BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25492_g2_i2 len=1759 path=[10479:0-102 12590:103-223 10650:224-276
12901:277-324 10742:325-445 13896:446-448 13899:449-451 50:452-472
71:473-511 13138:512-515 10933:516-562 13192:563-627 11027:628-736
12197:737-762 11162:763-1053 726:1054-1057 730:1058-1337
1251:1338-1360 1274:1361-1758]

Length=1759
                                                                      Score     E

ref|XP_011084416.1|  PREDICTED: O-glucosyltransferase rumi homolo...    676   0.0      
emb|CDP05199.1|  unnamed protein product                                674   0.0      
ref|XP_011084417.1|  PREDICTED: O-glucosyltransferase rumi homolo...    650   0.0      
ref|XP_009601780.1|  PREDICTED: O-glucosyltransferase rumi homolo...    650   0.0      
emb|CDP05200.1|  unnamed protein product                                647   0.0      
ref|XP_009793757.1|  PREDICTED: O-glucosyltransferase rumi homolog      646   0.0      
ref|XP_002321919.2|  hypothetical protein POPTR_0015s13090g             644   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004234394.1|  PREDICTED: O-glucosyltransferase rumi homolog      642   0.0      
ref|XP_007038693.1|  Glycosyltransferase isoform 2                      641   0.0      
ref|XP_007038692.1|  Glycosyltransferase isoform 1                      641   0.0      
gb|AED99886.1|  glycosyltransferase                                     634   0.0      
ref|XP_010087567.1|  hypothetical protein L484_001025                   632   0.0      
ref|XP_002510788.1|  KDEL motif-containing protein 1 precursor, p...    629   0.0      Ricinus communis
ref|XP_011048719.1|  PREDICTED: O-glucosyltransferase rumi homolog      627   0.0      
gb|KDP22278.1|  hypothetical protein JCGZ_26109                         625   0.0      
ref|XP_010662756.1|  PREDICTED: O-glucosyltransferase rumi homolo...    622   0.0      
ref|XP_008234246.1|  PREDICTED: KDEL motif-containing protein 2-like    622   0.0      
ref|XP_009340024.1|  PREDICTED: O-glucosyltransferase rumi homolog      621   0.0      
ref|XP_002268245.1|  PREDICTED: O-glucosyltransferase rumi homolo...    620   0.0      Vitis vinifera
ref|XP_008377535.1|  PREDICTED: protein O-glucosyltransferase 1-like    620   0.0      
ref|XP_009371331.1|  PREDICTED: O-glucosyltransferase rumi homolog      619   0.0      
ref|XP_010255433.1|  PREDICTED: O-glucosyltransferase rumi homolo...    619   0.0      
ref|XP_009342973.1|  PREDICTED: O-glucosyltransferase rumi homolog      617   0.0      
ref|XP_004308086.1|  PREDICTED: O-glucosyltransferase rumi homolog      612   0.0      
ref|XP_004309206.1|  PREDICTED: O-glucosyltransferase rumi homolog      609   0.0      
emb|CDP05198.1|  unnamed protein product                                609   0.0      
ref|XP_008439228.1|  PREDICTED: protein O-glucosyltransferase 1-like    607   0.0      
ref|XP_011076164.1|  PREDICTED: O-glucosyltransferase rumi homolo...    605   0.0      
ref|XP_010060950.1|  PREDICTED: O-glucosyltransferase rumi homolog      605   0.0      
ref|XP_011084732.1|  PREDICTED: protein O-glucosyltransferase 1-like    602   0.0      
ref|XP_004140839.1|  PREDICTED: protein O-glucosyltransferase 1-like    604   0.0      
ref|XP_004157225.1|  PREDICTED: protein O-glucosyltransferase 1-like    602   0.0      
ref|XP_010110639.1|  hypothetical protein L484_001070                   599   0.0      
ref|XP_006353390.1|  PREDICTED: protein O-glucosyltransferase 1-like    598   0.0      
ref|XP_007220455.1|  hypothetical protein PRUPE_ppa005169mg             595   0.0      
ref|XP_008234463.1|  PREDICTED: O-glucosyltransferase rumi homolog      592   0.0      
ref|XP_004234450.2|  PREDICTED: O-glucosyltransferase rumi homolog      592   0.0      
ref|XP_007220737.1|  hypothetical protein PRUPE_ppa023179mg             592   0.0      
ref|XP_010456660.1|  PREDICTED: O-glucosyltransferase rumi homolog      593   0.0      
ref|XP_010273073.1|  PREDICTED: O-glucosyltransferase rumi-like         591   0.0      
ref|XP_004514091.1|  PREDICTED: O-glucosyltransferase rumi homolo...    591   0.0      
ref|XP_011084731.1|  PREDICTED: protein O-glucosyltransferase 1-like    590   0.0      
ref|XP_009340025.1|  PREDICTED: O-glucosyltransferase rumi homolo...    590   0.0      
ref|XP_010910005.1|  PREDICTED: O-glucosyltransferase rumi homolog      592   0.0      
gb|KHN42549.1|  O-glucosyltransferase rumi like                         591   0.0      
ref|XP_011076165.1|  PREDICTED: O-glucosyltransferase rumi homolo...    588   0.0      
ref|XP_006394641.1|  hypothetical protein EUTSA_v10003948mg             591   0.0      
ref|XP_006421921.1|  hypothetical protein CICLE_v10004696mg             588   0.0      
ref|XP_006287442.1|  hypothetical protein CARUB_v10000648mg             587   0.0      
gb|KHN23210.1|  O-glucosyltransferase rumi like                         585   0.0      
ref|XP_008377526.1|  PREDICTED: protein O-glucosyltransferase 1-like    585   0.0      
gb|KDP22277.1|  hypothetical protein JCGZ_26108                         585   0.0      
ref|XP_003549080.1|  PREDICTED: KDEL motif-containing protein 2-l...    585   0.0      
ref|XP_010255431.1|  PREDICTED: O-glucosyltransferase rumi homolog      585   0.0      
ref|XP_010273071.1|  PREDICTED: O-glucosyltransferase rumi-like         585   0.0      
ref|XP_009340026.1|  PREDICTED: O-glucosyltransferase rumi homolo...    583   0.0      
emb|CDP05201.1|  unnamed protein product                                585   0.0      
ref|XP_008794191.1|  PREDICTED: O-glucosyltransferase rumi homolog      585   0.0      
ref|XP_006490390.1|  PREDICTED: KDEL motif-containing protein 2-like    584   0.0      
ref|XP_006353301.1|  PREDICTED: O-glucosyltransferase rumi homolog      576   0.0      
ref|XP_009601795.1|  PREDICTED: KDEL motif-containing protein 1-l...    575   0.0      
ref|XP_002304487.2|  hypothetical protein POPTR_0003s12500g             580   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010421189.1|  PREDICTED: O-glucosyltransferase rumi homolog      581   0.0      
gb|KFK27674.1|  hypothetical protein AALP_AA8G414000                    580   0.0      
ref|XP_010255430.1|  PREDICTED: O-glucosyltransferase rumi homolog      578   0.0      
gb|KHN42548.1|  O-glucosyltransferase rumi like                         580   0.0      
ref|XP_006599594.1|  PREDICTED: KDEL motif-containing protein 2-like    579   0.0      
ref|NP_197774.1|  uncharacterized protein                               579   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007152278.1|  hypothetical protein PHAVU_004G116000g             576   0.0      
gb|KEH17461.1|  glycosyltransferase family 90 protein                   577   0.0      
ref|XP_011022725.1|  PREDICTED: O-glucosyltransferase rumi-like i...    577   0.0      
ref|XP_011022723.1|  PREDICTED: O-glucosyltransferase rumi-like i...    577   0.0      
ref|XP_009400272.1|  PREDICTED: O-glucosyltransferase rumi homolog      579   0.0      
ref|XP_009150906.1|  PREDICTED: O-glucosyltransferase rumi homolog      578   0.0      
gb|KEH17460.1|  glycosyltransferase family 90 protein                   576   0.0      
ref|XP_009793762.1|  PREDICTED: O-glucosyltransferase rumi homolog      576   0.0      
ref|XP_006490389.1|  PREDICTED: protein O-glucosyltransferase 1-like    575   0.0      
ref|XP_010671883.1|  PREDICTED: O-glucosyltransferase rumi homolog      577   0.0      
emb|CDX80388.1|  BnaC07g30560D                                          575   0.0      
ref|XP_010550767.1|  PREDICTED: O-glucosyltransferase rumi homolo...    575   0.0      
ref|XP_002872075.1|  hypothetical protein ARALYDRAFT_910396             575   0.0      
gb|KDO60000.1|  hypothetical protein CISIN_1g043671mg                   573   0.0      
ref|XP_002510787.1|  KDEL motif-containing protein 1 precursor, p...    573   0.0      Ricinus communis
ref|XP_010660876.1|  PREDICTED: O-glucosyltransferase rumi homolog      573   0.0      
emb|CDX88050.1|  BnaA06g26410D                                          572   0.0      
ref|XP_010550766.1|  PREDICTED: O-glucosyltransferase rumi homolo...    571   0.0      
ref|XP_006421920.1|  hypothetical protein CICLE_v10007061mg             569   0.0      
ref|XP_007040187.1|  Glycosyltransferase isoform 1                      570   0.0      
ref|XP_006439571.1|  hypothetical protein CICLE_v10019647mg             570   0.0      
ref|XP_010089133.1|  hypothetical protein L484_024308                   570   0.0      
emb|CDP07206.1|  unnamed protein product                                566   0.0      
emb|CAN69493.1|  hypothetical protein VITISV_037876                     563   0.0      Vitis vinifera
ref|XP_006404195.1|  hypothetical protein EUTSA_v10010269mg             570   0.0      
ref|XP_009601762.1|  PREDICTED: O-glucosyltransferase rumi homolog      568   0.0      
ref|XP_006476587.1|  PREDICTED: O-glucosyltransferase rumi-like i...    568   0.0      
emb|CBI34690.3|  unnamed protein product                                567   0.0      
emb|CDP05197.1|  unnamed protein product                                566   0.0      
ref|XP_007040188.1|  Glycosyltransferase isoform 2                      565   0.0      
gb|KFK34190.1|  hypothetical protein AALP_AA5G112800                    568   0.0      
ref|XP_010255435.1|  PREDICTED: O-glucosyltransferase rumi homolo...    561   0.0      
ref|XP_006476586.1|  PREDICTED: O-glucosyltransferase rumi-like i...    566   0.0      
emb|CDP09762.1|  unnamed protein product                                563   0.0      
ref|XP_007040189.1|  Glycosyltransferase isoform 3                      561   0.0      
ref|XP_002875936.1|  hypothetical protein ARALYDRAFT_485256             560   0.0      
ref|XP_009149777.1|  PREDICTED: O-glucosyltransferase rumi homolog      560   0.0      
ref|XP_006842991.1|  hypothetical protein AMTR_s00076p00109920          558   0.0      
emb|CDY08097.1|  BnaA06g16290D                                          560   0.0      
ref|XP_010426402.1|  PREDICTED: protein O-glucosyltransferase 1-like    559   0.0      
ref|XP_004298753.1|  PREDICTED: O-glucosyltransferase rumi homolog      557   0.0      
ref|XP_010503544.1|  PREDICTED: protein O-glucosyltransferase 1-l...    558   0.0      
ref|XP_010515234.1|  PREDICTED: O-glucosyltransferase rumi homolog      558   0.0      
ref|XP_007209901.1|  hypothetical protein PRUPE_ppa004159mg             556   0.0      
emb|CDY05887.1|  BnaC08g20640D                                          556   0.0      
ref|XP_008813821.1|  PREDICTED: O-glucosyltransferase rumi homolo...    553   0.0      
ref|NP_190467.1|  uncharacterized protein                               556   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290867.1|  hypothetical protein CARUB_v10016976mg             555   0.0      
ref|XP_008813820.1|  PREDICTED: O-glucosyltransferase rumi homolo...    554   0.0      
ref|XP_007038694.1|  Glycosyltransferase isoform 3                      552   0.0      
ref|XP_010053285.1|  PREDICTED: O-glucosyltransferase rumi homolog      554   0.0      
ref|XP_008238869.1|  PREDICTED: O-glucosyltransferase rumi              553   0.0      
ref|XP_010053287.1|  PREDICTED: O-glucosyltransferase rumi homolog      552   0.0      
dbj|BAE99650.1|  hypothetical protein                                   549   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517464.1|  PREDICTED: KDEL motif-containing protein 1-l...    552   0.0      
ref|XP_004953263.1|  PREDICTED: protein O-glucosyltransferase 1-like    551   0.0      
ref|XP_002446853.1|  hypothetical protein SORBIDRAFT_06g023680          550   0.0      Sorghum bicolor [broomcorn]
ref|XP_010905099.1|  PREDICTED: protein O-glucosyltransferase 1-like    549   0.0      
ref|XP_008380708.1|  PREDICTED: KDEL motif-containing protein 1-like    548   0.0      
ref|XP_002454569.1|  hypothetical protein SORBIDRAFT_04g033620          548   0.0      Sorghum bicolor [broomcorn]
ref|XP_004985474.1|  PREDICTED: O-glucosyltransferase rumi homolog      547   0.0      
ref|NP_001047557.2|  Os02g0642700                                       543   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001136898.1|  hypothetical protein                               545   0.0      Zea mays [maize]
ref|XP_008232818.1|  PREDICTED: O-glucosyltransferase rumi homolog      543   0.0      
gb|EEC73683.1|  hypothetical protein OsI_08244                          542   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004300778.1|  PREDICTED: KDEL motif-containing protein 1-like    540   0.0      
ref|XP_010110644.1|  hypothetical protein L484_001075                   540   0.0      
ref|XP_007051850.1|  Downstream target of A 2                           542   0.0      
ref|XP_002509776.1|  KDEL motif-containing protein 1 precursor, p...    541   0.0      Ricinus communis
ref|XP_003611113.1|  KTEL motif-containing protein                      540   0.0      
ref|XP_007220377.1|  hypothetical protein PRUPE_ppa019065mg             540   0.0      
ref|XP_008669095.1|  PREDICTED: protein O-glucosyltransferase 1-l...    541   0.0      
ref|XP_003569968.1|  PREDICTED: protein O-glucosyltransferase 1-like    541   0.0      
ref|XP_002273091.2|  PREDICTED: O-glucosyltransferase rumi homolog      540   0.0      Vitis vinifera
gb|KCW78050.1|  hypothetical protein EUGRSUZ_D02274                     538   0.0      
ref|XP_008393993.1|  PREDICTED: protein O-glucosyltransferase 1-like    539   0.0      
ref|XP_004510812.1|  PREDICTED: protein O-glucosyltransferase 1-like    538   0.0      
ref|XP_010240178.1|  PREDICTED: O-glucosyltransferase rumi homolog      538   0.0      
ref|XP_004306802.1|  PREDICTED: O-glucosyltransferase rumi-like         535   0.0      
ref|XP_002320120.2|  hypothetical protein POPTR_0014s07740g             535   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004143920.1|  PREDICTED: O-glucosyltransferase rumi-like         531   5e-180   
ref|XP_006491072.1|  PREDICTED: O-glucosyltransferase rumi homolog      531   1e-179   
ref|XP_006445081.1|  hypothetical protein CICLE_v10019760mg             530   1e-179   
gb|EMS55632.1|  hypothetical protein TRIUR3_02972                       528   1e-179   
gb|KDO59999.1|  hypothetical protein CISIN_1g016930mg                   525   2e-179   
gb|AFW63189.1|  hypothetical protein ZEAMMB73_601289                    531   3e-179   
ref|XP_003618993.1|  KTEL motif-containing protein                      528   6e-179   
ref|XP_002511835.1|  KDEL motif-containing protein 1 precursor, p...    528   1e-178   Ricinus communis
emb|CAN70600.1|  hypothetical protein VITISV_027960                     527   1e-178   Vitis vinifera
ref|XP_007220070.1|  hypothetical protein PRUPE_ppa024728mg             527   2e-178   
ref|XP_003533188.2|  PREDICTED: O-glucosyltransferase rumi homolo...    522   2e-178   
ref|XP_008439224.1|  PREDICTED: protein O-glucosyltransferase 1-like    526   2e-178   
ref|XP_010661761.1|  PREDICTED: O-glucosyltransferase rumi homolo...    527   2e-178   
ref|XP_002273194.2|  PREDICTED: O-glucosyltransferase rumi-like         526   3e-178   Vitis vinifera
gb|EMT28728.1|  hypothetical protein F775_16149                         531   3e-178   
ref|XP_010661760.1|  PREDICTED: O-glucosyltransferase rumi homolo...    525   1e-177   
gb|KHN04653.1|  Protein O-glucosyltransferase 1                         524   3e-177   
emb|CAN66409.1|  hypothetical protein VITISV_020976                     521   4e-177   Vitis vinifera
gb|KDP28649.1|  hypothetical protein JCGZ_14420                         523   5e-177   
emb|CAH67462.1|  OSIGBa0159I10.7                                        523   1e-176   Oryza sativa [red rice]
ref|XP_003529952.1|  PREDICTED: O-glucosyltransferase rumi homolog      522   1e-176   
gb|KDO86109.1|  hypothetical protein CISIN_1g044043mg                   518   2e-176   
dbj|BAD25236.1|  unknown protein                                        516   4e-176   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010058149.1|  PREDICTED: O-glucosyltransferase rumi homolog      518   5e-176   
ref|XP_002273411.2|  PREDICTED: O-glucosyltransferase rumi-like i...    521   6e-176   Vitis vinifera
ref|XP_006445080.1|  hypothetical protein CICLE_v10023948mg             519   7e-176   
ref|XP_004976349.1|  PREDICTED: O-glucosyltransferase rumi-like         514   1e-175   
ref|XP_009771652.1|  PREDICTED: protein O-glucosyltransferase 1-l...    518   2e-175   
ref|XP_011035982.1|  PREDICTED: O-glucosyltransferase rumi homolog      519   3e-175   
ref|XP_009386726.1|  PREDICTED: O-glucosyltransferase rumi homolog      518   3e-175   
ref|XP_010418359.1|  PREDICTED: protein O-glucosyltransferase 1-l...    518   5e-175   
ref|XP_010430436.1|  PREDICTED: protein O-glucosyltransferase 1-l...    518   6e-175   
ref|XP_009771653.1|  PREDICTED: protein O-glucosyltransferase 1-l...    515   8e-175   
ref|XP_006647597.1|  PREDICTED: KDEL motif-containing protein 2-like    511   2e-174   
ref|XP_010473579.1|  PREDICTED: protein O-glucosyltransferase 1-like    518   3e-174   
ref|XP_010105961.1|  hypothetical protein L484_017309                   516   3e-174   
ref|XP_007135034.1|  hypothetical protein PHAVU_010G096100g             515   5e-174   
gb|KHN25713.1|  KDEL motif-containing protein 1                         509   1e-173   
ref|XP_004170219.1|  PREDICTED: protein O-glucosyltransferase 1-like    511   2e-173   
ref|XP_010672073.1|  PREDICTED: protein O-glucosyltransferase 1-l...    514   4e-173   
ref|XP_006302095.1|  hypothetical protein CARUB_v10020086mg             514   6e-173   
gb|KHG06444.1|  Protein O-glucosyltransferase 1                         513   7e-173   
gb|KGN57370.1|  hypothetical protein Csa_3G182060                       513   7e-173   
ref|XP_010413436.1|  PREDICTED: O-glucosyltransferase rumi homolog      512   1e-172   
ref|XP_004140843.1|  PREDICTED: protein O-glucosyltransferase 1-like    509   2e-172   
ref|XP_007219799.1|  hypothetical protein PRUPE_ppa026562mg             510   3e-172   
ref|XP_011091974.1|  PREDICTED: O-glucosyltransferase rumi homolo...    510   3e-172   
ref|XP_010418358.1|  PREDICTED: protein O-glucosyltransferase 1-l...    513   4e-172   
gb|KDP28650.1|  hypothetical protein JCGZ_14421                         510   5e-172   
ref|XP_010430435.1|  PREDICTED: protein O-glucosyltransferase 1-l...    513   5e-172   
ref|XP_008806857.1|  PREDICTED: protein O-glucosyltransferase 1         511   7e-172   
ref|XP_006391747.1|  hypothetical protein EUTSA_v10023375mg             512   9e-172   
ref|XP_010055153.1|  PREDICTED: O-glucosyltransferase rumi homolog      509   1e-171   
ref|XP_010315451.1|  PREDICTED: O-glucosyltransferase rumi-like         508   1e-171   
ref|XP_004234449.1|  PREDICTED: O-glucosyltransferase rumi homolog      504   1e-171   
gb|KCW77553.1|  hypothetical protein EUGRSUZ_D01868                     504   2e-171   
ref|XP_006339788.1|  PREDICTED: O-glucosyltransferase rumi-like         506   2e-171   
gb|EMT28780.1|  hypothetical protein F775_08370                         509   2e-171   
ref|XP_010672083.1|  PREDICTED: protein O-glucosyltransferase 1-l...    505   2e-171   
ref|XP_009630107.1|  PREDICTED: protein O-glucosyltransferase 1-like    508   2e-171   
gb|EYU32096.1|  hypothetical protein MIMGU_mgv1a004518mg                508   4e-171   
emb|CBI40335.3|  unnamed protein product                                509   9e-171   
ref|XP_006353391.1|  PREDICTED: KDEL motif-containing protein 1-like    503   1e-170   
ref|XP_010544721.1|  PREDICTED: O-glucosyltransferase rumi homolog      506   2e-170   
gb|KEH18906.1|  glycosyltransferase family 90 protein                   505   5e-170   
emb|CAD41531.1|  OSJNBb0020O11.18                                       500   6e-170   Oryza sativa Japonica Group [Japonica rice]
gb|KCW71637.1|  hypothetical protein EUGRSUZ_E00165                     503   6e-170   
ref|XP_008244917.1|  PREDICTED: O-glucosyltransferase rumi homolo...    499   1e-169   
ref|XP_010055151.1|  PREDICTED: protein O-glucosyltransferase 1-like    503   3e-169   
ref|XP_008244916.1|  PREDICTED: O-glucosyltransferase rumi homolo...    496   2e-168   
ref|XP_008244914.1|  PREDICTED: O-glucosyltransferase rumi homolog      496   2e-168   
gb|KCW71638.1|  hypothetical protein EUGRSUZ_E00166                     499   2e-168   
gb|KFK40510.1|  hypothetical protein AALP_AA2G005200                    503   3e-168   
emb|CBI40334.3|  unnamed protein product                                511   5e-168   
gb|KCW71636.1|  hypothetical protein EUGRSUZ_E00163                     497   6e-168   
ref|XP_010054851.1|  PREDICTED: O-glucosyltransferase rumi homolog      496   6e-168   
ref|XP_010512462.1|  PREDICTED: O-glucosyltransferase rumi homolog      500   7e-168   
gb|KCW55321.1|  hypothetical protein EUGRSUZ_I01244                     496   2e-167   
ref|NP_176531.1|  uncharacterized protein                               501   2e-167   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887961.1|  hypothetical protein ARALYDRAFT_475010             501   2e-167   
gb|KFK37372.1|  kdel motif-containing protein 1                         498   2e-167   
ref|XP_010661757.1|  PREDICTED: O-glucosyltransferase rumi homolog      499   3e-167   
ref|XP_010523736.1|  PREDICTED: O-glucosyltransferase rumi homolog      497   7e-167   
ref|XP_006576346.1|  PREDICTED: O-glucosyltransferase rumi homolog      496   8e-167   
ref|XP_011023362.1|  PREDICTED: KDEL motif-containing protein 1-like    495   2e-166   
ref|XP_010028565.1|  PREDICTED: protein O-glucosyltransferase 1-like    492   3e-166   
gb|EYU32097.1|  hypothetical protein MIMGU_mgv1a020993mg                491   1e-165   
ref|XP_008232795.1|  PREDICTED: O-glucosyltransferase rumi homolog      489   1e-165   
ref|XP_009112948.1|  PREDICTED: O-glucosyltransferase rumi homolog      496   1e-165   
emb|CDY25494.1|  BnaC09g11190D                                          496   1e-165   
emb|CAN65870.1|  hypothetical protein VITISV_012498                     493   2e-165   Vitis vinifera
ref|XP_009630106.1|  PREDICTED: O-glucosyltransferase rumi-like         493   3e-165   
ref|XP_009396165.1|  PREDICTED: protein O-glucosyltransferase 1         494   3e-165   
ref|NP_182107.3|  downstream target of AGL15 2                          493   3e-165   Arabidopsis thaliana [mouse-ear cress]
gb|AAC28541.1|  unknown protein                                         493   3e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006583309.1|  PREDICTED: O-glucosyltransferase rumi homolo...    491   6e-165   
