+    +  +M                    + 
Sbjct  232   HDTRFEYDRIPAVVELCIQAGVDIPEYPSRRRTNPIRMVGRRVLDRGGHLEEPKPLRTAE  291

Query  921   SKIVLPFD-------------QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
                V+ FD               +  +  ET++A++T+R GV KL+  Y VK C +CSEV
Sbjct  292   FSSVIDFDTYRACERFPPPPLSDVPKIAQETIDAYQTVRKGVRKLMKKYTVKACGYCSEV  351

Query  780   HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYG  601
             HVGP GH A+LCG FK++     H W+ A++D+++PPN VWH R  + P +    + YYG
Sbjct  352   HVGPWGHNAKLCGSFKHQWRDGKHGWQDATLDEVLPPNYVWHVRDTNGPPIKAALKRYYG  411

Query  600   HAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              APAVV++C +AGA  P++Y  +M++D
Sbjct  412   KAPAVVEVCVQAGARIPAEYKPLMRLD  438


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 53/108 (49%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E  +AW+ L  G+ +LL V P   C  CSEVHV  +GH    C      +    H W + 
Sbjct  149  EVFDAWKLLIKGLSQLLHVIPAYGCSECSEVHVAQTGHSILDCEGRTSSTRHSSHAWVRG  208

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            +V+D++ P   +H        ++ + R  Y   PAVV+LC +AG   P
Sbjct  209  NVNDILVPIESYHLFDPFGKRIMHDTRFEYDRIPAVVELCIQAGVDIP  256



>ref|XP_006467238.1| PREDICTED: APO protein 1, chloroplastic-like isoform X1 [Citrus 
sinensis]
 ref|XP_006467239.1| PREDICTED: APO protein 1, chloroplastic-like isoform X2 [Citrus 
sinensis]
 gb|KDO78633.1| hypothetical protein CISIN_1g013320mg [Citrus sinensis]
 gb|KDO78634.1| hypothetical protein CISIN_1g013320mg [Citrus sinensis]
 gb|KDO78635.1| hypothetical protein CISIN_1g013320mg [Citrus sinensis]
Length=445

 Score =   190 bits (483),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 103/270 (38%), Positives = 146/270 (54%), Gaps = 36/270 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V  +GH I+ C G     +   H W++GS++ IL+PVE++HL++ F   
Sbjct  164   VYGCSECSEVHVAHSGHHIQNCQGATAAKRRSFHSWVRGSINDILLPVESYHLYDPFGRR  223

Query  1044  IKHHERFDYSRISAVVELCLQAGAN-PNDESIDASKMEHESNSKIV--------------  910
             IKH  RFDY RI AVVELC+QAG + P   S   +K       K++              
Sbjct  224   IKHESRFDYDRIPAVVELCIQAGVDIPEYPSRRRTKPIRTLGKKVIDRGGFVEEPRPWRS  283

Query  909   -------------------LPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
                                 P    +  +  ET++A+E +RSGV KL+  Y VK C +C 
Sbjct  284   RGSSALSDLDTDGACGRLPPPSLADVPRIAQETMDAYEVVRSGVTKLMRKYSVKACGYCP  343

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVH+GP GH  +LCG FK++     H W+ A VD++ PPN VWH + P+ PP L    + 
Sbjct  344   EVHIGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDEVFPPNYVWHVQDPKGPP-LRSALKR  402

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             YYG APAVV++C +AGA  P +Y   M++D
Sbjct  403   YYGKAPAVVEVCMQAGAQVPEQYKPTMRLD  432


 Score = 67.8 bits (164),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E ++AW+ L  G+ +LL V PV  C  CSEVHV  SGH  + C        R  H W + 
Sbjct  143  EVIDAWKLLIKGLAQLLHVIPVYGCSECSEVHVAHSGHHIQNCQGATAAKRRSFHSWVRG  202

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  203  SINDILLPVESYHLYDPFGRRIKHESRFDYDRIPAVVELCIQAGVDIP  250


 Score = 65.1 bits (157),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/113 (27%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YCPEV++G  GH ++ CG ++H+ ++  H W    +D +  P   +H+ +     ++ 
Sbjct  339   CGYCPEVHIGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDEVFPPNYVWHVQDPKGPPLRS  398

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA   ++     +++      I++P  +++ L+ 
Sbjct  399   ALKRYYGKAPAVVEVCMQAGAQVPEQYKPTMRLD------IIVPESEEVDLVA  445



>gb|KCW81120.1| hypothetical protein EUGRSUZ_C02496 [Eucalyptus grandis]
Length=339

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/267 (39%), Positives = 142/267 (53%), Gaps = 32/267 (12%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C +C E++VG  GH  ++C G     +   H W   +++ IL PVE +HL +     
Sbjct  59    VLACGWCGEIHVGPVGHPFKSCKGPNSSMRKGHHEWTNATIEDILPPVEAYHLFDRLGKR  118

Query  1044  IKHHERFDYSRISAVVELCLQAGANPND----------------ESIDASKME-------  934
             I H ERF   RI AVVELC+QAG    D                E +DA + E       
Sbjct  119   ISHDERFSIPRIPAVVELCIQAGVEIPDLPTKRRRKPIIRIGKKEFVDADESELPDPIPE  178

Query  933   --------HESNSKIVLPFDQQMRLL-GNETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
                        +S+ + P D + +LL   ETL AWE +R G  KL+ VYPV+VC +C EV
Sbjct  179   APIIPMLTELPDSQTLAPSDDEEKLLLAEETLQAWEKMRHGSKKLMRVYPVRVCGYCPEV  238

Query  780   HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYG  601
             HVGP+GHKA+ CG  K++     H W+ A +DDL+PP  VWH    D   L  E  ++YG
Sbjct  239   HVGPTGHKAQNCGEHKHQQRNGQHGWQSAVLDDLIPPRYVWHVPNADGRPLQRELISFYG  298

Query  600   HAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              AP VV++C +AGA  P +Y   M++D
Sbjct  299   KAPVVVEICVQAGANVPEQYKPTMRLD  325


 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 53/112 (47%), Gaps = 0/112 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L     NA  TL + +  LL V PV  C  C E+HVGP GH  + C        +  H W
Sbjct  35   LAYNVFNARITLINNLKTLLKVVPVLACGWCGEIHVGPVGHPFKSCKGPNSSMRKGHHEW  94

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
              A+++D++PP   +H   +    +  + R      PAVV+LC +AG   P 
Sbjct  95   TNATIEDILPPVEAYHLFDRLGKRISHDERFSIPRIPAVVELCIQAGVEIPD  146



>dbj|BAB08863.1| unnamed protein product [Arabidopsis thaliana]
Length=405

 Score =   188 bits (478),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/264 (36%), Positives = 142/264 (54%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W    ++ +++P+E +HL +     I+H
Sbjct  128   CGWCNEIHVGPYGHPFKSCKGPNTSQRKGLHEWTNSVIEDVIVPLEAYHLFDRLGKRIRH  187

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHESN------  922
              ERF   R+ AVVELC+Q G                     E +DA + E          
Sbjct  188   DERFSIPRVPAVVELCIQGGVEIPEFPAKRRRKPIIRIGKSEFVDADETELPDPEPQPPP  247

Query  921   ---------SKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                      S+I  P  ++  + L  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  248   VPLLTELPVSEITPPSSEEETVSLAEETLQAWEEMRAGAKKLMRMYRVRVCGYCPEVHVG  307

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P +  E R++YG AP
Sbjct  308   PTGHKAQNCGAFKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVNGPPMQRELRSFYGQAP  367

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA+ P  Y   M+++
Sbjct  368   AVVEICAQAGAVVPEHYRATMRLE  391


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  +  NA   L + +H+L+ V  V  C  C+E+HVGP GH  + C        + +H W
Sbjct  101  LAYKVYNARIRLINNLHRLMKVVRVNACGWCNEIHVGPYGHPFKSCKGPNTSQRKGLHEW  160

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              + ++D++ P   +H   +    +  + R      PAVV+LC + G   P
Sbjct  161  TNSVIEDVIVPLEAYHLFDRLGKRIRHDERFSIPRVPAVVELCIQGGVEIP  211



>ref|XP_007153604.1| hypothetical protein PHAVU_003G049700g [Phaseolus vulgaris]
 gb|ESW25598.1| hypothetical protein PHAVU_003G049700g [Phaseolus vulgaris]
Length=329

 Score =   186 bits (473),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/263 (38%), Positives = 141/263 (54%), Gaps = 32/263 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G +   +  LH W    ++ IL P+E +HL +     I H
Sbjct  54    CGWCSEIHVGPVGHPFKSCKGAQANIRKGLHEWSNAYVEDILTPIEAYHLFDRLGKRITH  113

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKMEHES-------  925
              ERF   RI A+VELC+QAG    +                E IDA + E          
Sbjct  114   DERFQIPRIPALVELCIQAGVQIPEFPTKRRRKPIIRIGRKEFIDADESELPDEVPEGPL  173

Query  924   --------NSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGP  769
                     +++ V P D ++  L +ET+ AWE +R G  KL+ +Y V+VC +C EVHVG 
Sbjct  174   KPLLAEIPDAETVAPLDNELVPLADETIQAWEQMRKGAKKLMRMYNVRVCGYCPEVHVGA  233

Query  768   SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPA  589
              GHKA+ CG  K++     H W+ A +DDL+PP  VWH    + P L  E RN+YG APA
Sbjct  234   QGHKAQNCGAHKHQQRNGQHGWQSAVLDDLIPPRFVWHVPDVNVP-LDRELRNFYGQAPA  292

Query  588   VVDLCTKAGAIAPSKYFCMMKVD  520
             VV++C +AGA  P +Y   M++D
Sbjct  293   VVEMCIQAGASLPEEYKSTMRLD  315


 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 0/106 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            NA  TL + + KLL V PV  C  CSE+HVGP GH  + C   +    + +H W  A V+
Sbjct  33   NARITLINNLKKLLKVVPVHACGWCSEIHVGPVGHPFKSCKGAQANIRKGLHEWSNAYVE  92

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            D++ P   +H   +    +  + R      PA+V+LC +AG   P 
Sbjct  93   DILTPIEAYHLFDRLGKRITHDERFQIPRIPALVELCIQAGVQIPE  138



>gb|EPS57781.1| hypothetical protein M569_17036, partial [Genlisea aurea]
Length=381

 Score =   187 bits (476),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 98/270 (36%), Positives = 146/270 (54%), Gaps = 39/270 (14%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++V + GH I+ C G  +  ++  H WIKGS++ +++P++++H+ + F   IKH
Sbjct  100   CSFCSEIHVAQAGHEIQDCHGSTNAKRSSFHSWIKGSINDVIVPIDSYHMFDPFGRRIKH  159

Query  1035  HERFDYSRISAVVELCLQAGAN----PNDESIDASKM-----------------------  937
               RF+Y RI AVVELC+QAG      P+    +  +M                       
Sbjct  160   ETRFNYDRIPAVVELCIQAGVELPDYPSRRRSEPIRMLGKKVVYNGGFVDEPTLLPSSPC  219

Query  936   ----------EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
                        H +  +   P   +   +  ETL  +E +R GV +L+  Y VK C +CS
Sbjct  220   SSRSGILDLETHGALDRFPPPDQPETARVAQETLRVYERVRRGVTRLMRKYSVKACGYCS  279

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVHVGP GH A+LCG FK++     H W+ A+VD++  PN VWH   P+  P L   GR 
Sbjct  280   EVHVGPWGHDAKLCGEFKHQWRDGKHGWQDATVDEVFTPNYVWHVEDPKGAP-LRSAGRR  338

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             +YG +PAVV++C + GA AP+KY  MM+ D
Sbjct  339   FYGKSPAVVEVCMQGGATAPAKYRAMMRPD  368


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 54/108 (50%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+ W+ L  GV +LL V PV  C  CSE+HV  +GH+ + C           H W K 
Sbjct  76   ELLDNWKLLIKGVAQLLHVVPVHACSFCSEIHVAQAGHEIQDCHGSTNAKRSSFHSWIKG  135

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  136  SINDVIVPIDSYHMFDPFGRRIKHETRFNYDRIPAVVELCIQAGVELP  183


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 56/113 (50%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     ++ 
Sbjct  275   CGYCSEVHVGPWGHDAKLCGEFKHQWRDGKHGWQDATVDEVFTPNYVWHVEDPKGAPLRS  334

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               R  Y +  AVVE+C+Q GA         +K        IV+P D + RL+ 
Sbjct  335   AGRRFYGKSPAVVEVCMQGGATA------PAKYRAMMRPDIVVPDDDEARLVA  381



>ref|NP_200601.3| APO protein 2 [Arabidopsis thaliana]
 gb|AED96973.1| APO protein 2 [Arabidopsis thaliana]
Length=443

 Score =   189 bits (480),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/264 (36%), Positives = 142/264 (54%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W    ++ +++P+E +HL +     I+H
Sbjct  166   CGWCNEIHVGPYGHPFKSCKGPNTSQRKGLHEWTNSVIEDVIVPLEAYHLFDRLGKRIRH  225

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHESN------  922
              ERF   R+ AVVELC+Q G                     E +DA + E          
Sbjct  226   DERFSIPRVPAVVELCIQGGVEIPEFPAKRRRKPIIRIGKSEFVDADETELPDPEPQPPP  285

Query  921   ---------SKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                      S+I  P  ++  + L  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  286   VPLLTELPVSEITPPSSEEETVSLAEETLQAWEEMRAGAKKLMRMYRVRVCGYCPEVHVG  345

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P +  E R++YG AP
Sbjct  346   PTGHKAQNCGAFKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVNGPPMQRELRSFYGQAP  405

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA+ P  Y   M+++
Sbjct  406   AVVEICAQAGAVVPEHYRATMRLE  429


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  +  NA   L + +H+L+ V  V  C  C+E+HVGP GH  + C        + +H W
Sbjct  139  LAYKVYNARIRLINNLHRLMKVVRVNACGWCNEIHVGPYGHPFKSCKGPNTSQRKGLHEW  198

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              + ++D++ P   +H   +    +  + R      PAVV+LC + G   P
Sbjct  199  TNSVIEDVIVPLEAYHLFDRLGKRIRHDERFSIPRVPAVVELCIQGGVEIP  249



>ref|XP_006649018.1| PREDICTED: APO protein 2, chloroplastic-like [Oryza brachyantha]
Length=449

 Score =   189 bits (480),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/265 (37%), Positives = 142/265 (54%), Gaps = 33/265 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C+YC E++VG  GH  RTC G     +   H W    ++++ +PVE +HL +   N I 
Sbjct  172   GCKYCSEIHVGSVGHPFRTCKGMSSDKRRGEHDWGSTLVEAVFLPVEAYHLEDRLGNRIP  231

Query  1038  HHERFDYSRISAVVELCLQAGAN-------------------------------PNDESI  952
             H +RF   RI A+VELC+QAG N                               P    +
Sbjct  232   HDQRFAVPRIPALVELCIQAGVNLPEYPTKRRRKPIIKIGRSEFIDANEDDLPDPEPYKL  291

Query  951   DASKMEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
             D   +E   +++++ P   +++  L  ETL AWE +R G  +L+  Y V+VC +C EVH+
Sbjct  292   DHPILEELHDNEVITPSSPEEIVALAEETLEAWEVVRGGALRLMKSYAVRVCGYCPEVHI  351

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             G SGHKAR CG FK++     H W+ A +DDL+PP  VWH  P+    L  + +++YG A
Sbjct  352   GASGHKARNCGAFKHQQRNGQHGWQAAVLDDLIPPRYVWH-MPESGEELQRDLKSFYGQA  410

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV++C +AGA  P KY   M++D
Sbjct  411   PAVVEICVQAGAKVPEKYKATMRLD  435


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            NA   L + + +L+ V PV+ CK+CSE+HVG  GH  R C     +  R  H W    V+
Sbjct  152  NARILLINNLKRLMKVIPVRGCKYCSEIHVGSVGHPFRTCKGMSSDKRRGEHDWGSTLVE  211

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +  P   +H   +    +  + R      PA+V+LC +AG   P
Sbjct  212  AVFLPVEAYHLEDRLGNRIPHDQRFAVPRIPALVELCIQAGVNLP  256



>ref|NP_851208.1| APO protein 2 [Arabidopsis thaliana]
 sp|Q8W4A5.1|APO2_ARATH RecName: Full=APO protein 2, chloroplastic; AltName: Full=Accumulation 
of photosystem I protein 2; AltName: Full=Protein 
EMBRYO DEFECTIVE 1629; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL32779.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM47991.1| unknown protein [Arabidopsis thaliana]
 gb|AED96972.1| APO protein 2 [Arabidopsis thaliana]
Length=440

 Score =   189 bits (479),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/264 (36%), Positives = 142/264 (54%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W    ++ +++P+E +HL +     I+H
Sbjct  163   CGWCNEIHVGPYGHPFKSCKGPNTSQRKGLHEWTNSVIEDVIVPLEAYHLFDRLGKRIRH  222

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHESN------  922
              ERF   R+ AVVELC+Q G                     E +DA + E          
Sbjct  223   DERFSIPRVPAVVELCIQGGVEIPEFPAKRRRKPIIRIGKSEFVDADETELPDPEPQPPP  282

Query  921   ---------SKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                      S+I  P  ++  + L  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  283   VPLLTELPVSEITPPSSEEETVSLAEETLQAWEEMRAGAKKLMRMYRVRVCGYCPEVHVG  342

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P +  E R++YG AP
Sbjct  343   PTGHKAQNCGAFKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVNGPPMQRELRSFYGQAP  402

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA+ P  Y   M+++
Sbjct  403   AVVEICAQAGAVVPEHYRATMRLE  426


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  +  NA   L + +H+L+ V  V  C  C+E+HVGP GH  + C        + +H W
Sbjct  136  LAYKVYNARIRLINNLHRLMKVVRVNACGWCNEIHVGPYGHPFKSCKGPNTSQRKGLHEW  195

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              + ++D++ P   +H   +    +  + R      PAVV+LC + G   P
Sbjct  196  TNSVIEDVIVPLEAYHLFDRLGKRIRHDERFSIPRVPAVVELCIQGGVEIP  246



>ref|XP_006449973.1| hypothetical protein CICLE_v10015251mg [Citrus clementina]
 gb|ESR63213.1| hypothetical protein CICLE_v10015251mg [Citrus clementina]
Length=445

 Score =   189 bits (479),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 146/270 (54%), Gaps = 36/270 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C EV+V  +GH I+ C G     +   H W++GS++ IL+PVE++HL++ F   
Sbjct  164   VYGCSECSEVHVAHSGHHIQNCQGATAAKRRSFHSWVRGSINDILLPVESYHLYDPFGRR  223

Query  1044  IKHHERFDYSRISAVVELCLQAGAN-PNDES--------------IDASKMEHESN----  922
             IKH  RFDY RI AVVELC+QAG + P   S              ID      E      
Sbjct  224   IKHEFRFDYDRIPAVVELCIQAGVDIPEYPSRRRTKPIRMLGKKVIDRGGFVEEPRPWRS  283

Query  921   ---------------SKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
                             ++  P    +  +  ET++A+E +RSGV KL+  Y VK C +C 
Sbjct  284   RGSSALSDLDTDGACGRLPPPSLADVPRIAQETMDAYEVVRSGVTKLMRKYSVKACGYCP  343

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRN  610
             EVHVGP GH  +LCG FK++     H W+ A VD++ PPN VWH + P+ PP L    + 
Sbjct  344   EVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDEVFPPNYVWHVQDPKGPP-LRSALKR  402

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             YYG APAVV++C +AGA  P +Y   M++D
Sbjct  403   YYGKAPAVVEVCMQAGAQVPEQYKPTMRLD  432


 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E ++AW+ L  G+ +LL V PV  C  CSEVHV  SGH  + C        R  H W + 
Sbjct  143  EVIDAWKLLIKGLAQLLHVIPVYGCSECSEVHVAHSGHHIQNCQGATAAKRRSFHSWVRG  202

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  203  SINDILLPVESYHLYDPFGRRIKHEFRFDYDRIPAVVELCIQAGVDIP  250


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YCPEV+VG  GH ++ CG ++H+ ++  H W    +D +  P   +H+ +     ++ 
Sbjct  339   CGYCPEVHVGPWGHNVKLCGAFKHQWRDGKHGWQDAVVDEVFPPNYVWHVQDPKGPPLRS  398

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA   ++     +++      I++P  +++ L+ 
Sbjct  399   ALKRYYGKAPAVVEVCMQAGAQVPEQYKPTMRLD------IIVPESEEVDLVA  445



>ref|XP_009767511.1| PREDICTED: APO protein 2, chloroplastic [Nicotiana sylvestris]
Length=436

 Score =   188 bits (478),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/274 (37%), Positives = 150/274 (55%), Gaps = 34/274 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C++C E++VG  GH  ++C G +   +   H W K  L+ I++P+E++HL++     I 
Sbjct  159   GCKWCNEIHVGPVGHPFKSCRGSQASKRKGHHEWGKAVLEDIMVPLESYHLYDRLGKRIS  218

Query  1038  HHERFDYSRISAVVELCLQAGAN-------------------------------PNDESI  952
             H ERF   RI AVVELC+QAG +                               P  ES 
Sbjct  219   HEERFSIPRIPAVVELCIQAGVDMPEYPTKRRRKPIIWTGKNEFVDADESDLPDPEPESP  278

Query  951   DASKMEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                 +    ++++  P   ++  LL  ETL AWE +R G ++L+ +YPV+VC +C EVHV
Sbjct  279   MPPILTEIPDAEVEPPSSAEETVLLAEETLEAWERMRVGANRLMKMYPVRVCGYCPEVHV  338

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GPSGHKA+ CG  K++     H W+ A +DDL+PP  VWH    + P L  E R++YG A
Sbjct  339   GPSGHKAQNCGAHKHQQRNGQHGWQTAVLDDLIPPRYVWHVPDVNQP-LQRELRSFYGQA  397

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD-GLSAPISD  496
             PAVV++C +AGA  P +Y   M+ D G+ + I +
Sbjct  398   PAVVEICVQAGAEVPEQYKPTMRFDVGIPSSIKE  431


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L     NA  T+ + + +LL V PV  CK C+E+HVGP GH  + C   +    +  H W
Sbjct  133  LAYNVFNARITVINNLKRLLKVVPVNGCKWCNEIHVGPVGHPFKSCRGSQASKRKGHHEW  192

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             KA ++D++ P   +H   +    +  E R      PAVV+LC +AG   P
Sbjct  193  GKAVLEDIMVPLESYHLYDRLGKRISHEERFSIPRIPAVVELCIQAGVDMP  243



>ref|XP_011033400.1| PREDICTED: APO protein 2, chloroplastic [Populus euphratica]
Length=455

 Score =   189 bits (480),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 146/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +  LH W   +++ +L+P+E +HL++     IKH
Sbjct  178   CGWCNELHVGPEGHPFKSCKGKHATFRKGLHQWTNAAVEDVLVPIEAYHLYDPLGKRIKH  237

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASK------------  940
              ERF   RI AV+ELC+QAG   ++                E +DA +            
Sbjct  238   EERFSIPRIPAVMELCIQAGVYVSEYPTKRRRKPIIRIGKREFVDADESDLPDPVPEVPL  297

Query  939   ---MEHESNSKIVLPFDQQMR-LLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                +     SK V P +++ + LL  ETL AWE +R G  +L+ +Y V+VC +C EVHVG
Sbjct  298   KPILTELPISKAVAPANEEEKTLLAEETLQAWEKMRKGAKRLMQMYRVRVCGYCPEVHVG  357