ref|XP_006292623.1|  hypothetical protein CARUB_v10018865mg             492   6e-165   
ref|XP_006402499.1|  hypothetical protein EUTSA_v10006441mg             490   6e-165   
ref|XP_010672143.1|  PREDICTED: O-glucosyltransferase rumi homolog      492   1e-164   
dbj|BAF00020.1|  hypothetical protein                                   488   1e-164   Arabidopsis thaliana [mouse-ear cress]
gb|KDO86108.1|  hypothetical protein CISIN_1g017178mg                   486   2e-164   
ref|XP_009395424.1|  PREDICTED: protein O-glucosyltransferase 1-like    491   2e-164   
ref|XP_010508102.1|  PREDICTED: O-glucosyltransferase rumi homolo...    491   2e-164   
ref|XP_003529949.1|  PREDICTED: O-glucosyltransferase rumi homolo...    490   2e-164   
ref|XP_002880202.1|  hypothetical protein ARALYDRAFT_483721             491   2e-164   
dbj|BAJ91645.1|  predicted protein                                      491   2e-164   
emb|CDP05196.1|  unnamed protein product                                487   2e-164   
ref|XP_006339545.1|  PREDICTED: O-glucosyltransferase rumi-like         491   3e-164   
ref|XP_006296393.1|  hypothetical protein CARUB_v10025566mg             490   5e-164   
gb|KHN27314.1|  O-glucosyltransferase rumi like                         487   5e-164   
ref|XP_010326254.1|  PREDICTED: O-glucosyltransferase rumi-like         490   5e-164   
emb|CDP08836.1|  unnamed protein product                                511   1e-163   
ref|XP_011023363.1|  PREDICTED: O-glucosyltransferase rumi homolog      488   1e-163   
gb|KGN45647.1|  hypothetical protein Csa_6G003390                       488   1e-163   
ref|XP_002301352.2|  hypothetical protein POPTR_0002s15940g             488   1e-163   Populus trichocarpa [western balsam poplar]
ref|XP_002876602.1|  hypothetical protein ARALYDRAFT_486604             488   2e-163   
ref|XP_009775891.1|  PREDICTED: O-glucosyltransferase rumi-like         488   5e-163   
emb|CDY58789.1|  BnaA07g38040D                                          487   5e-163   
ref|XP_003581455.1|  PREDICTED: O-glucosyltransferase rumi-like         487   7e-163   
ref|XP_009104298.1|  PREDICTED: O-glucosyltransferase rumi homolog      486   9e-163   
ref|XP_009771654.1|  PREDICTED: O-glucosyltransferase rumi-like         486   1e-162   
gb|KHG10921.1|  O-glucosyltransferase rumi                              485   2e-162   
ref|XP_010087566.1|  hypothetical protein L484_001024                   485   2e-162   
ref|NP_191686.1|  lipopolysaccharide-modifying domain-containing ...    485   2e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010672155.1|  PREDICTED: O-glucosyltransferase rumi homolog      486   2e-162   
ref|XP_009142373.1|  PREDICTED: O-glucosyltransferase rumi homolo...    481   5e-162   
ref|XP_002301351.2|  hypothetical protein POPTR_0002s15930g             484   9e-162   Populus trichocarpa [western balsam poplar]
ref|XP_007135040.1|  hypothetical protein PHAVU_010G096500g             483   9e-162   
ref|XP_010672121.1|  PREDICTED: uncharacterized protein LOC104888...    496   1e-161   
emb|CDY37069.1|  BnaA04g26470D                                          484   2e-161   
ref|XP_009142372.1|  PREDICTED: O-glucosyltransferase rumi homolo...    484   2e-161   
emb|CDY45704.1|  BnaCnng13690D                                          483   2e-161   
ref|XP_010506562.1|  PREDICTED: O-glucosyltransferase rumi homolo...    484   2e-161   
ref|XP_009143178.1|  PREDICTED: O-glucosyltransferase rumi homolog      484   2e-161   
ref|XP_011091985.1|  PREDICTED: protein O-glucosyltransferase 1-like    482   2e-161   
emb|CDY27355.1|  BnaC04g50500D                                          484   2e-161   
emb|CDX71753.1|  BnaC08g31210D                                          482   2e-161   
ref|XP_010661759.1|  PREDICTED: O-glucosyltransferase rumi-like i...    483   3e-161   
ref|XP_009116791.1|  PREDICTED: O-glucosyltransferase rumi homolo...    482   4e-161   
ref|NP_001053412.1|  Os04g0534000                                       482   6e-161   
ref|XP_003521906.1|  PREDICTED: protein O-glucosyltransferase 1-like    480   1e-160   
gb|KEH18889.1|  glycosyltransferase family 90 protein                   481   1e-160   
emb|CBI40328.3|  unnamed protein product                                492   1e-160   
ref|XP_007051849.1|  Downstream target of A 2                           481   2e-160   
gb|KHN27315.1|  O-glucosyltransferase rumi like                         478   2e-160   
ref|XP_002511836.1|  KDEL motif-containing protein 1 precursor, p...    482   2e-160   
ref|XP_008458253.1|  PREDICTED: protein O-glucosyltransferase 1-like    480   3e-160   
emb|CDY48932.1|  BnaA09g39050D                                          479   3e-160   
gb|EPS60059.1|  hypothetical protein M569_14742                         476   4e-160   
ref|XP_009383838.1|  PREDICTED: O-glucosyltransferase rumi-like         480   8e-160   
ref|XP_010055154.1|  PREDICTED: O-glucosyltransferase rumi homolog      478   2e-159   
emb|CDY18897.1|  BnaC04g04530D                                          478   2e-159   
emb|CDX74769.1|  BnaA05g05150D                                          483   2e-159   
ref|XP_004140844.1|  PREDICTED: O-glucosyltransferase rumi homolog      474   7e-159   
ref|XP_009116790.1|  PREDICTED: O-glucosyltransferase rumi homolo...    476   9e-159   
ref|XP_009394572.1|  PREDICTED: O-glucosyltransferase rumi-like         477   1e-158   
ref|XP_010518227.1|  PREDICTED: O-glucosyltransferase rumi homolo...    476   2e-158   
gb|KCW71639.1|  hypothetical protein EUGRSUZ_E00167                     472   3e-158   
ref|XP_011091967.1|  PREDICTED: O-glucosyltransferase rumi homolo...    470   4e-158   
ref|XP_010055155.1|  PREDICTED: O-glucosyltransferase rumi homolo...    475   7e-158   
ref|XP_010533678.1|  PREDICTED: O-glucosyltransferase rumi homolo...    474   9e-158   
ref|XP_009394561.1|  PREDICTED: protein O-glucosyltransferase 1-like    473   4e-157   
ref|XP_004976347.1|  PREDICTED: O-glucosyltransferase rumi homolo...    473   5e-157   
ref|XP_010055156.1|  PREDICTED: O-glucosyltransferase rumi homolo...    473   6e-157   
ref|XP_004976348.1|  PREDICTED: O-glucosyltransferase rumi homolo...    471   9e-157   
ref|XP_004510803.1|  PREDICTED: O-glucosyltransferase rumi homolog      469   2e-156   
ref|XP_008661642.1|  PREDICTED: uncharacterized protein LOC100274...    470   3e-156   
ref|XP_006345599.1|  PREDICTED: KDEL motif-containing protein 1-like    468   3e-156   
ref|NP_001142048.1|  uncharacterized protein LOC100274204               469   4e-156   
ref|XP_002446852.1|  hypothetical protein SORBIDRAFT_06g023670          469   5e-156   
ref|XP_006652571.1|  PREDICTED: O-glucosyltransferase rumi-like         469   6e-156   
ref|XP_010055164.1|  PREDICTED: O-glucosyltransferase rumi homolog      469   1e-155   
gb|EMT17880.1|  hypothetical protein F775_15879                         466   5e-155   
ref|XP_004510813.1|  PREDICTED: uncharacterized protein LOC101488921    461   2e-154   
ref|XP_010523738.1|  PREDICTED: O-glucosyltransferase rumi homolog      466   2e-154   
ref|XP_009386737.1|  PREDICTED: O-glucosyltransferase rumi homolog      460   3e-154   
ref|XP_004168535.1|  PREDICTED: LOW QUALITY PROTEIN: O-glucosyltr...    462   7e-154   
ref|XP_004977804.1|  PREDICTED: O-glucosyltransferase rumi homolog      466   2e-153   
ref|XP_004138510.1|  PREDICTED: protein O-glucosyltransferase 1-like    456   9e-153   
ref|XP_007051848.1|  Downstream target of A 2, putative                 458   1e-152   
ref|NP_973694.1|  downstream target of AGL15 2                          456   2e-152   
ref|XP_010469056.1|  PREDICTED: O-glucosyltransferase rumi homolo...    461   2e-152   
ref|XP_010469055.1|  PREDICTED: O-glucosyltransferase rumi homolo...    460   2e-152   
ref|XP_010508103.1|  PREDICTED: O-glucosyltransferase rumi homolo...    455   2e-152   
ref|XP_007220525.1|  hypothetical protein PRUPE_ppa014578mg             454   3e-152   
ref|XP_010559090.1|  PREDICTED: O-glucosyltransferase rumi homolog      460   3e-152   
gb|KFK35324.1|  hypothetical protein AALP_AA5G269800                    458   5e-152   
ref|XP_010469053.1|  PREDICTED: O-glucosyltransferase rumi homolo...    460   7e-152   
ref|XP_010469054.1|  PREDICTED: O-glucosyltransferase rumi homolo...    459   8e-152   
ref|XP_009116794.1|  PREDICTED: O-glucosyltransferase rumi homolog      459   9e-152   
gb|AAF19705.1|AC008047_12  F2K11.20                                     462   1e-151   
ref|XP_006290877.1|  hypothetical protein CARUB_v10016988mg             458   2e-151   
gb|AES80125.2|  glycosyltransferase family 90 protein                   454   4e-151   
ref|XP_003623907.1|  KDEL motif-containing protein                      455   4e-151   
ref|XP_010661991.1|  PREDICTED: O-glucosyltransferase rumi homolog      451   5e-151   
ref|XP_003623906.1|  O-glucosyltransferase rumi                         454   7e-151   
emb|CDX71750.1|  BnaC08g31240D                                          456   1e-150   
gb|ABD33418.1|  Lipopolysaccharide-modifying protein                    451   1e-150   
emb|CDY48930.1|  BnaA09g39070D                                          456   2e-150   
ref|XP_010413434.1|  PREDICTED: O-glucosyltransferase rumi homolog      456   2e-150   
ref|XP_009116793.1|  PREDICTED: O-glucosyltransferase rumi homolog      455   2e-150   
ref|XP_010512464.1|  PREDICTED: O-glucosyltransferase rumi homolog      454   9e-150   
ref|XP_006292854.1|  hypothetical protein CARUB_v10019114mg             451   1e-149   
ref|XP_009603404.1|  PREDICTED: O-glucosyltransferase rumi homolog      447   2e-149   
ref|NP_191687.2|  lipopolysaccharide-modifying domain-containing ...    452   9e-149   
gb|KHN26985.1|  O-glucosyltransferase rumi like                         446   1e-148   
ref|XP_010506564.1|  PREDICTED: O-glucosyltransferase rumi homolo...    446   1e-148   
ref|NP_182108.2|  uncharacterized protein                               448   1e-147   
dbj|BAF01419.1|  hypothetical protein                                   448   1e-147   
ref|XP_002437850.1|  hypothetical protein SORBIDRAFT_10g003730          449   2e-147   
gb|KFK37373.1|  hypothetical protein AALP_AA4G248300                    445   5e-147   
gb|EEE61403.1|  hypothetical protein OsJ_15589                          447   6e-147   
ref|XP_006402498.1|  hypothetical protein EUTSA_v10005889mg             446   7e-147   
gb|ADE76177.1|  unknown                                                 445   9e-147   
gb|ADE75639.1|  unknown                                                 445   1e-146   
ref|XP_009116792.1|  PREDICTED: O-glucosyltransferase rumi homolog      446   2e-146   
ref|XP_004964825.1|  PREDICTED: O-glucosyltransferase rumi-like i...    446   2e-146   
ref|XP_004964824.1|  PREDICTED: O-glucosyltransferase rumi-like i...    446   3e-146   
ref|XP_010518229.1|  PREDICTED: O-glucosyltransferase rumi homolo...    440   3e-146   
emb|CDX71752.1|  BnaC08g31220D                                          441   4e-146   
ref|XP_004974290.1|  PREDICTED: uncharacterized protein LOC101776947    450   9e-146   
ref|XP_010512463.1|  PREDICTED: O-glucosyltransferase rumi homolog      444   1e-145   
ref|XP_009138780.1|  PREDICTED: O-glucosyltransferase rumi homolog      441   4e-145   
ref|XP_010512465.1|  PREDICTED: uncharacterized protein LOC104788418    439   1e-144   
dbj|BAJ95415.1|  predicted protein                                      441   3e-144   
ref|XP_010413435.1|  PREDICTED: O-glucosyltransferase rumi homolog      440   3e-144   
ref|XP_006397767.1|  hypothetical protein EUTSA_v10001309mg             450   4e-144   
emb|CDY69828.1|  BnaCnng65570D                                          433   1e-143   
gb|KCW71643.1|  hypothetical protein EUGRSUZ_E00171                     431   7e-143   
ref|XP_010473803.1|  PREDICTED: O-glucosyltransferase rumi homolog      436   8e-143   
ref|XP_006439572.1|  hypothetical protein CICLE_v10019647mg             432   1e-142   
emb|CBI40329.3|  unnamed protein product                                429   1e-142   
ref|XP_004963879.1|  PREDICTED: protein O-glucosyltransferase 1-like    432   3e-142   
ref|XP_010418597.1|  PREDICTED: uncharacterized protein LOC104704163    432   3e-142   
ref|XP_006439570.1|  hypothetical protein CICLE_v10019647mg             428   5e-142   
emb|CDX89107.1|  BnaA04g00790D                                          429   3e-141   
gb|KEH18907.1|  glycosyltransferase family 90 protein                   428   9e-141   
tpg|DAA36685.1|  TPA: hypothetical protein ZEAMMB73_061596              427   2e-140   
gb|KCW77552.1|  hypothetical protein EUGRSUZ_D01868                     423   3e-140   
ref|NP_191688.1|  lipopolysaccharide-modifying domain-containing ...    427   3e-140   
ref|XP_002880203.1|  hypothetical protein ARALYDRAFT_483723             428   7e-140   
gb|EMT29710.1|  hypothetical protein F775_17014                         427   3e-139   
ref|XP_006659728.1|  PREDICTED: uncharacterized protein LOC102707606    427   4e-139   
gb|EPS69952.1|  hypothetical protein M569_04809                         425   2e-138   
emb|CDY42493.1|  BnaC04g21880D                                          433   1e-137   
ref|XP_010469052.1|  PREDICTED: uncharacterized protein LOC104749168    421   3e-137   
ref|XP_003565513.1|  PREDICTED: O-glucosyltransferase rumi-like         420   3e-136   
gb|EYU19547.1|  hypothetical protein MIMGU_mgv1a010063mg                411   6e-136   
ref|XP_002443683.1|  hypothetical protein SORBIDRAFT_07g000280          421   8e-136   
dbj|BAD69335.1|  unknown protein                                        417   5e-135   
emb|CBI22743.3|  unnamed protein product                                408   6e-135   
ref|NP_001060764.1|  Os08g0101800                                       417   6e-135   
ref|NP_001056838.1|  Os06g0152700                                       416   7e-135   
gb|EAZ05278.1|  hypothetical protein OsI_27481                          417   7e-135   
gb|EPS63735.1|  hypothetical protein M569_11049                         412   9e-135   
gb|AFW65034.1|  lipopolysaccharide-modifying protein                    418   1e-134   
ref|NP_001149452.1|  LOC100283078                                       417   1e-134   
emb|CAN70601.1|  hypothetical protein VITISV_027961                     409   1e-134   
emb|CBI40330.3|  unnamed protein product                                402   2e-132   
ref|XP_006848230.1|  hypothetical protein AMTR_s00029p00246540          407   2e-131   
ref|XP_008457372.1|  PREDICTED: uncharacterized protein LOC103497080    396   6e-128   
gb|KDO76179.1|  hypothetical protein CISIN_1g0093872mg                  388   8e-128   
ref|XP_006652572.1|  PREDICTED: O-glucosyltransferase rumi homolog      388   1e-127   
gb|KFK43043.1|  hypothetical protein AALP_AA1G071000                    394   9e-127   
gb|KDO76181.1|  hypothetical protein CISIN_1g0093872mg                  385   1e-126   
dbj|BAG95835.1|  unnamed protein product                                385   1e-126   
ref|XP_010228584.1|  PREDICTED: protein O-glucosyltransferase 1-l...    395   4e-126   
ref|XP_010228582.1|  PREDICTED: protein O-glucosyltransferase 1-l...    395   5e-126   
ref|XP_008791205.1|  PREDICTED: O-glucosyltransferase rumi homolog      393   6e-126   
ref|XP_004167091.1|  PREDICTED: uncharacterized protein LOC101228589    390   7e-126   
emb|CBI40333.3|  unnamed protein product                                385   8e-126   
ref|XP_010923267.1|  PREDICTED: O-glucosyltransferase rumi isofor...    392   1e-125   
ref|XP_004153209.1|  PREDICTED: uncharacterized protein LOC101204904    390   2e-125   
ref|XP_004145318.1|  PREDICTED: uncharacterized protein LOC101204476    390   2e-125   
ref|XP_006307276.1|  hypothetical protein CARUB_v10008891mg             391   2e-125   
ref|XP_002892388.1|  hypothetical protein ARALYDRAFT_887933             390   2e-125   
ref|XP_010487239.1|  PREDICTED: O-glucosyltransferase rumi homolog      389   6e-125   
ref|NP_172202.1|  uncharacterized protein                               389   8e-125   
dbj|BAD94602.1|  hypothetical protein                                   389   1e-124   
gb|EAZ23969.1|  hypothetical protein OsJ_07696                          380   2e-124   
ref|XP_009118458.1|  PREDICTED: O-glucosyltransferase rumi-like         387   3e-124   
emb|CDY59071.1|  BnaAnng15820D                                          387   4e-124   
ref|XP_010475473.1|  PREDICTED: O-glucosyltransferase rumi homolo...    386   2e-123   
ref|XP_009118981.1|  PREDICTED: O-glucosyltransferase rumi              385   4e-123   
ref|XP_006350920.1|  PREDICTED: uncharacterized protein LOC102588367    383   5e-123   
emb|CAN70737.1|  hypothetical protein VITISV_008287                     390   1e-122   
ref|XP_010457887.1|  PREDICTED: O-glucosyltransferase rumi homolog      384   1e-122   
ref|XP_010104627.1|  hypothetical protein L484_022004                   385   1e-122   
ref|XP_009763226.1|  PREDICTED: O-glucosyltransferase rumi homolog      382   1e-122   
ref|XP_002968799.1|  hypothetical protein SELMODRAFT_450427             380   1e-122   
emb|CDY10259.1|  BnaC05g05020D                                          383   2e-122   
gb|KGN57369.1|  hypothetical protein Csa_3G182050                       377   3e-122   
gb|AFW58974.1|  hypothetical protein ZEAMMB73_087617                    375   4e-122   
ref|XP_002974180.1|  hypothetical protein SELMODRAFT_100126             379   5e-122   
ref|XP_009598645.1|  PREDICTED: O-glucosyltransferase rumi homolog      380   7e-122   
ref|XP_008220835.1|  PREDICTED: uncharacterized protein LOC103320870    380   2e-121   
emb|CDY09932.1|  BnaC08g45190D                                          379   8e-121   
ref|XP_004242062.1|  PREDICTED: O-glucosyltransferase rumi              377   1e-120   
gb|KEH34278.1|  glycosyltransferase family 90 protein                   376   2e-120   
ref|XP_003632132.1|  PREDICTED: O-glucosyltransferase rumi homolog      375   4e-120   
ref|XP_002525649.1|  conserved hypothetical protein                     376   4e-120   
emb|CDX71749.1|  BnaC08g31250D                                          374   5e-120   
ref|XP_010253905.1|  PREDICTED: O-glucosyltransferase rumi homolo...    376   8e-120   
gb|EMS58524.1|  hypothetical protein TRIUR3_06862                       375   9e-120   
ref|XP_010533680.1|  PREDICTED: O-glucosyltransferase rumi homolo...    373   1e-119   
ref|XP_010253904.1|  PREDICTED: O-glucosyltransferase rumi homolo...    375   1e-119   
ref|XP_009347260.1|  PREDICTED: protein O-glucosyltransferase 1         375   2e-119   
gb|KDP46492.1|  hypothetical protein JCGZ_08464                         375   2e-119   
ref|XP_010032976.1|  PREDICTED: O-glucosyltransferase rumi              375   2e-119   
ref|XP_010533679.1|  PREDICTED: O-glucosyltransferase rumi homolo...    373   2e-119   
ref|XP_008245982.1|  PREDICTED: O-glucosyltransferase rumi homolog      370   3e-119   
ref|XP_010934815.1|  PREDICTED: protein O-glucosyltransferase 1         370   8e-119   
gb|KHG28718.1|  O-glucosyltransferase rumi                              372   2e-118   
ref|XP_010542663.1|  PREDICTED: O-glucosyltransferase rumi homolog      372   3e-118   
ref|XP_008355051.1|  PREDICTED: uncharacterized protein LOC103418716    371   3e-118   
emb|CDP09193.1|  unnamed protein product                                371   4e-118   
ref|XP_006488529.1|  PREDICTED: uncharacterized protein LOC102623006    370   4e-118   
ref|XP_007016099.1|  F10K1.7 protein                                    372   5e-118   
ref|XP_007146770.1|  hypothetical protein PHAVU_006G068300g             370   6e-118   
ref|XP_011043775.1|  PREDICTED: protein O-glucosyltransferase 1         370   9e-118   
ref|XP_010685551.1|  PREDICTED: O-glucosyltransferase rumi homolog      370   2e-117   
ref|XP_004500267.1|  PREDICTED: uncharacterized protein LOC101501069    369   2e-117   
ref|XP_002299807.2|  hypothetical protein POPTR_0001s25900g             368   3e-117   
ref|XP_003552954.1|  PREDICTED: O-glucosyltransferase rumi-like         368   4e-117   
ref|XP_004295759.1|  PREDICTED: uncharacterized protein LOC101303314    369   7e-117   
ref|XP_003539326.2|  PREDICTED: O-glucosyltransferase rumi-like         367   1e-116   
ref|XP_006296467.1|  hypothetical protein CARUB_v10025651mg             365   2e-116   
ref|XP_006656650.1|  PREDICTED: O-glucosyltransferase rumi-like         364   6e-116   
emb|CAN70836.1|  hypothetical protein VITISV_015872                     376   3e-115   
dbj|BAJ90536.1|  predicted protein                                      363   4e-115   
emb|CAB71058.1|  putative protein                                       358   5e-115   
ref|XP_011080692.1|  PREDICTED: O-glucosyltransferase rumi homolog      362   5e-115   
ref|XP_002974420.1|  glycosyltransferase, CAZy family GT90              357   6e-114   
ref|XP_006425069.1|  hypothetical protein CICLE_v10028388mg             359   1e-113   
gb|KCW77554.1|  hypothetical protein EUGRSUZ_D01868                     351   2e-113   
ref|XP_008662039.1|  PREDICTED: lipopolysaccharide-modifying prot...    358   5e-113   
ref|NP_001266359.1|  uncharacterized protein LOC101027092               355   8e-113   
ref|XP_002985719.1|  glycosyltransferase, CAZy family GT90              354   8e-113   
ref|XP_002979254.1|  glycosyltransferase, CAZy family GT90              357   9e-113   
ref|XP_002993235.1|  hypothetical protein SELMODRAFT_431353             357   1e-112   
ref|XP_003533614.2|  PREDICTED: KDEL motif-containing protein 1-like    352   1e-112   
ref|XP_008662038.1|  PREDICTED: lipopolysaccharide-modifying prot...    357   1e-112   
ref|NP_001151574.1|  lipopolysaccharide-modifying protein               356   2e-112   
gb|AAY78729.1|  hypothetical protein At2g45840                          350   3e-112   
gb|AAP21678.1|  hypothetical protein                                    350   4e-112   
ref|XP_008349568.1|  PREDICTED: LOW QUALITY PROTEIN: O-glucosyltr...    355   7e-112   
gb|EEE65104.1|  hypothetical protein OsJ_20160                          355   9e-112   
ref|XP_009408712.1|  PREDICTED: LOW QUALITY PROTEIN: protein O-gl...    350   8e-111   
gb|EMT17881.1|  hypothetical protein F775_33129                         370   2e-110   
ref|XP_003566555.1|  PREDICTED: O-glucosyltransferase rumi homolog      350   4e-110   
ref|XP_004960277.1|  PREDICTED: uncharacterized protein LOC101780368    349   4e-109   
ref|XP_010672127.1|  PREDICTED: uncharacterized protein LOC104888...    349   2e-107   



>ref|XP_011084416.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Sesamum 
indicum]
Length=513

 Score =   676 bits (1745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/489 (67%), Positives = 380/489 (78%), Gaps = 29/489 (6%)
 Frame = +3

Query  348   KTLPRSSLAVFFFMVLCVGAFVSTRLLDSTV------TAQHP-------------TRLSH  470
             + L RSSL   FF VL VGAF+ TR LDS+       ++Q+P             T  +H
Sbjct  6     RQLARSSLVALFFAVLTVGAFICTRYLDSSSALMDRSSSQNPILTTKTVHDFPSETPQNH  65

Query  471   QKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRW  650
             Q   +    PLNCSL     +CPANYYPS      ++ +              CPDYFRW
Sbjct  66    QNTPKTIDIPLNCSLGNMSRTCPANYYPSKIFVEDQSLLS--------APPPSCPDYFRW  117

Query  651   IYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLL  830
             IYDDLW WRE+GI+REMVMSA RTANFRLVI++G AY   YRKSFQSRDTFTLWGILQLL
Sbjct  118   IYDDLWPWRETGITREMVMSASRTANFRLVILDGKAYVQTYRKSFQSRDTFTLWGILQLL  177

Query  831   RRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWG  1010
             RRYPGKVPDLDLMFD VDWPVIKK+++       APP LFRYCGD++++DIVFPDWSFWG
Sbjct  178   RRYPGKVPDLDLMFDCVDWPVIKKETFK-GPKYPAPPPLFRYCGDDSSYDIVFPDWSFWG  236

Query  1011  WPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGA  1190
             WPEINIKPWE LS++LKEGN +I W DRE +AYWKGNP VAATR DLLKCNV++KQDWGA
Sbjct  237   WPEINIKPWEALSEDLKEGNKRIGWTDREQHAYWKGNPTVAATRMDLLKCNVTDKQDWGA  296

Query  1191  RVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYD  1370
             RV+AQDW++E K+GY+QS+LA QC HRYKIYIEGSAWSVSEKYILACDS+TLLVKP+YYD
Sbjct  297   RVFAQDWLKEQKEGYKQSDLASQCAHRYKIYIEGSAWSVSEKYILACDSVTLLVKPYYYD  356

Query  1371  FYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYD  1550
             F+TR LMP++HYWPI+DDDKC+SIKHAVDWGN+H Q+AQ IG   S +I +ELKM+YVYD
Sbjct  357   FFTRSLMPLQHYWPIKDDDKCRSIKHAVDWGNSHQQEAQAIGKRASNFILDELKMDYVYD  416

Query  1551  YMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTM  1730
             YMFHLLSEYAKLLKYKPTVP  AVELCSE M C + G EK+FM +SLVK  PS + PCTM
Sbjct  417   YMFHLLSEYAKLLKYKPTVPKRAVELCSEAMACPSQGFEKKFMTDSLVK-GPSVSNPCTM  475

Query  1731  PPPFDPATL  1757
             PPP+DPA+L
Sbjct  476   PPPYDPASL  484



>emb|CDP05199.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/511 (65%), Positives = 396/511 (77%), Gaps = 26/511 (5%)
 Frame = +3

Query  273   MRETSE----GARLYRHFTDTNWRP-LPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDST  437
             MRE  +    G+  YRH  +    P L A  T+ RSSLA+FF ++LC+GAF STR LDS+
Sbjct  1     MREQVQSMLNGSGQYRHSAEKIGLPRLLAKNTVARSSLAIFFLILLCIGAFFSTRFLDSS  60

Query  438   VTA---QHPTRLSHQKIIEN--------EIPPLNCSLRTPMASCPANYYPSSKLTRTRTR  584
              T+     P + S   I  N        EIP LNCSL     +CP NYYPS K ++    
Sbjct  61    ATSLSVNSPKKSSFATIPVNPKNHRHKLEIP-LNCSLGDATRTCPPNYYPS-KFSKPNPH  118

Query  585   IQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYY  764
                   P+ T +   CPDYFRWI++DLW WRE+GI+R MV +A +TANFRLVI+NG AY 
Sbjct  119   ------PSSTTTQLTCPDYFRWIHEDLWPWRETGITRAMVKTASKTANFRLVILNGTAYV  172

Query  765   HNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPA  944
               Y+K+FQSRDTFTLWGILQLLRRYPG+VPDLDLMFD VDWPVIKK +Y      TAPP 
Sbjct  173   ETYQKAFQSRDTFTLWGILQLLRRYPGQVPDLDLMFDCVDWPVIKKDTY-HGPNATAPPP  231

Query  945   LFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNP  1124
             LFRYCGD+ T DIVFPDWSFWGWPEINIKPWE LS++LK GN + +WVDREPYAYWKGNP
Sbjct  232   LFRYCGDDTTLDIVFPDWSFWGWPEINIKPWEALSEDLKRGNERSRWVDREPYAYWKGNP  291

Query  1125  EVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWS  1304
              VA TR DLLKCN S+KQDWGARVYAQDWIQE +QGY+QS+LA QCIH+YKIYIEGSAWS
Sbjct  292   HVAETRMDLLKCNASDKQDWGARVYAQDWIQEQQQGYKQSDLASQCIHKYKIYIEGSAWS  351

Query  1305  VSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQA  1484
             VSEKYILACDS+TL+VKP YYDF+TRGLMP++HYWPIRDD KC+SIK+AVDWG+++ ++A
Sbjct  352   VSEKYILACDSVTLVVKPRYYDFFTRGLMPLQHYWPIRDDGKCRSIKYAVDWGSSNEEKA  411

Query  1485  QEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGL  1664
             Q IG A SK++Q+ELKM++VYDYMFHLL+ YAKLLKYKP+VPP+A+ELCSE M C A G 
Sbjct  412   QTIGKAASKFVQDELKMDFVYDYMFHLLNGYAKLLKYKPSVPPKAIELCSELMACPAKGF  471

Query  1665  EKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             EK+FM++S V+  PS+  PC MPPP+DPAT 
Sbjct  472   EKKFMVDSTVR-GPSSETPCVMPPPYDPATF  501



>ref|XP_011084417.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Sesamum 
indicum]
Length=475

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/434 (71%), Positives = 354/434 (82%), Gaps = 10/434 (2%)
 Frame = +3

Query  456   TRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCP  635
             T  +HQ   +    PLNCSL     +CPANYYPS      ++ +              CP
Sbjct  23    TPQNHQNTPKTIDIPLNCSLGNMSRTCPANYYPSKIFVEDQSLLS--------APPPSCP  74

Query  636   DYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWG  815
             DYFRWIYDDLW WRE+GI+REMVMSA RTANFRLVI++G AY   YRKSFQSRDTFTLWG
Sbjct  75    DYFRWIYDDLWPWRETGITREMVMSASRTANFRLVILDGKAYVQTYRKSFQSRDTFTLWG  134

Query  816   ILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPD  995
             ILQLLRRYPGKVPDLDLMFD VDWPVIKK+++       APP LFRYCGD++++DIVFPD
Sbjct  135   ILQLLRRYPGKVPDLDLMFDCVDWPVIKKETFK-GPKYPAPPPLFRYCGDDSSYDIVFPD  193

Query  996   WSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEK  1175
             WSFWGWPEINIKPWE LS++LKEGN +I W DRE +AYWKGNP VAATR DLLKCNV++K
Sbjct  194   WSFWGWPEINIKPWEALSEDLKEGNKRIGWTDREQHAYWKGNPTVAATRMDLLKCNVTDK  253

Query  1176  QDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVK  1355
             QDWGARV+AQDW++E K+GY+QS+LA QC HRYKIYIEGSAWSVSEKYILACDS+TLLVK
Sbjct  254   QDWGARVFAQDWLKEQKEGYKQSDLASQCAHRYKIYIEGSAWSVSEKYILACDSVTLLVK  313

Query  1356  PHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKM  1535
             P+YYDF+TR LMP++HYWPI+DDDKC+SIKHAVDWGN+H Q+AQ IG   S +I +ELKM
Sbjct  314   PYYYDFFTRSLMPLQHYWPIKDDDKCRSIKHAVDWGNSHQQEAQAIGKRASNFILDELKM  373

Query  1536  EYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTT  1715
             +YVYDYMFHLLSEYAKLLKYKPTVP  AVELCSE M C + G EK+FM +SLVK  PS +
Sbjct  374   DYVYDYMFHLLSEYAKLLKYKPTVPKRAVELCSEAMACPSQGFEKKFMTDSLVK-GPSVS  432

Query  1716  APCTMPPPFDPATL  1757
              PCTMPPP+DPA+L
Sbjct  433   NPCTMPPPYDPASL  446



>ref|XP_009601780.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009601785.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Nicotiana 
tomentosiformis]
Length=535

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/515 (64%), Positives = 373/515 (72%), Gaps = 53/515 (10%)
 Frame = +3

Query  342   AIKTLPRSSLAVFFFMVLCVGAFVSTRLLDST-----------------VTAQHPTRLSH  470
             A KT  RSS  +F  ++L +G FVS RLL S+                 +T  +PT  + 
Sbjct  2     ATKTTLRSSRTIFISVLLFIGVFVSMRLLHSSFEITTAGYSPRKSILTPITRNNPTDTTT  61

Query  471   ------QKIIE-----NEI--------PP-------LNCSLRTPMASCPANYYPSSKLTR  572
                   QK +E     N          PP       LNC L     +CPA+YYPS     
Sbjct  62    ANSKEPQKKLELVTFHNHTDATPAVSEPPQKKLEVQLNCKLGNLTRTCPASYYPS-----  116

Query  573   TRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNG  752
                +  D    T +     CPDYFRWIYDDLW WRE+GI+ EMVM ARRTANFRLVIV G
Sbjct  117   ---KSTDQNQATSSTPPPACPDYFRWIYDDLWPWRETGITEEMVMQARRTANFRLVIVKG  173

Query  753   IAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTT  932
              AY   Y+KSFQSRD FTLWGILQ+LRRYPGKVPDLDLMFD VDWPVIK + Y   +   
Sbjct  174   RAYVETYQKSFQSRDQFTLWGILQMLRRYPGKVPDLDLMFDCVDWPVIKTEFYRRPNAPA  233

Query  933   APPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYW  1112
              P  LFRYCG+ A+ DIVFPDWSFWGWPEIN+KPWE LSK L+EGN K+KW DRE YAYW
Sbjct  234   PP-PLFRYCGNNASLDIVFPDWSFWGWPEINLKPWETLSKNLREGNEKVKWTDREQYAYW  292

Query  1113  KGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEG  1292
             KGNP VA TR DLLKCNVSEKQDW AR+YAQDWIQE +QGY+QS+LA QCIHRYKIYIEG
Sbjct  293   KGNPVVAETRMDLLKCNVSEKQDWNARLYAQDWIQEQRQGYKQSDLASQCIHRYKIYIEG  352

Query  1293  SAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNH  1472
             SAWSVSEKYILACDS+TLLV+PHYYDFYTRGLMP+KHYWP++D+DKC+SIKHAVDWGN H
Sbjct  353   SAWSVSEKYILACDSVTLLVEPHYYDFYTRGLMPLKHYWPVKDNDKCRSIKHAVDWGNTH  412

Query  1473  HQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCG  1652
              Q+AQ IG A S +IQE+LKM+YVYDYMFHLLSEYAKLLKYKP VP +AVELCSE M C 
Sbjct  413   QQEAQAIGKAASDFIQEQLKMDYVYDYMFHLLSEYAKLLKYKPVVPRKAVELCSEAMACP  472

Query  1653  ANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             A G+ K+FM+ESLV+  PS   PCTMPPPF PA L
Sbjct  473   AEGVTKKFMLESLVE-GPSDAIPCTMPPPFGPAGL  506



>emb|CDP05200.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/509 (62%), Positives = 385/509 (76%), Gaps = 27/509 (5%)
 Frame = +3

Query  273   MRETSE----GARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTV  440
             MRE  +    G+ ++R   +  W P    K L ++++ +F  ++LC+GAF STR+LDS+V
Sbjct  1     MREQGQSMLNGSGVHRPSWEKIWLP----KVLAKNTIGIFLLILLCIGAFFSTRVLDSSV  56

Query  441   TAQHPTRL---------SHQKIIENEIP-PLNCSLRTPMASCPANYYPSSKLTRTRTRIQ  590
              +     L         SH +    ++  PLNCSL     +CPANYYPS    R   R  
Sbjct  57    ISLSINSLKKSTFSAITSHNQPGNKQVEIPLNCSLGDATLTCPANYYPS----RYSARNP  112

Query  591   DspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHN  770
             D PS     +   CPDYFRWI++DL  W+E+GI+  MV  A RTANFRLVI+NG A+   
Sbjct  113   DPPSAATQPT---CPDYFRWIHEDLSPWKETGITEAMVNMANRTANFRLVILNGTAFVET  169

Query  771   YRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALF  950
             Y K+FQ+RDTFTLWGILQLLRRYPG+VPDLDLMFD VDWPVI K S+      TAPP LF
Sbjct  170   YEKAFQTRDTFTLWGILQLLRRYPGQVPDLDLMFDCVDWPVINKDSHS-GPNATAPPPLF  228

Query  951   RYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEV  1130
             RYC ++ T DIVFPDWSFWGWPEINIKPWE LSK+LKEGN + +WVDREPYAYWKGNP+V
Sbjct  229   RYCANDTTLDIVFPDWSFWGWPEINIKPWEALSKDLKEGNERSRWVDREPYAYWKGNPQV  288

Query  1131  AATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVS  1310
             A  R DLLKCNVS++QDW AR+YAQDW +E +QGY++S+LA QCIHRYKIYIEGSAWSVS
Sbjct  289   AEKRMDLLKCNVSDQQDWNARIYAQDWGREQQQGYKKSDLASQCIHRYKIYIEGSAWSVS  348

Query  1311  EKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQE  1490
             EKYILACDS+TLLV P YYDF+TRGL P++HYWPIR+D+KC++IKHAVDWGN+  ++AQ 
Sbjct  349   EKYILACDSVTLLVTPKYYDFFTRGLTPLQHYWPIREDNKCRAIKHAVDWGNSKIEKAQA  408

Query  1491  IGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEK  1670
             IG A S ++Q+ELKM++VYDYMFHLL EYAKLLKYKP+VPP+A+ELCSE M C A G EK
Sbjct  409   IGKAASNFVQDELKMDFVYDYMFHLLREYAKLLKYKPSVPPKAIELCSESMACPAQGQEK  468

Query  1671  QFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +FMM+S V+  PS+  PC MPPP+DPATL
Sbjct  469   KFMMDSTVR-GPSSETPCGMPPPYDPATL  496



>ref|XP_009793757.1| PREDICTED: O-glucosyltransferase rumi homolog [Nicotiana sylvestris]
 ref|XP_009793758.1| PREDICTED: O-glucosyltransferase rumi homolog [Nicotiana sylvestris]
 ref|XP_009793759.1| PREDICTED: O-glucosyltransferase rumi homolog [Nicotiana sylvestris]
 ref|XP_009793760.1| PREDICTED: O-glucosyltransferase rumi homolog [Nicotiana sylvestris]
 ref|XP_009793761.1| PREDICTED: O-glucosyltransferase rumi homolog [Nicotiana sylvestris]
Length=535

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/515 (63%), Positives = 366/515 (71%), Gaps = 53/515 (10%)
 Frame = +3

Query  342   AIKTLPRSSLAVFFFMVLCVGAFVSTRLLDS----------------------------T  437
             A KT  RSS+ +F  ++L +G  VS RLL S                            T
Sbjct  2     ASKTTVRSSVTIFISILLFIGVIVSMRLLHSSFEITIAGYSPGKSILTPIACHNPTDTTT  61

Query  438   VTAQHPTRLSHQKIIENEI--------PP-------LNCSLRTPMASCPANYYPSSKLTR  572
               ++ P +        N          PP       LNC+L     +CPA+YYPS     
Sbjct  62    ANSKEPQKKLELATFHNHTDATPAVSKPPQKKLEVQLNCTLGNLTRTCPASYYPS-----  116

Query  573   TRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNG  752
                +  D    T     S CPDYFRWIYDDLW WRE+GI+ EMVM ARRTANFRLVIV G
Sbjct  117   ---KFTDQNQATSLTPPSTCPDYFRWIYDDLWPWRETGITEEMVMRARRTANFRLVIVKG  173

Query  753   IAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTT  932
              AY   YRKSFQSRD FTLWGILQ+LRRYPGKVPDLDLMFD VDWPVI  + Y   +   
Sbjct  174   RAYVETYRKSFQSRDQFTLWGILQMLRRYPGKVPDLDLMFDCVDWPVIHTEFYRRPNAPP  233

Query  933   APPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYW  1112
              P  LFRYCG+  + DIVFPDWSFWGWPEINIKPWE LSK+L++GN K+KW DRE YAYW
Sbjct  234   PP-PLFRYCGNNTSLDIVFPDWSFWGWPEINIKPWETLSKDLRKGNEKVKWTDRERYAYW  292

Query  1113  KGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEG  1292
             KGNP VA TR  LLKCNVSEKQDW ARVYAQDWIQE KQGY+QS+LA QCIHRYKIYIEG
Sbjct  293   KGNPVVAETRMALLKCNVSEKQDWNARVYAQDWIQEQKQGYKQSDLASQCIHRYKIYIEG  352

Query  1293  SAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNH  1472
             SAWSVSEKYILACDS+TLLV+PHYYDFYTRGLMP+KHYWP++D+DKC+SIKHAVDWGN H
Sbjct  353   SAWSVSEKYILACDSVTLLVEPHYYDFYTRGLMPLKHYWPVKDNDKCRSIKHAVDWGNTH  412

Query  1473  HQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCG  1652
              Q+AQ+IG A S +IQE+LKM+YVYDYMFHLLSEYAKLLKYKP VP  AVELCSE M C 
Sbjct  413   QQEAQDIGKAASNFIQEQLKMDYVYDYMFHLLSEYAKLLKYKPIVPRNAVELCSEAMACA  472

Query  1653  ANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             A G+ ++FM+ESLV+  PS   PCTMPPPF PA L
Sbjct  473   AEGVTRKFMLESLVE-GPSDAIPCTMPPPFGPAGL  506



>ref|XP_002321919.2| hypothetical protein POPTR_0015s13090g [Populus trichocarpa]
 gb|EEF06046.2| hypothetical protein POPTR_0015s13090g [Populus trichocarpa]
Length=506

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/490 (63%), Positives = 377/490 (77%), Gaps = 22/490 (4%)
 Frame = +3

Query  306   RHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHP---TRLSHQ-  473
             R      WRP   +K   RSS+ +F  + L VGA V TRLLDSTVT       T L+ + 
Sbjct  4     RFLESMIWRPF--MKLPARSSVVIFLLLFLIVGALVCTRLLDSTVTGGSSVVKTFLTDKI  61