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
              SGHKA+ CG  K++     H W+ A +DDL+PP  VWH    D P L  E +N+YG AP
Sbjct  358   HSGHKAQNCGAHKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVDGPPLRRELKNFYGQAP  417

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M+++
Sbjct  418   AVVEICVQAGAAVPDQYKSTMRLN  441


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/108 (36%), Positives = 59/108 (55%), Gaps = 2/108 (2%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRR-IHF  706
            L  +  NA  TL + + KLL V PV  C  C+E+HVGP GH  + C   K+ ++R+ +H 
Sbjct  151  LAYDVFNARITLINNLKKLLKVVPVHACGWCNELHVGPEGHPFKSCK-GKHATFRKGLHQ  209

Query  705  WEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
            W  A+V+D++ P   +H        +  E R      PAV++LC +AG
Sbjct  210  WTNAAVEDVLVPIEAYHLYDPLGKRIKHEERFSIPRIPAVMELCIQAG  257



>ref|XP_008782983.1| PREDICTED: APO protein 1, chloroplastic [Phoenix dactylifera]
Length=433

 Score =   188 bits (478),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 147/280 (53%), Gaps = 41/280 (15%)
 Frame = -1

Query  1236  ALSWLLN------CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVET  1075
              LS LLN      C  C EV+VG  GH I+ C G     +   H W++GS++ +LIP+E+
Sbjct  141   GLSQLLNVVTVYGCSKCSEVHVGPVGHRIQDCRGTGSEQRRSRHCWVQGSINDVLIPIES  200

Query  1074  FHLHNMFQNVIKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------  937
             +HL + F   IKH  RF+Y RI AVVELC+QAG +    P+       +M          
Sbjct  201   YHLFDPFGRRIKHETRFNYDRIPAVVELCIQAGVDFPEYPSRRRTTPIRMLGKKVIDRGG  260

Query  936   --------EHESNSKIVLPFD-------------QQMRLLGNETLNAWETLRSGVHKLLL  820
                       E    ++   D               +R L   TL A+ T+R GV +L+ 
Sbjct  261   YVEEPKPYRAEDCMSLLAELDTYGAQTGRPPLPPSDIRKLAERTLKAYSTVRRGVRQLMK  320

Query  819   VYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQD  640
              Y VK C +CSE+HVGP GH  +LCG FK++     H W+ A++D+++P N VWH R  +
Sbjct  321   KYTVKACGYCSEIHVGPWGHNVKLCGAFKHQWRDGKHGWQDATLDEVIPQNYVWHLRDPN  380

Query  639   PPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              P L    + +YG APAVV++C +AGA  P  Y  MM++D
Sbjct  381   GPPLATALKRFYGKAPAVVEVCVQAGAEIPESYRPMMRLD  420


 Score = 67.8 bits (164),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 55/109 (50%), Gaps = 0/109 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L  W+ L  G+ +LL V  V  C  CSEVHVGP GH+ + C     E  R  H W + 
Sbjct  130  EVLEHWKVLIKGLSQLLNVVTVYGCSKCSEVHVGPVGHRIQDCRGTGSEQRRSRHCWVQG  189

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P 
Sbjct  190  SINDVLIPIESYHLFDPFGRRIKHETRFNYDRIPAVVELCIQAGVDFPE  238


 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC E++VG  GH ++ CG ++H+ ++  H W   +LD ++     +HL +     +  
Sbjct  327   CGYCSEIHVGPWGHNVKLCGAFKHQWRDGKHGWQDATLDEVIPQNYVWHLRDPNGPPLAT  386

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA   +      +++      IVLP  ++ RL+ 
Sbjct  387   ALKRFYGKAPAVVEVCVQAGAEIPESYRPMMRLD------IVLPDSEEARLVA  433



>gb|EYU33498.1| hypothetical protein MIMGU_mgv1a020508mg, partial [Erythranthe 
guttata]
Length=375

 Score =   187 bits (474),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/262 (38%), Positives = 143/262 (55%), Gaps = 30/262 (11%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C E++VG  GH I+ C G     +   H+WIK S++ +LIP+E++H+ + F   IKH
Sbjct  101   CSECSEIHVGLIGHDIQDCHGTTSGARRSHHLWIKASINDVLIPIESYHMFDPFGRRIKH  160

Query  1035  HERFDYSRISAVVELCLQAGAN----PNDESIDASKM-----------------------  937
               RF+Y RI AVVELC+QAG      P+    +  +M                       
Sbjct  161   ETRFNYDRIPAVVELCIQAGVELQEYPSRRRTEPIRMIGRKVIEMGGIVEEPPLCGSLVA  220

Query  936   ---EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPS  766
                 H ++ +   P  +++  +  ETL A+E ++ GV KL+  Y VK C +CSEVHVGP 
Sbjct  221   ELDTHSASGRFPPPPKEEVPAVARETLFAYERVKWGVRKLMRKYTVKACGYCSEVHVGPW  280

Query  765   GHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAV  586
             GH A+LCG FK++     H W+ A+VD++ PPN VWH      P L    + +YG APA+
Sbjct  281   GHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVEDPMGPALTSGLKRFYGKAPAM  340

Query  585   VDLCTKAGAIAPSKYFCMMKVD  520
             V+   +AGA  P KY  MM++D
Sbjct  341   VEASVQAGASVPEKYKPMMRLD  362


 Score = 68.2 bits (165),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 59/112 (53%), Gaps = 0/112 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            Q +  +  + L++W+ L  G+ +L+ V PV  C  CSE+HVG  GH  + C      + R
Sbjct  69   QDLIPVAYQVLDSWKVLIKGLAQLMHVVPVHACSECSEIHVGLIGHDIQDCHGTTSGARR  128

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
              H W KAS++D++ P   +H        +  E R  Y   PAVV+LC +AG
Sbjct  129  SHHLWIKASINDVLIPIESYHMFDPFGRRIKHETRFNYDRIPAVVELCIQAG  180


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     +  
Sbjct  269   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVEDPMGPALTS  328

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  A+VE  +QAGA+  ++     +++      IV+P D++ RL+ 
Sbjct  329   GLKRFYGKAPAMVEASVQAGASVPEKYKPMMRLD------IVVPEDEEARLIA  375



>ref|NP_001132782.1| APO2 [Zea mays]
 gb|ACF81776.1| unknown [Zea mays]
 gb|AFW63822.1| APO2 [Zea mays]
Length=442

 Score =   188 bits (478),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 100/265 (38%), Positives = 141/265 (53%), Gaps = 33/265 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C+YC E++VG  GH  RTC G     +   H W    ++++ +PVE +HL +   N I 
Sbjct  165   GCKYCSEIHVGSVGHPFRTCRGMSSDQRRGEHDWGSTLVEAVFLPVEAYHLEDRLGNRIP  224

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDASK-----------  940
             H +RF   RI A+VELC+QAG +                   E +DA++           
Sbjct  225   HDQRFTVPRIPALVELCIQAGVDLPEYPTKRRRKPIIKIGRKEFVDANEDDLPEPEPDRF  284

Query  939   ----MEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                 +E     +I+ P   ++   L  ETL AWE +R G  KL+  Y V+VC +C EVHV
Sbjct  285   RQPLLEELRYDEIIAPSSPEETVALAEETLEAWEAVRDGALKLMKGYAVRVCGYCPEVHV  344

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GP+GHKAR CG FK++     H W+ A +DDL+PP  VWH  P+    L  E + +YG A
Sbjct  345   GPTGHKARNCGAFKHQQRNGQHGWQAAVLDDLIPPRYVWH-MPESGEELQRELKTFYGQA  403

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV++C + GA  P KY   M++D
Sbjct  404   PAVVEMCIQGGAKVPEKYKATMRLD  428


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            NA   L + + +L+ V PVK CK+CSE+HVG  GH  R C     +  R  H W    V+
Sbjct  145  NARILLINNLKRLMKVVPVKGCKYCSEIHVGSVGHPFRTCRGMSSDQRRGEHDWGSTLVE  204

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +  P   +H   +    +  + R      PA+V+LC +AG   P
Sbjct  205  AVFLPVEAYHLEDRLGNRIPHDQRFTVPRIPALVELCIQAGVDLP  249



>ref|XP_006343652.1| PREDICTED: APO protein 2, chloroplastic-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343653.1| PREDICTED: APO protein 2, chloroplastic-like isoform X2 [Solanum 
tuberosum]
Length=436

 Score =   188 bits (478),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 144/265 (54%), Gaps = 33/265 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C++C E++VG  GH  ++C G +   +   H W K  L+ I++P+E++HL++     I 
Sbjct  159   GCKWCNEIHVGPVGHPFKSCRGSQASQRKGHHEWGKAVLEDIIVPLESYHLYDRLGKRIS  218

Query  1038  HHERFDYSRISAVVELCLQAGAN-------------------------------PNDESI  952
             H ERF   RI A+VELC+QAG +                               P  ES 
Sbjct  219   HEERFSIPRIPAIVELCIQAGVDLPEYPTKRRRKPIIWTGKKEFVDADESELPDPEPESP  278

Query  951   DASKMEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                 +    + ++  P   ++  LL  ETL AWE +R+G +KL+ +YPV+VC +C EVHV
Sbjct  279   KPPILAEIPDPEVEPPSSTEETILLAEETLVAWEKMRAGANKLIKMYPVRVCGYCPEVHV  338

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GPSGHKA+ CG  K++     H W+ A +DDL+PP  VWH  P     L  E R++YG A
Sbjct  339   GPSGHKAQNCGAHKHQQRNGQHGWQTAVLDDLIPPRYVWH-VPDVAQPLQRELRSFYGQA  397

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV++C +AGA  P +Y   M+ D
Sbjct  398   PAVVEICVQAGAEVPEQYKPTMRFD  422


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 53/107 (50%), Gaps = 0/107 (0%)
 Frame = -1

Query  870  TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
              N   T+ + + +LL V  V  CK C+E+HVGP GH  + C   +    +  H W KA 
Sbjct  137  VFNTRMTVINNLKRLLKVVTVNGCKWCNEIHVGPVGHPFKSCRGSQASQRKGHHEWGKAV  196

Query  690  VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            ++D++ P   +H   +    +  E R      PA+V+LC +AG   P
Sbjct  197  LEDIIVPLESYHLYDRLGKRISHEERFSIPRIPAIVELCIQAGVDLP  243



>ref|XP_004242590.1| PREDICTED: APO protein 2, chloroplastic [Solanum lycopersicum]
Length=436

 Score =   188 bits (478),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 104/265 (39%), Positives = 146/265 (55%), Gaps = 33/265 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C++C E++VG  GH  ++C G +   +   H W K  L+ I++P+E +HL++     I 
Sbjct  159   GCKWCNEIHVGPVGHPFKSCRGSQASQRKGHHEWGKAVLEDIIVPLECYHLYDRLGKRIT  218

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDASKM-----EHESN  922
             H ERF   RI A+VELC+QAG +                  +E +DA +      E ES 
Sbjct  219   HEERFSIPRIPAIVELCIQAGVDLPEYPTKRRRKPIIWTGKNEFVDADESELPDPEPESP  278

Query  921   SKIVLP-----------FDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                VL              ++  LL  ETL AWE +R+G +KL+ +YPV+VC +C EVHV
Sbjct  279   KPPVLAEIPDPEVEPPSSTEETLLLAEETLVAWEKMRAGANKLIKMYPVRVCGYCPEVHV  338

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GPSGHKA+ CG  K++     H W+ A +DDL+PP  VWH  P     L  E R++YG A
Sbjct  339   GPSGHKAQNCGAHKHQQRNGQHGWQTAVLDDLIPPRYVWH-VPDVTQPLQRELRSFYGQA  397

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV+LC +AGA  P +Y   M+ D
Sbjct  398   PAVVELCVQAGAEVPEQYKPTMRFD  422


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 54/107 (50%), Gaps = 0/107 (0%)
 Frame = -1

Query  870  TLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKAS  691
              NA  T+ + + +LL V  V  CK C+E+HVGP GH  + C   +    +  H W KA 
Sbjct  137  VFNARMTVINNLKRLLKVVTVNGCKWCNEIHVGPVGHPFKSCRGSQASQRKGHHEWGKAV  196

Query  690  VDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            ++D++ P   +H   +    +  E R      PA+V+LC +AG   P
Sbjct  197  LEDIIVPLECYHLYDRLGKRITHEERFSIPRIPAIVELCIQAGVDLP  243



>gb|ACG31531.1| APO2 [Zea mays]
Length=442

 Score =   188 bits (478),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 100/265 (38%), Positives = 141/265 (53%), Gaps = 33/265 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C+YC E++VG  GH  RTC G     +   H W    ++++ +PVE +HL +   N I 
Sbjct  165   GCKYCSEIHVGSVGHPFRTCRGMSSDQRRGEHDWGSTLVEAVFLPVEAYHLEDRLGNRIP  224

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDASK-----------  940
             H +RF   RI A+VELC+QAG +                   E +DA++           
Sbjct  225   HDQRFTVPRIPALVELCIQAGVDLPEYPTKCRRKPIIKIGRKEFVDANEDDLPEPEPDRF  284

Query  939   ----MEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                 +E     +I+ P   ++   L  ETL AWE +R G  KL+  Y V+VC +C EVHV
Sbjct  285   RQPLLEELRYDEIIAPSSPEETVALAEETLEAWEAVRDGALKLMKGYAVRVCGYCPEVHV  344

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GP+GHKAR CG FK++     H W+ A +DDL+PP  VWH  P+    L  E + +YG A
Sbjct  345   GPTGHKARNCGAFKHQQRNGQHGWQAAVLDDLIPPRYVWH-MPESGEELQRELKTFYGQA  403

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV++C + GA  P KY   M++D
Sbjct  404   PAVVEMCIQGGAKVPEKYKATMRLD  428


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            NA   L + + +L+ V PVK CK+CSE+HVG  GH  R C     +  R  H W    V+
Sbjct  145  NARILLINNLKRLMKVVPVKGCKYCSEIHVGSVGHPFRTCRGMSSDQRRGEHDWGSTLVE  204

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +  P   +H   +    +  + R      PA+V+LC +AG   P
Sbjct  205  AVFLPVEAYHLEDRLGNRIPHDQRFTVPRIPALVELCIQAGVDLP  249



>ref|XP_002325131.2| hypothetical protein POPTR_0018s11560g [Populus trichocarpa]
 gb|EEF03696.2| hypothetical protein POPTR_0018s11560g [Populus trichocarpa]
Length=455

 Score =   188 bits (478),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 145/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G R   +N LH W   +++ +L+PVE +HL++     I H
Sbjct  178   CGWCDEIHVGLEGHPFKSCKGKRATLRNGLHQWTNAAIEDVLVPVEAYHLYDRLGKRITH  237

Query  1035  HERFDYSRISAVVELCLQAG-----------------------ANPNDESIDASKME---  934
              ERF   +I AV+ELC+QAG                       A+ ++  +    +E   
Sbjct  238   EERFSILQIPAVMELCIQAGVHIPEYPTKRRRKPIIRIGKREFADADESDLPEPLLEVPL  297

Query  933   -----HESNSKIVLPFDQQMR-LLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                    S S+ V P +++ + LL  ETL AWE +R G  +L+ +Y V+ C +C EVHVG
Sbjct  298   KPLLTEISISEAVAPANEEEKTLLAEETLRAWEKMRKGAKRLMQMYRVRACGYCPEVHVG  357

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG  K++     H W+ A +DDL+PP  VWH        L  E RN+YG AP
Sbjct  358   PSGHKAQNCGAHKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVVGLPLRRELRNFYGQAP  417

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M++D
Sbjct  418   AVVEICFQAGAAVPDQYKSTMRLD  441


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 56/116 (48%), Gaps = 0/116 (0%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            Q +  L  +  NA  TL + + KLL V PV  C  C E+HVG  GH  + C   +     
Sbjct  146  QSLLPLAYDVFNARITLINNLRKLLKVVPVHACGWCDEIHVGLEGHPFKSCKGKRATLRN  205

Query  717  RIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +H W  A+++D++ P   +H   +    +  E R      PAV++LC +AG   P
Sbjct  206  GLHQWTNAAIEDVLVPVEAYHLYDRLGKRITHEERFSILQIPAVMELCIQAGVHIP  261



>ref|XP_009617161.1| PREDICTED: APO protein 2, chloroplastic [Nicotiana tomentosiformis]
Length=436

 Score =   187 bits (476),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 104/273 (38%), Positives = 151/273 (55%), Gaps = 34/273 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++C E++VG  GH  ++C G +   +   H W K  L+ I++P+E++HL++     I H
Sbjct  160   CKWCNEIHVGPVGHPFKSCRGSQASKRKGHHEWGKAVLEDIMVPLESYHLYDRLGKRISH  219

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKM-----EHESNS  919
              ERF   RI AVVELC+QAG +                  +E +DA +      E ES  
Sbjct  220   EERFSIPRIPAVVELCIQAGVDIPEYPTKRRRKPIIWTGKNEFVDADESELPDPEPESPK  279

Query  918   KIVL-----------PFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
               +L              ++  LL  ETL AWE +R G ++L+ +YPV+VC +C EVHVG
Sbjct  280   PPILTEIPDVDVEPPSSAEETVLLAEETLEAWERMRVGANRLMKMYPVRVCGYCPEVHVG  339

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG  K++     H W+ A +DDL+PP  VWH  P     L  E R++YG AP
Sbjct  340   PSGHKAQNCGAHKHQQRNGQHGWQTAVLDDLIPPRYVWH-VPDVTQSLQRELRSFYGQAP  398

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD-GLSAPISD  496
             AVV++C +AGA  P +Y   M+ D G+ + I +
Sbjct  399   AVVEICVQAGAEVPEQYKPTMRFDVGIPSSIKE  431


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 56/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L     NA  T+ + + +LL V PV  CK C+E+HVGP GH  + C   +    +  H W
Sbjct  133  LAYNVFNARITVINNLKRLLKVVPVNGCKWCNEIHVGPVGHPFKSCRGSQASKRKGHHEW  192

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             KA ++D++ P   +H   +    +  E R      PAVV+LC +AG   P
Sbjct  193  GKAVLEDIMVPLESYHLYDRLGKRISHEERFSIPRIPAVVELCIQAGVDIP  243



>gb|EYU35330.1| hypothetical protein MIMGU_mgv1a006906mg [Erythranthe guttata]
Length=426

 Score =   187 bits (475),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 145/274 (53%), Gaps = 34/274 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
             +C++C E++VG  GH  ++C G +   +   H W +  L+ IL PVE +HL++     I 
Sbjct  149   SCKWCSEIHVGPTGHPFKSCRGPQASARKGAHEWGEAFLEDILAPVEAYHLYDRLGKRIP  208

Query  1038  HHERFDYSRISAVVELCLQAGAN-------------------------------PNDESI  952
             H ERF   RI AVVELC+QAG +                               P  +S 
Sbjct  209   HEERFSVPRIPAVVELCIQAGVDLPEYPTKRRRKPIIRIGKREFVDADESELPDPEPDSP  268

Query  951   DASKMEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                 +    +S+ + P   ++  LL  ETL AWE +R G  KL+ +Y V+ C +C EVHV
Sbjct  269   KPEILSELFDSETIPPSSKEETVLLAEETLEAWEEMRGGAKKLMKLYTVRACGYCPEVHV  328

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GPSGHKA+ CG  K++     H W+ A +DDL+PP  VWH    + P L  E R++YG A
Sbjct  329   GPSGHKAQNCGAHKHQQRNGQHGWQAAILDDLIPPKYVWHVPDVNKP-LQKELRSFYGQA  387

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD-GLSAPISD  496
             PAVV+LC +AGA  P  Y   M+ D G+ A + +
Sbjct  388   PAVVELCVQAGAEVPDHYRPTMRSDVGIPANVRE  421


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 57/111 (51%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L    LNA   L + + KLL V P   CK CSE+HVGP+GH  + C   +  + +  H W
Sbjct  123  LAYRVLNARIRLINNLKKLLKVTPAYSCKWCSEIHVGPTGHPFKSCRGPQASARKGAHEW  182

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +A ++D++ P   +H   +    +  E R      PAVV+LC +AG   P
Sbjct  183  GEAFLEDILAPVEAYHLYDRLGKRIPHEERFSVPRIPAVVELCIQAGVDLP  233



>ref|XP_003570510.1| PREDICTED: APO protein 2, chloroplastic [Brachypodium distachyon]
Length=455

 Score =   187 bits (475),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 143/265 (54%), Gaps = 34/265 (13%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C+YC E++VG  GH  RTC G +   +   H W    ++++ +PVE +HL +     I 
Sbjct  179   GCKYCSEIHVGSVGHPFRTCRGMKSDQRRGEHDWGSTFVEAVFLPVEAYHLEDRLGPRIT  238

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDASK-----------  940
             H +RF+  RI A+VELC+QAG +                   E +DA++           
Sbjct  239   HDQRFEVPRIPALVELCIQAGVDLPEYPTKRRRKPIIKIGRKEFVDANEDDLPDLEPDRF  298

Query  939   ----MEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                 +E   + +I+ P   ++   L  ETL AWET+R G  +LL  Y V+VC +C EVH+
Sbjct  299   KEPILEELPDDEIIAPSSPEETAALAEETLEAWETVRHGALRLLKSYAVRVCGYCPEVHI  358

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             G SGHKAR CG FK++     H W+ A +DDL+PP  VWH    D   L  E +++YG A
Sbjct  359   GSSGHKARNCGAFKHQQRNGQHGWQAAVLDDLIPPRYVWHM--PDSGELQKELKSFYGQA  416

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV++C + GA  P KY   M++D
Sbjct  417   PAVVEICIQGGAEVPEKYKATMRLD  441


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 52/105 (50%), Gaps = 0/105 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            NA   L + + +L+ V PV  CK+CSE+HVG  GH  R C   K +  R  H W    V+
Sbjct  159  NARILLINNLRRLMKVVPVNGCKYCSEIHVGSVGHPFRTCRGMKSDQRRGEHDWGSTFVE  218

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +  P   +H   +  P +  + R      PA+V+LC +AG   P
Sbjct  219  AVFLPVEAYHLEDRLGPRITHDQRFEVPRIPALVELCIQAGVDLP  263



>ref|XP_009126804.1| PREDICTED: APO protein 2, chloroplastic [Brassica rapa]
Length=442

 Score =   186 bits (473),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/264 (36%), Positives = 143/264 (54%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +   H W    L+ +++P+E +HL++     I+H
Sbjct  165   CGWCNEIHVGPYGHPFKSCKGPNASQRKGHHEWTNSVLEDVIVPLEAYHLYDRLGKRIRH  224

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKME----------  934
              ERF   R+ AVVELC+Q G                     E +DA + E          
Sbjct  225   DERFTIPRVPAVVELCIQGGVEIPEFPAKRRRKPIIRIGKSEFVDADETELPDPEPHIPP  284

Query  933   -----HESNSKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                      S+I  P +++  + L  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  285   EPLLTELPPSEITPPSNEEETVSLAEETLQAWEEMRAGAKKLMRMYRVRVCGYCPEVHVG  344

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P +  E R++YG AP
Sbjct  345   PTGHKAQNCGAFKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVNGPPMQRELRSFYGQAP  404

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M+++
Sbjct  405   AVVEICAQAGAEVPEQYRATMRLE  428