Query  474   -KIIENEIP-PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFR  647
              KI  N+   P+NC+   P   CP NY  +++    R  +              CP++FR
Sbjct  62    PKITRNKTEYPVNCTAFNPTRKCPLNYPTNTQEGPDRPSVS------------TCPEHFR  109

Query  648   WIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQL  827
             WI++DL  W  +GISR+MV  A+RTANFRLVIVNG AY   YRKSFQ+RDTFT+WGI+QL
Sbjct  110   WIHEDLRPWAHTGISRDMVERAKRTANFRLVIVNGKAYMERYRKSFQTRDTFTVWGIIQL  169

Query  828   LRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFW  1007
             LR+YPGK+PDLD+MFD VDWPVI+   Y      T+PPALFRYCGD+ + D+VFPDWSFW
Sbjct  170   LRKYPGKLPDLDMMFDCVDWPVIRSSDYS-GPNATSPPALFRYCGDDDSLDVVFPDWSFW  228

Query  1008  GWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWG  1187
             GWPEINIKPWE LS +LKEGN   KW++REPYAYWKGNP VAATR+DL+KC+ SE QDW 
Sbjct  229   GWPEINIKPWESLSNDLKEGNKITKWMEREPYAYWKGNPSVAATRQDLMKCHASETQDWN  288

Query  1188  ARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYY  1367
             ARVYAQDWI+E +QGYQQSNLA+QC+H+YKIYIEGSAWSVSEKYILACDS+TLLVKPHYY
Sbjct  289   ARVYAQDWIKESQQGYQQSNLANQCVHKYKIYIEGSAWSVSEKYILACDSVTLLVKPHYY  348

Query  1368  DFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVY  1547
             DF+TR L+P +HYWPI++DDKC+SIK AV+WGNNH ++AQ +G A S++IQE+LKM+YVY
Sbjct  349   DFFTRSLVPNRHYWPIKEDDKCRSIKFAVEWGNNHSEEAQAMGKAASEFIQEDLKMDYVY  408

Query  1548  DYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCT  1727
             DYMFHLL+EYAKLL +KPT+P  A+ELC+E M C ANGLEK+FMM+S+V  +P+ T+PCT
Sbjct  409   DYMFHLLNEYAKLLTFKPTIPGRAIELCAEAMACPANGLEKKFMMDSMV-MSPADTSPCT  467

Query  1728  MPPPFDPATL  1757
             MPPP+DP +L
Sbjct  468   MPPPYDPLSL  477



>ref|XP_004234394.1| PREDICTED: O-glucosyltransferase rumi homolog [Solanum lycopersicum]
Length=514

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/492 (64%), Positives = 374/492 (76%), Gaps = 31/492 (6%)
 Frame = +3

Query  345   IKTLPRSSLAVFFFMVLCVGAFVSTRLL----DSTVTAQHPTR-----------------  461
             + T   SSL +F  ++L +GA  ST  L    +++ T   P +                 
Sbjct  1     MATKTTSSLTLFVSLLLFIGAIFSTHFLYSPFNNSTTGYSPRKTIVTRVIRYNHTYATPS  60

Query  462   LSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDY  641
             +S Q + + EI  LNC+L     +CPA+YYP  K T      + + S T +     CPDY
Sbjct  61    VSKQPLKKLEIQ-LNCTLGNLTRTCPASYYPL-KFT------EQNESSTSSSPPPTCPDY  112

Query  642   FRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGIL  821
             FRWIYDDLW WRE+GI++EMVM A+RTA+FRLVIVNG AY   Y K+FQSRDTFTLWGIL
Sbjct  113   FRWIYDDLWHWRETGITKEMVMRAKRTADFRLVIVNGRAYVETYHKAFQSRDTFTLWGIL  172

Query  822   QLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWS  1001
             Q+LRRYPGKVPDLDLMFD VDWPV+K + Y  +     PP LFRYCG++++ DIVFPDWS
Sbjct  173   QMLRRYPGKVPDLDLMFDCVDWPVLKTEFY-RHPKAPVPPPLFRYCGNDSSLDIVFPDWS  231

Query  1002  FWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQD  1181
             FWGWPEINIKPWE LSK+LK+GN K+KW +REPYAYWKGNP VA TR+DLLKCN SEKQD
Sbjct  232   FWGWPEINIKPWETLSKDLKKGNEKMKWTEREPYAYWKGNPVVAETRRDLLKCNASEKQD  291

Query  1182  WGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPH  1361
             W ARVYAQDW Q  KQGY+QS+LA+QCIHRYKIY+EGSAWSVSEKYILACDS+TLL+KP 
Sbjct  292   WNARVYAQDWAQAEKQGYKQSDLANQCIHRYKIYVEGSAWSVSEKYILACDSVTLLIKPQ  351

Query  1362  YYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEY  1541
             YYDFYTRGLMP++HYWP++D DKC+SIKHAVDWGN H Q+AQ IG A S +IQE+LKM+Y
Sbjct  352   YYDFYTRGLMPLQHYWPVKDKDKCRSIKHAVDWGNTHEQEAQAIGKAASDFIQEQLKMDY  411

Query  1542  VYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAP  1721
             VYDYMFHLLSEYAKLLKYKPTVP +AVELCSE M C A GL K+FM+ES+V+  PS   P
Sbjct  412   VYDYMFHLLSEYAKLLKYKPTVPRKAVELCSEAMACSAEGLTKKFMLESMVE-GPSDATP  470

Query  1722  CTMPPPFDPATL  1757
             C MPPP+ PA L
Sbjct  471   CNMPPPYGPAGL  482



>ref|XP_007038693.1| Glycosyltransferase isoform 2 [Theobroma cacao]
 gb|EOY23194.1| Glycosyltransferase isoform 2 [Theobroma cacao]
Length=498

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/511 (63%), Positives = 381/511 (75%), Gaps = 31/511 (6%)
 Frame = +3

Query  267   LKMRETS----EGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDS  434
             + MRE +     G+ L+  FT+T WRP    K+  RSS     F+VL VGAF ST LLD+
Sbjct  3     INMRENNMQQGNGSGLFSQFTETIWRPF--AKSSARSSAIFVVFIVLLVGAF-STHLLDT  59

Query  435   TV----TAQHP------TRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTR  584
             T      AQ P      +R + +K  +    PLNC+ R    +CP N           T 
Sbjct  60    TTFLGSLAQKPMLSTRTSRGNPKKPRQQRDIPLNCTARNLTRACPTN---------DPTA  110

Query  585   IQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYY  764
             I++ P  +       CPDYFRWI++DL  W  +GIS +M+  A +TANFRLV+VNG AY 
Sbjct  111   IEEEPDSSLNAM---CPDYFRWIHEDLRPWAYTGISMDMLKRAEKTANFRLVVVNGRAYV  167

Query  765   HNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPA  944
               YR+SFQ+RD FTLWGILQLLRRYPGKVPDLDLMFD VDWPVIK   Y   + TT PP 
Sbjct  168   QRYRRSFQTRDVFTLWGILQLLRRYPGKVPDLDLMFDCVDWPVIKTSDYGGPNATTPPP-  226

Query  945   LFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNP  1124
             LFRYC D+ T DIVFPDWSFWGWPEINIKPW  L  +L EGN ++ W  REP+AYWKGNP
Sbjct  227   LFRYCKDDETLDIVFPDWSFWGWPEINIKPWVPLLNDLMEGNKRMGWEGREPHAYWKGNP  286

Query  1125  EVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWS  1304
              VA TR+DLLKCNVS+KQDWGARVYAQDW +E +QGY+QS+LA+QCIHR+KIYIEGSAWS
Sbjct  287   NVATTRQDLLKCNVSDKQDWGARVYAQDWARESQQGYKQSDLANQCIHRFKIYIEGSAWS  346

Query  1305  VSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQA  1484
             VSEKYILACDSLTLLVKP YYDF+TR L PM+HYWPI+DDDKC+SIKHAVDWGN H Q+A
Sbjct  347   VSEKYILACDSLTLLVKPRYYDFFTRSLEPMRHYWPIKDDDKCRSIKHAVDWGNGHQQEA  406

Query  1485  QEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGL  1664
             Q IG A S++I+E LKM+YVYDYMFHLL+EYAKLL+YKPTVP +AVELCSE M C A GL
Sbjct  407   QAIGKAASEFIKEGLKMDYVYDYMFHLLNEYAKLLRYKPTVPRKAVELCSETMACPAEGL  466

Query  1665  EKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +K+FMMES+VK  PS T+PCTMPPP+DPA+L
Sbjct  467   QKKFMMESMVK-GPSVTSPCTMPPPYDPASL  496



>ref|XP_007038692.1| Glycosyltransferase isoform 1 [Theobroma cacao]
 gb|EOY23193.1| Glycosyltransferase isoform 1 [Theobroma cacao]
Length=522

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/511 (63%), Positives = 381/511 (75%), Gaps = 31/511 (6%)
 Frame = +3

Query  267   LKMRETS----EGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDS  434
             + MRE +     G+ L+  FT+T WRP    K+  RSS     F+VL VGAF ST LLD+
Sbjct  3     INMRENNMQQGNGSGLFSQFTETIWRPF--AKSSARSSAIFVVFIVLLVGAF-STHLLDT  59

Query  435   TV----TAQHP------TRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTR  584
             T      AQ P      +R + +K  +    PLNC+ R    +CP N           T 
Sbjct  60    TTFLGSLAQKPMLSTRTSRGNPKKPRQQRDIPLNCTARNLTRACPTN---------DPTA  110

Query  585   IQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYY  764
             I++ P  +       CPDYFRWI++DL  W  +GIS +M+  A +TANFRLV+VNG AY 
Sbjct  111   IEEEPDSSLNAM---CPDYFRWIHEDLRPWAYTGISMDMLKRAEKTANFRLVVVNGRAYV  167

Query  765   HNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPA  944
               YR+SFQ+RD FTLWGILQLLRRYPGKVPDLDLMFD VDWPVIK   Y   + TT PP 
Sbjct  168   QRYRRSFQTRDVFTLWGILQLLRRYPGKVPDLDLMFDCVDWPVIKTSDYGGPNATTPPP-  226

Query  945   LFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNP  1124
             LFRYC D+ T DIVFPDWSFWGWPEINIKPW  L  +L EGN ++ W  REP+AYWKGNP
Sbjct  227   LFRYCKDDETLDIVFPDWSFWGWPEINIKPWVPLLNDLMEGNKRMGWEGREPHAYWKGNP  286

Query  1125  EVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWS  1304
              VA TR+DLLKCNVS+KQDWGARVYAQDW +E +QGY+QS+LA+QCIHR+KIYIEGSAWS
Sbjct  287   NVATTRQDLLKCNVSDKQDWGARVYAQDWARESQQGYKQSDLANQCIHRFKIYIEGSAWS  346

Query  1305  VSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQA  1484
             VSEKYILACDSLTLLVKP YYDF+TR L PM+HYWPI+DDDKC+SIKHAVDWGN H Q+A
Sbjct  347   VSEKYILACDSLTLLVKPRYYDFFTRSLEPMRHYWPIKDDDKCRSIKHAVDWGNGHQQEA  406

Query  1485  QEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGL  1664
             Q IG A S++I+E LKM+YVYDYMFHLL+EYAKLL+YKPTVP +AVELCSE M C A GL
Sbjct  407   QAIGKAASEFIKEGLKMDYVYDYMFHLLNEYAKLLRYKPTVPRKAVELCSETMACPAEGL  466

Query  1665  EKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +K+FMMES+VK  PS T+PCTMPPP+DPA+L
Sbjct  467   QKKFMMESMVK-GPSVTSPCTMPPPYDPASL  496



>gb|AED99886.1| glycosyltransferase [Panax notoginseng]
Length=546

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/514 (63%), Positives = 374/514 (73%), Gaps = 37/514 (7%)
 Frame = +3

Query  291   GARLYRHFTDTNWRPLPAIKTLPRSSLAVFF-----FMVLCVGAFVSTRLLDSTVTAQHP  455
               +LYR+  +    PL  IK L  ++ + +F       +L +GAF+STRLLDSTVT    
Sbjct  18    SGKLYRYLKEMV-TPLLTIK-LSSATFSYYFRLSTVITLLFLGAFISTRLLDSTVTTSIT  75

Query  456   ----------TRLSH-----QKIIENEIP-----PLNCSLRTPMASCPANYYPSSKLTRT  575
                       T+ +H       II  + P     PLNCS    + +CPANYYP +     
Sbjct  76    GNSSQSSILVTKTTHIYPEITPIIRKKPPRKVEIPLNCSTGNLIRTCPANYYPRT-----  130

Query  576   RTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGI  755
                IQD    +       CP+YFRWIY+DL  WRE+GI+REMV  ARRTANFRLVI+NG 
Sbjct  131   -FNIQDQDHSSIPPV--SCPEYFRWIYEDLRPWRETGITREMVERARRTANFRLVILNGR  187

Query  756   AYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTA  935
             AY   ++KSFQSRD FTLWGILQLLR YPGKVPDLDLMFD VDWPVI  + Y      TA
Sbjct  188   AYVETHQKSFQSRDVFTLWGILQLLRMYPGKVPDLDLMFDCVDWPVIISRFY-HGPNATA  246

Query  936   PPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWK  1115
             PP LFRYC D++T DIVFPDW+FWGWPEINIKPW  L K+LKEGN   +W+DREPYAYWK
Sbjct  247   PPPLFRYCADDSTLDIVFPDWTFWGWPEINIKPWGSLLKDLKEGNTGTQWMDREPYAYWK  306

Query  1116  GNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGS  1295
             GNP VA TR DLLKCNVS+KQDW ARVYA DW +E + GY+QS+LA QCIHRYKIYIEGS
Sbjct  307   GNPIVAKTRMDLLKCNVSDKQDWNARVYAXDWARESQLGYKQSDLASQCIHRYKIYIEGS  366

Query  1296  AWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHH  1475
             AWSVSEKYILACDS+TL VKP YYDF+TRGLMP+ HYWPIRDDDKC+SIK AVDWGNNH 
Sbjct  367   AWSVSEKYILACDSVTLXVKPRYYDFFTRGLMPVHHYWPIRDDDKCRSIKFAVDWGNNHK  426

Query  1476  QQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGA  1655
             Q+A  IG   S +IQE+LKM+YVYDYMFHLL+EYAKLL+YKPTVPP+AVELCSE M C A
Sbjct  427   QKAHSIGKEASNFIQEDLKMDYVYDYMFHLLNEYAKLLRYKPTVPPKAVELCSETMACPA  486

Query  1656  NGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              G  K+FMMES+VK  P+  +PC M PP+DP TL
Sbjct  487   EGFTKKFMMESIVK-GPTDKSPCVMQPPYDPPTL  519



>ref|XP_010087567.1| hypothetical protein L484_001025 [Morus notabilis]
 gb|EXB29382.1| hypothetical protein L484_001025 [Morus notabilis]
Length=515

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/486 (64%), Positives = 381/486 (78%), Gaps = 15/486 (3%)
 Frame = +3

Query  303   YRHFTDTNWRPLPAIKTLPRS-SLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKI  479
             + +FTDT WRP   +K+  +S ++   F   L VGAFVSTRLL++   A        +K 
Sbjct  15    WSNFTDTIWRPF--LKSSAKSPAVLFVFLFFLFVGAFVSTRLLNTANLAGPTIAKISEKS  72

Query  480   IENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYD  659
              +    PLNCS  +P  +CPANY        T    QD        +   CPDYFRWIY+
Sbjct  73    RQRIGIPLNCSAYSPTRTCPANY-------PTTYNKQDDLDRPLLPT---CPDYFRWIYE  122

Query  660   DLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRY  839
             DL  W  +GISR+MV  A+RTANFRLVIVNG AY   ++K+FQ+RD FTLWGILQLLR+Y
Sbjct  123   DLRPWAYTGISRDMVERAKRTANFRLVIVNGKAYVETFQKAFQTRDVFTLWGILQLLRKY  182

Query  840   PGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPE  1019
             PG+VPDL+LMFD VDWPV+  ++Y   D TT PP LFRYCGD++T DIVFPDWSFWGWPE
Sbjct  183   PGRVPDLELMFDCVDWPVVLSKAYSGPDATTPPP-LFRYCGDDSTLDIVFPDWSFWGWPE  241

Query  1020  INIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVY  1199
              NIKPWE L KEL+EGN K KWV+RE YAYWKGNP VAATR+DLLKCNVS+KQDW AR+Y
Sbjct  242   TNIKPWEALLKELEEGNKKSKWVEREAYAYWKGNPVVAATRQDLLKCNVSDKQDWNARLY  301

Query  1200  AQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYT  1379
             AQDW++E K+GY+QS+LA+QCIHRYKIYIEGSAWSVSEKYILACDS+TL+VKPHYYDF+T
Sbjct  302   AQDWLKESKEGYKQSDLANQCIHRYKIYIEGSAWSVSEKYILACDSVTLIVKPHYYDFFT  361

Query  1380  RGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMF  1559
             RGL+PM+HYWPI+DDDKC+SIK AVDWGN+H ++A+ IG A S++IQ++LKMEYVYDYMF
Sbjct  362   RGLVPMQHYWPIKDDDKCRSIKFAVDWGNSHKKKAKSIGKAASRFIQDDLKMEYVYDYMF  421

Query  1560  HLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPP  1739
             HLL+EYAKLLK+KP++P +AVE CSE M C A G+ K+FMMES+VK  P+ ++PCTMPP 
Sbjct  422   HLLNEYAKLLKFKPSIPEKAVEFCSESMACTAEGIGKKFMMESMVK-GPADSSPCTMPPS  480

Query  1740  FDPATL  1757
             ++P++L
Sbjct  481   YNPSSL  486



>ref|XP_002510788.1| KDEL motif-containing protein 1 precursor, putative [Ricinus 
communis]
 gb|EEF51390.1| KDEL motif-containing protein 1 precursor, putative [Ricinus 
communis]
Length=528

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/511 (61%), Positives = 379/511 (74%), Gaps = 37/511 (7%)
 Frame = +3

Query  276   RETSEGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVG-AFVSTRLLDSTV----  440
             R    G+  Y HF D   +  P++K LP S +++F F+++C+  AF++TR LDS+     
Sbjct  9     RSLQYGSGFYSHFID---KISPSLK-LP-SRISIFLFLLICLASAFLTTRFLDSSSAFTG  63

Query  441   -TAQ-----------HPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTR  584
              +AQ           +PT +S   + +  IP LNC+      +CP+NY  +      R  
Sbjct  64    SSAQKPLITTKSAPTNPTLISKNALNKINIP-LNCAAFNLTRTCPSNYPTTFTENPDRPS  122

Query  585   IQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYY  764
             +              CP+Y+RWIY+DL  W  +GISR+MV  A+ TANFRLVIVNG AY 
Sbjct  123   VS------------ACPEYYRWIYEDLRPWARTGISRDMVERAKTTANFRLVIVNGKAYV  170

Query  765   HNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPA  944
               YR++FQ+RD FTLWGILQLLRRYPGKVPDL+LMFD VDWPVIK  +Y       APP 
Sbjct  171   EKYRRAFQTRDVFTLWGILQLLRRYPGKVPDLELMFDCVDWPVIKSSNYS-GPNAMAPPP  229

Query  945   LFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNP  1124
             LFRYCGD+ T D+VFPDWSFWGW EINIKPWE L +ELKEGN K +W++REPYAYWKGNP
Sbjct  230   LFRYCGDDDTLDVVFPDWSFWGWSEINIKPWERLLRELKEGNEKRRWMEREPYAYWKGNP  289

Query  1125  EVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWS  1304
              VA TR+DL+KCNVSE+QDW ARVYAQDWI+E +QGY+QSNLA QC+HRYKIYIEGSAWS
Sbjct  290   AVAETRQDLMKCNVSEQQDWNARVYAQDWIKELQQGYKQSNLASQCMHRYKIYIEGSAWS  349

Query  1305  VSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQA  1484
             VSEKYILACDS+TLLVKPHYYDF+TR L P+ HYWPI+D DKC+SIK AVDWGNNH Q+A
Sbjct  350   VSEKYILACDSVTLLVKPHYYDFFTRSLRPIHHYWPIKDYDKCRSIKFAVDWGNNHKQKA  409

Query  1485  QEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGL  1664
             Q IG A S++IQEELKM+YVYDYMFHLL+EYAKLL +KP +P +AVELCSE M C ANG+
Sbjct  410   QAIGKAASEFIQEELKMDYVYDYMFHLLNEYAKLLTFKPVIPRKAVELCSESMACPANGI  469

Query  1665  EKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             EK+FMMES+V+  P+ T PC M PP+DP+ L
Sbjct  470   EKEFMMESMVQ-GPAETNPCIMLPPYDPSAL  499



>ref|XP_011048719.1| PREDICTED: O-glucosyltransferase rumi homolog [Populus euphratica]
Length=506

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/479 (62%), Positives = 367/479 (77%), Gaps = 20/479 (4%)
 Frame = +3

Query  339   PAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIP------P  500
             P +K   RSS  +F  + L VGA V TRLLDSTV        +   +   +IP      P
Sbjct  13    PFMKLPARSSAVIFLLLFLLVGALVCTRLLDSTVIGGSTVVKTFLTVKIPKIPRNKTEYP  72

Query  501   LNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRE  680
             +NC+   P   CP NY  +++    R  +              CP++FRWI++DL  W  
Sbjct  73    VNCTAFNPTRKCPTNYPTNTQEGPDRPSLS------------TCPEHFRWIHEDLRPWAH  120

Query  681   SGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDL  860
             +GISR+MV  A+RTANFRLVIVNG AY   YRKSFQ+RDTFT+WGI+QLLR+YPGK+PDL
Sbjct  121   TGISRDMVERAKRTANFRLVIVNGKAYMERYRKSFQTRDTFTVWGIVQLLRKYPGKLPDL  180

Query  861   DLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWE  1040
             D+MFD VDWPV++   Y      T+PPALFRYCGD+ + D+VFPDWSFWGWPEINIKPWE
Sbjct  181   DMMFDCVDWPVVRSSDYS-GPNATSPPALFRYCGDDDSLDVVFPDWSFWGWPEINIKPWE  239

Query  1041  GLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQE  1220
              LS +LK GN   KW++REPYAYWKGNP VAATR+DL+KC+ SE QDW ARVYAQDWI+E
Sbjct  240   SLSNDLKAGNKITKWMEREPYAYWKGNPSVAATRQDLMKCHASETQDWNARVYAQDWIKE  299

Query  1221  HKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMK  1400
              +QGYQQSNLA+QC+H+YKIYIEGSAWSVSEKYILACDS+TLLVKPHYYDF+TR L+P +
Sbjct  300   SQQGYQQSNLANQCVHKYKIYIEGSAWSVSEKYILACDSVTLLVKPHYYDFFTRSLVPNR  359

Query  1401  HYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYA  1580
             HYWPI++DDKC+SIK AV+WGNNH ++AQ +G A S++IQE LKM+YVYDYMFHLL+EYA
Sbjct  360   HYWPIKEDDKCRSIKFAVEWGNNHSEEAQAMGKAASEFIQENLKMDYVYDYMFHLLNEYA  419

Query  1581  KLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             KLL +KPT+P  A+ELC+E M C ANGLEK+FMM+S+V  +P+ T+PCTMPPP+DP +L
Sbjct  420   KLLTFKPTIPGRAIELCAEAMACPANGLEKKFMMDSMV-MSPADTSPCTMPPPYDPPSL  477



>gb|KDP22278.1| hypothetical protein JCGZ_26109 [Jatropha curcas]
Length=496

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/482 (64%), Positives = 365/482 (76%), Gaps = 31/482 (6%)
 Frame = +3

Query  354   LPRSSLAVFF-FMVLCVGAFVSTRLLDSTV-TAQHPTRLSHQKIIENEIP---------P  500
             LP     VF  F+ L VGAFVSTRLLDSTV T         ++ I  EIP         P
Sbjct  3     LPARLFTVFLVFLFLIVGAFVSTRLLDSTVLTGGSAPEPLLKRTISPEIPKKPSNVVEIP  62

Query  501   LNCSLRTPMASCPANY---YPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWA  671
             L+C+       CPANY   +P +   R+ +                CP+YFRWIY+DL  
Sbjct  63    LHCAAFNRTRRCPANYPVTFPENLDRRSLS---------------TCPEYFRWIYEDLSP  107

Query  672   WRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKV  851
             W  +GI+R+M+  ARRTANFRLVI+ G  Y   Y+K+FQ+RD FTLWGI+QLLRRYPGKV
Sbjct  108   WARTGITRDMLERARRTANFRLVILKGKVYIERYQKAFQTRDVFTLWGIIQLLRRYPGKV  167

Query  852   PDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIK  1031
             PDL+LMFD VDWPVIK   Y      TAPP LFRYCGD+ T+DIVFPDWSFWGWPEINIK
Sbjct  168   PDLELMFDCVDWPVIKSSDYS-GPNATAPPPLFRYCGDDDTFDIVFPDWSFWGWPEINIK  226

Query  1032  PWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDW  1211
             PWE L  +LKEGN K +W++REPYAYWKGNP VAA+R+DL+KCNVSE+QDW ARVYAQDW
Sbjct  227   PWERLLNDLKEGNKKTRWMEREPYAYWKGNPAVAASRQDLMKCNVSEQQDWNARVYAQDW  286

Query  1212  IQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLM  1391
             I+E ++GY+QS+LA QC HRYKIYIEGSAWSVS+KYILACDSLTLLVKPHYYDF+TR L 
Sbjct  287   IKESQEGYKQSDLASQCTHRYKIYIEGSAWSVSDKYILACDSLTLLVKPHYYDFFTRSLN  346

Query  1392  PMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLS  1571
             P+ HYWPI+DDDKC+SIK AVDWGN+H ++AQEIG A SK+IQEELKM+YVYDYMFHLL+
Sbjct  347   PIDHYWPIKDDDKCRSIKFAVDWGNSHKRKAQEIGKAASKFIQEELKMDYVYDYMFHLLN  406

Query  1572  EYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPA  1751
             +YAKLL +KP  PP+A+ELCSE M C  NG+ K+FM+ESLVK +P  T+PCT+ PP DPA
Sbjct  407   QYAKLLTFKPVRPPKAIELCSESMACPFNGVGKEFMIESLVK-SPEETSPCTILPPHDPA  465

Query  1752  TL  1757
             +L
Sbjct  466   SL  467



>ref|XP_010662756.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Vitis 
vinifera]
Length=525

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/503 (64%), Positives = 379/503 (75%), Gaps = 29/503 (6%)
 Frame = +3

Query  291   GARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQH------  452
             G+  +RHF+D+ WRP   +K   RSS  +FFF+ L +GAF+STRLLDS  +         
Sbjct  11    GSGYFRHFSDSIWRPF--MKAPARSSAILFFFLFLFIGAFLSTRLLDSATSLPTTSVEKP  68

Query  453   --PTRLSHQKIIENEIP------PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspspt  608
               PT  +H+     + P      PLNCS      +CP NY P++       R        
Sbjct  69    ILPTGTAHKPFKIPKKPPVKIEYPLNCSAGNLTRTCPRNY-PTAFSPEDPDR--------  119

Query  609   ptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQ  788
                S  +CP YFRWIY DL  W +SGI+REMV  A+RTA F+LVI+NG AY   Y+++FQ
Sbjct  120   --PSPPECPHYFRWIYGDLRPWMKSGITREMVERAKRTATFKLVILNGRAYVEKYQRAFQ  177

Query  789   SRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDE  968
             +RD FTLWGILQLLRRYPGKVPDL+LMFD VDWPVI+   Y      TAPP LFRYCGD+
Sbjct  178   TRDVFTLWGILQLLRRYPGKVPDLELMFDCVDWPVIQSNEY-RGPNATAPPPLFRYCGDD  236

Query  969   ATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKD  1148
             AT DIVFPDWSFWGWPEINIKPWE L K+LKEGN + +W++REPYAYWKGNP VAATR D
Sbjct  237   ATLDIVFPDWSFWGWPEINIKPWESLLKDLKEGNKRSRWMEREPYAYWKGNPAVAATRLD  296

Query  1149  LLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILA  1328
             LLKCNVS+KQDW ARVY QDWI+E ++GY+QS+LA QCIHRYKIYIEGSAWSVS+KYILA
Sbjct  297   LLKCNVSDKQDWNARVYTQDWIRESQEGYKQSDLASQCIHRYKIYIEGSAWSVSQKYILA  356

Query  1329  CDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGS  1508
             CDS+TLLVKPHYYDF+TR LMP+ HYWPIR+DDKC+SIK AVDWGN H Q+AQ IG A S
Sbjct  357   CDSVTLLVKPHYYDFFTRSLMPVHHYWPIREDDKCRSIKFAVDWGNRHKQKAQSIGKAAS  416

Query  1509  KYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMES  1688
              +IQE+LKM+ VYDYMFHLL+EYAKLLK+KPTVP +AVELCSE+M CGA GL+K+FMMES
Sbjct  417   DFIQEDLKMDNVYDYMFHLLNEYAKLLKFKPTVPEKAVELCSERMGCGAEGLKKKFMMES  476

Query  1689  LVKAAPSTTAPCTMPPPFDPATL  1757
             +VK  P   +PCTMPPPF P  L
Sbjct  477   MVK-YPMDASPCTMPPPFSPLEL  498



>ref|XP_008234246.1| PREDICTED: KDEL motif-containing protein 2-like [Prunus mume]
Length=525

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/503 (61%), Positives = 374/503 (74%), Gaps = 16/503 (3%)
 Frame = +3

Query  261   HILKMRETSEGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTV  440
             +I   R  S+   LY  F DT     P +K+  R S AVF  + L  GAFV TRLL+S +
Sbjct  6     NIYMQRLQSQRCYLYGPFVDTILMLRPFMKSPARFS-AVFVLLFLLFGAFVCTRLLNSPI  64

Query  441   ----TAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspspt  608
                 +A+ P   +          PLNC+      +CP+NY      T T    QDS  P 
Sbjct  65    LVDTSAEEPIITTRTSRKHPREIPLNCTAYDLTRTCPSNY-----PTATSQPEQDSDRPL  119

Query  609   ptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQ  788
             P      CP+YFRWI++DL  W  +GI+R+MV  A+RTANF+LVIVNG AY   Y+KSFQ
Sbjct  120   PPT----CPEYFRWIHEDLRPWAHTGITRDMVQRAKRTANFKLVIVNGKAYVEKYQKSFQ  175

Query  789   SRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDE  968
             +RD FT+WGILQLLRRYPG+VPDL+LMFD VDWPVI    Y      TAPP LFRYCGD+
Sbjct  176   TRDVFTMWGILQLLRRYPGQVPDLELMFDCVDWPVISSNDYS-GPNATAPPPLFRYCGDD  234

Query  969   ATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKD  1148
              + DIVFPDWSFWGW EINIKPWE L K+L++GN + +W+DR PYAYWKGNP VAATR+D
Sbjct  235   NSLDIVFPDWSFWGWAEINIKPWEVLLKDLEDGNKRKRWIDRAPYAYWKGNPSVAATRQD  294

Query  1149  LLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILA  1328
             LLKCNVS++QDW ARVYAQDW++E  +GY+QS+LA QC+ RYKIYIEGSAWSVS+KYILA
Sbjct  295   LLKCNVSDQQDWNARVYAQDWLRESSEGYKQSDLASQCVDRYKIYIEGSAWSVSDKYILA  354

Query  1329  CDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGS  1508
             CDS+TL+VKP YYDF+TR LMP+ HYWPI+DDDKC+SIK AVDWGN+H Q+AQ IG A S
Sbjct  355   CDSVTLIVKPRYYDFFTRSLMPVHHYWPIKDDDKCRSIKFAVDWGNSHKQKAQAIGKAAS  414

Query  1509  KYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMES  1688
             K IQEELKM+YVYDYMFHLL+EYAKLL++KPT+P +A+ELCSE M C A G EK+FMMES
Sbjct  415   KLIQEELKMDYVYDYMFHLLNEYAKLLQFKPTIPRKAIELCSEAMACQAQGTEKKFMMES  474

Query  1689  LVKAAPSTTAPCTMPPPFDPATL  1757
             +VK  P+ + PCTMPPP+ PA+L
Sbjct  475   MVK-GPAVSNPCTMPPPYGPASL  496



>ref|XP_009340024.1| PREDICTED: O-glucosyltransferase rumi homolog [Pyrus x bretschneideri]
Length=528

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/515 (60%), Positives = 379/515 (74%), Gaps = 34/515 (7%)
 Frame = +3

Query  267   LKMRETSEGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLD-----  431
             ++  E+++   LY HFT+      P +K+  R S+    F+ L  GAFV TRLL+     
Sbjct  1     MRENESTQRHSLYTHFTEAILYLRPFMKSPARFSVV---FVFLLFGAFVCTRLLNFPTLV  57

Query  432   -----STVTA----QHPTRLSHQKIIENEIP----PLNCSLRTPMASCPANYYPSSKLTR  572
                  S VT     +HP    +  I ++  P    PLNC+      +CP+NY        
Sbjct  58    DTSQGSVVTTGASQKHPPETPN--IPKSPPPKLEIPLNCTAYNLTRTCPSNY--------  107

Query  573   TRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNG  752
               T       P        CP+YFRWIY+DL  W ++GI+++MV SA+RTANF+LVI+NG
Sbjct  108   -PTTFSPEQDPDSPSPPPTCPEYFRWIYEDLRPWAQTGITKDMVQSAKRTANFKLVILNG  166

Query  753   IAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTT  932
              AY   Y+KSFQ+RD FTLWGILQLLRRYPGKVPDL+LMFD VDWPVI  + Y     +T
Sbjct  167   KAYLETYQKSFQTRDVFTLWGILQLLRRYPGKVPDLELMFDCVDWPVILSRFYS-QPNST  225

Query  933   APPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYW  1112
             APP LFRYCGD+ + DIVFPDWSFWGW EINIKPWE L K+L+EGN +  W+DREP+AYW
Sbjct  226   APPPLFRYCGDDRSLDIVFPDWSFWGWSEINIKPWELLLKDLEEGNSRSNWIDREPHAYW  285

Query  1113  KGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEG  1292
             KGNP VA TRKDLLKCNVSE+ DW AR+YAQDWI+E ++GY+QS+LA QC+HRYKIYIEG
Sbjct  286   KGNPFVAETRKDLLKCNVSEQTDWNARIYAQDWIKESREGYKQSDLASQCVHRYKIYIEG  345

Query  1293  SAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNH  1472
             SAWSVSEKYILACDS+TL+VKP YYDF+TRGL+P+ HYWPI+DDDKC+SIK AVDWGNNH
Sbjct  346   SAWSVSEKYILACDSVTLIVKPRYYDFFTRGLIPVHHYWPIKDDDKCRSIKFAVDWGNNH  405

Query  1473  HQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCG  1652
              ++AQ IG   SK IQE+LKM+YVYDYMFHLLSEY+KLL++KPT+P +AVELCSE MVC 
Sbjct  406   KKKAQSIGKEASKMIQEDLKMDYVYDYMFHLLSEYSKLLQFKPTIPRKAVELCSEAMVCQ  465

Query  1653  ANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             A GLEK+FMM+S+VK  P+   PC MPPP+DPA+L
Sbjct  466   AQGLEKKFMMDSMVK-GPAERNPCAMPPPYDPASL  499



>ref|XP_002268245.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Vitis 
vinifera]
 emb|CBI22745.3| unnamed protein product [Vitis vinifera]
Length=525

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/503 (64%), Positives = 378/503 (75%), Gaps = 29/503 (6%)
 Frame = +3

Query  291   GARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQH------  452
             G+  +RHF+D+ WRP   +K   RSS  +FFF+ L +GAF+STRLLDS  +         
Sbjct  11    GSGYFRHFSDSIWRPF--MKAPARSSAILFFFLFLFIGAFLSTRLLDSATSLPTTSVEKP  68

Query  453   --PTRLSHQKIIENEIP------PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspspt  608
               PT  +H+     + P      PLNCS      +CP NY P++       R        
Sbjct  69    ILPTGTAHKPFKIPKKPPVKIEYPLNCSAGNLTRTCPRNY-PTAFSPEDPDR--------  119

Query  609   ptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQ  788
                S  +CP YFRWIY DL  W +SGI+REMV  A+RTA F+LVI+NG AY   Y+++FQ
Sbjct  120   --PSPPECPHYFRWIYGDLRPWMKSGITREMVERAKRTATFKLVILNGRAYVEKYQRAFQ  177

Query  789   SRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDE  968
             +RD FTLWGILQLLRRYPGKVPDL+LMFD VDWPVI+   Y      TAPP LFRYCGD+
Sbjct  178   TRDVFTLWGILQLLRRYPGKVPDLELMFDCVDWPVIQSNEY-RGPNATAPPPLFRYCGDD  236

Query  969   ATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKD  1148
             AT DIVFPDWSFWGWPEINIKPWE L K+LKEGN + +W++REPYAYWKGNP VAATR D
Sbjct  237   ATLDIVFPDWSFWGWPEINIKPWESLLKDLKEGNKRSRWMEREPYAYWKGNPAVAATRLD  296

Query  1149  LLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILA  1328
             LLKCNVS+KQDW ARVY QDWI E ++GY+QS+LA QCIHRYKIYIEGSAWSVS+KYILA
Sbjct  297   LLKCNVSDKQDWNARVYTQDWILESQEGYKQSDLASQCIHRYKIYIEGSAWSVSQKYILA  356

Query  1329  CDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGS  1508
             CDS+TLLVKPHYYDF+TR LMP+ HYWPIR+DDKC+SIK AVDWGN H Q+AQ IG A S
Sbjct  357   CDSVTLLVKPHYYDFFTRSLMPVHHYWPIREDDKCRSIKFAVDWGNRHKQKAQSIGKAAS  416

Query  1509  KYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMES  1688
              +IQE+LKM+ VYDYMFHLL+EYAKLLK+KPTVP +AVELCSE+M CGA GL+K+FMMES
Sbjct  417   DFIQEDLKMDNVYDYMFHLLNEYAKLLKFKPTVPEKAVELCSERMGCGAEGLKKKFMMES  476

Query  1689  LVKAAPSTTAPCTMPPPFDPATL  1757
             +VK  P   +PCTMPPPF P  L
Sbjct  477   MVK-YPMDASPCTMPPPFSPLEL  498



>ref|XP_008377535.1| PREDICTED: protein O-glucosyltransferase 1-like [Malus domestica]
Length=528

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/515 (61%), Positives = 378/515 (73%), Gaps = 36/515 (7%)
 Frame = +3

Query  273   MRETSEGAR--LYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLD-----  431
             MRE     R  LY HFT+      P +K+  R S AVF F++   GAFV TRL++     
Sbjct  1     MRENESTQRHYLYTHFTEAILYLRPFMKSPARFS-AVFVFLLF--GAFVCTRLINFPTLV  57

Query  432   -----STVTA----QHPTRLSHQKIIENEIP----PLNCSLRTPMASCPANYYPSSKLTR  572
                  S VT     +HP    +  I ++  P    PLNC+      +CP+NY        
Sbjct  58    DTSQGSVVTTGASQKHPPETPN--IPKSPPPKLEIPLNCTAYNLTRTCPSNY--------  107

Query  573   TRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNG  752
               T       P        CP+YFRWIY+DL  W  +GI+++MV SA+RTANF+LVI+NG
Sbjct  108   -PTTFSPEQDPDSPSPPPTCPEYFRWIYEDLRPWALTGITKDMVQSAKRTANFKLVILNG  166

Query  753   IAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTT  932
              AY   Y+KSFQ+RD FTLWGILQLLRRYPGKVPDL+LMFD VDWPVI  + Y     +T
Sbjct  167   KAYLETYQKSFQTRDVFTLWGILQLLRRYPGKVPDLELMFDCVDWPVILSRFYS-QPNST  225

Query  933   APPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYW  1112
             APP LFRYCGD+ + DIVFPDWSFWGW EINIKPWE L K+L+EGN + KW+DREPYAYW
Sbjct  226   APPPLFRYCGDDRSLDIVFPDWSFWGWSEINIKPWELLLKDLEEGNNRSKWIDREPYAYW  285

Query  1113  KGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEG  1292
             KGNP VA TRKDLLKCNVSE+ DW ARVYAQDW +E ++GY+QS+LA QC+HRYKIYIEG
Sbjct  286   KGNPFVAETRKDLLKCNVSEQTDWNARVYAQDWFKESREGYKQSDLASQCVHRYKIYIEG  345

Query  1293  SAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNH  1472
             SAWSVSEKYILACDS+TL+VKP YYDF+TRGL+P+ HYWPI+DDDKC+SIK AVDWGN+H
Sbjct  346   SAWSVSEKYILACDSVTLIVKPRYYDFFTRGLIPVHHYWPIKDDDKCRSIKFAVDWGNSH  405

Query  1473  HQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCG  1652
              ++AQ IG   SK IQE+LKM+YVYDYMFHLLSEY+KLL++KPT+P +AVELCSE MVC 
Sbjct  406   KKKAQSIGKEASKMIQEDLKMDYVYDYMFHLLSEYSKLLQFKPTIPRKAVELCSEAMVCQ  465

Query  1653  ANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             A GLEK+FMM+S+VK  P+   PC MPPPFDPA+L
Sbjct  466   AQGLEKKFMMDSMVK-GPAERNPCAMPPPFDPASL  499



>ref|XP_009371331.1| PREDICTED: O-glucosyltransferase rumi homolog [Pyrus x bretschneideri]
Length=530

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/503 (61%), Positives = 373/503 (74%), Gaps = 29/503 (6%)
 Frame = +3

Query  300   LYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLD-----------STVTA  446
             LY HF++  +   P +K+  R S AVF F+ L +GAFV TRLL+           S VT 
Sbjct  11    LYSHFSEAIFLLRPFMKSPARFS-AVFVFVFLSLGAFVCTRLLNFPTIIDTSAQGSIVTT  69

Query  447   QHPTRLSHQ--KIIENEIP----PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspspt  608
             +      H+   I +   P    PLNC+      +CP+NY          T       P 
Sbjct  70    RASQNYPHKTPNIPKKPPPKLEFPLNCTAYDLTRTCPSNY---------PTTFNPEQGPD  120

Query  609   ptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQ  788
                    CP+YFRWIY+DL  W  +GI+++MV SA+RTANF+LVI+NG AY   Y+ SFQ
Sbjct  121   SPSPPPTCPEYFRWIYEDLRPWAHTGITKDMVQSAKRTANFKLVIMNGKAYVETYQNSFQ  180

Query  789   SRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDE  968
             +RD FTLWGILQLLRRYPGKVPDL+LMFD VDWPVI  + Y     +TAPP LFRYCGD+
Sbjct  181   TRDVFTLWGILQLLRRYPGKVPDLELMFDCVDWPVILSRFYS-RPNSTAPPPLFRYCGDD  239

Query  969   ATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKD  1148
             ++ DIVFPDWSFWGW EINIKPWE L K+L+EGN + KW+DREPYAYWKGNP VA TRKD
Sbjct  240   SSLDIVFPDWSFWGWSEINIKPWELLLKDLEEGNKRSKWIDREPYAYWKGNPSVAETRKD  299

Query  1149  LLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILA  1328
             L+KCNVS++ DW AR+YAQDW++E K+G++QS+LA QC+HRYKIYIEGSAWSVSEKYILA
Sbjct  300   LVKCNVSDQMDWNARIYAQDWLKELKEGFKQSDLASQCVHRYKIYIEGSAWSVSEKYILA  359

Query  1329  CDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGS  1508
             CDS+T +VKP YYDF+TRGLMP+ HYWPI+DDDKC+SIK AVDWGN+H ++AQ IG A  
Sbjct  360   CDSVTFIVKPRYYDFFTRGLMPVHHYWPIKDDDKCRSIKFAVDWGNSHKKKAQSIGKAAR  419

Query  1509  KYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMES  1688
             K I E+LKM+YVYDYMFHLLSEY+KLL++KPT+P +AVELCSE MVC A GLEK+FMMES
Sbjct  420   KMIHEDLKMDYVYDYMFHLLSEYSKLLQFKPTIPRKAVELCSEAMVCQAQGLEKKFMMES  479

Query  1689  LVKAAPSTTAPCTMPPPFDPATL  1757
             LVK  P+   PC MPPP+DPATL
Sbjct  480   LVK-GPAERNPCAMPPPYDPATL  501



>ref|XP_010255433.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Nelumbo 
nucifera]
 ref|XP_010255434.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Nelumbo 
nucifera]
Length=533

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/509 (61%), Positives = 370/509 (73%), Gaps = 39/509 (8%)
 Frame = +3

Query  291   GARLYRHFTDTNW-RPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLL------DSTVT--  443
             G+  Y+ F+     RPL   K  P  +  +F F++L +GAF+S   +      DST T  
Sbjct  15    GSEFYKQFSSAKLCRPL---KKRPAKTSLLFCFILL-IGAFISAHWIAASISGDSTSTQG  70

Query  444   ------AQHPTRLSHQKIIEN-----EIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQ  590
                   A H T L  QK ++      E+P LNC+ R    +CP  Y  + +     +  +
Sbjct  71    GIISSQAIHKTSLQIQKNLKKPRRKLELP-LNCTARNLTQTCPVIYSEAFEADGDNSPSR  129

Query  591   DspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHN  770
             +            CP+YFRWIY+DL  W++ GIS+EMV  A++TANFRLVIV G AY   
Sbjct  130   E------------CPEYFRWIYEDLRPWKDRGISKEMVERAKKTANFRLVIVRGRAYIEK  177