>ref|XP_010048793.1| PREDICTED: APO protein 2, chloroplastic-like [Eucalyptus grandis]
 gb|KCW81163.1| hypothetical protein EUGRSUZ_C02537 [Eucalyptus grandis]
Length=462

 Score =   187 bits (474),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/267 (39%), Positives = 142/267 (53%), Gaps = 32/267 (12%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C +C E++VG  GH  ++C G     +   H W   +++ IL PVE +HL +     
Sbjct  182   VLACGWCGEIHVGPVGHPFKSCKGPNSSMRKGHHEWTNATIEDILPPVEAYHLFDRLGKR  241

Query  1044  IKHHERFDYSRISAVVELCLQAGANPND----------------ESIDASKME-------  934
             I H ERF   RI AVVELC+QAG    D                E +DA + E       
Sbjct  242   ISHDERFSIPRIPAVVELCIQAGVEIPDLPTKRRRKPIIRIGKKEFVDADESELPDPIPE  301

Query  933   --------HESNSKIVLPFDQQMRLL-GNETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
                        +S+ + P D + +LL   ETL AWE +R G  KL+ VYPV+VC +C EV
Sbjct  302   APIIPMLTELPDSQTLAPSDDEEKLLLAEETLQAWEKMRHGSKKLMRVYPVRVCGYCPEV  361

Query  780   HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYG  601
             HVGP+GHKA+ CG  K++     H W+ A +DDL+PP  VWH    D   L  E  ++YG
Sbjct  362   HVGPTGHKAQNCGEHKHQQRNGQHGWQSAVLDDLIPPRYVWHVPNADGRPLQRELISFYG  421

Query  600   HAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              AP VV++C +AGA  P +Y   M++D
Sbjct  422   KAPVVVEICVQAGANVPEQYKPTMRLD  448


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L     NA  TL + +  LL V PV  C  C E+HVGP GH  + C        +  H W
Sbjct  158  LAYNVFNARITLINNLKTLLKVVPVLACGWCGEIHVGPVGHPFKSCKGPNSSMRKGHHEW  217

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              A+++D++PP   +H   +    +  + R      PAVV+LC +AG   P
Sbjct  218  TNATIEDILPPVEAYHLFDRLGKRISHDERFSIPRIPAVVELCIQAGVEIP  268



>ref|XP_010048752.1| PREDICTED: APO protein 2, chloroplastic-like [Eucalyptus grandis]
 gb|KCW81119.1| hypothetical protein EUGRSUZ_C02496 [Eucalyptus grandis]
Length=462

 Score =   187 bits (474),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/267 (39%), Positives = 142/267 (53%), Gaps = 32/267 (12%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +L C +C E++VG  GH  ++C G     +   H W   +++ IL PVE +HL +     
Sbjct  182   VLACGWCGEIHVGPVGHPFKSCKGPNSSMRKGHHEWTNATIEDILPPVEAYHLFDRLGKR  241

Query  1044  IKHHERFDYSRISAVVELCLQAGANPND----------------ESIDASKME-------  934
             I H ERF   RI AVVELC+QAG    D                E +DA + E       
Sbjct  242   ISHDERFSIPRIPAVVELCIQAGVEIPDLPTKRRRKPIIRIGKKEFVDADESELPDPIPE  301

Query  933   --------HESNSKIVLPFDQQMRLL-GNETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
                        +S+ + P D + +LL   ETL AWE +R G  KL+ VYPV+VC +C EV
Sbjct  302   APIIPMLTELPDSQTLAPSDDEEKLLLAEETLQAWEKMRHGSKKLMRVYPVRVCGYCPEV  361

Query  780   HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYG  601
             HVGP+GHKA+ CG  K++     H W+ A +DDL+PP  VWH    D   L  E  ++YG
Sbjct  362   HVGPTGHKAQNCGEHKHQQRNGQHGWQSAVLDDLIPPRYVWHVPNADGRPLQRELISFYG  421

Query  600   HAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              AP VV++C +AGA  P +Y   M++D
Sbjct  422   KAPVVVEICVQAGANVPEQYKPTMRLD  448


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 53/111 (48%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L     NA  TL + +  LL V PV  C  C E+HVGP GH  + C        +  H W
Sbjct  158  LAYNVFNARITLINNLKTLLKVVPVLACGWCGEIHVGPVGHPFKSCKGPNSSMRKGHHEW  217

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              A+++D++PP   +H   +    +  + R      PAVV+LC +AG   P
Sbjct  218  TNATIEDILPPVEAYHLFDRLGKRISHDERFSIPRIPAVVELCIQAGVEIP  268



>ref|XP_002454332.1| hypothetical protein SORBIDRAFT_04g028820 [Sorghum bicolor]
 gb|EES07308.1| hypothetical protein SORBIDRAFT_04g028820 [Sorghum bicolor]
Length=442

 Score =   186 bits (473),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 141/265 (53%), Gaps = 33/265 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C+YC E++VG  GH  RTC G     +   H W    ++++ +P+E +HL +     I 
Sbjct  165   GCKYCSEIHVGSVGHPFRTCRGMSAAQRRGEHDWGSTLVEAVFLPIEAYHLEDRLGPRIP  224

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDASK-----------  940
             H +RF   RI A+VELC+QAG +                   E +DA++           
Sbjct  225   HDQRFSVPRIPALVELCIQAGVDLPEYPTKRRRKPIIKIGRKEFVDANEDDLPEPEPDRF  284

Query  939   ----MEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                 +E     +I+ P + ++   L  ETL AWE +R G  KL+  Y V+VC +C EVHV
Sbjct  285   KQPLLEELHYDEIIAPSNPEETAALAEETLEAWEAVRDGALKLMKGYAVRVCGYCPEVHV  344

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GP+GHKAR CG FK++     H W+ A +DDLVPP  VWH  P+    L  E + +YG A
Sbjct  345   GPTGHKARNCGAFKHQQRNGQHGWQAAVLDDLVPPRYVWH-MPESGEELQRELKTFYGQA  403

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV++C + GA  P KY   M++D
Sbjct  404   PAVVEICIQGGAKVPEKYKATMRLD  428


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            NA   L + + +L+ V PVK CK+CSE+HVG  GH  R C        R  H W    V+
Sbjct  145  NARILLINNLKRLMKVVPVKGCKYCSEIHVGSVGHPFRTCRGMSAAQRRGEHDWGSTLVE  204

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +  P   +H   +  P +  + R      PA+V+LC +AG   P
Sbjct  205  AVFLPIEAYHLEDRLGPRIPHDQRFSVPRIPALVELCIQAGVDLP  249



>gb|AFK43230.1| unknown [Lotus japonicus]
Length=442

 Score =   186 bits (473),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 140/264 (53%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC E++V   GH  ++C G +   +  LH W     + IL PVE +HL +     I H
Sbjct  165   CGYCSEIHVCPVGHPFKSCRGTQANIRKGLHEWANAHFEDILTPVEAYHLSDRLGKRITH  224

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKME----------  934
              ERF   RI AVVELC+QAG    +                E +DA + E          
Sbjct  225   EERFSIPRIPAVVELCIQAGVEIPEYPTKRRRKPIIRIGRKEYVDADESELPDQMPENPP  284

Query  933   -----HESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +S+IV P D +++  L  ETL AWE +R G  +L+ +Y V+VC +C E+HVG
Sbjct  285   KLLLTEIPDSEIVAPVDKEEIVQLAEETLQAWERMRKGAKRLMGMYRVRVCGYCPEIHVG  344

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P GHKA+ CG  K++     H W+ + ++DL+PP  VWH    + P L  E R +YG AP
Sbjct  345   PQGHKAQNCGAHKHQQRNGQHGWQSSVLNDLIPPRFVWHVPDVNGPPLQRELREFYGQAP  404

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M++D
Sbjct  405   AVVEMCIQAGAALPEQYKSTMRLD  428


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 53/105 (50%), Gaps = 0/105 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            N+  TL + + KLL V PV  C +CSE+HV P GH  + C   +    + +H W  A  +
Sbjct  144  NSRITLINNLKKLLKVVPVHACGYCSEIHVCPVGHPFKSCRGTQANIRKGLHEWANAHFE  203

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            D++ P   +H   +    +  E R      PAVV+LC +AG   P
Sbjct  204  DILTPVEAYHLSDRLGKRITHEERFSIPRIPAVVELCIQAGVEIP  248



>ref|XP_007153605.1| hypothetical protein PHAVU_003G049700g [Phaseolus vulgaris]
 gb|ESW25599.1| hypothetical protein PHAVU_003G049700g [Phaseolus vulgaris]
Length=439

 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/263 (38%), Positives = 141/263 (54%), Gaps = 32/263 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G +   +  LH W    ++ IL P+E +HL +     I H
Sbjct  164   CGWCSEIHVGPVGHPFKSCKGAQANIRKGLHEWSNAYVEDILTPIEAYHLFDRLGKRITH  223

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKME----------  934
              ERF   RI A+VELC+QAG    +                E IDA + E          
Sbjct  224   DERFQIPRIPALVELCIQAGVQIPEFPTKRRRKPIIRIGRKEFIDADESELPDEVPEGPL  283

Query  933   -----HESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGP  769
                     +++ V P D ++  L +ET+ AWE +R G  KL+ +Y V+VC +C EVHVG 
Sbjct  284   KPLLAEIPDAETVAPLDNELVPLADETIQAWEQMRKGAKKLMRMYNVRVCGYCPEVHVGA  343

Query  768   SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPA  589
              GHKA+ CG  K++     H W+ A +DDL+PP  VWH    + P L  E RN+YG APA
Sbjct  344   QGHKAQNCGAHKHQQRNGQHGWQSAVLDDLIPPRFVWHVPDVNVP-LDRELRNFYGQAPA  402

Query  588   VVDLCTKAGAIAPSKYFCMMKVD  520
             VV++C +AGA  P +Y   M++D
Sbjct  403   VVEMCIQAGASLPEEYKSTMRLD  425


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 54/106 (51%), Gaps = 0/106 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            NA  TL + + KLL V PV  C  CSE+HVGP GH  + C   +    + +H W  A V+
Sbjct  143  NARITLINNLKKLLKVVPVHACGWCSEIHVGPVGHPFKSCKGAQANIRKGLHEWSNAYVE  202

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            D++ P   +H   +    +  + R      PA+V+LC +AG   P 
Sbjct  203  DILTPIEAYHLFDRLGKRITHDERFQIPRIPALVELCIQAGVQIPE  248



>emb|CDY32738.1| BnaA02g08000D [Brassica napus]
Length=444

 Score =   186 bits (472),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/264 (36%), Positives = 142/264 (54%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +   H W    L+ +++P+E +HL++     I+H
Sbjct  167   CGWCNEIHVGPYGHPFKSCKGPNASQRKGHHEWTNSVLEDVIVPLEAYHLYDRLGKRIRH  226

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKME----------  934
              ERF   R+ AVVELC+Q G                     E +DA + E          
Sbjct  227   DERFTIPRVPAVVELCIQGGVEIPEFPAKRRRKPIIRIGKSEFVDADETELPDPEPHIPP  286

Query  933   -----HESNSKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                      S+I  P  ++  + L  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  287   EPLLTELPPSEITPPSSEEETVSLAEETLQAWEEMRAGAKKLMRMYRVRVCGYCPEVHVG  346

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P +  E R++YG AP
Sbjct  347   PTGHKAQNCGAFKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVNGPPMQRELRSFYGQAP  406

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M+++
Sbjct  407   AVVEICAQAGAEVPEQYRATMRLE  430


 Score = 52.0 bits (123),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 52/111 (47%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  +  NA   L + +H+L+ V  V  C  C+E+HVGP GH  + C        +  H W
Sbjct  140  LAYKVYNARIRLINNLHRLMKVVRVNACGWCNEIHVGPYGHPFKSCKGPNASQRKGHHEW  199

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              + ++D++ P   +H   +    +  + R      PAVV+LC + G   P
Sbjct  200  TNSVLEDVIVPLEAYHLYDRLGKRIRHDERFTIPRVPAVVELCIQGGVEIP  250



>ref|NP_001048031.1| Os02g0732900 [Oryza sativa Japonica Group]
 dbj|BAD16144.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF09945.1| Os02g0732900 [Oryza sativa Japonica Group]
 gb|EAZ24517.1| hypothetical protein OsJ_08278 [Oryza sativa Japonica Group]
Length=449

 Score =   186 bits (472),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 147/265 (55%), Gaps = 33/265 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C++C E++VG  GH  RTC G     +   H W    ++++ +PVE +HL +     I 
Sbjct  172   GCKHCSEIHVGSVGHPFRTCKGMSSDKRRGQHDWGGTLVEAVFVPVEAYHLEDRLGKRIP  231

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDAS----------KM  937
             H +RF   RI A+VELC+QAG N                  +E +DA+          K+
Sbjct  232   HDQRFAVPRIPALVELCIQAGVNLPEYPTKRRRKPIIKIGKNEFVDANEDDLPDPEPYKL  291

Query  936   EHE-----SNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
             EH      ++++I+ P   +++  L  ETL AWE +R G  KL+  Y V+VC +C EVH+
Sbjct  292   EHPILEELNDNEIIAPASPEEIVALAEETLEAWEVVRDGALKLMKGYAVRVCGYCPEVHI  351

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             G SGHKAR CG FK++     H W+ A +DDL+PP  VWH  P+    L  + +++YG A
Sbjct  352   GASGHKARNCGAFKHQQRNGQHGWQAAVLDDLIPPRYVWH-LPESGEDLQRDLKSFYGQA  410

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PA+V++C +AGA  P KY   M++D
Sbjct  411   PAIVEICVQAGAKVPEKYKATMRLD  435


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            NA   L + + +L+ V PVK CKHCSE+HVG  GH  R C     +  R  H W    V+
Sbjct  152  NARILLINNLKRLMKVIPVKGCKHCSEIHVGSVGHPFRTCKGMSSDKRRGQHDWGGTLVE  211

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +  P   +H   +    +  + R      PA+V+LC +AG   P
Sbjct  212  AVFVPVEAYHLEDRLGKRIPHDQRFAVPRIPALVELCIQAGVNLP  256



>gb|EAY87417.1| hypothetical protein OsI_08824 [Oryza sativa Indica Group]
Length=449

 Score =   186 bits (472),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 147/265 (55%), Gaps = 33/265 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C++C E++VG  GH  RTC G     +   H W    ++++ +PVE +HL +     I 
Sbjct  172   GCKHCSEIHVGSVGHPFRTCKGMSSDKRRGQHDWGGTLVEAVFVPVEAYHLEDRLGKRIP  231

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDAS----------KM  937
             H +RF   RI A+VELC+QAG N                  +E +DA+          K+
Sbjct  232   HDQRFAVPRIPALVELCIQAGVNLPEYPTKRRRKPIIKIGKNEFVDANEDDLPDPEPYKL  291

Query  936   EHE-----SNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
             EH      ++++I+ P   +++  L  ETL AWE +R G  KL+  Y V+VC +C EVH+
Sbjct  292   EHPILEELNDNEIIAPASPEEIVALAEETLEAWEVVRDGALKLMKGYAVRVCGYCPEVHI  351

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             G SGHKAR CG FK++     H W+ A +DDL+PP  VWH  P+    L  + +++YG A
Sbjct  352   GASGHKARNCGAFKHQQRNGQHGWQAAVLDDLIPPRYVWH-LPESGEDLQRDLKSFYGQA  410

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PA+V++C +AGA  P KY   M++D
Sbjct  411   PAIVEICVQAGAKVPEKYKATMRLD  435


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 51/105 (49%), Gaps = 0/105 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            NA   L + + +L+ V PVK CKHCSE+HVG  GH  R C     +  R  H W    V+
Sbjct  152  NARILLINNLKRLMKVIPVKGCKHCSEIHVGSVGHPFRTCKGMSSDKRRGQHDWGGTLVE  211

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +  P   +H   +    +  + R      PA+V+LC +AG   P
Sbjct  212  AVFVPVEAYHLEDRLGKRIPHDQRFAVPRIPALVELCIQAGVNLP  256



>emb|CAN79322.1| hypothetical protein VITISV_018985 [Vitis vinifera]
Length=932

 Score =   191 bits (485),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/269 (39%), Positives = 150/269 (56%), Gaps = 37/269 (14%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C  C E++V ++GH I+ C G     +  LH W+KGS++ +LIP+E++HL++ F   IK
Sbjct  652   GCSECSEIHVAQSGHHIQDCTGPSSVKRRGLHSWVKGSINDVLIPIESYHLYDPFGRRIK  711

Query  1038  HHERFDYSRISAVVELCLQAGAN----PNDESIDASKM----------------------  937
             H  RF Y RI AVVELC+QAG +    P+       +M                      
Sbjct  712   HETRFSYDRIPAVVELCVQAGVDLPEYPSRRRTIPIRMIGKKVIDRGGFVEEPEPFHSSD  771

Query  936   ---------EHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSE  784
                       H +  +   P    +  +  ET++A+E +R GV KL+  Y VK C +CSE
Sbjct  772   SSSLLMDIDTHGAFGRFPPPPLSDIPRIAQETIDAYEVVRWGVRKLMRKYTVKACGYCSE  831

Query  783   VHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNY  607
             VHVGP GH A+LCG FK++     H W+ A+V++++PPN V+H R P+ PPL     R +
Sbjct  832   VHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVEEVIPPNYVYHLRDPKGPPLRSGLKR-F  890

Query  606   YGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             YG APAVV++C +AGA  P KY  MM++D
Sbjct  891   YGKAPAVVEVCMQAGAQVPDKYKPMMRLD  919


 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 56/108 (52%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW+ L  G+ +LL V PV  C  CSE+HV  SGH  + C        R +H W K 
Sbjct  629  EVLDAWKVLIKGLAQLLHVIPVHGCSECSEIHVAQSGHHIQDCTGPSSVKRRGLHSWVKG  688

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  689  SINDVLIPIESYHLYDPFGRRIKHETRFSYDRIPAVVELCVQAGVDLP  736


 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 61/113 (54%), Gaps = 6/113 (5%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   +++ ++ P   +HL +     ++ 
Sbjct  826   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVEEVIPPNYVYHLRDPKGPPLRS  885

Query  1035  HERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA   D+     +++      IV+P  ++ RL+ 
Sbjct  886   GLKRFYGKAPAVVEVCMQAGAQVPDKYKPMMRLD------IVIPDTEESRLVA  932



>ref|XP_007204347.1| hypothetical protein PRUPE_ppa005668mg [Prunus persica]
 gb|EMJ05546.1| hypothetical protein PRUPE_ppa005668mg [Prunus persica]
Length=449

 Score =   185 bits (469),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 150/274 (55%), Gaps = 34/274 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWI-KGSLDSILIPVETFHLHNMFQNVIK  1039
             CR+C E++VG  GH  ++C G     +  +H WI   ++D + +PVE FHL++     I 
Sbjct  171   CRFCNEIHVGPVGHPFKSCKGANANIRKGVHEWITNATVDDVFLPVEAFHLYDRLGRRIP  230

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDASKME---------  934
             H ERF   RI A+VELC+QAG +                   E +DA + E         
Sbjct  231   HEERFSIPRIPAIVELCIQAGVDVAEYPTKRRRKPIIRISKSEFVDADESELPDTDTEGP  290

Query  933   ------HESNSKIVLPFDQQMRLLGNETL-NAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                      +S+IV P D++   L  E    AW+ +R G  +L+ +Y V+VC +C EVHV
Sbjct  291   KRPVLTEIPDSEIVAPSDEEETTLLAEETLRAWDQMRRGAKRLMKMYLVRVCGYCPEVHV  350

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GPSGHKA+ CG FK++     H W+ A ++DL+PP  VWH    + P +  E RN+YG A
Sbjct  351   GPSGHKAQNCGAFKHQQRNGQHGWQAAVLNDLIPPRYVWHVPDVNGPPMERELRNFYGQA  410

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD-GLSAPISD  496
             PAVV++C +AGA  P +Y   M++D G+ + I +
Sbjct  411   PAVVEMCIQAGAAVPEEYRPTMRLDVGIPSTIKE  444


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 1/105 (1%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW-EK  697
            +  NA  TL + + KLL V PV+ C+ C+E+HVGP GH  + C        + +H W   
Sbjct  147  DVFNARITLINNLKKLLKVVPVQACRFCNEIHVGPVGHPFKSCKGANANIRKGVHEWITN  206

Query  696  ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
            A+VDD+  P   +H   +    +  E R      PA+V+LC +AG
Sbjct  207  ATVDDVFLPVEAFHLYDRLGRRIPHEERFSIPRIPAIVELCIQAG  251



>ref|XP_010414216.1| PREDICTED: APO protein 1, chloroplastic-like [Camelina sativa]
Length=430

 Score =   184 bits (468),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 97/271 (36%), Positives = 142/271 (52%), Gaps = 36/271 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C  V+V  +GH I+ C G     +   H W+KG+++ +LIPVE++H++++F   
Sbjct  147   VFACSECGAVHVANSGHSIKDCNGPTSSQRRGSHSWVKGTINDVLIPVESYHMYDLFGRR  206

Query  1044  IKHHERFDYSRISAVVELCLQAGAN--------------------------------PND  961
             IKH  RFDY RI A+VELC+QAG +                                P  
Sbjct  207   IKHETRFDYERIPALVELCIQAGVDIPEYPCRRRTQPIRMMGKRVIERGGYVREPDKPQT  266

Query  960   ESIDASKMEHESN----SKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
              S  +S +          +   P  + +  +  ET++A+E +R GV KL+  Y VK C +
Sbjct  267   SSSLSSPLAELDTLGACERYPPPIPEDIPRIAQETMDAYEKVRLGVTKLMRKYTVKACGY  326

Query  792   CSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGR  613
             CSEVHVGP GH  +LCG FK++     H W+ A VD++ PPN VWH R      L    R
Sbjct  327   CSEVHVGPWGHSVKLCGEFKHQWRDGKHGWQDALVDEVFPPNYVWHVRDLKGNPLTGSLR  386

Query  612   NYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              +YG APA+V++C  +GA  P +Y  MM++D
Sbjct  387   RFYGKAPALVEICMHSGARVPQRYKAMMRLD  417


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 1/116 (1%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + ++ ++ W+ L  G+ +LL + PV  C  C  VHV  SGH  + C        R  H W
Sbjct  123  VASQVIDNWKLLIKGLAQLLHLVPVFACSECGAVHVANSGHSIKDCNGPTSSQRRGSHSW  182

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFC  535
             K +++D++ P   +H        +  E R  Y   PA+V+LC +AG   P +Y C
Sbjct  183  VKGTINDVLIPVESYHMYDLFGRRIKHETRFDYERIPALVELCIQAGVDIP-EYPC  237



>ref|XP_011018036.1| PREDICTED: APO protein 2, chloroplastic-like [Populus euphratica]
Length=493

 Score =   186 bits (471),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/263 (38%), Positives = 143/263 (54%), Gaps = 31/263 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +N LH W   +++ +L+PVE +HL++     I H
Sbjct  217   CGWCDEIHVGPEGHPFKSCKGKHATLRNGLHQWTNAAIEDVLVPVEAYHLYDRLGKRITH  276

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKME----------  934
              ERF   +I AV+ELC+QAG +  +                E  DA + +          
Sbjct  277   EERFSIPQIPAVMELCIQAGVHIPEYPTKRRRKPIIRIGKREFADADESDLPDLLEVPLK  336

Query  933   ----HESNSKIVLPFDQ-QMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGP  769
                   S S+ V P ++ +  LL  ETL AWE +R G  +L+ +Y V+ C +C EVHVGP
Sbjct  337   PLLIEISISEAVAPANEVEKTLLAEETLQAWEKMRKGAKRLMQMYRVRACGYCPEVHVGP  396

Query  768   SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPA  589
             SGHKA+ CG  K++     H W+ A +DDL+PP  VWH        L  E RN+YG APA
Sbjct  397   SGHKAQNCGAHKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVVGLPLRRELRNFYGQAPA  456

Query  588   VVDLCTKAGAIAPSKYFCMMKVD  520
             VV++C +AGA  P +Y   M++D
Sbjct  457   VVEICFQAGAAVPDQYKSTMRLD  479


 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 60/117 (51%), Gaps = 2/117 (2%)
 Frame = -1

Query  897  QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWR  718
            Q +  L  +  NA  TL + + KLL V PV  C  C E+HVGP GH  + C   K+ + R
Sbjct  185  QSLLPLAYDVFNARITLINNLRKLLKVVPVHACGWCDEIHVGPEGHPFKSCK-GKHATLR  243

Query  717  R-IHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              +H W  A+++D++ P   +H   +    +  E R      PAV++LC +AG   P
Sbjct  244  NGLHQWTNAAIEDVLVPVEAYHLYDRLGKRITHEERFSIPQIPAVMELCIQAGVHIP  300



>emb|CBI36535.3| unnamed protein product [Vitis vinifera]
Length=551

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/302 (35%), Positives = 155/302 (51%), Gaps = 35/302 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++C E++VG  GH  ++C G +   +   H W    ++ IL+PV+ FHL +     I H
Sbjct  203   CKWCNEIHVGHVGHPFKSCRGPQTSIRKGDHEWTNAFIEDILVPVDAFHLFDRLGRRIPH  262

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHES-------  925
              ERF   RI AVVELC+QAG +                   E IDA + E          
Sbjct  263   EERFSIPRIPAVVELCIQAGVDLPEFPTKRRRKPIIRIGKSEFIDADESELPDPVPEVPK  322

Query  924   --------NSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +S+I  P   ++  LL  ETL AW+ ++ G  KL+ +YPV+VC +C EVH+G
Sbjct  323   TPLLTEIPDSEIEAPSSAEETALLAEETLKAWDKMKGGAKKLMRMYPVRVCGYCPEVHIG  382

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG  K++     H W+ A ++DL+PP  VWH     P  L  E +N+YG AP
Sbjct  383   PSGHKAQNCGAHKHQQRNGQHGWQAAVLNDLIPPRYVWHVPNGQP--LQRELKNFYGQAP  440

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD-GLSAPISDKP*CHIAIIIYWSHVASWFEMC*RSYV  415
              VV++C +AGA  P +Y   M++D G+   I +     +   ++   ++  F      Y 
Sbjct  441   VVVEMCVQAGAAVPEQYKPTMRLDVGIPTDIREAEMVVLLFFVFTHLLSHPFPPLLTPYA  500

Query  414   WP  409
             WP
Sbjct  501   WP  502


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + +NA  TL + + KLL V PV  CK C+E+HVG  GH  + C   +    +  H W  A
Sbjct  179  DVMNARTTLINNLKKLLKVLPVHACKWCNEIHVGHVGHPFKSCRGPQTSIRKGDHEWTNA  238

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             ++D++ P   +H   +    +  E R      PAVV+LC +AG   P
Sbjct  239  FIEDILVPVDAFHLFDRLGRRIPHEERFSIPRIPAVVELCIQAGVDLP  286



>ref|XP_002275774.2| PREDICTED: APO protein 2, chloroplastic [Vitis vinifera]
Length=478

 Score =   185 bits (469),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 99/264 (38%), Positives = 142/264 (54%), Gaps = 34/264 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++C E++VG  GH  ++C G +   +   H W    ++ IL+PV+ FHL +     I H
Sbjct  203   CKWCNEIHVGHVGHPFKSCRGPQTSIRKGDHEWTNAFIEDILVPVDAFHLFDRLGRRIPH  262

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHES-------  925
              ERF   RI AVVELC+QAG +                   E IDA + E          
Sbjct  263   EERFSIPRIPAVVELCIQAGVDLPEFPTKRRRKPIIRIGKSEFIDADESELPDPVPEVPK  322

Query  924   --------NSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +S+I  P   ++  LL  ETL AW+ ++ G  KL+ +YPV+VC +C EVH+G
Sbjct  323   TPLLTEIPDSEIEAPSSAEETALLAEETLKAWDKMKGGAKKLMRMYPVRVCGYCPEVHIG  382

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             PSGHKA+ CG  K++     H W+ A ++DL+PP  VWH     P  L  E +N+YG AP
Sbjct  383   PSGHKAQNCGAHKHQQRNGQHGWQAAVLNDLIPPRYVWHVPNGQP--LQRELKNFYGQAP  440

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
              VV++C +AGA  P +Y   M++D
Sbjct  441   VVVEMCVQAGAAVPEQYKPTMRLD  464


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + +NA  TL + + KLL V PV  CK C+E+HVG  GH  + C   +    +  H W  A
Sbjct  179  DVMNARTTLINNLKKLLKVLPVHACKWCNEIHVGHVGHPFKSCRGPQTSIRKGDHEWTNA  238

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             ++D++ P   +H   +    +  E R      PAVV+LC +AG   P
Sbjct  239  FIEDILVPVDAFHLFDRLGRRIPHEERFSIPRIPAVVELCIQAGVDLP  286



>emb|CDY02779.1| BnaC02g11100D [Brassica napus]
Length=441

 Score =   184 bits (467),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/264 (36%), Positives = 141/264 (53%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C +C E++VG  GH  ++C G     +   H W    L+ +++P+E +HL++     I+H
Sbjct  164   CGWCNEIHVGPYGHPFKSCKGPSASQRKGHHEWTNSVLEDVIVPLEAYHLYDRLGKRIRH  223

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKME----------  934
              ERF   R+  VVELC+Q G                     E +DA + E          
Sbjct  224   DERFTIPRVPPVVELCIQGGVEIPELPAKRRRKPIIRIGKSEFVDADETELPDPEPHIPP  283

Query  933   -----HESNSKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                      S+I  P  ++  + L  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  284   EPLLTELPPSEITPPSSEEETVSLAEETLQAWEEMRAGAKKLMRMYRVRVCGYCPEVHVG  343

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG FK++     H W+ A +DDL+PP  VWH    + P +  E R++YG AP
Sbjct  344   PTGHKAQNCGAFKHQQRNGQHGWQSAVLDDLIPPRYVWHVPDVNGPPMQRELRSFYGQAP  403

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M+++
Sbjct  404   AVVEICAQAGAEVPEQYRATMRLE  427



>ref|XP_006302272.1| hypothetical protein CARUB_v10020316mg [Capsella rubella]
 ref|XP_006302273.1| hypothetical protein CARUB_v10020316mg [Capsella rubella]
 gb|EOA35170.1| hypothetical protein CARUB_v10020316mg [Capsella rubella]
 gb|EOA35171.1| hypothetical protein CARUB_v10020316mg [Capsella rubella]
Length=435

 Score =   184 bits (466),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/270 (36%), Positives = 144/270 (53%), Gaps = 35/270 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C  V+V  +GH I+ C G  +  +   H W+KG+++ +LIPVE++H+++ F   
Sbjct  153   VFACSECGAVHVANSGHNIKDCNGPTNSQRRGSHSWVKGTINDVLIPVESYHMYDPFGRR  212

Query  1044  IKHHERFDYSRISAVVELCLQAGAN--------------------------------PND  961
             IKH  RFDY RI A+VELC+QAG +                                P  
Sbjct  213   IKHETRFDYDRIPALVELCIQAGVDIPEYPCRRRTQPIRMMGKRVIDHGGYVREPDKPQT  272

Query  960   ESIDASKMEHES---NSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHC  790
              S+ +   E ++     +   P  + +  +  ET++A+E +R GV KL+  + VK C +C
Sbjct  273   SSLSSPLAELDTLGACERYPPPTPEDIPKIAQETMDAYEKVRLGVTKLMRKFTVKACGYC  332

Query  789   SEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRN  610
             SEVHVGP GH  +LCG FK++     H W+ A VD++ PPN VWH R      L    R 
Sbjct  333   SEVHVGPWGHSVKLCGEFKHQWRDGKHGWQDALVDEVFPPNYVWHVRDLKGNPLTGNLRR  392

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             +YG APAVV++C  +GA  P +Y  MM++D
Sbjct  393   FYGKAPAVVEICMHSGARVPQRYKAMMRLD  422


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 57/116 (49%), Gaps = 1/116 (1%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + ++ ++ W+ L  G+ +LL V PV  C  C  VHV  SGH  + C        R  H W
Sbjct  129  VASQVIDNWKLLIKGLAQLLHVVPVFACSECGAVHVANSGHNIKDCNGPTNSQRRGSHSW  188

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFC  535
             K +++D++ P   +H        +  E R  Y   PA+V+LC +AG   P +Y C
Sbjct  189  VKGTINDVLIPVESYHMYDPFGRRIKHETRFDYDRIPALVELCIQAGVDIP-EYPC  243



>ref|XP_009366189.1| PREDICTED: APO protein 2, chloroplastic isoform X2 [Pyrus x bretschneideri]
Length=452

 Score =   184 bits (467),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 150/274 (55%), Gaps = 34/274 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKG-SLDSILIPVETFHLHNMFQNVIK  1039
             CR+C E++VG  GH  ++C G     +  +H WI   ++D I +PVE FHL++     I 
Sbjct  174   CRFCNEIHVGPVGHPFKSCKGANANIRKGVHEWIPNVTVDDIFLPVEAFHLYDRLGRRIP  233

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHES------  925
             H ERF   R+ A+VELC+QAG +                   E +DA + E         
Sbjct  234   HEERFSTPRLPALVELCIQAGVDIPEYPTKRRRKPIIRISKSEFVDADESELPDLDNEGP  293

Query  924   ---------NSKIVLPFDQQMRLLGNETL-NAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                      +S+++ P D++   L  E    AWE +R G  +L+ +Y V+VC +C EVHV
Sbjct  294   RRPVLTEILDSEVIAPSDEEETTLLAEETLRAWEQMRRGAKRLMKMYLVRVCGYCPEVHV  353

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GPSGHKA+ CG FK++     H W+ A ++DL+PP  VWH    + P L  E RN+YG A
Sbjct  354   GPSGHKAQNCGAFKHQQRNGQHGWQAAVLNDLIPPRYVWHVPDVNGPPLERELRNFYGQA  413

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD-GLSAPISD  496
             PAVV++C +AGA  P +Y   M++D G+ + I +
Sbjct  414   PAVVEMCIQAGAAVPEEYRPTMRLDVGIPSTIKE  447


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 1/109 (1%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW-EK  697
            +  +A  TL + + +LL V PV+ C+ C+E+HVGP GH  + C        + +H W   
Sbjct  150  DVYDARITLINNLKRLLKVVPVQACRFCNEIHVGPVGHPFKSCKGANANIRKGVHEWIPN  209

Query  696  ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +VDD+  P   +H   +    +  E R      PA+V+LC +AG   P
Sbjct  210  VTVDDIFLPVEAFHLYDRLGRRIPHEERFSTPRLPALVELCIQAGVDIP  258



>dbj|BAJ90733.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   184 bits (468),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 138/265 (52%), Gaps = 34/265 (13%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C+YC E++VG  GH  RTC G     +   H W    ++++ +PVE +HL +     I 
Sbjct  194   GCKYCSEIHVGSVGHPFRTCRGMSSDKRKGEHDWGSTFVEAVFLPVEAYHLEDRLGPRIP  253

Query  1038  HHERFDYSRISAVVELCLQAG-------------------------------ANPNDESI  952
             H +RF+  RI A+VELC+QAG                                +P  +  
Sbjct  254   HDQRFEVPRIPALVELCIQAGLDLPEYPTKRRRKPIVKIGRKEFVDANEDDLPDPEPDKF  313

Query  951   DASKMEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                 +E   + +I+ P   ++   L  ETL  WETLR+G  +L+  Y V+VC +C EVH+
Sbjct  314   KEPILEEVPDDEIIPPLSPEETAALAEETLVVWETLRNGALRLMKRYSVRVCGYCPEVHI  373

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             G SGHKAR CG FK++     H W+ A +DDL+PP  VWH    +   L  E +++YG A
Sbjct  374   GASGHKARNCGAFKHQQRNGQHGWQAAVLDDLIPPRYVWHM--PESGELQKELKSFYGQA  431

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV+LC + GA  P KY   M++D
Sbjct  432   PAVVELCIQGGAQVPEKYKATMRLD  456


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 52/105 (50%), Gaps = 0/105 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            NA   L + + +L+ V PVK CK+CSE+HVG  GH  R C     +  +  H W    V+
Sbjct  174  NARILLINNLKRLMKVVPVKGCKYCSEIHVGSVGHPFRTCRGMSSDKRKGEHDWGSTFVE  233

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +  P   +H   +  P +  + R      PA+V+LC +AG   P
Sbjct  234  AVFLPVEAYHLEDRLGPRIPHDQRFEVPRIPALVELCIQAGLDLP  278



>ref|XP_009366188.1| PREDICTED: APO protein 2, chloroplastic isoform X1 [Pyrus x bretschneideri]
Length=453

 Score =   184 bits (467),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 150/274 (55%), Gaps = 34/274 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKG-SLDSILIPVETFHLHNMFQNVIK  1039
             CR+C E++VG  GH  ++C G     +  +H WI   ++D I +PVE FHL++     I 
Sbjct  175   CRFCNEIHVGPVGHPFKSCKGANANIRKGVHEWIPNVTVDDIFLPVEAFHLYDRLGRRIP  234

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHES------  925
             H ERF   R+ A+VELC+QAG +                   E +DA + E         
Sbjct  235   HEERFSTPRLPALVELCIQAGVDIPEYPTKRRRKPIIRISKSEFVDADESELPDLDNEGP  294

Query  924   ---------NSKIVLPFDQQMRLLGNETL-NAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                      +S+++ P D++   L  E    AWE +R G  +L+ +Y V+VC +C EVHV
Sbjct  295   RRPVLTEILDSEVIAPSDEEETTLLAEETLRAWEQMRRGAKRLMKMYLVRVCGYCPEVHV  354

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GPSGHKA+ CG FK++     H W+ A ++DL+PP  VWH    + P L  E RN+YG A
Sbjct  355   GPSGHKAQNCGAFKHQQRNGQHGWQAAVLNDLIPPRYVWHVPDVNGPPLERELRNFYGQA  414

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD-GLSAPISD  496
             PAVV++C +AGA  P +Y   M++D G+ + I +
Sbjct  415   PAVVEMCIQAGAAVPEEYRPTMRLDVGIPSTIKE  448


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 55/109 (50%), Gaps = 1/109 (1%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW-EK  697
            +  +A  TL + + +LL V PV+ C+ C+E+HVGP GH  + C        + +H W   
Sbjct  151  DVYDARITLINNLKRLLKVVPVQACRFCNEIHVGPVGHPFKSCKGANANIRKGVHEWIPN  210

Query  696  ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +VDD+  P   +H   +    +  E R      PA+V+LC +AG   P
Sbjct  211  VTVDDIFLPVEAFHLYDRLGRRIPHEERFSTPRLPALVELCIQAGVDIP  259



>ref|XP_008242998.1| PREDICTED: APO protein 2, chloroplastic [Prunus mume]
Length=449

 Score =   184 bits (467),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 103/274 (38%), Positives = 149/274 (54%), Gaps = 34/274 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWI-KGSLDSILIPVETFHLHNMFQNVIK  1039
             CR+C E++VG  GH  ++C G     +  LH WI   ++D + +PVE FHL++     I 
Sbjct  171   CRFCNEIHVGPVGHPFKSCKGANANIRKGLHEWITNATVDDVFLPVEAFHLYDRLGRRIP  230

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDASKME---------  934
             H ERF   RI A+VELC+QAG +                   E +DA + E         
Sbjct  231   HEERFSIPRIPAIVELCIQAGVDVPEYPTKRRRKPIIRISKSEFVDADESELPDTDTERP  290

Query  933   ------HESNSKIVLPFDQQMRLLGNETL-NAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                      +S+IV P D++   L  E    AW+ +R G  KL+ +Y V+VC +C EVHV
Sbjct  291   KRPVLTEIPDSEIVAPSDEEETTLLAEETLRAWDQMRRGAKKLMKMYLVRVCGYCPEVHV  350

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GPSGHKA+ CG FK++     H W+ A ++DL+PP  VWH    +   +  E RN+YG A
Sbjct  351   GPSGHKAQNCGAFKHQQRNGQHGWQAAVLNDLIPPRYVWHVPDVNGAPMERELRNFYGQA  410

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD-GLSAPISD  496
             PAVV++C +AGA  P +Y   M++D G+ + I +
Sbjct  411   PAVVEMCIQAGAAVPEEYRPTMRLDVGIPSTIKE  444


 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 56/109 (51%), Gaps = 1/109 (1%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW-EK  697
            +  NA  TL + + KLL V PV+ C+ C+E+HVGP GH  + C        + +H W   
Sbjct  147  DVFNARITLINNLKKLLKVVPVQACRFCNEIHVGPVGHPFKSCKGANANIRKGLHEWITN  206

Query  696  ASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            A+VDD+  P   +H   +    +  E R      PA+V+LC +AG   P
Sbjct  207  ATVDDVFLPVEAFHLYDRLGRRIPHEERFSIPRIPAIVELCIQAGVDVP  255



>ref|XP_008344061.1| PREDICTED: APO protein 2, chloroplastic-like [Malus domestica]
Length=291

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 100/274 (36%), Positives = 148/274 (54%), Gaps = 34/274 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKG-SLDSILIPVETFHLHNMFQNVIK  1039
             CR+C E++VG  GH  ++C G     +  +H WI   ++D I +PVE FHL++     I 
Sbjct  13    CRFCNEIHVGPVGHPFKSCKGANANIRKGVHEWIPNVTVDDIFLPVEAFHLYDRLGRRIP  72

Query  1038  HHERFDYSRISAVVELCLQAGAN----------------PNDESIDASKMEHES------  925
             H ERF   R+ A+VELC+QAG +                   E +DA + E         
Sbjct  73    HEERFSTPRLPALVELCIQAGVDIPEYPTKRRRKPIIRISKSEFVDADESELPDLDDEGP  132

Query  924   ---------NSKIVLPFDQQMRLLGNETL-NAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                      +S+++ P D++   L  E    AWE +R G  +L+ +Y V+VC +C EVHV
Sbjct  133   KRPVLAEILDSEVIXPSDEEETTLLAEETLRAWEQMRRGAKRLMKMYLVRVCGYCPEVHV  192

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GPSGHKA+ CG FK++     H W+ A ++DL+PP  VWH    + P L  E RN+YG A
Sbjct  193   GPSGHKAQNCGAFKHQQRNGQHGWQAAVLNDLIPPRYVWHVPDVNGPPLERELRNFYGQA  252

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD-GLSAPISD  496
             P  V++C +AGA  P +Y   M++D G+ + I +
Sbjct  253   PXXVEMCIQAGAAVPEEYRPTMRLDVGIPSTIKE  286



>gb|KFK27330.1| hypothetical protein AALP_AA8G369000 [Arabis alpina]
Length=621

 Score =   186 bits (473),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 141/264 (53%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC E++VG  GH  ++C G     +  LH W    ++ +++P+E +HL +     I H
Sbjct  344   CGYCNEIHVGPYGHPFKSCKGPTASQRKGLHEWTNSVIEDVIVPLEAYHLFDRLGKRIHH  403

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKME----------  934
              ERF   R+ A+VELC+Q G                     E +DA + E          
Sbjct  404   DERFSVPRVPAIVELCIQGGVEIPEFPTKRRRKPIIRIAKSEFVDADETELPDLEPQPPP  463

Query  933   -----HESNSKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                      S+I  P  ++  + +  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  464   VPLLTELPVSEITPPSSEEETVSIAEETLQAWEEMRAGAKKLMRLYRVRVCGYCPEVHVG  523

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG FK++     H W+ A +DD++PP  VWH    + P +  E R++YG AP
Sbjct  524   PTGHKAQNCGAFKHQQRNGQHGWQSAVLDDVIPPRYVWHVPDVNGPPMQRELRSFYGQAP  583

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M+++
Sbjct  584   AVVEICAQAGATVPEQYRATMRLE  607


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  +  NA  TL + +H+L+ V  V  C +C+E+HVGP GH  + C        + +H W
Sbjct  317  LAYKVYNARITLINNLHRLMKVVRVNACGYCNEIHVGPYGHPFKSCKGPTASQRKGLHEW  376

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              + ++D++ P   +H   +    +  + R      PA+V+LC + G   P
Sbjct  377  TNSVIEDVIVPLEAYHLFDRLGKRIHHDERFSVPRVPAIVELCIQGGVEIP  427



>ref|XP_008394316.1| PREDICTED: APO protein 2, chloroplastic-like [Malus domestica]
 ref|XP_008394317.1| PREDICTED: APO protein 2, chloroplastic-like [Malus domestica]
 ref|XP_008394318.1| PREDICTED: APO protein 2, chloroplastic-like [Malus domestica]
 ref|XP_008394319.1| PREDICTED: APO protein 2, chloroplastic-like [Malus domestica]
Length=292

 Score =   179 bits (454),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 98/274 (36%), Positives = 146/274 (53%), Gaps = 34/274 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKG-SLDSILIPVETFHLHNMFQNVIK  1039
             CR+C E++VG  GH  ++C G     +  +H WI   ++D I +PVE FHL++     I 
Sbjct  14    CRFCNEIHVGPVGHPFKSCKGANANIRKGVHEWIPNVTVDDIFLPVEAFHLYDRLGRRIP  73

Query  1038  HHERFDYSRISAVVELCLQAGAN-------------------------------PNDESI  952
             H ERF   R+ A+VELC+ AG +                               P+ E+ 
Sbjct  74    HEERFSTPRVPAIVELCIXAGVDVPEYPTTRRRKPIIXIXKXXFVDADESELPDPDSEAP  133

Query  951   DASKMEHESNSKIVLPFDQQMRLLGNETL-NAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                 +   S+ ++V P D++   L  E    AWE +R G  +L+ +Y V+ C +C EVHV
Sbjct  134   KRPVLTEISDXEVVAPTDEEETTLLXEETLRAWEQMRRGAKRLMKMYLVRXCGYCPEVHV  193

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GPSGHKA+ CG FK++     H W+ A ++DL+PP  VWH    +   L  E RN+YG A
Sbjct  194   GPSGHKAQNCGXFKHQQRNGQHGWQTAVLNDLIPPRYVWHVPDVNGXPLQXELRNFYGQA  253

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD-GLSAPISD  496
             PAVV++C +AGA  P +Y   M++D G+ + I +
Sbjct  254   PAVVEMCIQAGAAVPEEYRPTMRLDVGIPSTIKE  287



>gb|KFK27329.1| hypothetical protein AALP_AA8G369000 [Arabis alpina]
Length=642

 Score =   186 bits (472),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/264 (35%), Positives = 141/264 (53%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC E++VG  GH  ++C G     +  LH W    ++ +++P+E +HL +     I H
Sbjct  365   CGYCNEIHVGPYGHPFKSCKGPTASQRKGLHEWTNSVIEDVIVPLEAYHLFDRLGKRIHH  424