Query  771   YRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALF  950
             Y+++FQSRD FTLWGILQLLRRYPGK+PDL+LMFD VDWPVIK Q Y      TAPP LF
Sbjct  178   YKRAFQSRDVFTLWGILQLLRRYPGKLPDLELMFDCVDWPVIKSQ-YYRGPNATAPPPLF  236

Query  951   RYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEV  1130
             RYCGD  T DIVFPDWSFWGWPEINIKPWE L KEL+EGN + KW+ REPYAYWKGNP V
Sbjct  237   RYCGDHRTLDIVFPDWSFWGWPEINIKPWESLLKELREGNGRTKWMQREPYAYWKGNPAV  296

Query  1131  AATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVS  1310
             AATR+DLLKCNVS + DW AR+YAQDWIQE  QGY+QS+LA QC HRYKIYIEGSAWSVS
Sbjct  297   AATRQDLLKCNVSHQHDWNARLYAQDWIQELHQGYKQSDLAKQCSHRYKIYIEGSAWSVS  356

Query  1311  EKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQE  1490
             EKYILACDS+TL+VKP YYDF++R L+P+ HYWPIRDDDKC+SIK AVDWGN+H Q+AQ 
Sbjct  357   EKYILACDSVTLIVKPQYYDFFSRSLVPVHHYWPIRDDDKCRSIKFAVDWGNSHKQKAQA  416

Query  1491  IGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEK  1670
             IG A S  +QEELKM+YVYDYMFHLLSEYAKLL YKPTVPP+AVELCSE M C A+GL K
Sbjct  417   IGKAASNLVQEELKMDYVYDYMFHLLSEYAKLLTYKPTVPPQAVELCSETMACHADGLTK  476

Query  1671  QFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             + MMES+VK +P+ T PC +P PFDP  L
Sbjct  477   KLMMESMVK-SPTYTKPCALPTPFDPLAL  504



>ref|XP_009342973.1| PREDICTED: O-glucosyltransferase rumi homolog [Pyrus x bretschneideri]
Length=537

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/520 (60%), Positives = 379/520 (73%), Gaps = 37/520 (7%)
 Frame = +3

Query  273   MRETSEGAR-LYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLD------  431
             MRE     R LY HF++  +   P IK+  R S AVF F+ L +GAFV TRLL+      
Sbjct  1     MRENDSMQRCLYSHFSEAIFLLRPFIKSPARFS-AVFVFVFLSLGAFVCTRLLNFPTIID  59

Query  432   -----STVTAQHPTRLSHQ--KIIENEIP----PLNCSLRTPMASCPANYYPSSKLTRTR  578
                  S VT +      H+   I +   P    PLNC+      +CP+NY          
Sbjct  60    TSAQGSIVTTRASQNYPHKTPNIPKKPPPKLEFPLNCTAYDLTRTCPSNY---------P  110

Query  579   TRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIA  758
             T       P        CP+YFRWIY+DL  W  +GI+++MV SA+RTANF+LVI+NG A
Sbjct  111   TTFNPEQGPDSPSPPPTCPEYFRWIYEDLRPWAHTGITKDMVQSAKRTANFKLVIMNGKA  170

Query  759   YYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAP  938
             Y   Y+ SFQ+RD FTLWGILQLLRRYPGKVPDL+LMFD VDWPVI  + Y L ++T AP
Sbjct  171   YVETYQNSFQTRDVFTLWGILQLLRRYPGKVPDLELMFDCVDWPVILSRFYSLPNST-AP  229

Query  939   PALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKG  1118
             P LFRYCGD+++ DIVFPDWSFWGW EINIKPWE L K+L+EGN + KW+DREPYAYWKG
Sbjct  230   PPLFRYCGDDSSLDIVFPDWSFWGWSEINIKPWELLLKDLEEGNKRSKWIDREPYAYWKG  289

Query  1119  NPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSA  1298
             NP VA TRK+L+KCNVS++ DW AR+YAQDW++E K+G++QS+LA QC+HRYKIYIEGSA
Sbjct  290   NPSVAETRKNLVKCNVSDQMDWNARIYAQDWLKELKEGFKQSDLASQCVHRYKIYIEGSA  349

Query  1299  WSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQ  1478
             WSVSEKYILACDS+T +VKP YYDF+TRGLMP+ HYWPI+DDDKC+SIK AVDWGN+H +
Sbjct  350   WSVSEKYILACDSVTFIVKPRYYDFFTRGLMPVHHYWPIKDDDKCRSIKFAVDWGNSHKK  409

Query  1479  QAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGA-  1655
             +AQ IG A  K I E+LKM+YVYDYMFHLLSEY+KLL++KPT+P +AVELCSE MVC A 
Sbjct  410   KAQSIGKAARKMIHEDLKMDYVYDYMFHLLSEYSKLLQFKPTIPRKAVELCSEAMVCQAQ  469

Query  1656  ------NGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
                    GLEK+FMMESLVK  P+   PC MPPP+DPATL
Sbjct  470   GLEKKLQGLEKKFMMESLVK-GPAERNPCAMPPPYDPATL  508



>ref|XP_004308086.1| PREDICTED: O-glucosyltransferase rumi homolog [Fragaria vesca 
subsp. vesca]
Length=508

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/471 (63%), Positives = 356/471 (76%), Gaps = 31/471 (7%)
 Frame = +3

Query  402   GAFVSTRLLDSTV-----TAQHPTRLS--------HQKIIENEIPP------LNCSLRTP  524
             GAFV TRLL+ST      T+   + L+        H   +  + PP      LNC+    
Sbjct  21    GAFVCTRLLNSTTHTLGGTSAQDSILNTKASQSYPHDTPVLPKTPPKILEIPLNCTAFDL  80

Query  525   MASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMV  704
               +CP+NY  +S       R            +  CP+YFRWI++DL  W  +GIS+   
Sbjct  81    TRTCPSNYPTTSSPDHDPER----------PPAPTCPEYFRWIHEDLRPWAHTGISKATF  130

Query  705   MSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVD  884
               ARRTANF+LVIVNG AY   Y KSFQSRDTFTLWGILQLLRRYPGKVPDL+LMFD VD
Sbjct  131   QKARRTANFKLVIVNGKAYMERYGKSFQSRDTFTLWGILQLLRRYPGKVPDLELMFDCVD  190

Query  885   WPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKE  1064
             WPVI  + Y   D ++APP LFRYCGD+++ DIVFPDWSFWGWPEINI PWE L K+L+E
Sbjct  191   WPVILSKFYT-GDNSSAPPPLFRYCGDDSSLDIVFPDWSFWGWPEINIAPWENLLKQLEE  249

Query  1065  GNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQS  1244
             GN + +W+DREPYAYWKGNP VA TR+DLLKCNVSE+QDW ARVYAQDW +E K+G++QS
Sbjct  250   GNKRSRWIDREPYAYWKGNPAVAETRQDLLKCNVSEEQDWNARVYAQDWSRESKEGFKQS  309

Query  1245  NLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDD  1424
             +LA QCIHRYKIYIEGSAWSVS KYILACDS+TL+VKP YYDF+TR LMP+ HYWPI+DD
Sbjct  310   DLASQCIHRYKIYIEGSAWSVSNKYILACDSVTLIVKPRYYDFFTRELMPVHHYWPIKDD  369

Query  1425  DKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPT  1604
             DKC+SIK+AVDWGN+H Q+AQ IG A S  IQE+LKM+YVYDYMFHLLSEYAKLL++KPT
Sbjct  370   DKCRSIKYAVDWGNSHKQKAQAIGKAASNLIQEDLKMDYVYDYMFHLLSEYAKLLQFKPT  429

Query  1605  VPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +P +A+ELCSE M C A GLEK+FMMES+VK  P+ T+PCTMPPP+DP  L
Sbjct  430   IPRKAIELCSEAMACQAQGLEKKFMMESMVK-GPAVTSPCTMPPPYDPPAL  479



>ref|XP_004309206.1| PREDICTED: O-glucosyltransferase rumi homolog [Fragaria vesca 
subsp. vesca]
Length=508

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/485 (61%), Positives = 356/485 (73%), Gaps = 32/485 (7%)
 Frame = +3

Query  363   SSLAVFFFMVLCVGAFVSTRLL--------------DSTVTAQHPTRLSHQKIIENEIPP  500
             SS A+   ++  VGAFV TRLL              D+ VT         Q  +  + PP
Sbjct  8     SSAALVSLLLFFVGAFVFTRLLLNSSTHTLVGKSAQDAIVTIDASQLHPQQTPVLPKTPP  67

Query  501   ------LNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDD  662
                   L+C       +CP+NY  +S   +   R           S   CPD+FRWI++D
Sbjct  68    NTLKIPLDCPAYNLTGTCPSNYPTTSSPDQDHNR----------PSQPTCPDFFRWIHED  117

Query  663   LWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYP  842
             L  W  +GI+R+   +A RTA F+LVIVNG AYY  Y K+FQSRDTFTLWGILQLLRRYP
Sbjct  118   LKPWAYTGITRDTFEAANRTAAFKLVIVNGKAYYQKYVKAFQSRDTFTLWGILQLLRRYP  177

Query  843   GKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEI  1022
             GKVPDL+LMFD VDWPVI   S+     +TAPP LFRYCGD  T DIVFPDWSFWGWPE 
Sbjct  178   GKVPDLELMFDCVDWPVILSSSFT-GPNSTAPPPLFRYCGDNNTLDIVFPDWSFWGWPET  236

Query  1023  NIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYA  1202
             NI PWE L ++L EGN + +WVDREPYAYWKGNP+VA TR+DLLKCNVSE+ +W ARVYA
Sbjct  237   NIAPWENLLEQLVEGNRRSRWVDREPYAYWKGNPKVAETRQDLLKCNVSEEHEWNARVYA  296

Query  1203  QDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTR  1382
             Q+W  E K G+++S+LA QC+HRYKIYIEGSAWSVS KYILACDS+TLLV+P Y DF+ R
Sbjct  297   QNWTLEEKAGFKKSDLASQCVHRYKIYIEGSAWSVSNKYILACDSVTLLVRPRYNDFFMR  356

Query  1383  GLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFH  1562
             GLMP+ HYWP+RDDDKC+SIK+AVDWGN+H ++AQ IG A S YI+E+LKM+YVYDYMFH
Sbjct  357   GLMPVHHYWPVRDDDKCRSIKYAVDWGNSHQKKAQAIGKAASNYIKEDLKMDYVYDYMFH  416

Query  1563  LLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPF  1742
             LLSEYAKLL++KPTVPPEA+ELCSE M C A GLEK+FMMES+VK  P+ T+PCTMPPP+
Sbjct  417   LLSEYAKLLRFKPTVPPEAIELCSETMACQAEGLEKKFMMESMVK-GPAVTSPCTMPPPY  475

Query  1743  DPATL  1757
             DPA+L
Sbjct  476   DPASL  480



>emb|CDP05198.1| unnamed protein product [Coffea canephora]
Length=530

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/487 (61%), Positives = 354/487 (73%), Gaps = 31/487 (6%)
 Frame = +3

Query  363   SSLAVFFFMVLCVGAFVSTRLLDSTVTAQ----------------HPTRLSHQKIIENEI  494
             S L + F ++L + A V TRLLDS+  AQ                H    + +    +E 
Sbjct  24    SVLPLLFLIILSIAAIVYTRLLDSSSIAQNYSEHSIFTGITFHNYHSREYTKKTTQSDEF  83

Query  495   P------PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIY  656
             P      PLNC+      +CPANYYPS  L      +QD    T     + CPDYFRWI+
Sbjct  84    PVKKVEIPLNCTAGISKRTCPANYYPSQLL------VQDQNIATSPPQPT-CPDYFRWIH  136

Query  657   DDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRR  836
             +DLW WRE+GI+ EM+  AR+TA+FRLVIVNG AY   +R+S  SRDTFTLWGILQLLR+
Sbjct  137   EDLWPWRETGITLEMLSMARKTAHFRLVIVNGRAYMEKFRRSHHSRDTFTLWGILQLLRK  196

Query  837   YPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWP  1016
             YPG++PDL+LMFD  D P I K+       + APP LF YC D+AT DIVFPDWSFWGWP
Sbjct  197   YPGQLPDLELMFDCNDRPAIMKEVQS-GPNSPAPPPLFAYCRDDATLDIVFPDWSFWGWP  255

Query  1017  EINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARV  1196
             E+NIKPWE LSK+LKEGN + +WV+REP+AYWKGNP VA  R D+ KCNVS+KQDW AR+
Sbjct  256   ELNIKPWESLSKDLKEGNERSRWVEREPHAYWKGNPAVARNRLDMAKCNVSDKQDWNARI  315

Query  1197  YAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFY  1376
             Y+QDWI+E +QGY+QS+LA QC HRYKIYIEG  WSVSEKYILACDSLTLLVKP YYDF+
Sbjct  316   YSQDWIREQQQGYKQSDLASQCTHRYKIYIEGVGWSVSEKYILACDSLTLLVKPRYYDFF  375

Query  1377  TRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYM  1556
              R LMP++HYWPIR+DDKC+SIKHAVDWGN H Q+AQ IG A S +IQEELKM+YVYDYM
Sbjct  376   ARSLMPLEHYWPIRNDDKCRSIKHAVDWGNTHPQEAQAIGKAASSFIQEELKMDYVYDYM  435

Query  1557  FHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPP  1736
             FHLLS YAKLLK+KP VP EAVE+CSE M C A GL K+ MME+  +  PS   PCTMPP
Sbjct  436   FHLLSGYAKLLKFKPGVPREAVEVCSEFMACPAQGLVKEMMMETFAR-GPSDAPPCTMPP  494

Query  1737  PFDPATL  1757
             P+DP TL
Sbjct  495   PYDPQTL  501



>ref|XP_008439228.1| PREDICTED: protein O-glucosyltransferase 1-like [Cucumis melo]
Length=537

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/474 (63%), Positives = 357/474 (75%), Gaps = 33/474 (7%)
 Frame = +3

Query  399   VGAFVSTRLLDSTV-------------------TAQHPTRLSHQKIIENEIPPLNCSLRT  521
              G F+STRLL S+                    T++ P   +H++        L+C+   
Sbjct  47    AGIFLSTRLLHSSTAAYNLTIKGSGKSQYYPNDTSEVPENPNHRRRRRQVEFALDCTSFN  106

Query  522   PM--ASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISR  695
              +   +CPANY P+++ T                SS+ CP+YFRWI++DL  W  +GISR
Sbjct  107   NITGGACPANY-PTNRTTDEHEN---------RPSSTTCPEYFRWIHEDLRPWARTGISR  156

Query  696   EMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFD  875
               V + +RTANFRLVI+NG AY   Y+KSFQ+RDTFT+WGILQLLRRYPGKV DLDLMFD
Sbjct  157   AAVEAGQRTANFRLVILNGKAYVETYKKSFQTRDTFTVWGILQLLRRYPGKVADLDLMFD  216

Query  876   TVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKE  1055
              VDWPVI    +   D  T PP LFRYCGD+ T DIVFPDWSFWGWPEINIKPWE L K+
Sbjct  217   CVDWPVILSSHFSGPDGPTPPP-LFRYCGDDPTLDIVFPDWSFWGWPEINIKPWEPLLKD  275

Query  1056  LKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGY  1235
             LKEGN +I W  REPYAYWKGNPEVA TRKDLLKCNVS++QDW ARV+AQDW +E ++GY
Sbjct  276   LKEGNKRILWKSREPYAYWKGNPEVADTRKDLLKCNVSDQQDWNARVFAQDWTKESQEGY  335

Query  1236  QQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPI  1415
             +QS+L++QC+HRYKIYIEGSAWSVSEKYILACDS+TL+VKPHYYDF+TRGLMP+ HYWP+
Sbjct  336   KQSDLSNQCLHRYKIYIEGSAWSVSEKYILACDSVTLIVKPHYYDFFTRGLMPVHHYWPV  395

Query  1416  RDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKY  1595
             +DDDKCKSIK AVDWGN+H Q+AQ IG A S +IQEELKM+YVYDYMFHLLSEY+KLL +
Sbjct  396   KDDDKCKSIKFAVDWGNSHKQKAQAIGKAASSFIQEELKMDYVYDYMFHLLSEYSKLLTF  455

Query  1596  KPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             KPTVPP A+ELCSE M C A GL K+FM ESLVK  P+ + PCTMPPP+DPA+L
Sbjct  456   KPTVPPTAIELCSEAMACPAEGLTKKFMTESLVK-RPAESNPCTMPPPYDPASL  508



>ref|XP_011076164.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Sesamum 
indicum]
Length=501

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/464 (63%), Positives = 354/464 (76%), Gaps = 23/464 (5%)
 Frame = +3

Query  375   VFFFMVLCVGAFVSTRLLDSTVTAQH--PTRLSHQKIIENEIPPLNCSLRTPMASCPANY  548
              FF  +L VGA++ST +LD +V+     PT     KIIE    PL+CS      +CPANY
Sbjct  28    AFFTCLLVVGAYLSTSILDISVSVNKELPT-----KIIE---IPLDCSSTNQTKTCPANY  79

Query  549   YPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTAN  728
             YPS+ L   R R         +     CP YF WI++DL  W+++GI+ EMV+ A RTAN
Sbjct  80    YPSA-LPTIRPR--------SSSILLSCPHYFHWIHEDLRPWKDTGITEEMVVRANRTAN  130

Query  729   FRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQS  908
             FRLVI+NG AY   Y KSFQ+RD FTLWGILQLLRRYPGKVPDLDLMFD VDWPVIK   
Sbjct  131   FRLVILNGRAYLETYVKSFQTRDVFTLWGILQLLRRYPGKVPDLDLMFDCVDWPVIKSSD  190

Query  909   YV-LNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKW  1085
             Y  LN     PP LFRYCG+  T+DI FPDWSFWGWPE NIKPWE L  +L EGN K++W
Sbjct  191   YQGLN--ALKPPPLFRYCGNNQTFDIAFPDWSFWGWPETNIKPWEQLMGDLNEGNKKLRW  248

Query  1086  VDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCI  1265
             +DREPYA+WKGNP+VA  R DLLKCNVSEKQDW ARVY QDW +E ++G++QS+LA QC 
Sbjct  249   MDREPYAFWKGNPKVAEKRVDLLKCNVSEKQDWNARVYKQDWDKEIEEGFKQSDLAKQCT  308

Query  1266  HRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIK  1445
             HRYKIYIEGSAWSVSEKYILACDS+TLLV P YYDF+TR L+PM+HYWPI+ +DKC+SIK
Sbjct  309   HRYKIYIEGSAWSVSEKYILACDSVTLLVTPDYYDFFTRSLVPMQHYWPIKAEDKCRSIK  368

Query  1446  HAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVE  1625
              AVDWGNNH ++AQE+G A S ++Q +LKM++VYDYMFHLLSEY+KLL+YKP +PP+AVE
Sbjct  369   FAVDWGNNHKEKAQELGTAASSFVQNDLKMDFVYDYMFHLLSEYSKLLRYKPKIPPKAVE  428

Query  1626  LCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             LCSE M C A GLEK FM++S+VK +P  ++PC+MP P +P+ L
Sbjct  429   LCSEAMACHAQGLEKTFMLDSMVK-SPKESSPCSMPSPLEPSAL  471



>ref|XP_010060950.1| PREDICTED: O-glucosyltransferase rumi homolog [Eucalyptus grandis]
 gb|KCW90698.1| hypothetical protein EUGRSUZ_A02783 [Eucalyptus grandis]
Length=540

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/509 (60%), Positives = 377/509 (74%), Gaps = 34/509 (7%)
 Frame = +3

Query  291   GARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLD-------------  431
             G+  +RHF D+ WRP   +K+  RSS A+     L V AF+STRLLD             
Sbjct  18    GSGAFRHFADSIWRPF--LKSPARSSAALLVLAFLLVSAFLSTRLLDSSASSSSISAAPR  75

Query  432   -------STVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQ  590
                    S V  + P  +  +   + EIP LNC+   P  +CP+NY P+S         +
Sbjct  76    PIVNIATSHVYPRKPPAVLERPREKLEIP-LNCTSYNPGRTCPSNY-PTS--------FR  125

Query  591   DspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHN  770
                 P    +++ CPDYFRWI++DL  W  +GI+R+MV  A+ TANFRL IV G AY   
Sbjct  126   PEQDPDAPSAAAACPDYFRWIHEDLKPWARTGITRDMVERAKGTANFRLAIVGGRAYVET  185

Query  771   YRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALF  950
             ++KSFQ+RD FTLWGILQLLRRYPG+VPDL+LMFD VDWPV++ + +      T PP LF
Sbjct  186   FQKSFQTRDVFTLWGILQLLRRYPGQVPDLELMFDCVDWPVVQSRLHS-GPNATGPPPLF  244

Query  951   RYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEV  1130
             RYCGD+AT DIVFPDWSFWGWPE+NIKPWE L ++LKEGN ++KW+DREPYAYWKGNP V
Sbjct  245   RYCGDDATLDIVFPDWSFWGWPEVNIKPWESLLRDLKEGNKRVKWMDREPYAYWKGNPTV  304

Query  1131  AATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVS  1310
             AATR+DLLKCNVS+KQDW ARV+AQDWI+E +QGY+QS+LA+QCIHRYKIYIEGSAWSVS
Sbjct  305   AATRQDLLKCNVSDKQDWNARVFAQDWIRESQQGYKQSDLANQCIHRYKIYIEGSAWSVS  364

Query  1311  EKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQE  1490
             EKYILACDS+TL+VKPHYYDF+TRGLMP+ HYWPIR+DDKC+SIK AVDWGN H Q+AQ 
Sbjct  365   EKYILACDSVTLVVKPHYYDFFTRGLMPVHHYWPIREDDKCRSIKFAVDWGNGHKQKAQA  424

Query  1491  IGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEK  1670
             +G A S Y+ E+L+M+ VYDYMFHLL+EYAKLL++KP VP +AVE CSE M C A GLEK
Sbjct  425   LGKAASSYVLEDLRMDLVYDYMFHLLNEYAKLLRFKPVVPEKAVEFCSEHMACQAEGLEK  484

Query  1671  QFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +FM ESLVK  P+ T PC + PP+D  +L
Sbjct  485   KFMEESLVK-GPADTYPCKLAPPYDALSL  512



>ref|XP_011084732.1| PREDICTED: protein O-glucosyltransferase 1-like [Sesamum indicum]
Length=462

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/441 (65%), Positives = 338/441 (77%), Gaps = 15/441 (3%)
 Frame = +3

Query  450   HPTRLSHQKIIENE-----IPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptpt  614
             H T     K +EN      +P LNCS+      C AN Y +    R +           +
Sbjct  3     HTTPSKITKNVENTPTTIIVPALNCSMGNLSRRCLANSYSTKTFVRDKN--------ISS  54