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKME----------  934
              ERF   R+ A+VELC+Q G                     E +DA + E          
Sbjct  425   DERFSVPRVPAIVELCIQGGVEIPEFPTKRRRKPIIRIAKSEFVDADETELPDLEPQPPP  484

Query  933   -----HESNSKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                      S+I  P  ++  + +  ETL AWE +R+G  KL+ +Y V+VC +C EVHVG
Sbjct  485   VPLLTELPVSEITPPSSEEETVSIAEETLQAWEEMRAGAKKLMRLYRVRVCGYCPEVHVG  544

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P+GHKA+ CG FK++     H W+ A +DD++PP  VWH    + P +  E R++YG AP
Sbjct  545   PTGHKAQNCGAFKHQQRNGQHGWQSAVLDDVIPPRYVWHVPDVNGPPMQRELRSFYGQAP  604

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C +AGA  P +Y   M+++
Sbjct  605   AVVEICAQAGATVPEQYRATMRLE  628


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/111 (29%), Positives = 55/111 (50%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            L  +  NA  TL + +H+L+ V  V  C +C+E+HVGP GH  + C        + +H W
Sbjct  338  LAYKVYNARITLINNLHRLMKVVRVNACGYCNEIHVGPYGHPFKSCKGPTASQRKGLHEW  397

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
              + ++D++ P   +H   +    +  + R      PA+V+LC + G   P
Sbjct  398  TNSVIEDVIVPLEAYHLFDRLGKRIHHDERFSVPRVPAIVELCIQGGVEIP  448



>ref|XP_002886768.1| hypothetical protein ARALYDRAFT_475482 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63027.1| hypothetical protein ARALYDRAFT_475482 [Arabidopsis lyrata subsp. 
lyrata]
Length=435

 Score =   182 bits (462),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/270 (36%), Positives = 141/270 (52%), Gaps = 35/270 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C  V+V   GH IR C G  +  +   H W+KG+++ +LIPVE++H+H+ F   
Sbjct  153   VFACSECGAVHVANAGHNIRDCNGPTNSQRRGSHSWVKGTINDVLIPVESYHMHDPFGRR  212

Query  1044  IKHHERFDYSRISAVVELCLQAGA--------------------------------NPND  961
             IKH  RFDY RI  +VELC+QAG                                  P  
Sbjct  213   IKHETRFDYERIPVLVELCIQAGVEIPEYPCRRRTQPIRMMGKRVIDRGGYLREPDKPQT  272

Query  960   ESIDASKMEHES---NSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHC  790
              S+ +   E ++     +   P  + +  +  ET++A+E +R GV KL+  + VK C +C
Sbjct  273   SSLSSPLAELDTLGACERHPPPTPEDIPKIAQETMDAYEKVRLGVTKLMRKFTVKACGYC  332

Query  789   SEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRN  610
             SEVHVGP GH  +LCG FK++     H W+ A VD++ PPN VWH R      L    R 
Sbjct  333   SEVHVGPWGHSVKLCGEFKHQWRDGKHGWQDALVDEVFPPNYVWHVRDLKGNPLTGNLRR  392

Query  609   YYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             +YG APA+V++C  +GA  P +Y  MM++D
Sbjct  393   FYGKAPALVEICMHSGARVPQRYKAMMRLD  422


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/113 (32%), Positives = 54/113 (48%), Gaps = 1/113 (1%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + ++ W+ L  G+ +LL V PV  C  C  VHV  +GH  R C        R  H W K 
Sbjct  132  QVIDNWKLLIKGLAQLLHVVPVFACSECGAVHVANAGHNIRDCNGPTNSQRRGSHSWVKG  191

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFC  535
            +++D++ P   +H        +  E R  Y   P +V+LC +AG   P +Y C
Sbjct  192  TINDVLIPVESYHMHDPFGRRIKHETRFDYERIPVLVELCIQAGVEIP-EYPC  243



>emb|CAN76001.1| hypothetical protein VITISV_019165 [Vitis vinifera]
Length=472

 Score =   183 bits (464),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 141/264 (53%), Gaps = 34/264 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++C E++VG  GH  ++C G +   +   H W    ++ IL+PV+ FHL +     I H
Sbjct  112   CKWCNEIHVGHVGHPFKSCRGPQTSIRKGDHEWTNAFIEDILVPVDAFHLFDRLGRRIPH  171

Query  1035  HERFDYSRISAVVELCLQAGAN----------------PNDESIDASKME----------  934
              ERF   RI AVVELC+QAG +                   E IDA + E          
Sbjct  172   EERFSIPRIPAVVELCIQAGVDLPEFPTKRRRKPIIRIGKSEFIDADESELPDPVPEAPK  231

Query  933   -----HESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                     +S+I  P   ++  LL  ETL AW+ ++ G  KL+ +YPV+VC +C EVH+G
Sbjct  232   TPLLTEIPDSEIEAPSSAEETALLAEETLKAWDKMKGGAKKLMRMYPVRVCGYCPEVHIG  291

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
              SGHKA+ CG  K++     H W+ A ++DL+PP  VWH     P  L  E +N+YG AP
Sbjct  292   XSGHKAQNCGAHKHQQRNGQHGWQAAVLNDLIPPRYVWHVPNGQP--LQRELKNFYGQAP  349

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
              VV++C +AGA  P +Y   M++D
Sbjct  350   VVVEMCVQAGAAVPEQYKPTMRLD  373


 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 55/108 (51%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            + +NA  TL + + KLL V PV  CK C+E+HVG  GH  + C   +    +  H W  A
Sbjct  88   DVMNARTTLINNLKKLLKVLPVHACKWCNEIHVGHVGHPFKSCRGPQTSIRKGDHEWTNA  147

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             ++D++ P   +H   +    +  E R      PAVV+LC +AG   P
Sbjct  148  FIEDILVPVDAFHLFDRLGRRIPHEERFSIPRIPAVVELCIQAGVDLP  195



>gb|EMT11689.1| hypothetical protein F775_05116 [Aegilops tauschii]
Length=445

 Score =   182 bits (461),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 137/265 (52%), Gaps = 34/265 (13%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIK  1039
              C+YC E++VG  GH  RTC G     +   H W    ++++ +PVE +HL +     I 
Sbjct  169   GCKYCGEIHVGSVGHPFRTCRGMSSDKRKGEHDWGSTFVEAVFLPVEAYHLEDRLGPRIP  228

Query  1038  HHERFDYSRISAVVELCLQAG-------------------------------ANPNDESI  952
             H +RF+  RI A+VELC+QAG                                +P  +  
Sbjct  229   HDQRFEVPRIPALVELCIQAGLDLPEYPTKRRRKPIVKIGRKEFVDANEDDLPDPEPDKF  288

Query  951   DASKMEHESNSKIVLPFD-QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
                 +E  S+ +I  P   ++   L  ETL  WETLR+G  +L+  Y V+VC +C EVH+
Sbjct  289   KEPILEEVSDDEITPPSSPEETAALAEETLKMWETLRNGALRLMKRYSVRVCGYCPEVHI  348

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             G SGHKAR CG FK++     H W+ A +DDL+PP  VWH    +   L  E + +YG A
Sbjct  349   GASGHKARNCGAFKHQQRNGQHGWQAAVLDDLIPPRYVWHM--PESGELQKELKIFYGQA  406

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV++C + GA  P KY   M++D
Sbjct  407   PAVVEICIQGGAQVPEKYKATMRLD  431


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 52/105 (50%), Gaps = 0/105 (0%)
 Frame = -1

Query  864  NAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVD  685
            NA  +L + + +L+ V PVK CK+C E+HVG  GH  R C     +  +  H W    V+
Sbjct  149  NARISLINNLKRLMKVVPVKGCKYCGEIHVGSVGHPFRTCRGMSSDKRKGEHDWGSTFVE  208

Query  684  DLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             +  P   +H   +  P +  + R      PA+V+LC +AG   P
Sbjct  209  AVFLPVEAYHLEDRLGPRIPHDQRFEVPRIPALVELCIQAGLDLP  253



>emb|CDX77468.1| BnaA07g06060D [Brassica napus]
Length=414

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 144/268 (54%), Gaps = 33/268 (12%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C  V+V   GH IR C G     ++  H+W+KG+++ +L+PVE++H+++ F   
Sbjct  134   VFACSECAAVHVASAGHNIRDCSGPTSSQRHGSHLWVKGTINDVLVPVESYHMYDPFGRR  193

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKMEHE-----------------  928
             IKH  RFDY RI AVVELC+QAG      P+       +M  +                 
Sbjct  194   IKHESRFDYERIPAVVELCVQAGVEIPEYPSRRRTQPVRMMGKRVIDRGGYVKEPDKPCS  253

Query  927   SNSKIV------------LPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSE  784
             S S +              P  +++  +  ET++A+E +R GV KL+  Y VK C +CSE
Sbjct  254   STSPLADLDTLGACERHPPPTPEKVSKIAQETMDAYEKVRWGVTKLMREYTVKACGYCSE  313

Query  783   VHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYY  604
             VHVGP GH  +LCG FK++     H W+ A V++++PPN VWH R      L    + +Y
Sbjct  314   VHVGPWGHSVKLCGEFKHQWRDGKHGWQDALVEEVLPPNYVWHVRDLKGTPLTGNLKRFY  373

Query  603   GHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             G APA+V++C  +GA  P  Y  MM++D
Sbjct  374   GKAPALVEVCMHSGARVPQCYKAMMRLD  401


 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E ++ W+ L  G+ +LL V PV  C  C+ VHV  +GH  R C           H W K 
Sbjct  113  EVIDNWKLLIKGLAQLLHVVPVFACSECAAVHVASAGHNIRDCSGPTSSQRHGSHLWVKG  172

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            +++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  173  TINDVLVPVESYHMYDPFGRRIKHESRFDYERIPAVVELCVQAGVEIP  220



>ref|XP_010424459.1| PREDICTED: APO protein 4, mitochondrial-like [Camelina sativa]
Length=122

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 90/121 (74%), Gaps = 0/121 (0%)
 Frame = -1

Query  861  AWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDD  682
            AW  LR GV KLLLVYP +VCK C EVHVGP+G+KARLC VFKYESWR  H+WEKA V+D
Sbjct  2    AWAKLREGVKKLLLVYPWRVCKQCKEVHVGPTGNKARLCDVFKYESWRDTHYWEKAGVND  61

Query  681  LVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAPI  502
             VP  +VWH RPQDP +LLD+GRN+Y HA A+V LC+   A  P KY C MK  GLS PI
Sbjct  62   FVPKKMVWHCRPQDPVVLLDQGRNHYVHASAIVSLCSHVSATVPVKYSCKMKFQGLSFPI  121

Query  501  S  499
             
Sbjct  122  Q  122



>ref|XP_009102558.1| PREDICTED: APO protein 1, chloroplastic [Brassica rapa]
Length=432

 Score =   181 bits (458),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/268 (36%), Positives = 144/268 (54%), Gaps = 33/268 (12%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C  V+V   GH IR C G     ++  H+W+KG+++ +L+PVE++H+++ F   
Sbjct  152   VFACSECAAVHVASAGHNIRDCSGPTSSQRHGSHLWVKGTINDVLVPVESYHMYDPFGRR  211

Query  1044  IKHHERFDYSRISAVVELCLQAGAN----PNDESIDASKMEHE-----------------  928
             IKH  RFDY RI AVVELC+QAG      P+       +M  +                 
Sbjct  212   IKHESRFDYERIPAVVELCVQAGVEIPEYPSRRRTQPVRMMGKRVIDRGGYVKEPDKPCS  271

Query  927   SNSKIV------------LPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSE  784
             S S +              P  +++  +  ET++A+E +R GV KL+  Y VK C +CSE
Sbjct  272   STSPLADLDTLGACERHPPPTPEKVSKIAQETMDAYEKVRWGVTKLMREYTVKACGYCSE  331

Query  783   VHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYY  604
             VHVGP GH  +LCG FK++     H W+ A V++++PPN VWH R      L    + +Y
Sbjct  332   VHVGPWGHSVKLCGEFKHQWRDGKHGWQDALVEEVLPPNYVWHVRDLKGTPLTGNLKRFY  391

Query  603   GHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             G APA+V++C  +GA  P  Y  MM++D
Sbjct  392   GKAPALVEVCMHSGARVPQCYKAMMRLD  419


 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 52/108 (48%), Gaps = 0/108 (0%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E ++ W+ L  G+ +LL V PV  C  C+ VHV  +GH  R C           H W K 
Sbjct  131  EVIDNWKLLIKGLAQLLHVVPVFACSECAAVHVASAGHNIRDCSGPTSSQRHGSHLWVKG  190

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            +++D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  191  TINDVLVPVESYHMYDPFGRRIKHESRFDYERIPAVVELCVQAGVEIP  238



>gb|EPS60915.1| hypothetical protein M569_13885 [Genlisea aurea]
Length=433

 Score =   181 bits (458),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/263 (37%), Positives = 142/263 (54%), Gaps = 32/263 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C++C E++VG   H  +TC G     +   H W K  ++ IL P++ +HL++     I H
Sbjct  158   CKWCNEIHVGPIVHPFKTCTGPESSIRKGSHEWGKAVVEDILTPIDAYHLYDRLGKRITH  217

Query  1035  HERFDYSRISAVVELCLQAGANPND----------------ESIDASKME----------  934
              ERF   RI AV ELC+QAG    D                E IDA + E          
Sbjct  218   LERFSIPRIPAVAELCIQAGVELPDYPAKRRRKPVIRTGKNEFIDADETELPDPETTTMP  277

Query  933   ----HESNSKIVLPFDQQMRL-LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGP  769
                   ++++IV P   + +  +  ET+ AWE +R+G  +L+ +YPV+ C +C EVHVGP
Sbjct  278   ELLVEMADTEIVAPSSGEEKTRVAEETVRAWEEMRNGAKRLMKMYPVRTCGYCPEVHVGP  337

Query  768   SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPA  589
             +GHKA+ CG  K++     H W+ A +DDL+PP  VWH    D P +  E R++YG APA
Sbjct  338   TGHKAQNCGARKHQQRNGQHGWQTAILDDLIPPRYVWHVPEIDKP-MEKELRSFYGQAPA  396

Query  588   VVDLCTKAGAIAPSKYFCMMKVD  520
             VV+LC +AGA  P  Y   M++D
Sbjct  397   VVELCLQAGADVPHVYKSTMRLD  419


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 51/106 (48%), Gaps = 0/106 (0%)
 Frame = -1

Query  867  LNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASV  688
             NA   L + + KLL V PV  CK C+E+HVGP  H  + C   +    +  H W KA V
Sbjct  136  FNARIKLINNLKKLLKVMPVHACKWCNEIHVGPIVHPFKTCTGPESSIRKGSHEWGKAVV  195

Query  687  DDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            +D++ P   +H   +    +    R      PAV +LC +AG   P
Sbjct  196  EDILTPIDAYHLYDRLGKRITHLERFSIPRIPAVAELCIQAGVELP  241



>ref|XP_010510287.1| PREDICTED: APO protein 1, chloroplastic-like [Camelina sativa]
Length=434

 Score =   180 bits (457),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/267 (35%), Positives = 142/267 (53%), Gaps = 32/267 (12%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C  V+V  +GH I+ C G  +  +   H W++G+++ ++IPVE++H+++ F   
Sbjct  155   VFACSECGAVHVACSGHNIKDCNGPTNSQRRGSHSWVRGTINDVIIPVESYHMYDPFGRR  214

Query  1044  IKHHERFDYSRISAVVELCLQAGAN--------------------------------PND  961
             IKH  RFDY RI A+VELC+QAG +                                P  
Sbjct  215   IKHETRFDYERIPALVELCIQAGVDIPEYPCRRRTQPIRMMGKRVIERGGYVREPDKPQT  274

Query  960   ESIDASKMEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEV  781
              S  A      +  +   P  + +  +  ET++A+E +R GV KL+  + VK C +CSEV
Sbjct  275   SSPLAELDTLGACERYPPPIPEDIPRIAQETMDAYEKVRLGVTKLMRKFTVKACGYCSEV  334

Query  780   HVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYG  601
             HVGP GH  +LCG FK++     H W+ A VD++ PPN VWH R  +   L    R +YG
Sbjct  335   HVGPWGHSVKLCGEFKHQWRDGKHGWQDALVDEVFPPNYVWHVRDLNGNPLTGSLRRFYG  394

Query  600   HAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              APA+V++C  +GA  P +Y  MM++D
Sbjct  395   KAPALVEICMHSGARVPQRYKAMMRLD  421


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 1/116 (1%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + ++ ++ W+ L  G+ +LL V PV  C  C  VHV  SGH  + C        R  H W
Sbjct  131  VASQVIDNWKLLIKGLAQLLHVVPVFACSECGAVHVACSGHNIKDCNGPTNSQRRGSHSW  190

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFC  535
             + +++D++ P   +H        +  E R  Y   PA+V+LC +AG   P +Y C
Sbjct  191  VRGTINDVIIPVESYHMYDPFGRRIKHETRFDYERIPALVELCIQAGVDIP-EYPC  245



>ref|XP_010550896.1| PREDICTED: APO protein 1, chloroplastic [Tarenaya hassleriana]
Length=436

 Score =   179 bits (453),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/268 (35%), Positives = 139/268 (52%), Gaps = 36/268 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C  V+V + GH I+ C G  +  +   H W+KG++  IL+PVE++H+++ F   IKH
Sbjct  156   CSECAAVHVADAGHKIQDCEGPTNSRQGGFHSWVKGTVSDILVPVESYHMYDPFGRRIKH  215

Query  1035  HERFDYSRISAVVELCLQAGAN----PNDESIDASKM-------------------EHES  925
               RFDY RI AVVELC+QAG      P+       +M                     + 
Sbjct  216   ETRFDYDRIPAVVELCIQAGVEIPEYPSRRRTQPIRMIGKKVLDRGGFVREPRPWRSTDL  275

Query  924   NSKIVLPFD-------------QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSE  784
             +S  +   D             +    +   T++A+E +R GV KL+  Y VK C +CSE
Sbjct  276   SSSALADLDTLGACKRYPPARPEDAPQIAKVTMDAYEKVRRGVTKLMRKYTVKACGYCSE  335

Query  783   VHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYY  604
             VHVGP GH  +LCG FK++     H W+ A+VD++ PPN VWH R      +    + +Y
Sbjct  336   VHVGPWGHSVKLCGEFKHQWRDGKHGWQDATVDEIFPPNYVWHVRDLKASPITSSLKRFY  395

Query  603   GHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             G APA+V++C   GA  P +Y  MM++D
Sbjct  396   GKAPAIVEICMHGGARVPQRYKPMMRLD  423


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 54/111 (49%), Gaps = 0/111 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + +E L+ W+ L  G+ +LL V PV  C  C+ VHV  +GHK + C           H W
Sbjct  129  VAHEVLDNWKFLIKGLTQLLHVVPVYACSECAAVHVADAGHKIQDCEGPTNSRQGGFHSW  188

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
             K +V D++ P   +H        +  E R  Y   PAVV+LC +AG   P
Sbjct  189  VKGTVSDILVPVESYHMYDPFGRRIKHETRFDYDRIPAVVELCIQAGVEIP  239



>ref|NP_176661.1| APO protein 1 [Arabidopsis thaliana]
 sp|Q9XIR4.1|APO1_ARATH RecName: Full=APO protein 1, chloroplastic; AltName: Full=Accumulation 
of photosystem I protein 1; AltName: Full=Protein 
ACCUMULATION OF PHOTOSYSTEM ONE 1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD38255.1|AC006193_11 Unknown protein [Arabidopsis thaliana]
 gb|AAS45665.1| chloroplast APO1 [Arabidopsis thaliana]
 dbj|BAE99113.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABI54344.1| At1g64810 [Arabidopsis thaliana]
 gb|AEE34292.1| APO protein 1 [Arabidopsis thaliana]
Length=436

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 140/271 (52%), Gaps = 36/271 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C  V+V   GH IR C G  +  +   H W+KG+++ +LIPVE++H+++ F   
Sbjct  153   VFACSECGAVHVANVGHNIRDCNGPTNSQRRGSHSWVKGTINDVLIPVESYHMYDPFGRR  212

Query  1044  IKHHERFDYSRISAVVELCLQAGA--------------------------------NPND  961
             IKH  RF+Y RI A+VELC+QAG                                  P  
Sbjct  213   IKHETRFEYERIPALVELCIQAGVEIPEYPCRRRTQPIRMMGKRVIDRGGYHKEPEKPQT  272

Query  960   ESIDASKMEHESN----SKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
              S  +S +          +   P  + +  +  ET++A+E +R GV KL+  + VK C +
Sbjct  273   SSSLSSPLAELDTLGVFERYPPPTPEDIPKIAQETMDAYEKVRLGVTKLMRKFTVKACGY  332

Query  792   CSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGR  613
             CSEVHVGP GH  +LCG FK++     H W+ A VD++ PPN VWH R      L    R
Sbjct  333   CSEVHVGPWGHSVKLCGEFKHQWRDGKHGWQDALVDEVFPPNYVWHVRDLKGNPLTGNLR  392

Query  612   NYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              +YG APA+V++C  +GA  P +Y  MM++D
Sbjct  393   RFYGKAPALVEICMHSGARVPQRYKAMMRLD  423


 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 56/116 (48%), Gaps = 1/116 (1%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + ++ ++ W+ L  G+ +LL V PV  C  C  VHV   GH  R C        R  H W
Sbjct  129  VADQVIDNWKLLIKGLAQLLHVVPVFACSECGAVHVANVGHNIRDCNGPTNSQRRGSHSW  188

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFC  535
             K +++D++ P   +H        +  E R  Y   PA+V+LC +AG   P +Y C
Sbjct  189  VKGTINDVLIPVESYHMYDPFGRRIKHETRFEYERIPALVELCIQAGVEIP-EYPC  243



>ref|XP_010469796.1| PREDICTED: APO protein 1, chloroplastic [Camelina sativa]
Length=430

 Score =   178 bits (452),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 140/271 (52%), Gaps = 36/271 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C  V+V  +GH I+ C G     +   H W+KG+++ +LIPVE++H+++ F   
Sbjct  147   VFACSECGAVHVASSGHSIKDCNGPTSSQRRGSHSWVKGTINDVLIPVESYHMYDPFGRR  206

Query  1044  IKHHERFDYSRISAVVELCLQAGAN--------------------------------PND  961
             IKH  RFDY RI A+VELC+QAG +                                P  
Sbjct  207   IKHETRFDYERIPALVELCIQAGVDIPEYPCRRRTQPIRMMGKRVIERGGYVREPDKPQT  266

Query  960   ESIDASKMEHESN----SKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
              S  +S +          +   P  + +  +  ET++A+  +R GV KL+  + VK C +
Sbjct  267   SSSLSSPLAELDTLGACERYPPPTPEDIPRIAQETMDAYVKVRLGVTKLMSKFTVKACGY  326

Query  792   CSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGR  613
             CSEVHVGP GH  +LCG FK++     H W+ A VD++ PPN VWH R      L    R
Sbjct  327   CSEVHVGPWGHSVKLCGEFKHQWRDGKHGWQDALVDEVFPPNYVWHVRDLKGNPLTGSLR  386

Query  612   NYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              +YG APA+V++C  +GA  P +Y  MM++D
Sbjct  387   RFYGKAPALVEICMHSGARVPQRYKAMMRLD  417


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 57/116 (49%), Gaps = 1/116 (1%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + ++ ++ W+ L  G+ +LL V PV  C  C  VHV  SGH  + C        R  H W
Sbjct  123  VASQVIDNWKLLIKGLAQLLHVVPVFACSECGAVHVASSGHSIKDCNGPTSSQRRGSHSW  182

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFC  535
             K +++D++ P   +H        +  E R  Y   PA+V+LC +AG   P +Y C
Sbjct  183  VKGTINDVLIPVESYHMYDPFGRRIKHETRFDYERIPALVELCIQAGVDIP-EYPC  237



>ref|XP_010930508.1| PREDICTED: APO protein 3, mitochondrial [Elaeis guineensis]
 ref|XP_010930509.1| PREDICTED: APO protein 3, mitochondrial [Elaeis guineensis]
 ref|XP_010930510.1| PREDICTED: APO protein 3, mitochondrial [Elaeis guineensis]
Length=418

 Score =   177 bits (450),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 146/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMF-QNVIK  1039
             CR+C EV++G  GH IR+C G +  ++N +HVW +G +  ++     +HLH+   +  + 
Sbjct  142   CRFCSEVHIGHLGHEIRSCEGPKCGSRNSIHVWRRGGIRDVVGFPYCYHLHDRVGKPRVG  201

Query  1038  HHERFDYSRISAVVELCLQAGANPNDE----------SIDASKMEHE-------------  928
             H ERF   R+ A+VELC+QAG +              SID   ++ E             
Sbjct  202   HKERFGIQRLPAMVELCIQAGLDLEGYRTKRRTKPVYSIDGRIVDFEPEEEAMAVEEAHE  261

Query  927   ------SNSKIVLPFDQQ--MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
                   + S +   F++Q  M  L   TL +W  +RSG  KL+  Y V  C +C EV VG
Sbjct  262   SVNQCLNTSSMDNTFEEQATMSELSARTLQSWLEIRSGAMKLMKKYSVVTCGYCPEVQVG  321

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P GHK R+C   K++    +H W++A++DDL+ PN VWH R    PLL++E + YYG AP
Sbjct  322   PKGHKVRMCKASKHQHRDGLHAWQEATIDDLIRPNYVWHLRDLHAPLLVNELKRYYGKAP  381

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             A+V+LC +AGA  P +Y  MM++D
Sbjct  382   AIVELCVQAGAPVPKQYRSMMRLD  405


 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C YCPEV VG  GH +R C   +H+ ++ LH W + ++D ++ P   +HL ++   +
Sbjct  309   VVTCGYCPEVQVGPKGHKVRMCKASKHQHRDGLHAWQEATIDDLIRPNYVWHLRDLHAPL  368

Query  1044  IKHHERFDYSRISAVVELCLQAGA  973
             + +  +  Y +  A+VELC+QAGA
Sbjct  369   LVNELKRYYGKAPAIVELCVQAGA  392


 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 66/130 (51%), Gaps = 7/130 (5%)
 Frame = -1

Query  939  MEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLL---LVYPVKVCKHCSEVHVGP  769
            +EH   + +++P    +  + ++  NA E+L  G+ KL+      PVK C+ CSEVH+G 
Sbjct  96   LEHAPENGLLVP---DLTEVAHQVYNARESLLRGLSKLVNGDAAIPVKRCRFCSEVHIGH  152

Query  768  SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQ-DPPLLLDEGRNYYGHAP  592
             GH+ R C   K  S   IH W +  + D+V     +H   +   P +  + R      P
Sbjct  153  LGHEIRSCEGPKCGSRNSIHVWRRGGIRDVVGFPYCYHLHDRVGKPRVGHKERFGIQRLP  212

Query  591  AVVDLCTKAG  562
            A+V+LC +AG
Sbjct  213  AMVELCIQAG  222



>ref|NP_001031234.1| APO protein 1 [Arabidopsis thaliana]
 gb|AEE34293.1| APO protein 1 [Arabidopsis thaliana]
Length=460

 Score =   178 bits (452),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 140/271 (52%), Gaps = 36/271 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C  V+V   GH IR C G  +  +   H W+KG+++ +LIPVE++H+++ F   
Sbjct  177   VFACSECGAVHVANVGHNIRDCNGPTNSQRRGSHSWVKGTINDVLIPVESYHMYDPFGRR  236

Query  1044  IKHHERFDYSRISAVVELCLQAGA--------------------------------NPND  961
             IKH  RF+Y RI A+VELC+QAG                                  P  
Sbjct  237   IKHETRFEYERIPALVELCIQAGVEIPEYPCRRRTQPIRMMGKRVIDRGGYHKEPEKPQT  296

Query  960   ESIDASKMEHESNSKIV----LPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
              S  +S +       +      P  + +  +  ET++A+E +R GV KL+  + VK C +
Sbjct  297   SSSLSSPLAELDTLGVFERYPPPTPEDIPKIAQETMDAYEKVRLGVTKLMRKFTVKACGY  356

Query  792   CSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGR  613
             CSEVHVGP GH  +LCG FK++     H W+ A VD++ PPN VWH R      L    R
Sbjct  357   CSEVHVGPWGHSVKLCGEFKHQWRDGKHGWQDALVDEVFPPNYVWHVRDLKGNPLTGNLR  416

Query  612   NYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              +YG APA+V++C  +GA  P +Y  MM++D
Sbjct  417   RFYGKAPALVEICMHSGARVPQRYKAMMRLD  447


 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/116 (32%), Positives = 56/116 (48%), Gaps = 1/116 (1%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + ++ ++ W+ L  G+ +LL V PV  C  C  VHV   GH  R C        R  H W
Sbjct  153  VADQVIDNWKLLIKGLAQLLHVVPVFACSECGAVHVANVGHNIRDCNGPTNSQRRGSHSW  212

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFC  535
             K +++D++ P   +H        +  E R  Y   PA+V+LC +AG   P +Y C
Sbjct  213  VKGTINDVLIPVESYHMYDPFGRRIKHETRFEYERIPALVELCIQAGVEIP-EYPC  267



>gb|EYU25371.1| hypothetical protein MIMGU_mgv1a007845mg [Erythranthe guttata]
Length=393

 Score =   175 bits (444),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/269 (36%), Positives = 145/269 (54%), Gaps = 41/269 (15%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C EV+VG+  H I+TC     R K++ H W +G +D+IL  VE+FHL++     + H
Sbjct  116   CSVCREVHVGDPPHKIKTCSV---RGKSKEHAWERGGMDNILPVVESFHLYDRLGRAVSH  172

Query  1035  HERFDYSRISAVVELCLQAGA-NP---------------------------ND---ESID  949
             +ER +  RI A+VELC+QAG  NP                           ND   +SI+
Sbjct  173   NERLEVDRIPALVELCIQAGVENPEYPTRRRDFPVYRVAGKIIDFEKRFPKNDFSGQSIN  232

Query  948   AS------KMEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
             AS      K  +E    ++LP++  ++    + + A+E L +GV K++  Y V+ C +CS
Sbjct  233   ASGFWEMKKRSNEDQEPLILPYND-LKGFAEQGMKAYENLHNGVEKIMKKYAVQTCGYCS  291

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNY  607
             EV VGP GH+ R C  FK++     H W++A++DDL PP  VWH R +    L+D  + Y
Sbjct  292   EVQVGPKGHRVRQCQAFKHQMRGGQHGWQEATIDDLFPPVYVWHVRNKKDSFLIDALKRY  351

Query  606   YGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             YG  PA+V+L  +AGA     Y  MM+ D
Sbjct  352   YGKLPALVELFAQAGATVGEDYRAMMRED  380



>ref|XP_010250523.1| PREDICTED: APO protein 3, mitochondrial [Nelumbo nucifera]
Length=406

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/266 (37%), Positives = 143/266 (54%), Gaps = 34/266 (13%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVIK  1039
             CR+C EV++G+ GH IRTC G R   ++  HVW +G ++ ++   + +HL + + +  I 
Sbjct  128   CRFCSEVHIGDVGHEIRTCTGPRSGFRSATHVWRRGGIEDVVYFPQCYHLQDRVGKPRIG  187

Query  1038  HHERFDYSRISAVVELCLQAGANPNDESIDASK--------------------MEHESNS  919
             H ER    R+ A+VELC+QAG N  D      K                    M  +S  
Sbjct  188   HDERCKVVRLPAIVELCIQAGLNIRDYPTSRRKKPVYCIEGRIVDFESEEELEMLEDSQQ  247

Query  918   KIVLPFDQQ------------MRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
               + P+++                +G  TLN+W  + SG  KL+  Y V  C +C EV V
Sbjct  248   PEIQPWNENDEEKNMGGSNSSSSTVGVRTLNSWFEMISGAKKLMQKYSVWTCGYCPEVQV  307

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGH  598
             GP GHK R+C   K++S   +H W++A++DDLV PN VWH R P   P L ++ + YYG 
Sbjct  308   GPKGHKVRMCRSSKHQSRNGLHAWQEATIDDLVGPNYVWHVRDPHHGPALANDLKRYYGK  367

Query  597   APAVVDLCTKAGAIAPSKYFCMMKVD  520
             APAVV+LC +AGA  P +Y  MM++D
Sbjct  368   APAVVELCVQAGAPVPDEYRSMMRLD  393


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 4/101 (4%)
 Frame = -1

Query  855  ETLRSGVHKLL-LVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDL  679
            E+L  G+  L+ +V PVK C+ CSEVH+G  GH+ R C   +       H W +  ++D+
Sbjct  109  ESLLYGLSMLVDVVVPVKRCRFCSEVHIGDVGHEIRTCTGPRSGFRSATHVWRRGGIEDV  168

Query  678  V--PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
            V  P       R   P +  DE R      PA+V+LC +AG
Sbjct  169  VYFPQCYHLQDRVGKPRIGHDE-RCKVVRLPAIVELCIQAG  208



>gb|EYU46673.1| hypothetical protein MIMGU_mgv1a007863mg [Erythranthe guttata]
Length=393

 Score =   174 bits (441),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 98/269 (36%), Positives = 145/269 (54%), Gaps = 41/269 (15%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C EV+VG+  H I+TC     R K++ H W +G +D+IL  VE+FHL++     + H
Sbjct  116   CSVCREVHVGDPPHEIKTCSV---RGKSKEHAWERGGMDNILPVVESFHLYDRLGRAVSH  172

Query  1035  HERFDYSRISAVVELCLQAGA-NP---------------------------ND---ESID  949
             +ER +  RI A+VELC+QAG  NP                           ND   +SI+
Sbjct  173   NERLEVDRIPALVELCIQAGVENPEYPTRRRDFPIYRVAGKIIDFEKRFPKNDFSGQSIN  232

Query  948   AS------KMEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
             AS      K  +E    ++LP++  ++    + + A+E L  GV K++  Y V+ C +CS
Sbjct  233   ASGFWEMKKRSNEDQEPLILPYND-LKGFAEQGMKAYENLHIGVEKIMKKYAVQTCGYCS  291

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNY  607
             EV VGP GH+ R C  FK++     H W++A++DDL PP  VWH R ++   L+D  + Y
Sbjct  292   EVQVGPKGHRVRQCQAFKHQMRGGQHGWQEATIDDLFPPVYVWHVRNKNDSFLIDALKRY  351

Query  606   YGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             YG  PA+V+L  +AGA     Y  MM+ D
Sbjct  352   YGKLPALVELFAQAGATVGEDYRAMMRED  380



>ref|XP_010663253.1| PREDICTED: APO protein 3, mitochondrial [Vitis vinifera]
 ref|XP_003634299.2| PREDICTED: APO protein 3, mitochondrial [Vitis vinifera]
 ref|XP_010663254.1| PREDICTED: APO protein 3, mitochondrial [Vitis vinifera]
 emb|CBI15128.3| unnamed protein product [Vitis vinifera]
Length=418

 Score =   174 bits (442),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/278 (36%), Positives = 148/278 (53%), Gaps = 46/278 (17%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHL-HNMFQNVIK  1039
             CR+C EV++G  GH IRTC G +   ++  HVW KG ++  +   + FHL   + +  + 
Sbjct  128   CRFCFEVHIGHMGHEIRTCTGPKSGFRSSKHVWRKGRVEDAVYFPKCFHLCDRVGKPRVV  187

Query  1038  HHERFDYSRISAVVELCLQAGAN------------------------PNDE------SID  949
             H ERF+  RI A++ELC+QAG +                        P  E      +++
Sbjct  188   HDERFNIKRIPAILELCIQAGVDLEKYPTKRRARPVYCIEGRIVDFEPETEKDEMRRNVE  247

Query  948   AS-------KMEHESNSKIVLPF--------DQQMRLLGNETLNAWETLRSGVHKLLLVY  814
             AS       +ME  SNS     F        ++ ++ L   TL +W  + SG  K++  Y
Sbjct  248   ASDLGTKTEEMERNSNSHNPSHFLTHSNNGEEKSLKELSTTTLESWFEMISGAKKIMEKY  307

Query  813   PVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPP  634
              VK C +C EV VGP GHK R+C   K++S   +H W++A++DDLV PN VWH + Q+ P
Sbjct  308   SVKTCGYCPEVQVGPKGHKVRMCKASKHQSRNGLHAWQEATIDDLVGPNYVWHVQDQNRP  367

Query  633   LLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              L +  + YYG APAVV+LC + GA  P +Y  MM++D
Sbjct  368   ALDNSLKRYYGKAPAVVELCVQGGASIPDQYRSMMRLD  405


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/109 (34%), Positives = 56/109 (51%), Gaps = 3/109 (3%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            + ++   A ++L  G+ KL+ V PV+ C+ C EVH+G  GH+ R C   K       H W
Sbjct  101  VAHQVYQAQQSLLLGLRKLIDVIPVQRCRFCFEVHIGHMGHEIRTCTGPKSGFRSSKHVW  160

Query  702  EKASVDDLVPPNIVWH--RRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
             K  V+D V     +H   R   P ++ DE  N     PA+++LC +AG
Sbjct  161  RKGRVEDAVYFPKCFHLCDRVGKPRVVHDERFN-IKRIPAILELCIQAG  208



>ref|XP_002975837.1| hypothetical protein SELMODRAFT_104587 [Selaginella moellendorffii]
 gb|EFJ22742.1| hypothetical protein SELMODRAFT_104587 [Selaginella moellendorffii]
Length=382

 Score =   173 bits (439),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/274 (32%), Positives = 137/274 (50%), Gaps = 33/274 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C +++VG +GHLIRTC G    ++   H WIK     +L+P E +H+ +   + I H
Sbjct  105   CSCCKDIHVGASGHLIRTCKGSGCASRRGAHAWIKAYPPDVLVPTECYHILDRLASPIIH  164

Query  1035  HERFDYSRISAVVELCLQAGANPNDESI-------------------------DASKMEH  931
              +RF   R+ A+ ELC+QAG    D  +                             +E 
Sbjct  165   EQRFSVPRLCAITELCIQAGYEHPDYPVVRWARISGRQLETTNREEDEEEEEDQVGGIEE  224

Query  930   ESNS--------KIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHV  775
             E+          ++  P   ++      T+ A+ T+R G+  ++  Y VK C +C E+HV
Sbjct  225   EAQGSEESFLEGRVFDPARDEIVATAERTIEAFHTVRKGIQLMMKKYVVKACGYCPEIHV  284

Query  774   GPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHA  595
             GP GH+ ++CG FK++     H W++A++ D+ PPN VWH      P L  E R YYG A
Sbjct  285   GPRGHRVKICGAFKHQQRDGKHGWQEAALSDIFPPNFVWHVPSGHSPALRPELRRYYGQA  344

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVDGLSAPISDK  493
             PAVV+LC +AGA  P K+   M+ D +   + +K
Sbjct  345   PAVVELCVQAGARVPVKWKPFMRSDVVIPDVEEK  378


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 50/107 (47%), Gaps = 0/107 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E +     L  GV KL+ V PV+ C  C ++HVG SGH  R C      S R  H W
Sbjct  78   VAYEVMKQLGILEEGVKKLMEVVPVQACSCCKDIHVGASGHLIRTCKGSGCASRRGAHAW  137

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
             KA   D++ P   +H   +    ++ E R       A+ +LC +AG
Sbjct  138  IKAYPPDVLVPTECYHILDRLASPIIHEQRFSVPRLCAITELCIQAG  184



>ref|XP_010105597.1| APO protein 3 [Morus notabilis]
 gb|EXC05164.1| APO protein 3 [Morus notabilis]
Length=414

 Score =   174 bits (441),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 102/279 (37%), Positives = 146/279 (52%), Gaps = 44/279 (16%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQN  1048
             L  CRYC EV+VG+ GH IRTC G     ++  HVW KG +  ++   + FHL + + + 
Sbjct  123   LQRCRYCYEVHVGQAGHEIRTCTGPNSGFRSAKHVWRKGGVQDVVFFPKCFHLFDRVGKP  182

Query  1047  VIKHHERFDYSRISAVVELCLQAGAN----PNDE------SIDASKMEHESNSKI-----  913
              + H ER+   RI A++ELC+QAG +    P         SI+    + E  +KI     
Sbjct  183   RVGHDERYAVPRIPAILELCIQAGVDLYKYPTKRRTRPVCSIEGRIADFEVMTKIDEVER  242

Query  912   -----VLPF-----------------------DQQMRLLGNETLNAWETLRSGVHKLLLV  817
                  VL F                        Q +R LG  TL +W  + SGV K++  
Sbjct  243   NSDSSVLGFPEHFVAGTKLGELVDSNLEIDNAGQNLRELGIGTLESWLEMISGVKKIMET  302

Query  816   YPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDP  637
             Y V  C +C EV VGP GHK R+C   K++S   +H W++A+++DL+ PN VWH    + 
Sbjct  303   YTVWTCGYCPEVQVGPKGHKVRMCKASKHQSRNGLHAWQEATIEDLIGPNYVWHVHDPNE  362

Query  636   PLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             P L +  + YYG APAVV+LC +AGA  P +Y  MM++D
Sbjct  363   PALDNNLKRYYGKAPAVVELCVQAGAPVPDQYRSMMRLD  401


 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (51%), Gaps = 6/128 (5%)
 Frame = -1

Query  939  MEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGH  760
            +EH   + +++P   Q+  + ++   A ETL  GV KLL V P++ C++C EVHVG +GH
Sbjct  83   LEHPPENGLLVP---QLVAVAHQVHQARETLLLGVSKLLQVLPLQRCRYCYEVHVGQAGH  139

Query  759  KARLCGVFKYESWRRIHFWEKASVDDLV--PPNIVWHRRPQDPPLLLDEGRNYYGHAPAV  586
            + R C           H W K  V D+V  P       R   P +  DE R      PA+
Sbjct  140  EIRTCTGPNSGFRSAKHVWRKGGVQDVVFFPKCFHLFDRVGKPRVGHDE-RYAVPRIPAI  198

Query  585  VDLCTKAG  562
            ++LC +AG
Sbjct  199  LELCIQAG  206



>ref|XP_008776586.1| PREDICTED: APO protein 3, mitochondrial [Phoenix dactylifera]
Length=418

 Score =   174 bits (440),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/264 (36%), Positives = 144/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMF-QNVIK  1039
             CR+C EV++G  GH IR+C G +  ++N +HVW +G L  ++     +HL++   +  + 
Sbjct  142   CRFCSEVHIGHFGHEIRSCEGPKCGSRNSIHVWRRGGLRDVVGFPYCYHLYDRVGKPRVG  201

Query  1038  HHERFDYSRISAVVELCLQAGAN------------------------PNDESIDASKMEH  931
             H ERF   R+ AVVELC+QAG +                        P ++++   +   
Sbjct  202   HKERFGVQRLPAVVELCIQAGLDLEGYPTKRRTKPVYSIDGRIVDFDPEEQAVAVEETLE  261

Query  930   ESN-----SKIVLPFDQQMRL--LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
               N     S I   F++QM +  L   TL +W  +RSG  KLL  Y V  C +C EV VG
Sbjct  262   SVNQSRRASSIDSIFEEQMTVSELSARTLQSWLEMRSGAMKLLKKYSVVTCGYCPEVQVG  321

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P GHK R+C   K++    +H W++A++ DL+ PN VWH R      L++E + YYG AP
Sbjct  322   PKGHKVRMCKASKHQHRDGLHGWQEATIYDLIRPNYVWHVRDLHGSPLVNELKRYYGKAP  381

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             A+V+LC +AGA  P +Y  MM++D
Sbjct  382   AIVELCVQAGAPVPKQYRSMMRLD  405


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C YCPEV VG  GH +R C   +H+ ++ LH W + ++  ++ P   +H+ ++  + 
Sbjct  309   VVTCGYCPEVQVGPKGHKVRMCKASKHQHRDGLHGWQEATIYDLIRPNYVWHVRDLHGSP  368

Query  1044  IKHHERFDYSRISAVVELCLQAGA  973
             + +  +  Y +  A+VELC+QAGA
Sbjct  369   LVNELKRYYGKAPAIVELCVQAGA  392


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 67/130 (52%), Gaps = 7/130 (5%)
 Frame = -1

Query  939  MEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLL---LVYPVKVCKHCSEVHVGP  769
            +EH   + +++P   ++  + ++  NA E+L  G+ KL+      PVK C+ CSEVH+G 
Sbjct  96   LEHAPENGLLVP---ELIEVAHQVYNARESLLHGLSKLVNGDAAIPVKRCRFCSEVHIGH  152

Query  768  SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQ-DPPLLLDEGRNYYGHAP  592
             GH+ R C   K  S   IH W +  + D+V     +H   +   P +  + R      P
Sbjct  153  FGHEIRSCEGPKCGSRNSIHVWRRGGLRDVVGFPYCYHLYDRVGKPRVGHKERFGVQRLP  212

Query  591  AVVDLCTKAG  562
            AVV+LC +AG
Sbjct  213  AVVELCIQAG  222



>ref|XP_002965760.1| hypothetical protein SELMODRAFT_84056 [Selaginella moellendorffii]
 gb|EFJ33180.1| hypothetical protein SELMODRAFT_84056 [Selaginella moellendorffii]
Length=388

 Score =   173 bits (438),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/280 (33%), Positives = 136/280 (49%), Gaps = 39/280 (14%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C +++VG +GHLIRTC G    ++   H WIK     +L+P E +H+ +   + I H
Sbjct  105   CSCCKDIHVGASGHLIRTCKGSGCASRRGAHAWIKAYPPDVLVPTECYHILDRLASPIIH  164

Query  1035  HERFDYSRISAVVELCLQAGAN------------------------------------PN  964
              +RF   R+ A+ ELC+QAG                                      P 
Sbjct  165   EQRFSVPRLCAITELCIQAGYEHPDYPVVRWARISGRQVGSGRAQVAESRLLKPYTGFPG  224

Query  963   DESIDASKMEHESNSKIVLPFD---QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
             D    A + +     +    FD    ++      T+ A+ T+R GV  ++  Y VK C +
Sbjct  225   DSGHTAGRKDSTKEGRFGRVFDPARDEIVATAERTIEAFHTVRKGVQLMMKKYVVKACGY  284

Query  792   CSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGR  613
             C E+HVGP GH+ ++CG FK++     H W++A++ D+ PPN VWH      P L  E R
Sbjct  285   CPEIHVGPRGHRVKICGAFKHQQRDGKHGWQEAALSDIFPPNFVWHVPSGHSPALRPELR  344