Query  615   qsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSR  794
                + CPDYFRWI++DLW WR +GI+REMVM A RTANFRLVI++G AY   Y K FQSR
Sbjct  55    TLLASCPDYFRWIHEDLWPWRRTGITREMVMRANRTANFRLVILDGKAYAQTYSKGFQSR  114

Query  795   DTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEAT  974
             DTFTLWGILQLLRRYPGKVPDLDLMFD  D PVI+K+++      +APP LF YC D++T
Sbjct  115   DTFTLWGILQLLRRYPGKVPDLDLMFDCDDLPVIRKENFK-GVKHSAPPTLFGYCKDDST  173

Query  975   WDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLL  1154
              +IVFPDWSFWGWPEINIKPWE LSK+LK GN +  W +REP AYWKGNP VAATR DLL
Sbjct  174   LNIVFPDWSFWGWPEINIKPWEALSKDLKAGNKRSSWTEREPNAYWKGNPYVAATRIDLL  233

Query  1155  KCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACD  1334
              CNVS+K DWGAR+YAQDW +E K+G++QS+LA QC HRYKIYIEG  WSVSEKYILACD
Sbjct  234   DCNVSDKLDWGARIYAQDWQKEEKEGFKQSDLASQCTHRYKIYIEGVGWSVSEKYILACD  293

Query  1335  SLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKY  1514
             S+TLLVKPHYYDF+TR LMP++HYWPI+DDDKC+SIKHAVDWGN+H ++AQ IG   S +
Sbjct  294   SVTLLVKPHYYDFFTRDLMPLQHYWPIKDDDKCRSIKHAVDWGNSHREEAQAIGKTASSF  353

Query  1515  IQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLV  1694
             +  ELKM+YVYDYMFHLLSEY+KLLKYKPTVP +AVELCSE M C A GLEK+FM ++LV
Sbjct  354   VLNELKMDYVYDYMFHLLSEYSKLLKYKPTVPDKAVELCSEAMACRAQGLEKKFMTDTLV  413

Query  1695  KAAPSTTAPCTMPPPFDPATL  1757
             K  PS ++PCTMPPP+ PA+ 
Sbjct  414   K-GPSFSSPCTMPPPYGPASF  433



>ref|XP_004140839.1| PREDICTED: protein O-glucosyltransferase 1-like [Cucumis sativus]
 gb|KGN57375.1| hypothetical protein Csa_3G182110 [Cucumis sativus]
Length=538

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/474 (63%), Positives = 359/474 (76%), Gaps = 32/474 (7%)
 Frame = +3

Query  399   VGAFVSTRLLDSTVTAQ------------HPTRLSHQKIIENEIP-------PLNCSLRT  521
              G F+STRLL S+ TA             +PT  S      N  P        L+C+   
Sbjct  47    AGVFLSTRLLHSSTTAYNLTIKGSGKSQYYPTNTSQVPHNPNHQPRRPQVEFTLHCASFN  106

Query  522   PM--ASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISR  695
              +   +CPA +YP++  T             P  SSS CPDYFRWI++DL  W  +GI+R
Sbjct  107   NITPGACPA-HYPTNWTTDEDQN--------PPSSSSACPDYFRWIHEDLRPWARTGITR  157

Query  696   EMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFD  875
               + + +RTANFRL+I+NG AY   Y+KSFQ+RDTFT+WGILQLLRRYPGKVPDLDLMFD
Sbjct  158   ATLEAGQRTANFRLLILNGKAYVETYKKSFQTRDTFTVWGILQLLRRYPGKVPDLDLMFD  217

Query  876   TVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKE  1055
              VDWPVI   S+        PP LFRYCGD+AT+DIVFPDWSFWGWPEINIKPWE L K+
Sbjct  218   CVDWPVIL-TSHFSGPNGPTPPPLFRYCGDDATFDIVFPDWSFWGWPEINIKPWEPLLKD  276

Query  1056  LKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGY  1235
             +KEGN +I W  REPYAYWKGNPEVA TRKDL+KCNVS++QDW ARV+AQDW +E ++GY
Sbjct  277   IKEGNKRIPWKSREPYAYWKGNPEVADTRKDLIKCNVSDQQDWNARVFAQDWTKESQEGY  336

Query  1236  QQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPI  1415
             +QS+L++QC+HRYKIYIEGSAWSVSEKYILACDS+TL+VKPHYYDF+TRGLMP+ HYWP+
Sbjct  337   KQSDLSNQCLHRYKIYIEGSAWSVSEKYILACDSVTLIVKPHYYDFFTRGLMPVHHYWPV  396

Query  1416  RDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKY  1595
             +DDDKCKSIK AVDWGN+H Q+AQ IG A S +IQEELKM+YVYDYMFHLLSEY+KLL +
Sbjct  397   KDDDKCKSIKFAVDWGNSHKQKAQAIGKAASSFIQEELKMDYVYDYMFHLLSEYSKLLTF  456

Query  1596  KPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             KPT+PP A+ELCSE M C A GL K+FM ESLVK  P+ + PCTMPPP+DPA+L
Sbjct  457   KPTLPPNAIELCSEAMACPAEGLTKKFMTESLVK-RPAESNPCTMPPPYDPASL  509



>ref|XP_004157225.1| PREDICTED: protein O-glucosyltransferase 1-like [Cucumis sativus]
Length=538

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/474 (63%), Positives = 358/474 (76%), Gaps = 32/474 (7%)
 Frame = +3

Query  399   VGAFVSTRLLDSTVTAQ------------HPTRLSHQKIIENEIP-------PLNCSLRT  521
              G F+STRLL S+ TA             +PT  S      N  P        L+C+   
Sbjct  47    AGVFLSTRLLHSSTTAYNLTIKGSGKSQYYPTNTSQVPHNPNHQPRRPQVEFTLHCASFN  106

Query  522   PM--ASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISR  695
              +   +CPA +YP++  T             P  SSS CPDYFRWI++DL  W  +GI+R
Sbjct  107   NITPGACPA-HYPTNWTT--------DEDQNPPSSSSACPDYFRWIHEDLRPWARTGITR  157

Query  696   EMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFD  875
               + + +RTANFRL+I+NG AY   Y+KSFQ+RDTFT+WGILQLLRRYPGKVPDLDLMFD
Sbjct  158   ATLEAGQRTANFRLLILNGKAYVETYKKSFQTRDTFTVWGILQLLRRYPGKVPDLDLMFD  217

Query  876   TVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKE  1055
              VDWPVI   S+        PP LFRYCGD+AT+DIVFPDWSFWGWPEINIKPWE L K+
Sbjct  218   CVDWPVIL-TSHFSGPNGPTPPPLFRYCGDDATFDIVFPDWSFWGWPEINIKPWEPLLKD  276

Query  1056  LKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGY  1235
             +KEGN +I W  R+PYAYWKGNPEVA TRKDL+KCNVS++QDW ARV+AQDW +E ++GY
Sbjct  277   IKEGNKRIPWKSRQPYAYWKGNPEVADTRKDLIKCNVSDQQDWNARVFAQDWTKESQEGY  336

Query  1236  QQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPI  1415
             +QSNL++QC+HRYKIYIEGSAWSVSEKYILACDS+TL+VKPHYYDF+TRGLMP+ HYWP+
Sbjct  337   KQSNLSNQCLHRYKIYIEGSAWSVSEKYILACDSVTLIVKPHYYDFFTRGLMPVHHYWPV  396

Query  1416  RDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKY  1595
             +DDDKCKSIK AVDWGN+H Q+AQ IG A S +IQEELKM+YVYDYMFHLLSEY+KLL +
Sbjct  397   KDDDKCKSIKFAVDWGNSHKQKAQAIGKAASSFIQEELKMDYVYDYMFHLLSEYSKLLTF  456

Query  1596  KPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             KPT+PP A+ELCSE M C A GL K+FM ESLVK  P+ + PCTMP P+DPA+L
Sbjct  457   KPTLPPNAIELCSEAMACPAEGLTKKFMTESLVK-RPAESNPCTMPSPYDPASL  509



>ref|XP_010110639.1| hypothetical protein L484_001070 [Morus notabilis]
 gb|EXC27334.1| hypothetical protein L484_001070 [Morus notabilis]
Length=511

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/484 (60%), Positives = 358/484 (74%), Gaps = 16/484 (3%)
 Frame = +3

Query  309   HFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDS-TVTAQHPTRLSHQKIIE  485
             HF  T WRP   +K+   S +      +L VGA VSTR L+S  +     T++  +   +
Sbjct  17    HFRYTIWRPF--LKSSASSPVVFAVLFLLFVGAIVSTRFLNSANLAGPTITKIFERPPQK  74

Query  486   NEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDL  665
              EIP LNC+   P  +CP+NY          T   +        S   CPDYFRWIY+DL
Sbjct  75    IEIP-LNCTAYDPTRTCPSNY----------TTAHNKQDDLDRPSPPTCPDYFRWIYEDL  123

Query  666   WAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPG  845
               W  +GISR+MV  A+ TA+FRLVIVNG AY   YR+SFQ+RD FTLWGILQLLRRYPG
Sbjct  124   RPWAHTGISRDMVERAKPTADFRLVIVNGKAYVETYRRSFQTRDIFTLWGILQLLRRYPG  183

Query  846   KVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEIN  1025
             +VPDLDLMF+  D P+I  +SY      T+PP LF YC D+ T DIVFPDWSFWGWPE+N
Sbjct  184   RVPDLDLMFNCGDLPLILSKSYS-GANATSPPPLFHYCADDYTLDIVFPDWSFWGWPEVN  242

Query  1026  IKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQ  1205
             IKPWE L KEL+EGN K KWVDR+P+AYWKGNP V+ +R+DLLKC VS+K DW AR+Y Q
Sbjct  243   IKPWEPLLKELEEGNKKSKWVDRQPHAYWKGNPNVSPSRQDLLKCKVSKKHDWNARLYVQ  302

Query  1206  DWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRG  1385
             DW +E ++GY+QSNLA QC HRYKIYIEG AWSVSEKYILACDS+TLLVK H+YDF+TR 
Sbjct  303   DWNKESREGYKQSNLARQCFHRYKIYIEGVAWSVSEKYILACDSVTLLVKSHFYDFFTRS  362

Query  1386  LMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHL  1565
             L+PM+HYWPI+ DDKC+SIK AVDWGN+H  +A+ IG AGS++IQEELKMEYVYD+MFHL
Sbjct  363   LVPMQHYWPIKVDDKCRSIKFAVDWGNSHKTKAKSIGKAGSRFIQEELKMEYVYDFMFHL  422

Query  1566  LSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFD  1745
             L+EYAKLLK+KP++P +AVE CSE M C   GL K+FMM+S+VK  P+ + PCTMPPP+ 
Sbjct  423   LNEYAKLLKFKPSIPEKAVEFCSESMACTTEGLGKKFMMDSMVK-GPADSRPCTMPPPYG  481

Query  1746  PATL  1757
             P++L
Sbjct  482   PSSL  485



>ref|XP_006353390.1| PREDICTED: protein O-glucosyltransferase 1-like [Solanum tuberosum]
Length=494

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/469 (62%), Positives = 359/469 (77%), Gaps = 18/469 (4%)
 Frame = +3

Query  360   RSSLAVFFFMVLCVGA--FVSTRLLDSTVTAQHPT-RLSHQKIIENEIPPLNCSLRTPMA  530
             RSS+ +  F+ L +G   F ++  ++S +T   PT  +  QK ++ +   LNC+      
Sbjct  11    RSSVIILVFLFLFIGVILFRASFEINSILTDTTPTVSVQLQKKLQIQ---LNCTNGNLTN  67

Query  531   SCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMS  710
             +CPA+YYP          ++ +       SSS CPDYFRWIYDDLW WRE+G+++EMVM+
Sbjct  68    TCPASYYP----------LKFTNQNQSNSSSSTCPDYFRWIYDDLWPWRETGVTKEMVMA  117

Query  711   ARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWP  890
              +  A+FRLVIV+G AY   YR+SFQSRDTFTLWGILQ+LRRYPGKVPDLDLMF+  D  
Sbjct  118   GKSNADFRLVIVDGRAYVETYRESFQSRDTFTLWGILQMLRRYPGKVPDLDLMFNCGDSA  177

Query  891   VIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGN  1070
             V + + Y       APP LFRYCG++A+ DIVFPDWSFWGW EINIKPWE LSKELK+ N
Sbjct  178   VTETKFY-RLPNAPAPPPLFRYCGNDASLDIVFPDWSFWGWAEINIKPWETLSKELKKAN  236

Query  1071  VKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNL  1250
              K+KW  REPYAYWKGNP VA TR D+LKCNVSEKQDW AR+Y QDWI+E KQG++QSNL
Sbjct  237   EKLKWSKREPYAYWKGNPYVAGTRMDMLKCNVSEKQDWNARIYKQDWIKEQKQGFKQSNL  296

Query  1251  ADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDK  1430
             A QC HRYKIY+EG  WSVSEKYILACDS+TLL+KP+YYDFY+RGLMP+KHYWP+ ++DK
Sbjct  297   ASQCKHRYKIYVEGQTWSVSEKYILACDSVTLLIKPYYYDFYSRGLMPLKHYWPVNNNDK  356

Query  1431  CKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVP  1610
             C+SIKHAVDWGN H ++AQEIG A + ++QE+LKM+YVYDYMFHLLSEY+KLLKYKPTVP
Sbjct  357   CRSIKHAVDWGNTHQKEAQEIGKAANDFLQEQLKMDYVYDYMFHLLSEYSKLLKYKPTVP  416

Query  1611  PEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              +A+ELCSE M C A G+ K+FM ES+VK  PS   PC +PPPF PA +
Sbjct  417   KKAIELCSEVMACPAEGVIKKFMAESMVK-GPSDAIPCNIPPPFSPADV  464



>ref|XP_007220455.1| hypothetical protein PRUPE_ppa005169mg [Prunus persica]
 gb|EMJ21654.1| hypothetical protein PRUPE_ppa005169mg [Prunus persica]
Length=474

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/494 (60%), Positives = 353/494 (71%), Gaps = 57/494 (12%)
 Frame = +3

Query  276   RETSEGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHP  455
             R  S+   LY  F DT     P +K+  R S AVF  + L  GAFV TRLL+S    Q P
Sbjct  9     RLQSQRCYLYGPFADTILMLRPFMKSPARFS-AVFVLLFLLFGAFVCTRLLNSR---QDP  64

Query  456   TRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCP  635
              R          +PP                                           CP
Sbjct  65    DR---------PLPP------------------------------------------TCP  73

Query  636   DYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWG  815
             +YFRWI++DL  W  +GI+R+M+  A+RTANF+LVIVNG AY   Y+KSFQ+RD FT+WG
Sbjct  74    EYFRWIHEDLRPWAHTGITRDMIQRAKRTANFKLVIVNGKAYVEKYQKSFQTRDVFTMWG  133

Query  816   ILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPD  995
             ILQLLRRYPG+VPDL+LMFD VDWPVI    Y      TAPP LFRYCGD+ + DIVFPD
Sbjct  134   ILQLLRRYPGQVPDLELMFDCVDWPVISSNDYS-GPNATAPPPLFRYCGDDNSLDIVFPD  192

Query  996   WSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEK  1175
             WSFWGW EINI PWE L K+L+EGN + +W+DR PYAYWKGNP VAATR+DLLKCNVS++
Sbjct  193   WSFWGWAEINIMPWEVLLKDLEEGNKRRRWIDRAPYAYWKGNPSVAATRQDLLKCNVSDQ  252

Query  1176  QDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVK  1355
             QDW ARVYAQDW++E  +GY+QS+LA QC+ RYKIYIEGSAWSVS+KYILACDS+TL+VK
Sbjct  253   QDWNARVYAQDWLRESSEGYKQSDLASQCVDRYKIYIEGSAWSVSDKYILACDSVTLIVK  312

Query  1356  PHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKM  1535
             P YYDF+TR LMP+ HYWPI+DDDKC+SIK AVDWGN+H Q+AQ IG A SK IQEELKM
Sbjct  313   PRYYDFFTRSLMPVHHYWPIKDDDKCRSIKFAVDWGNSHKQKAQAIGKAASKLIQEELKM  372

Query  1536  EYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTT  1715
             +YVYDYMFHLL+EYAKLL++KPT+P +A+ELCSE M C A G EK+FMMES+VK  P+ +
Sbjct  373   DYVYDYMFHLLNEYAKLLQFKPTIPRKAIELCSEAMACQAQGTEKKFMMESMVK-GPAVS  431

Query  1716  APCTMPPPFDPATL  1757
              PCTMPPP+ PA+L
Sbjct  432   NPCTMPPPYGPASL  445



>ref|XP_008234463.1| PREDICTED: O-glucosyltransferase rumi homolog [Prunus mume]
Length=499

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/474 (61%), Positives = 348/474 (73%), Gaps = 24/474 (5%)
 Frame = +3

Query  372   AVFFFMVLCVGAFVSTRLLD---STVTAQHPTRLSHQKIIENEIP---------PLNCSL  515
             A+F  + + VGA + TRLL+    T+    P           EIP         PLNC  
Sbjct  9     AIFVVLFVLVGALICTRLLNYNTETLFGATPKTSQSYPHKTGEIPKKAPGKLEIPLNCPA  68

Query  516   RTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISR  695
                  +CP+NY  +    +   R           S S CP+YFRWI++DL  W  +GI+R
Sbjct  69    YDLRGTCPSNYPTTFHPEQNPER----------PSPSTCPEYFRWIHEDLRPWARTGITR  118

Query  696   EMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFD  875
             EMV  A RTANF+LVIVNG AY   Y K+FQ+RD FT+WG LQLLRRYPG+VPDL+LMFD
Sbjct  119   EMVERANRTANFKLVIVNGKAYVEQYEKAFQTRDVFTVWGFLQLLRRYPGQVPDLELMFD  178

Query  876   TVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKE  1055
              VDWPVI    Y      TAPP LFRYC D+ T DIVFPDWSFWGW EINI+PWE L +E
Sbjct  179   CVDWPVIPSHEYS-GPNATAPPPLFRYCADDNTLDIVFPDWSFWGWAEINIRPWEVLFEE  237

Query  1056  LKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGY  1235
             LKEGN +  W++REPYAYWKGNP +A TR+DL+KCNVS++ DW AR+YAQDW +E K+GY
Sbjct  238   LKEGNNRKTWLEREPYAYWKGNPAIAETRQDLIKCNVSKEHDWNARLYAQDWDRESKEGY  297

Query  1236  QQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPI  1415
              +S+LA QCIHRYKIYIEGSAWSVSEKYILACDS+TL+VKP YYDF+TR LMP++HYWPI
Sbjct  298   NKSDLASQCIHRYKIYIEGSAWSVSEKYILACDSVTLIVKPRYYDFFTRRLMPVEHYWPI  357

Query  1416  RDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKY  1595
             +DDDKC+SIK +VDWGN H ++AQ IG A S  IQEELKM+YVYDYMFHLL+EYAKLL++
Sbjct  358   KDDDKCRSIKFSVDWGNTHRRKAQAIGKASSNLIQEELKMDYVYDYMFHLLNEYAKLLQF  417

Query  1596  KPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             KPTVP +AVELCSE M C A G EK+FM++SLVK  P+ + PCTMPPP+DP++L
Sbjct  418   KPTVPKKAVELCSEAMACQAEGTEKKFMLQSLVK-GPAVSEPCTMPPPYDPSSL  470



>ref|XP_004234450.2| PREDICTED: O-glucosyltransferase rumi homolog [Solanum lycopersicum]
Length=498

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/473 (61%), Positives = 351/473 (74%), Gaps = 22/473 (5%)
 Frame = +3

Query  360   RSSLAVFFFMVLCVGAFVSTRL------LDSTVT-AQHPTRLSHQKIIENEIPPLNCSLR  518
             RSS+ +   + L +G  +STR       ++S +T       L  QK ++ +   LNC+  
Sbjct  11    RSSIIILVSLFLFIGVILSTRFHRAPFDINSILTDTTRKVSLQPQKKLQIQ---LNCTNG  67

Query  519   TPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISRE  698
                 +CPA+YYP     + ++            SS  CPDYFRWIYDDLW WRE+G+++ 
Sbjct  68    NLTNTCPASYYPFKFTNQNQSN----------SSSPTCPDYFRWIYDDLWPWRETGVTKA  117

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MVMS +  A+FRLVIV+G AY   YR+SFQSRDTFTLWGILQ+LRRYPGK+PDLDLMFD 
Sbjct  118   MVMSGKNNADFRLVIVDGRAYVETYRESFQSRDTFTLWGILQMLRRYPGKIPDLDLMFDC  177

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
              D  V   +SY L +    P  LFRYCG+ A+ DIVFPDWSFWGW EINIKPWE LSKEL
Sbjct  178   GDSTVTNTKSYRLPNAPAPP-PLFRYCGNNASLDIVFPDWSFWGWVEINIKPWETLSKEL  236

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             K+ N K+KW  REPYAYWKGNP V  TR D+LKCNVSEKQDW AR+Y QDWI+E KQG++
Sbjct  237   KKANEKLKWSKREPYAYWKGNPYVGRTRMDMLKCNVSEKQDWNARIYKQDWIKEQKQGFK  296

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             QSNLA QC HRYKIY+EG+ WSVSEKYILACDS+TLLVKP YYDFY+RGLMP+KHYWP+ 
Sbjct  297   QSNLASQCKHRYKIYVEGNTWSVSEKYILACDSVTLLVKPDYYDFYSRGLMPLKHYWPVN  356

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             ++DKC+SIKHAV WGN H ++AQEIG A + ++QE+LKM+YVYDYMFHLLSEYAKLLKYK
Sbjct  357   NNDKCRSIKHAVHWGNTHQKEAQEIGKAANDFLQEQLKMDYVYDYMFHLLSEYAKLLKYK  416

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             P +P +A+ELCSE M C A G+ K+FM ES+V+  PS   PC +PPPF PA +
Sbjct  417   PAIPKKAIELCSEVMACPAEGVIKKFMEESMVQ-GPSDAIPCNIPPPFSPADV  468



>ref|XP_007220737.1| hypothetical protein PRUPE_ppa023179mg [Prunus persica]
 gb|EMJ21936.1| hypothetical protein PRUPE_ppa023179mg [Prunus persica]
Length=502

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/478 (60%), Positives = 349/478 (73%), Gaps = 29/478 (6%)
 Frame = +3

Query  372   AVFFFMVLCVGAFVSTRLLD-------STVTAQHPTRLSHQKIIENEIP---------PL  503
             A+F  + + VGA + TRLL+         ++ Q  T  S+      EIP         PL
Sbjct  9     AIFVVLFVLVGALICTRLLNYNTETLLGAISGQARTSQSYPHKT-GEIPKKPRGKLEIPL  67