Query  612   NYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAPISDK  493
              YYG APAVV+LC +AGA  P K+   M+ D +   + +K
Sbjct  345   RYYGQAPAVVELCVQAGARVPVKWKPFMRSDVVIPDVEEK  384


 Score = 58.5 bits (140),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 50/107 (47%), Gaps = 0/107 (0%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +  E +     L  GV KL+ V PV+ C  C ++HVG SGH  R C      S R  H W
Sbjct  78   VAYEVMKQLGILEEGVKKLMEVVPVQACSCCKDIHVGASGHLIRTCKGSGCASRRGAHAW  137

Query  702  EKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
             KA   D++ P   +H   +    ++ E R       A+ +LC +AG
Sbjct  138  IKAYPPDVLVPTECYHILDRLASPIIHEQRFSVPRLCAITELCIQAG  184



>ref|XP_009415009.1| PREDICTED: APO protein 3, mitochondrial [Musa acuminata subsp. 
malaccensis]
Length=414

 Score =   173 bits (439),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/266 (36%), Positives = 148/266 (56%), Gaps = 33/266 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVI  1042
              CR+C EV++G+ GH IR+C G +  +++  HVW +G +  ++     +HL++ + +  +
Sbjct  136   KCRFCTEVHIGQLGHEIRSCEGPKCGSRSSNHVWGRGGIRDVVGFPYCYHLYDRVGKPRV  195

Query  1041  KHHERFDYSRISAVVELCLQAGANPNDE----------SIDASKMEHE------------  928
              H ERF   R+ A+VELC+QAG +  D           SI+   ++ E            
Sbjct  196   GHKERFGVKRLPAIVELCIQAGLHLEDYPTKRRTKPVYSIEGRIVDFEPEEDKNAFTGNN  255

Query  927   -SNSKIVLPF---DQQMRLLGN------ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVH  778
               +++ VLP      ++ + G        TL +W  +RSG  KL+  Y V  C +C EV 
Sbjct  256   FDSAREVLPIILDGDRLDVAGTISEFSARTLQSWLDMRSGATKLMKKYSVITCGYCPEVQ  315

Query  777   VGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGH  598
             VGP GHK R+C   K++    +H W++A++DDL+ PN VWH R  D P L +E + YYG 
Sbjct  316   VGPKGHKVRMCKATKHQFRAGLHAWQEATIDDLIRPNYVWHVRDLDGPPLANELKRYYGK  375

Query  597   APAVVDLCTKAGAIAPSKYFCMMKVD  520
             APA+V+LC +AGA  P +Y  MM++D
Sbjct  376   APAIVELCVQAGAPVPKEYRSMMRLD  401


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             ++ C YCPEV VG  GH +R C   +H+ +  LH W + ++D ++ P   +H+ ++    
Sbjct  305   VITCGYCPEVQVGPKGHKVRMCKATKHQFRAGLHAWQEATIDDLIRPNYVWHVRDLDGPP  364

Query  1044  IKHHERFDYSRISAVVELCLQAGA  973
             + +  +  Y +  A+VELC+QAGA
Sbjct  365   LANELKRYYGKAPAIVELCVQAGA  388


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 65/138 (47%), Gaps = 23/138 (17%)
 Frame = -1

Query  939  MEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLL---LVYPVKVCKHCSEVHVGP  769
            +EH   + +++P    +  + ++  NA E+L  G+ KL+       VK C+ C+EVH+G 
Sbjct  91   LEHAPENGLLVP---DLIEVAHQVYNARESLLHGLSKLVDGEEAITVKKCRFCTEVHIGQ  147

Query  768  SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDE-GRNYYGHA-  595
             GH+ R C   K  S    H W +  + D+V     +H        L D  G+   GH  
Sbjct  148  LGHEIRSCEGPKCGSRSSNHVWGRGGIRDVVGFPYCYH--------LYDRVGKPRVGHKE  199

Query  594  -------PAVVDLCTKAG  562
                   PA+V+LC +AG
Sbjct  200  RFGVKRLPAIVELCIQAG  217



>ref|XP_011083835.1| PREDICTED: APO protein 1, chloroplastic isoform X2 [Sesamum indicum]
Length=365

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 142/265 (54%), Gaps = 38/265 (14%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C E++V + GH I+ C G    ++   H W+KGS++ +L+P+E++H+++ F   IKH
Sbjct  93    CSECSEIHVAQKGHDIQDCRGPTSGSRKSFHSWVKGSINDVLLPIESYHMYDPFGRRIKH  152

Query  1035  HER--------------------------------FDYSRISAVVELCLQAGANPNDESI  952
               R                                 D        E+C  +G+      +
Sbjct  153   ETRXXXXLCIQAGVELPEYPSRRRTEPIRMIGKKVIDIGGFVEEPEICCPSGSGSQIMEL  212

Query  951   DASKMEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
             D     H++  +   P +  + ++  +T+NA+E ++ GV KL+  Y VK C +CSEVHVG
Sbjct  213   DT----HQALGRFPPPKESDVPMIAQQTVNAYEKVKWGVTKLMKKYSVKACGYCSEVHVG  268

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGHA  595
             P GH A+LCG FK++     H W+ A+VD++ PPN VWH + P+ PP L    +++YG A
Sbjct  269   PWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVKDPKGPP-LTSALKSFYGKA  327

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV++C +AGA  P+KY  MM+ D
Sbjct  328   PAVVEVCIQAGARVPNKYKPMMRDD  352


 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 59/114 (52%), Gaps = 8/114 (7%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     +  
Sbjct  259   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVKDPKGPPLTS  318

Query  1035  HERFDYSRISAVVELCLQAGAN-PNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA  PN       K +      IV+P D++ RL+ 
Sbjct  319   ALKSFYGKAPAVVEVCIQAGARVPN-------KYKPMMRDDIVVPEDEEARLVA  365


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 50/109 (46%), Gaps = 7/109 (6%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW+ L  G+ ++L V PV  C  CSE+HV   GH  + C      S +  H W K 
Sbjct  69   EVLDAWKVLIGGLAQILHVVPVHACSECSEIHVAQKGHDIQDCRGPTSGSRKSFHSWVKG  128

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPS  547
            S++D++ P   +H    DP      GR           LC +AG   P 
Sbjct  129  SINDVLLPIESYHM--YDP-----FGRRIKHETRXXXXLCIQAGVELPE  170



>ref|XP_009112004.1| PREDICTED: APO protein 3, mitochondrial [Brassica rapa]
Length=399

 Score =   172 bits (436),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 144/259 (56%), Gaps = 27/259 (10%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVIK  1039
             CR+C EV++G+ GH IRTC G     ++  HVW +G    +++  + FHL++   +  + 
Sbjct  128   CRFCSEVHIGKEGHGIRTCTGSGSGLRSATHVWKRGRASDVVLFPKCFHLYDRAVKPRVI  187

Query  1038  HHERFDYSRISAVVELCLQAGAN----PNDE------SIDASKMEHE------SNSKIVL  907
             H ERF   +ISAV+ELC+QAG +    P         SI+   ++ E      S + +  
Sbjct  188   HDERFTVPKISAVLELCIQAGVDLEKFPAKRRSKPVYSIEGRIVDFEGVNNGNSETAVTT  247

Query  906   PFDQ----------QMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHK  757
             P  +           ++ L  ET+++W  + +GV KL+  Y V  C +C E+ VGP GHK
Sbjct  248   PLQEDNLCMSAEKKSLKELSIETMDSWFEMVTGVKKLMERYKVWTCGYCPEIQVGPKGHK  307

Query  756   ARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDL  577
              ++C   K++    +H W++A++DD+V PN VWH R  D   L +  + +YG APAVV+L
Sbjct  308   VKMCKATKHQMRDGMHAWQEATIDDVVGPNYVWHVRDPDSSALDNSLQRFYGKAPAVVEL  367

Query  576   CTKAGAIAPSKYFCMMKVD  520
             C + GA  P +Y  MM++D
Sbjct  368   CVQGGAQVPDQYKSMMRLD  386



>gb|KHG05029.1| APO 3, mitochondrial -like protein [Gossypium arboreum]
Length=413

 Score =   171 bits (434),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 94/273 (34%), Positives = 145/273 (53%), Gaps = 44/273 (16%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVIK  1039
             CR+C EV++G  GH IRTC G +  +++  HVW KG +  ++   + FHL++ + ++ + 
Sbjct  131   CRFCYEVHIGNVGHEIRTCTGPKSGSRSATHVWRKGGVGDVIFFPKCFHLYDRVGKSRVV  190

Query  1038  HHERFDYSRISAVVELCLQAG---------------------------------------  976
             H ER    RI A++ELC+QAG                                       
Sbjct  191   HDERHSAPRIPAILELCIQAGVDVENYPSKRRTKPVYSIEGRIVDFESVAGVDEMETNLS  250

Query  975   -ANPNDESIDASKMEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVC  799
               N +D  +D   +  + NS++    D  +  L   TL++W  +  GV K++  Y V  C
Sbjct  251   FGNADDTEVDV--LRRDPNSELNAE-DTNLIELSTRTLDSWFEMIGGVRKIMEKYNVWTC  307

Query  798   KHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDE  619
              +C EV VGP GHK R+C   K++S   +H W++A+++DLV PN VWH R  + P L ++
Sbjct  308   GYCPEVQVGPKGHKVRMCRASKHQSRNGLHAWQEATINDLVGPNYVWHVRDLNSPPLRND  367

Query  618   GRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              + YYG APAVV+LC +AGA  P +Y  MM++D
Sbjct  368   LKRYYGKAPAVVELCVQAGAPVPDQYRSMMRLD  400


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 65/128 (51%), Gaps = 6/128 (5%)
 Frame = -1

Query  939  MEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGH  760
            +EH   + +++P   ++  + +    A E + SG+ KLL   PV+ C+ C EVH+G  GH
Sbjct  88   LEHPPANGLLVP---ELVDVAHRVYRARELILSGLSKLLQFIPVQRCRFCYEVHIGNVGH  144

Query  759  KARLCGVFKYESWRRIHFWEKASVDDLV--PPNIVWHRRPQDPPLLLDEGRNYYGHAPAV  586
            + R C   K  S    H W K  V D++  P     + R     ++ DE R+     PA+
Sbjct  145  EIRTCTGPKSGSRSATHVWRKGGVGDVIFFPKCFHLYDRVGKSRVVHDE-RHSAPRIPAI  203

Query  585  VDLCTKAG  562
            ++LC +AG
Sbjct  204  LELCIQAG  211



>ref|XP_006394451.1| hypothetical protein EUTSA_v10004339mg [Eutrema salsugineum]
 gb|ESQ31737.1| hypothetical protein EUTSA_v10004339mg [Eutrema salsugineum]
Length=403

 Score =   171 bits (433),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 141/269 (52%), Gaps = 43/269 (16%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVI  1042
              CR+C EV++G+ GH IRTC G    +++  HVW KG    +++  ++FHL++   +  +
Sbjct  129   RCRFCSEVHIGKEGHEIRTCTGSGSGSRSATHVWKKGRASDVVLFPKSFHLYDRAVKPRV  188

Query  1041  KHHERFDYSRISAVVELCLQAGANPNDESIDASKMEHESNSKIVLPFD------------  898
              H ERF   +ISAV+ELCLQAG       +D  K   +  SK V   +            
Sbjct  189   THDERFTVPKISAVLELCLQAG-------VDLEKFPSKRRSKPVYSIEGRIVDFEEVDGN  241

Query  897   -----------------------QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCS  787
                                    + ++ L  + + +W  + SGV +L+  Y V  C +C 
Sbjct  242   PETAVTTTTTVHLQEDDRCNADKKSLKELSIQMMESWFEMVSGVRELMERYKVWTCGYCP  301

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNY  607
             E+ VGP GHK R+C   K++    +H W++A++DD+V PN VWH R  D   L +  + +
Sbjct  302   EIQVGPKGHKVRMCKATKHQMRDGMHAWQEATIDDVVGPNYVWHVRDPDGSALDNSLQRF  361

Query  606   YGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             YG APAVV+LC +AGA  P +Y  MM++D
Sbjct  362   YGKAPAVVELCVQAGAPVPDQYKSMMRLD  390


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 50/99 (51%), Gaps = 3/99 (3%)
 Frame = -1

Query  852  TLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLV-  676
            +L SG+ K++   PV  C+ CSEVH+G  GH+ R C      S    H W+K    D+V 
Sbjct  113  SLLSGLSKIIHQIPVHRCRFCSEVHIGKEGHEIRTCTGSGSGSRSATHVWKKGRASDVVL  172

Query  675  -PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
             P +   + R   P +  DE R       AV++LC +AG
Sbjct  173  FPKSFHLYDRAVKPRVTHDE-RFTVPKISAVLELCLQAG  210



>ref|XP_003518320.1| PREDICTED: APO protein 3, mitochondrial-like [Glycine max]
Length=427

 Score =   171 bits (434),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 99/292 (34%), Positives = 150/292 (51%), Gaps = 54/292 (18%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMF-QN  1048
             +L CR C EV++G  GH IRTC G    ++N +HVW +G +  ++   + FHL++   + 
Sbjct  126   VLRCRLCNEVHIGYIGHEIRTCTGPESFSRNAMHVWTRGGVQDVVFFPKCFHLYDRVGKP  185

Query  1047  VIKHHERFDYSRISAVVELCLQAGAN----PND----------------ESI---DASKM  937
              + H ERF   RI A+VELC+QAG +    P                  ES+   D ++ 
Sbjct  186   RVGHDERFSVPRIPAIVELCIQAGLDLEKYPTKRRTKPVYCIEGRIVDFESVVKEDETER  245

Query  936   EH---------ESNSKIVLPFDQ---------------------QMRLLGNETLNAWETL  847
             +H          S+S +  P ++                     ++R L   TL++W  +
Sbjct  246   QHFFENDKPFVNSSSMLTQPIEKVQILLENNISHLDQLSDEERNKLRDLSKHTLDSWIEM  305

Query  846   RSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPN  667
              SG  K++  Y V  C +C EV VGP GHK R+C   K++S   +H W++A++DDLV PN
Sbjct  306   TSGAKKIMEKYTVNTCGYCPEVQVGPKGHKLRMCKASKHQSRNGLHAWQEATLDDLVIPN  365

Query  666   IVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
              VWH    + P L +  + YYG APAVV+LC  +G   P +Y  MM++D +S
Sbjct  366   YVWHVEDLNGPALNNNLKRYYGKAPAVVELCVHSGTPVPDQYSSMMRLDVVS  417


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 54/109 (50%), Gaps = 3/109 (3%)
 Frame = -1

Query  882  LGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFW  703
            +      A  +L  G+ +L+ V PV  C+ C+EVH+G  GH+ R C   +  S   +H W
Sbjct  102  VARRVYQARGSLLFGLSQLVRVIPVLRCRLCNEVHIGYIGHEIRTCTGPESFSRNAMHVW  161

Query  702  EKASVDDLV--PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
             +  V D+V  P     + R   P +  DE R      PA+V+LC +AG
Sbjct  162  TRGGVQDVVFFPKCFHLYDRVGKPRVGHDE-RFSVPRIPAIVELCIQAG  209



>ref|XP_011083834.1| PREDICTED: APO protein 1, chloroplastic isoform X1 [Sesamum indicum]
Length=437

 Score =   171 bits (434),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 90/265 (34%), Positives = 142/265 (54%), Gaps = 38/265 (14%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C  C E++V + GH I+ C G    ++   H W+KGS++ +L+P+E++H+++ F   IKH
Sbjct  165   CSECSEIHVAQKGHDIQDCRGPTSGSRKSFHSWVKGSINDVLLPIESYHMYDPFGRRIKH  224

Query  1035  HER--------------------------------FDYSRISAVVELCLQAGANPNDESI  952
               R                                 D        E+C  +G+      +
Sbjct  225   ETRXXXXLCIQAGVELPEYPSRRRTEPIRMIGKKVIDIGGFVEEPEICCPSGSGSQIMEL  284

Query  951   DASKMEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
             D     H++  +   P +  + ++  +T+NA+E ++ GV KL+  Y VK C +CSEVHVG
Sbjct  285   DT----HQALGRFPPPKESDVPMIAQQTVNAYEKVKWGVTKLMKKYSVKACGYCSEVHVG  340

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGHA  595
             P GH A+LCG FK++     H W+ A+VD++ PPN VWH + P+ PP L    +++YG A
Sbjct  341   PWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVKDPKGPP-LTSALKSFYGKA  399

Query  594   PAVVDLCTKAGAIAPSKYFCMMKVD  520
             PAVV++C +AGA  P+KY  MM+ D
Sbjct  400   PAVVEVCIQAGARVPNKYKPMMRDD  424


 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/114 (32%), Positives = 59/114 (52%), Gaps = 8/114 (7%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             C YC EV+VG  GH  + CG ++H+ ++  H W   ++D +  P   +H+ +     +  
Sbjct  331   CGYCSEVHVGPWGHNAKLCGEFKHQWRDGKHGWQDATVDEVFPPNYVWHVKDPKGPPLTS  390

Query  1035  HERFDYSRISAVVELCLQAGAN-PNDESIDASKMEHESNSKIVLPFDQQMRLLG  877
               +  Y +  AVVE+C+QAGA  PN       K +      IV+P D++ RL+ 
Sbjct  391   ALKSFYGKAPAVVEVCIQAGARVPN-------KYKPMMRDDIVVPEDEEARLVA  437


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 50/108 (46%), Gaps = 7/108 (6%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E L+AW+ L  G+ ++L V PV  C  CSE+HV   GH  + C      S +  H W K 
Sbjct  141  EVLDAWKVLIGGLAQILHVVPVHACSECSEIHVAQKGHDIQDCRGPTSGSRKSFHSWVKG  200

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAP  550
            S++D++ P   +H    DP      GR           LC +AG   P
Sbjct  201  SINDVLLPIESYHM--YDP-----FGRRIKHETRXXXXLCIQAGVELP  241



>ref|XP_010457964.1| PREDICTED: APO protein 3, mitochondrial-like [Camelina sativa]
Length=401

 Score =   170 bits (431),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 94/261 (36%), Positives = 147/261 (56%), Gaps = 28/261 (11%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVI  1042
              CR C EV++G+ GH IRTC G    +++  HVW +G +  +++  ++FHL++   +  +
Sbjct  128   RCRCCSEVHIGKEGHEIRTCTGPGSGSRSATHVWKRGRVSDVVLFPKSFHLYDRAVKPRV  187

Query  1041  KHHERFDYSRISAVVELCLQAGAN----PNDE------SIDASKMEHESNSK--------  916
              H ERF   +ISAV+ELC+QAG +    P+        SI+   ++ E  S         
Sbjct  188   IHDERFTVPKISAVLELCIQAGVDLEKFPSKRRSKPVYSIEGRIVDFEEVSDGSSETAVA  247

Query  915   IVLPFD--------QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGH  760
             +VL  D        + ++ L  ET+ +W  +  GV KL+  Y V  C +C E+ VGP GH
Sbjct  248   VVLQEDDRCKVEEKKSLKELSIETMESWFEMVLGVRKLMERYKVWTCGYCPEIQVGPKGH  307

Query  759   KARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGHAPAVV  583
             K R+C   K++    +H W++A++DD+V PN VWH R P D  +L +    +YG APAVV
Sbjct  308   KVRMCKATKHQMRDGMHAWQEATIDDVVGPNYVWHVRDPTDGSVLDNSLTRFYGKAPAVV  367

Query  582   DLCTKAGAIAPSKYFCMMKVD  520
              +C + GA+ P +Y  MM++D
Sbjct  368   QMCVQGGALVPDQYKSMMRLD  388


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 3/100 (3%)
 Frame = -1

Query  852  TLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLV-  676
            +L SG+ K++   PV  C+ CSEVH+G  GH+ R C      S    H W++  V D+V 
Sbjct  112  SLLSGLSKIIPHVPVHRCRCCSEVHIGKEGHEIRTCTGPGSGSRSATHVWKRGRVSDVVL  171

Query  675  -PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
             P +   + R   P ++ DE R       AV++LC +AG 
Sbjct  172  FPKSFHLYDRAVKPRVIHDE-RFTVPKISAVLELCIQAGV  210



>gb|KGN49647.1| hypothetical protein Csa_5G044010 [Cucumis sativus]
Length=429

 Score =   170 bits (431),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 149/296 (50%), Gaps = 53/296 (18%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQN  1048
             +  CR+C EV++G  GH IRTC G +   ++  H+W KG +  ++   + +HL++ + + 
Sbjct  130   IQRCRFCFEVHIGHVGHEIRTCTGEKSGFRSATHIWRKGRVQDVVFFPKCYHLYDRVVKP  189

Query  1047  VIKHHERFDYSRISAVVELCLQAGAN----------------------------------  970
              + H ER D  RI A++ELC+QAG +                                  
Sbjct  190   RVGHDERHDIPRIPAILELCIQAGVDLEKYPSKRRTKPVYNIEGRIVDFESVKEMNEVKT  249

Query  969   -----------PNDESIDASKMEHESNSKIVLPFDQQ------MRLLGNETLNAWETLRS  841
                         +D  I+       S  K     DQQ      +R L  +TL++W  + S
Sbjct  250   GVSTKISDNFVKSDFGIELEGTSKSSLEKFSNTLDQQYEVDTEVRQLSIQTLDSWLEMVS  309

Query  840   GVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIV  661
             G  K++  Y V+ C +C EV VGP GHK R+C   K++S   +H W++A++DDLV PN V
Sbjct  310   GAKKIMEKYMVQTCGYCPEVQVGPKGHKVRMCRASKHQSRNGLHAWQEATIDDLVGPNYV  369

Query  660   WHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAPISDK  493
             WH R    P L ++ + YYG  PAVV+LC +AGA  P +Y  MM++D +  P SD+
Sbjct  370   WHGRDLKAPPLDNKLKRYYGKVPAVVELCVQAGAPIPDQYRSMMRLD-VVCPDSDE  424


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 52/103 (50%), Gaps = 3/103 (3%)
 Frame = -1

Query  861  AWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDD  682
            AW+ L  G+ +LL   P++ C+ C EVH+G  GH+ R C   K       H W K  V D
Sbjct  113  AWKMLHFGISRLLKAVPIQRCRFCFEVHIGHVGHEIRTCTGEKSGFRSATHIWRKGRVQD  172

Query  681  LV--PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            +V  P     + R   P +  DE R+     PA+++LC +AG 
Sbjct  173  VVFFPKCYHLYDRVVKPRVGHDE-RHDIPRIPAILELCIQAGV  214



>gb|KFK27935.1| hypothetical protein AALP_AA8G450000 [Arabis alpina]
Length=404

 Score =   169 bits (429),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/260 (34%), Positives = 144/260 (55%), Gaps = 28/260 (11%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVIK  1039
             CR+C EV++G+ GH IRTC G    +++  HVW +G    +++ ++ FHL++   +  + 
Sbjct  132   CRFCSEVHIGKEGHEIRTCIGPGSGSRSATHVWKRGRASDVVVFLKCFHLYDRAVKPRVI  191

Query  1038  HHERFDYSRISAVVELCLQAGAN----PND----------------ESIDASKMEHESNS  919
             H ERF   +ISAV+ELC+QAG +    P+                 E ++    E     
Sbjct  192   HDERFSVPKISAVLELCIQAGVDIEKFPSKRRSKPVYSIEGRIVDFEDVNNGSSETAVTI  251

Query  918   KIVLPFD-------QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGH  760
               VL  D       + ++ L  +T+ +W  + +GV KL+  Y V  C +C E+ VGP GH
Sbjct  252   ATVLQEDDCCNTEKKSLKELSIKTMESWFEMVTGVRKLMERYKVWTCGYCPEIQVGPKGH  311

Query  759   KARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVD  580
             K ++C   K++    +H W++A+VDD++ PN VWH R  D  +L +  + +YG APAVV+
Sbjct  312   KVKMCKATKHQMRDGMHAWQEATVDDVIGPNYVWHVRDPDSSVLDNSLQRFYGKAPAVVE  371

Query  579   LCTKAGAIAPSKYFCMMKVD  520
             LC + GA  P ++  MM++D
Sbjct  372   LCVQGGAPVPDQHKSMMRLD  391



>ref|XP_004142282.1| PREDICTED: APO protein 3, mitochondrial-like [Cucumis sativus]
Length=483

 Score =   170 bits (431),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 148/293 (51%), Gaps = 53/293 (18%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVIK  1039
             CR+C EV++G  GH IRTC G +   ++  H+W KG +  ++   + +HL++ + +  + 
Sbjct  187   CRFCFEVHIGHVGHEIRTCTGEKSGFRSATHIWRKGRVQDVVFFPKCYHLYDRVVKPRVG  246

Query  1038  HHERFDYSRISAVVELCLQAGAN-------------------------------------  970
             H ER D  RI A++ELC+QAG +                                     
Sbjct  247   HDERHDIPRIPAILELCIQAGVDLEKYPSKRRTKPVYNIEGRIVDFESVKEMNEVKTGVS  306

Query  969   --------PNDESIDASKMEHESNSKIVLPFDQQ------MRLLGNETLNAWETLRSGVH  832
                      +D  I+       S  K     DQQ      +R L  +TL++W  + SG  
Sbjct  307   TKISDNFVKSDFGIELEGTSKSSLEKFSNTLDQQYEVDTEVRQLSIQTLDSWLEMVSGAK  366

Query  831   KLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHR  652
             K++  Y V+ C +C EV VGP GHK R+C   K++S   +H W++A++DDLV PN VWH 
Sbjct  367   KIMEKYMVQTCGYCPEVQVGPKGHKVRMCRASKHQSRNGLHAWQEATIDDLVGPNYVWHG  426

Query  651   RPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLSAPISDK  493
             R    P L ++ + YYG  PAVV+LC +AGA  P +Y  MM++D +  P SD+
Sbjct  427   RDLKAPPLDNKLKRYYGKVPAVVELCVQAGAPIPDQYRSMMRLD-VVCPDSDE  478


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 52/103 (50%), Gaps = 3/103 (3%)
 Frame = -1

Query  861  AWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDD  682
            AW+ L  G+ +LL   P++ C+ C EVH+G  GH+ R C   K       H W K  V D
Sbjct  167  AWKMLHFGISRLLKAVPIQRCRFCFEVHIGHVGHEIRTCTGEKSGFRSATHIWRKGRVQD  226

Query  681  LV--PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            +V  P     + R   P +  DE R+     PA+++LC +AG 
Sbjct  227  VVFFPKCYHLYDRVVKPRVGHDE-RHDIPRIPAILELCIQAGV  268



>ref|XP_004490634.1| PREDICTED: APO protein 3, mitochondrial-like isoform X1 [Cicer 
arietinum]
Length=418

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/284 (34%), Positives = 143/284 (50%), Gaps = 46/284 (16%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMF-QN  1048
             +L C  C EV++G  GH IRTC G    ++N  HVW +G +  ++   + FHL++   + 
Sbjct  125   ILRCELCNEVHIGYVGHEIRTCTGPNSFSRNATHVWRRGGIRDVVCFPKCFHLYDRVGKP  184

Query  1047  VIKHHERFDYSRISAVVELCLQAGAN--------------------------------PN  964
              + H ERF   RI A+VELC+QAG +                                  
Sbjct  185   RVGHDERFSVPRIPAIVELCIQAGLDLEKYPTKRRTKPVYCIEGRIADFESVVEEDESER  244

Query  963   DESIDASKMEHESNSKIVLPFDQ-------------QMRLLGNETLNAWETLRSGVHKLL  823
               S++      + +S ++ P +              ++R+L   TLN+W  + SG  K++
Sbjct  245   KPSLENFNPLMDPSSMLIEPVENISHIDELKDEERNKLRILSEHTLNSWFEMTSGAKKIM  304

Query  822   LVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQ  643
               Y V  C +C EV VGP GHK R+C   K++S   +H W++A +DDLV PN VWH    
Sbjct  305   EKYVVNTCGYCPEVQVGPKGHKLRMCKASKHQSRNGLHAWQEAILDDLVGPNYVWHVEDL  364

Query  642   DPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVDGLS  511
             + P L +  + YYG APAVV+LC  AGA  P +Y  MM++D +S
Sbjct  365   NGPALNNNLKRYYGKAPAVVELCVHAGAPVPDQYRSMMRLDVVS  408


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 50/98 (51%), Gaps = 3/98 (3%)
 Frame = -1

Query  849  LRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLV--  676
            L SG+ +L+ V P+  C+ C+EVH+G  GH+ R C      S    H W +  + D+V  
Sbjct  112  LLSGLRQLVRVIPILRCELCNEVHIGYVGHEIRTCTGPNSFSRNATHVWRRGGIRDVVCF  171

Query  675  PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAG  562
            P     + R   P +  DE R      PA+V+LC +AG
Sbjct  172  PKCFHLYDRVGKPRVGHDE-RFSVPRIPAIVELCIQAG  208



>ref|XP_006418818.1| hypothetical protein EUTSA_v10002534mg [Eutrema salsugineum]
 gb|ESQ37254.1| hypothetical protein EUTSA_v10002534mg [Eutrema salsugineum]
Length=434

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 140/271 (52%), Gaps = 36/271 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNV  1045
             +  C  C  V+V   GH I+ C G ++  +   H+W+KG+++ +L PVE++H+++ F   
Sbjct  151   VFACSECGAVHVANAGHNIKDCNGPKNSQRRGSHLWVKGTINDVLSPVESYHMYDPFGRR  210

Query  1044  IKHHERFDYSRISAVVELCLQAGANPND---------------ESIDASKMEHESN----  922
             IKH  RFDY RI AVVELC+QAG    +                 ID      E N    
Sbjct  211   IKHENRFDYERIPAVVELCVQAGVEIPEYPCRRRTQPVRMIGKRVIDRGGYVKEPNKPCS  270

Query  921   -----------------SKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
                               +   P  +++  +  ET++A+E +R GV +L+  + VK C +
Sbjct  271   STSLSSPLSDLDTLGACERYPPPKPEEIPKIAQETMDAYEKVRWGVTRLMREFTVKACGY  330

Query  792   CSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGR  613
             CSEVHVGP GH  +LCG FK++     H W+ A V++L PPN VWH R      L    +
Sbjct  331   CSEVHVGPWGHSVKLCGEFKHQWRDGKHGWQDALVEELFPPNYVWHVRDLKGNPLTGNLK  390

Query  612   NYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
              +YG APA V++C  +GA  P  Y  MM++D
Sbjct  391   RFYGKAPACVEICMHSGARVPQCYKAMMRLD  421


 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 56/113 (50%), Gaps = 1/113 (1%)
 Frame = -1

Query  873  ETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKA  694
            E ++ W+ L  G+ +LL V PV  C  C  VHV  +GH  + C   K    R  H W K 
Sbjct  130  EVIDNWKLLIKGLAQLLHVVPVFACSECGAVHVANAGHNIKDCNGPKNSQRRGSHLWVKG  189

Query  693  SVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGAIAPSKYFC  535
            +++D++ P   +H        +  E R  Y   PAVV+LC +AG   P +Y C
Sbjct  190  TINDVLSPVESYHMYDPFGRRIKHENRFDYERIPAVVELCVQAGVEIP-EYPC  241



>emb|CDX87228.1| BnaC09g05430D [Brassica napus]
Length=406

 Score =   168 bits (426),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/263 (35%), Positives = 146/263 (56%), Gaps = 31/263 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVIK  1039
             CR+C EV++G+ GH IRTC G    +++  HVW KG    +++  + FHL++   +  + 
Sbjct  131   CRFCSEVHIGKEGHGIRTCTGPGSGSRSATHVWNKGRASDVVLFPKCFHLYDRAVKPRVI  190

Query  1038  HHERFDYSRISAVVELCLQAGAN----PNDE------SIDASKMEHES----NSKIVL--  907
             H ERF   RISAV+ELC+QAG +    P         SI+   ++ E     NS+  +  
Sbjct  191   HDERFTVPRISAVLELCIQAGVDLEKFPAKRRAKPVYSIEGRIVDFEEVNNRNSETAVTS  250

Query  906   -----PFDQ---------QMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGP  769
                  P  +          ++ L  +T+++W  + +GV +L+  Y V  C +C EV VGP
Sbjct  251   VSTATPLQEDDHYSTEKKSLKELSVKTMDSWFEMVTGVKELMEKYKVWTCGYCPEVQVGP  310

Query  768   SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAPA  589
              GHK ++C   K++    +H W++A++DD+V PN VWH R  D   L +  + +YG APA
Sbjct  311   KGHKVKMCKATKHQMRDGMHAWQEATIDDVVGPNYVWHVRDPDSSALDNSLQRFYGKAPA  370

Query  588   VVDLCTKAGAIAPSKYFCMMKVD  520
             VV+LC + GA  P +Y  MM++D
Sbjct  371   VVELCVQGGAPVPDQYKSMMRLD  393



>emb|CDY16799.1| BnaA09g05830D [Brassica napus]
Length=413

 Score =   168 bits (426),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 89/264 (34%), Positives = 145/264 (55%), Gaps = 32/264 (12%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVIK  1039
             CR+C EV++G+ GH IRTC G    +++  HVW +G    +++  + FHL++   +  + 
Sbjct  137   CRFCSEVHIGKEGHGIRTCIGPGSGSRSATHVWKRGRASDVVLFPKCFHLYDRAVKPRVI  196

Query  1038  HHERFDYSRISAVVELCLQAGANPND----------ESIDASKMEHE------------S  925
             H ERF   +ISAV+ELC+QAG + +            SI+   ++ E            +
Sbjct  197   HDERFAVPKISAVLELCIQAGVDIDKFPAKRRSKPVYSIEGRIVDFEEVNNGNSETAVTN  256

Query  924   NSKIVLPFDQ---------QMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVG  772
             ++    P  +          ++ L  ET+++W  + +GV KL+  Y V  C +C E+ VG
Sbjct  257   STTTATPLQEDYHYSTEKKSLKELSVETMDSWFEMVTGVKKLMERYKVWTCGYCPEIQVG  316

Query  771   PSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPPLLLDEGRNYYGHAP  592
             P GHK ++C   K++    +H W++A++DD+V PN VWH R  D   L +  + +YG AP
Sbjct  317   PKGHKVKMCKATKHQMRDGMHAWQEATIDDVVGPNYVWHVRDPDSSALDNSLQRFYGKAP  376

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV+LC + GA  P +Y  MM++D
Sbjct  377   AVVELCVQGGAPVPDQYKSMMRLD  400



>ref|XP_010483880.1| PREDICTED: APO protein 3, mitochondrial [Camelina sativa]
Length=404

 Score =   168 bits (425),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 145/264 (55%), Gaps = 31/264 (12%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVI  1042
              CR C EV++G+ GH IRTC G    +++  HVW +G +  +++  ++FHL++   +  +
Sbjct  128   RCRCCSEVHIGKEGHEIRTCTGPGSGSRSATHVWKRGRVSDVVLFPKSFHLYDRAVKPRV  187

Query  1041  KHHERFDYSRISAVVELCLQAG----------------------------ANPNDESIDA  946
              H ERF   +ISAV+ELC+QAG                            ++ N E+   
Sbjct  188   IHDERFTVPKISAVLELCIQAGVDLEKFPSKRRSKPVYSIEGRIVDFEKVSDGNIETAVT  247

Query  945   SKMEH-ESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGP  769
             S +E  + + +  +   + ++ L  ET+ +W  +  GV KL+  Y V  C +C E+ VGP
Sbjct  248   STVELLQEDDRCKVEEKKSLKELSIETMESWFEMVLGVRKLMERYKVWTCGYCPEIQVGP  307

Query  768   SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGHAP  592
              GHK R+C   K++    +H W++A++DD+V PN VWH R P D  +L +    +YG AP
Sbjct  308   KGHKVRMCKATKHQMRDGMHAWQEATIDDVVGPNYVWHVRDPTDGSVLDNSLTRFYGKAP  367

Query  591   AVVDLCTKAGAIAPSKYFCMMKVD  520
             AVV++C + GA  P +Y  MM++D
Sbjct  368   AVVEMCVQGGAPVPDQYKSMMRLD  391


 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 3/100 (3%)
 Frame = -1

Query  852  TLRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLV-  676
            +L SG+ K++   PV  C+ CSEVH+G  GH+ R C      S    H W++  V D+V 
Sbjct  112  SLLSGLSKIIHHVPVHRCRCCSEVHIGKEGHEIRTCTGPGSGSRSATHVWKRGRVSDVVL  171

Query  675  -PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
             P +   + R   P ++ DE R       AV++LC +AG 
Sbjct  172  FPKSFHLYDRAVKPRVIHDE-RFTVPKISAVLELCIQAGV  210



>ref|XP_002454004.1| hypothetical protein SORBIDRAFT_04g022910 [Sorghum bicolor]
 gb|EES06980.1| hypothetical protein SORBIDRAFT_04g022910 [Sorghum bicolor]
Length=423

 Score =   168 bits (426),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 98/274 (36%), Positives = 143/274 (52%), Gaps = 44/274 (16%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVI  1042
              CR+C EV++G  GH IRTC G     +N LHVW  G++  ++     +HL + + +  +
Sbjct  140   RCRFCSEVHIGRVGHEIRTCEGRNSGARNSLHVWRPGTVRDVVGFPYCYHLFDRVGKPRV  199

Query  1041  KHHERFDYSRISAVVELCLQAGAN------------------------PNDESIDASKME  934
              H E++D  R+ AV+ELC+QAG +                        P+DE+   S  E
Sbjct  200   VHKEKYDVPRLPAVMELCIQAGVDVPRYPTKRRTRPVYSIEGRIVDFEPDDEAAGTSP-E  258

Query  933   HESNSKIVLPFDQQMRLLGNE-----------TLNAWETLRSGVHKLLLVYPVKVCKHCS  787
               + + ++ P    +   G E           TL +W  +RSG  +L+  Y V  C +C 
Sbjct  259   PPACTPLLPPAAGVVNGEGEESEITVPELASRTLQSWLDMRSGAARLMKKYSVHTCGYCP  318

Query  786   EVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQDPP-----LLLD  622
             +V VGP GHK R+C   K++     H W++A+VDDLVPPN VWH    DP       L +
Sbjct  319   DVQVGPKGHKVRMCRATKHQQRDGQHAWQEATVDDLVPPNYVWHV--ADPAGDESLPLAN  376

Query  621   EGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             E + YYG APAVV+LC +AGA  P+ Y  MM++D
Sbjct  377   ELKRYYGKAPAVVELCVQAGAPVPAAYRSMMRLD  410



>ref|XP_003575155.1| PREDICTED: APO protein 3, mitochondrial [Brachypodium distachyon]
Length=416

 Score =   168 bits (425),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 97/275 (35%), Positives = 145/275 (53%), Gaps = 42/275 (15%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVI  1042
              CR+C E+++G  GH IRTC G +  ++N LHVW  G++  ++     +HL + + +  +
Sbjct  129   RCRFCSELHIGNVGHEIRTCEGPQSGSRNSLHVWQPGTVRDVVGFPYCYHLSDRVGKPRV  188

Query  1041  KHHERFDYSRISAVVELCLQAGAN----PNDE------SIDA------------------  946
                E+++  R+ A++ELC+QAG +    P         SID                   
Sbjct  189   VRKEKYEVPRLPAILELCIQAGVDIGRYPTKRRTRPVYSIDGRIADFELDEEEESLEAET  248

Query  945   -------SKMEHESNSKIVLPFDQQM--RLLGNETLNAWETLRSGVHKLLLVYPVKVCKH  793
                    S     S +      +Q+M  R LG+ TL +W  +RSG  +L+  Y V  C +
Sbjct  249   SPEPSLLSPTGSASTADGSEQTEQEMTVRELGSRTLQSWLDMRSGAARLMRKYGVVTCGY  308

Query  792   CSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRR----PQDPPLLL  625
             C +V VGP GHK R+C   K++     H W++A+VDDLVPPN VWH R      D   L 
Sbjct  309   CPDVQVGPKGHKVRMCKASKHQQRDGQHAWQEATVDDLVPPNYVWHVRDPAGAGDGAPLA  368

Query  624   DEGRNYYGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             +E + YYG APAVV+LC +AGA  P++Y  MM++D
Sbjct  369   NELKRYYGKAPAVVELCVRAGAQVPAQYKSMMRLD  403


 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 12/93 (13%)
 Frame = -1

Query  1224  LLNCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-----  1060
             ++ C YCP+V VG  GH +R C   +H+ ++  H W + ++D ++ P   +H+ +     
Sbjct  303   VVTCGYCPDVQVGPKGHKVRMCKASKHQQRDGQHAWQEATVDDLVPPNYVWHVRDPAGAG  362

Query  1059  ---MFQNVIKHHERFDYSRISAVVELCLQAGAN  970
                   N +K +    Y +  AVVELC++AGA 
Sbjct  363   DGAPLANELKRY----YGKAPAVVELCVRAGAQ  391


 Score = 52.0 bits (123),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 66/130 (51%), Gaps = 7/130 (5%)
 Frame = -1

Query  939  MEHESNSKIVLPFDQQMRLLGNETLNAWETLRSGVHKLL---LVYPVKVCKHCSEVHVGP  769
            +EH   + +++P    +  + ++   A E   +G+ +L+      PVK C+ CSE+H+G 
Sbjct  84   LEHPPGNGLLVP---HLVEVAHQVHRARERFLAGLTRLVKGEAAMPVKRCRFCSELHIGN  140

Query  768  SGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWHRRPQ-DPPLLLDEGRNYYGHAP  592
             GH+ R C   +  S   +H W+  +V D+V     +H   +   P ++ + +      P
Sbjct  141  VGHEIRTCEGPQSGSRNSLHVWQPGTVRDVVGFPYCYHLSDRVGKPRVVRKEKYEVPRLP  200

Query  591  AVVDLCTKAG  562
            A+++LC +AG
Sbjct  201  AILELCIQAG  210



>ref|XP_010935256.1| PREDICTED: APO protein 3, mitochondrial-like [Elaeis guineensis]
 ref|XP_010935258.1| PREDICTED: APO protein 3, mitochondrial-like [Elaeis guineensis]
Length=405

 Score =   167 bits (423),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 98/269 (36%), Positives = 139/269 (52%), Gaps = 38/269 (14%)
 Frame = -1

Query  1215  CRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHNMFQNVIKH  1036
             CR C EV+VG   + IR+C      +    H W KG ++ +L  VE+FHL++     + H
Sbjct  125   CRVCGEVHVGMVPYRIRSCDVVGSLSTKD-HSWAKGGMEHVLPLVESFHLYDRLGRAVSH  183

Query  1035  HERFDYSRISAVVELCLQAGA---------------NPNDESIDASKM--EHESNSKIVL  907
              ER +  RI A+VELC+QAG                N   + ID  K      S+ K + 
Sbjct  184   EERLEVDRIPAIVELCVQAGVDIPEYPTKRRAFPVYNIGGKMIDFEKKFPRDYSSGKDIQ  243

Query  906   PF-------------------DQQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSE  784
             PF                   +  ++ +  + ++AWE +RSG  KL+  YPV+ C  C E
Sbjct  244   PFGFWQWKKKPGDSDSPSFSSNDSIQDIAVQGMDAWEKMRSGALKLVKKYPVQTCGFCPE  303

Query  783   VHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNY  607
             V VGP GH+AR+C  +K++     H W++A+VDDLVPP  VWH   P D   L+ E R Y
Sbjct  304   VQVGPKGHRARICQAYKHQMRDGQHAWQEATVDDLVPPVYVWHVPDPDDGNPLMHELRRY  363

Query  606   YGHAPAVVDLCTKAGAIAPSKYFCMMKVD  520
             YG  PAVV+L  +AGAI    Y+ +M+ D
Sbjct  364   YGKLPAVVELFAQAGAIVGKDYYGLMRKD  392



>gb|AAK48980.1|AF370553_1 Unknown protein [Arabidopsis thaliana]
 gb|AAN72097.1| Unknown protein [Arabidopsis thaliana]
Length=340

 Score =   166 bits (419),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/263 (34%), Positives = 146/263 (56%), Gaps = 30/263 (11%)
 Frame = -1

Query  1218  NCRYCPEVYVGENGHLIRTCGGYRHRTKNQLHVWIKGSLDSILIPVETFHLHN-MFQNVI  1042
              CR C EV++G+ GH IRTC G    +++  HVW +G +  +++  + FHL++   +  +
Sbjct  65    RCRLCAEVHIGKQGHEIRTCTGPGSGSRSATHVWKRGRVSDVVLFPKCFHLYDRAVKPRV  124

Query  1041  KHHERFDYSRISAVVELCLQAGAN----PNDE------SIDASKMEHE------------  928
              H ERF   +ISAV+ELC+QAG +    P+        SI+   ++ E            
Sbjct  125   IHDERFTVPKISAVLELCIQAGVDLEKFPSKRRSKPVYSIEGRIVDFEDVNDGNSELAVT  184

Query  927   SNSKIVLPFD------QQMRLLGNETLNAWETLRSGVHKLLLVYPVKVCKHCSEVHVGPS  766
             S + ++   D      + ++ L  ET+ +W  +  GV KL+  Y V  C +C E+ VGP 
Sbjct  185   STTTLIQEDDRCKEEKKSLKELSFETMESWFEMVLGVRKLMERYRVWTCGYCPEIQVGPK  244

Query  765   GHKARLCGVFKYESWRRIHFWEKASVDDLVPPNIVWH-RRPQDPPLLLDEGRNYYGHAPA  589
             GHK R+C   K++    +H W++A++DD+V P  VWH R P D  +L +  + +YG APA
Sbjct  245   GHKVRMCKATKHQMRDGMHAWQEATIDDVVGPTYVWHVRDPTDGSVLDNSLKRFYGKAPA  304

Query  588   VVDLCTKAGAIAPSKYFCMMKVD  520
             V+++C + GA  P +Y  MM++D
Sbjct  305   VIEMCVQGGAPVPDQYNSMMRLD  327


 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 50/99 (51%), Gaps = 3/99 (3%)
 Frame = -1

Query  849  LRSGVHKLLLVYPVKVCKHCSEVHVGPSGHKARLCGVFKYESWRRIHFWEKASVDDLV--  676
            L SG+ K++   PV  C+ C+EVH+G  GH+ R C      S    H W++  V D+V  
Sbjct  50   LLSGLSKIIHHVPVHRCRLCAEVHIGKQGHEIRTCTGPGSGSRSATHVWKRGRVSDVVLF  109

Query  675  PPNIVWHRRPQDPPLLLDEGRNYYGHAPAVVDLCTKAGA  559
            P     + R   P ++ DE R       AV++LC +AG 
Sbjct  110  PKCFHLYDRAVKPRVIHDE-RFTVPKISAVLELCIQAGV  147



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4318295211160