Query  504   NCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRES  683
             NC       +CP+NY  +    +   R           S   CP+YFRWI++DL  W  +
Sbjct  68    NCPAYDLRGTCPSNYPTTFHPEQNPER----------PSPPTCPEYFRWIHEDLRPWART  117

Query  684   GISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLD  863
             GI+REMV  A RTANF+ VIVNG AY   Y K+FQ+RD FT+WG LQLLRRYPG+VPDL+
Sbjct  118   GITREMVERANRTANFKFVIVNGKAYVEQYEKAFQTRDVFTVWGFLQLLRRYPGQVPDLE  177

Query  864   LMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEG  1043
             LMFD VDWPVI    Y      TAPP LFRYC D+ T DIVFPDWSFWGW EINI+PWE 
Sbjct  178   LMFDCVDWPVIPSHEYS-GPNATAPPPLFRYCADDNTLDIVFPDWSFWGWAEINIRPWEV  236

Query  1044  LSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEH  1223
             L +ELKEGN +  W++REPYAYWKGNP++A TR+DL+KCNVSE+ DW AR+YAQDW +E 
Sbjct  237   LFEELKEGNKRKTWLEREPYAYWKGNPDIAETRQDLIKCNVSEEHDWNARLYAQDWDRES  296

Query  1224  KQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKH  1403
             K+GY +S+LA QCIHRYKIYIEGSAWSVSEKYILACDS+TL+VKP YYDF+TR LMP++H
Sbjct  297   KEGYNKSDLASQCIHRYKIYIEGSAWSVSEKYILACDSVTLIVKPRYYDFFTRRLMPVEH  356

Query  1404  YWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAK  1583
             YWPI+DDDKC+SIK +VDWGN H ++AQ IG A S  IQEELKMEYVYDYMFHLL+EYAK
Sbjct  357   YWPIKDDDKCRSIKFSVDWGNTHRRKAQAIGKASSNLIQEELKMEYVYDYMFHLLNEYAK  416

Query  1584  LLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             LL++KPTVP +AVELCSE M C A G EK+FM++SLVK  P+ + PC MPPP+DP++L
Sbjct  417   LLQFKPTVPKKAVELCSEAMACQAEGTEKKFMLQSLVK-GPAVSEPCAMPPPYDPSSL  473



>ref|XP_010456660.1| PREDICTED: O-glucosyltransferase rumi homolog [Camelina sativa]
Length=549

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/522 (56%), Positives = 367/522 (70%), Gaps = 35/522 (7%)
 Frame = +3

Query  264   ILKMRETSEGARLYRHFTDTNWRPL--PAIKTLPRSSLAVF-FFMVLCVGAFVSTRLL--  428
             I + +  S G    RHFTD  W P     +   P  S A+F   ++L VGAF+STRLL  
Sbjct  9     IARSKNGSSGGHC-RHFTDAVWSPFIKSGLGISPNRSYALFSLVILLAVGAFISTRLLLD  67

Query  429   ----DSTVTAQHPTRLSHQKIIENEIPP-------------LNCSLR--TPMASCPANYY  551
                    VTA   T+     I     PP             L+CS    T  ++CP N Y
Sbjct  68    PTVLTEAVTASPKTKTQTHTISPKYPPPTTVITQNPKPEFTLHCSANETTTASTCPRNKY  127

Query  552   PSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANF  731
             P      T T   D     P  ++  CPDYFRWI++DL  W ++GI+RE +  A++TANF
Sbjct  128   P------TTTSFGDDDPNHPPTAT--CPDYFRWIHEDLRPWAKTGITREALEGAKKTANF  179

Query  732   RLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSY  911
             RL IV G  Y   ++ +FQ+RD FT+WG LQLLR+YPGK+PDL+LMFD VDWPV++   +
Sbjct  180   RLAIVGGKVYVEKFQDAFQTRDVFTIWGFLQLLRKYPGKIPDLELMFDCVDWPVVRAAEF  239

Query  912   VLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVD  1091
                    +PP LFRYCG+E T DIVFPDWSFWGW E+NIKPWE L KEL+EGN +  W++
Sbjct  240   A-GVNAPSPPPLFRYCGNEETLDIVFPDWSFWGWAEVNIKPWESLLKELREGNERRTWIN  298

Query  1092  REPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHR  1271
             REPYAYWKGNP VA TR+DL+KCNVSE+ +W AR+YAQDWI+E K+GY+QS+LA QC HR
Sbjct  299   REPYAYWKGNPVVAETRQDLMKCNVSEEHEWNARLYAQDWIKESKEGYKQSDLASQCHHR  358

Query  1272  YKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHA  1451
             YKIYIEGSAWSVSEKYILACDS+TLLVKPHYYDF+TRGL+P  HYWP+R+ DKC+SIK A
Sbjct  359   YKIYIEGSAWSVSEKYILACDSVTLLVKPHYYDFFTRGLLPAHHYWPVREQDKCRSIKFA  418

Query  1452  VDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELC  1631
             VDWGN H Q+AQ++G A S +IQ+ELKM+YVYDYM+HL++EY+KLL +KP +P  AVE+C
Sbjct  419   VDWGNTHVQKAQDMGKAASDFIQQELKMDYVYDYMYHLITEYSKLLLFKPEIPRNAVEIC  478

Query  1632  SEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             SE M C  +G E++FM ESLVK  P+ + PCTMPPP+DPA+L
Sbjct  479   SETMACPRSGNERKFMTESLVK-HPADSGPCTMPPPYDPASL  519



>ref|XP_010273073.1| PREDICTED: O-glucosyltransferase rumi-like [Nelumbo nucifera]
Length=510

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/472 (61%), Positives = 350/472 (74%), Gaps = 22/472 (5%)
 Frame = +3

Query  360   RSSLAVFFFMVLCVGAFVSTRLLDSTVTA-QHPTRLSH--QKIIENEIPPLNCSLRTPMA  530
             R +  +FFF++     FVS   +D+++TA   P  L    +K       PLNC+      
Sbjct  30    RRNNVLFFFVLFLCAVFVSAYWIDASITADSKPANLFKVLRKPKRRIELPLNCTAGNLTR  89

Query  531   SCPANY---YPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREM  701
             +CPA Y   Y S K   +               +  CPDYFRWI++DL  W+++GI+REM
Sbjct  90    TCPAGYPSTYESGKYENSSA-------------APVCPDYFRWIHEDLRPWKDTGITREM  136

Query  702   VMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTV  881
             V  A R+A FRLV+VNG AY   YRK+ Q+RD FTLWGILQLLRRYPG++PDLDLMFD  
Sbjct  137   VEGAGRSAKFRLVVVNGTAYVEKYRKAIQTRDVFTLWGILQLLRRYPGRMPDLDLMFDCD  196

Query  882   DWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELK  1061
             D P+I+ + +       APP LFRYCGD+ T DIVFPDWSFWGW EINIKPWE L KELK
Sbjct  197   DRPLIRSRDH--RGPNAAPPPLFRYCGDDWTLDIVFPDWSFWGWAEINIKPWESLLKELK  254

Query  1062  EGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQ  1241
             +GN   KW +REPYAYWKGNP VA TR+DLLKCNVS++QDW AR+Y QDW +E +QGY++
Sbjct  255   KGNEMTKWKEREPYAYWKGNPYVAPTRRDLLKCNVSQEQDWNARLYIQDWNRESQQGYKE  314

Query  1242  SNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRD  1421
             SNL  QC HRYKIYIEG AWSVSEKYILAC+S TLLV+P++YDF+TR L+P +HYWPIR 
Sbjct  315   SNLEQQCTHRYKIYIEGWAWSVSEKYILACNSPTLLVRPNFYDFFTRSLVPGRHYWPIRG  374

Query  1422  DDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKP  1601
             +DKC+SIK AVDWGNNH Q+AQ IG A S +IQEELKM++VYDYMFHLL+EYAKLLKY+P
Sbjct  375   NDKCRSIKFAVDWGNNHTQEAQAIGEAASSFIQEELKMDFVYDYMFHLLNEYAKLLKYRP  434

Query  1602  TVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             TVPP A++LCSE M C ANGL+++FMMES+VK AP  T PC +PPPFDPATL
Sbjct  435   TVPPNAIQLCSETMACPANGLQRKFMMESMVK-APKETGPCALPPPFDPATL  485



>ref|XP_004514091.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Cicer 
arietinum]
 ref|XP_004514092.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Cicer 
arietinum]
Length=495

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/481 (59%), Positives = 357/481 (74%), Gaps = 27/481 (6%)
 Frame = +3

Query  345   IKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIEN-EIP--------  497
             +K+L RS++ +   ++L VGA V  R LD+       + +      ++ EIP        
Sbjct  3     MKSLSRSTVVLVLPIILIVGALVYARFLDTPEVFSAGSSMEQILTTKSYEIPKIPLNQTE  62

Query  498   -PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAW  674
              PLNCS      +CP N   ++K++      QD  S +       CPDYFRWI++DL  W
Sbjct  63    IPLNCSGYNLTGTCPTN---NAKISWNN---QDHSSNST------CPDYFRWIHEDLRPW  110

Query  675   RESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVP  854
               +GI++E +  A+ T+NF+L+I+ G AY   Y KSFQ+RD FTLWGILQLLR+YPG +P
Sbjct  111   AHTGITKETIEKAKTTSNFKLIILKGKAYLETYEKSFQTRDVFTLWGILQLLRKYPGMLP  170

Query  855   DLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKP  1034
             DL+LMFD VDWPV+    Y   D    PP LFRYCG++AT DIVFPDWSFWGWPE+N+KP
Sbjct  171   DLELMFDCVDWPVVSIGQYNGVD----PPPLFRYCGNDATLDIVFPDWSFWGWPEVNVKP  226

Query  1035  WEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWI  1214
             W  L  ELKEGN KI W++REPYAYWKGNP VA TR+DL+KCN+SEKQDW AR+YAQDW 
Sbjct  227   WGILLGELKEGNKKISWMNREPYAYWKGNPTVAETRQDLMKCNLSEKQDWNARLYAQDWG  286

Query  1215  QEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMP  1394
             +E ++GY++S+LA QC H+YK+YIEGSAWSVSEKYILACDS TLLVKPHYYDF+TRGL+P
Sbjct  287   RESQEGYKKSDLASQCTHKYKVYIEGSAWSVSEKYILACDSPTLLVKPHYYDFFTRGLIP  346

Query  1395  MKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSE  1574
             + HYWPI++DDKC+SIK AVDWGN+H ++A  IG A S +IQEELKM+YVYDYMFHLL+ 
Sbjct  347   VHHYWPIKEDDKCRSIKFAVDWGNSHKEKAHNIGKAASNFIQEELKMDYVYDYMFHLLNS  406

Query  1575  YAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPAT  1754
             YAKL +YKP++  +AVELC E MVC A GLEK+FMMESLVK APS T PCTMPPP+DP +
Sbjct  407   YAKLFRYKPSISDKAVELCVESMVCKAQGLEKKFMMESLVK-APSNTNPCTMPPPYDPPS  465

Query  1755  L  1757
             L
Sbjct  466   L  466



>ref|XP_011084731.1| PREDICTED: protein O-glucosyltransferase 1-like [Sesamum indicum]
Length=491

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/474 (61%), Positives = 352/474 (74%), Gaps = 23/474 (5%)
 Frame = +3

Query  369   LAVFFFMVLCVGAFVSTRLLDSTV------TAQHPTRLSHQKIIEN-----EIPPLNCSL  515
             +A      L  GAF+ TR LDS            P+  S    +EN      I    CSL
Sbjct  1     MAALLVASLTFGAFLCTRHLDSVAFLMVRRDRSFPSESSQN--LENFPTTTVIQVHKCSL  58

Query  516   RTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISR  695
                  SCP N + S      +T I D    +    S  CPDYFRW+++DL  WR++GI+R
Sbjct  59    GNLSPSCPVNCHSS------KTFIGDKNVRSTPPPS--CPDYFRWVHEDLGPWRKTGITR  110

Query  696   EMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFD  875
             EMVMSA+RTANFRLVI++G AY   Y K F+SRDTFTLWGILQLLR+YPGKVPDLDLMFD
Sbjct  111   EMVMSAKRTANFRLVILDGKAYVETYSKGFESRDTFTLWGILQLLRKYPGKVPDLDLMFD  170

Query  876   TVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKE  1055
               D PVIKK+++       APP LF YC +++T++IVFPDWSFWGWPE+NIKPWE LSK+
Sbjct  171   CGDLPVIKKENFK-GRMHPAPPTLFGYCKNDSTFNIVFPDWSFWGWPELNIKPWETLSKD  229

Query  1056  LKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGY  1235
             +KEGN + +W +R+PYAYWKGNP VA+ R+DL +CNVS+K DWGAR+YAQDW +E K+G+
Sbjct  230   IKEGNKRKRWRERKPYAYWKGNPLVASKRRDLRRCNVSDKMDWGARIYAQDWRKEKKEGF  289

Query  1236  QQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPI  1415
             +QSNLA+QC HRYKIYIEG  WSVSEKYILACDS+ LLVKPHYYDF+TRGL P++HYWPI
Sbjct  290   KQSNLANQCTHRYKIYIEGVGWSVSEKYILACDSVMLLVKPHYYDFFTRGLTPLQHYWPI  349

Query  1416  RDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKY  1595
             +DDDKC+SIKHAVDWGNNH ++AQ IG   S ++  E+KM+YVYDYMFHLLSEY+KLLKY
Sbjct  350   KDDDKCRSIKHAVDWGNNHREEAQAIGKTASSFVLNEVKMDYVYDYMFHLLSEYSKLLKY  409

Query  1596  KPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             KPTVP  AVELC E + C + GL K+FMM++LVK  PS + PC MPPP+DP +L
Sbjct  410   KPTVPERAVELCLEALACPSQGLAKKFMMDTLVK-CPSVSNPCMMPPPYDPPSL  462



>ref|XP_009340025.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Pyrus 
x bretschneideri]
Length=506

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/482 (60%), Positives = 357/482 (74%), Gaps = 32/482 (7%)
 Frame = +3

Query  372   AVFFFMVLCVGAFVSTRLLDS-------TVTAQHPTRLSHQKII----ENEIP-------  497
             A+F F+ + VGA V TRLL+S       T T+Q PT  +           +IP       
Sbjct  9     AIFLFLFVLVGALVCTRLLNSSTETLISTTTSQVPTLTTKTSQTYPNKTGQIPQNPSSQL  68

Query  498   --PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWA  671
               PLNCS      +CP+NY  +    +   R           +S  CP+YFRWI++DL  
Sbjct  69    EIPLNCSAYNLTTTCPSNYPTTFHPEQDPDR----------PASPTCPEYFRWIHEDLRP  118

Query  672   WRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKV  851
             W  +GI+R+MV  A RTANF+LVIVNG AY   Y K+FQ+RDTFT+WGILQLLRRYPGKV
Sbjct  119   WAHTGITRDMVERANRTANFKLVIVNGKAYVEQYEKAFQTRDTFTIWGILQLLRRYPGKV  178

Query  852   PDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIK  1031
             PDL++MFD VDWPVI    Y   ++TT PP LFRYCGD+ T D+VFPDWSFWGW EINI+
Sbjct  179   PDLEMMFDCVDWPVILSGDYDGPNSTTPPP-LFRYCGDDNTLDVVFPDWSFWGWAEINIR  237

Query  1032  PWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDW  1211
             PWE L K L+EGN + KW+DREPYAYWKGNP +A  R++L+ CNVS++ DW AR+YAQDW
Sbjct  238   PWEILLKNLEEGNKRSKWLDREPYAYWKGNPTIAEHRQELMTCNVSDQYDWYARLYAQDW  297

Query  1212  IQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLM  1391
              +E ++G+++S+LA QC+HRYKIYIEGSAWSVSEKYILACDS+TL+VKP YYDF+TR LM
Sbjct  298   SREAQEGFKRSDLASQCVHRYKIYIEGSAWSVSEKYILACDSITLIVKPRYYDFFTRTLM  357

Query  1392  PMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLS  1571
             P+ HYWPI+ DDKC+SIK AVDWGN+H ++AQ IG A SK IQE+LKM+YVYDYMFHLL+
Sbjct  358   PLHHYWPIKYDDKCRSIKFAVDWGNSHQKKAQAIGKASSKLIQEDLKMDYVYDYMFHLLN  417

Query  1572  EYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPA  1751
             EYA LL++KP +P +A+ELCSE M C A GLEK+FMMESLVK  P+   PC++PPP+DPA
Sbjct  418   EYANLLQFKPRIPQKAIELCSEAMACQAEGLEKKFMMESLVK-GPAVGEPCSLPPPYDPA  476

Query  1752  TL  1757
             +L
Sbjct  477   SL  478



>ref|XP_010910005.1| PREDICTED: O-glucosyltransferase rumi homolog [Elaeis guineensis]
Length=551

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/473 (60%), Positives = 348/473 (74%), Gaps = 25/473 (5%)
 Frame = +3

Query  402   GAFVSTRLLD-STVTAQHPTRLSHQKIIENEIPPLNCSLRTPMA----------------  530
             GAF+S R ++ +++ +   T    Q +IE  IP  + S R P                  
Sbjct  52    GAFISVRWINVASIRSITDTDTKTQNLIE--IPTTSTSHRAPPPQPLPPKPKLKPKPKPL  109

Query  531   ----SCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISRE  698
                 SCP     S+ +  +               S  CPDYFRWI++DL  W+ +GI++E
Sbjct  110   IIPFSCPIGNQNSTGICPSTPLPPPLSDDASLPPSPSCPDYFRWIHEDLRPWKSTGITQE  169

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MV  ARRTANFRLVI++G AY   YR SFQSRD FTLWGILQLLR YPG++PDL+LMFDT
Sbjct  170   MVKRARRTANFRLVILDGRAYVEYYRPSFQSRDVFTLWGILQLLRHYPGRIPDLELMFDT  229

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPVI  + Y      + PP LFRYC D +T DIVFPDWSFWGWPEINIKPWE L +EL
Sbjct  230   VDWPVIMARDY-RGRNASVPPPLFRYCADVSTLDIVFPDWSFWGWPEINIKPWEALRREL  288

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             KEGN +++W+DREPYAYWKGNP VAATR+DLLKCNVSE  DW AR+YAQDW QE ++G++
Sbjct  289   KEGNERVRWMDREPYAYWKGNPAVAATRQDLLKCNVSEAHDWNARIYAQDWFQETRKGFK  348

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             +S+LA+QCIHRYKIYIEG+ WSVSEKYILAC+SLTLLVKP YYDF+TRGLMP++HYWP+R
Sbjct  349   ESDLANQCIHRYKIYIEGTTWSVSEKYILACNSLTLLVKPRYYDFFTRGLMPVQHYWPVR  408

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
              +DKC+SIK AVDWGN+H Q+AQ IG   S +IQE++KMEYVYDYM HLL+EYAKLL+YK
Sbjct  409   SNDKCRSIKFAVDWGNSHKQKAQAIGKEASSFIQEKVKMEYVYDYMLHLLTEYAKLLRYK  468

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             PT PP A+ELCSE M C A GL K+FMM+S+VK +P  +APCT+PPPF P  L
Sbjct  469   PTRPPNAMELCSESMACPAEGLVKKFMMDSMVK-SPHDSAPCTLPPPFSPVEL  520



>gb|KHN42549.1| O-glucosyltransferase rumi like [Glycine soja]
Length=528

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/508 (56%), Positives = 352/508 (69%), Gaps = 32/508 (6%)
 Frame = +3

Query  270   KMRETSEGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLD------  431
             +  E  E    +RHF D+ W   P +K+LPRS+  + F ++L +GAF  TR LD      
Sbjct  12    QQEENHEMVGNFRHFKDSIW--WPVVKSLPRSTAVLIFPVMLIIGAFAYTRTLDTHRMFS  69

Query  432   ---STVTAQHPTRLSHQKI---IENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQD  593
                S+ +AQ  T          I   I PLNC+      +CP N         T T    
Sbjct  70    GASSSKSAQSTTPYGTSPFTVSIRKPIAPLNCTAYNLTGTCPTNLQDHQNSPATAT----  125

Query  594   spsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNY  773
                         CPDYFRWI++DL  W  +GI+++MV  A++TANFRL+I+ G AY   Y
Sbjct  126   ------------CPDYFRWIHEDLRPWARTGITQDMVERAKQTANFRLIILKGRAYLETY  173

Query  774   RKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFR  953
              + +Q+RD F++WGILQLLRRYPGK+PDL+LMFD VDWPV+    Y        PP LFR
Sbjct  174   SRPYQTRDVFSIWGILQLLRRYPGKIPDLELMFDCVDWPVVLADRYN-GPNVEQPPPLFR  232

Query  954   YCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVA  1133
             YCG++AT DIVFPDWSFWGW EINIKPW  L  ELKEG  +I W++REPYAYWKGNP VA
Sbjct  233   YCGNDATLDIVFPDWSFWGWAEINIKPWHILLGELKEGTTRIPWLNREPYAYWKGNPAVA  292

Query  1134  ATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSE  1313
              TR+DL+KCNVSE QDW AR+ AQDW +E ++G+ +S+L  QC +RYK+YIEGSAWSVS+
Sbjct  293   QTRQDLIKCNVSENQDWNARLLAQDWFRESQEGFNKSDLPSQCTYRYKVYIEGSAWSVSQ  352

Query  1314  KYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEI  1493
             KYIL+CDS TLL+KP YYDF+TRGL+P+ HYWPI+DDDKC+SIK AVDWGNNH Q+A +I
Sbjct  353   KYILSCDSTTLLLKPKYYDFFTRGLIPVHHYWPIKDDDKCRSIKFAVDWGNNHKQRAHQI  412

Query  1494  GMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQ  1673
             G   S +IQEE+KM+YVYDYMFHLL+ YAKL +YKP++   A ELC E MVCGA G  K+
Sbjct  413   GKVASDFIQEEVKMDYVYDYMFHLLNSYAKLFRYKPSISANATELCVESMVCGAEGSVKK  472

Query  1674  FMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             FMMESLVK  P+ T PCTMP PFDP TL
Sbjct  473   FMMESLVK-VPANTDPCTMPAPFDPPTL  499



>ref|XP_011076165.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Sesamum 
indicum]
Length=480

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/462 (61%), Positives = 344/462 (74%), Gaps = 40/462 (9%)
 Frame = +3

Query  375   VFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYP  554
              FF  +L VGA++ST +LD +V+ +                           +CPANYYP
Sbjct  28    AFFTCLLVVGAYLSTSILDISVSTK---------------------------TCPANYYP  60

Query  555   SSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFR  734
             S+ L   R R         +     CP YF WI++DL  W+++GI+ EMV+ A RTANFR
Sbjct  61    SA-LPTIRPR--------SSSILLSCPHYFHWIHEDLRPWKDTGITEEMVVRANRTANFR  111

Query  735   LVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYV  914
             LVI+NG AY   Y KSFQ+RD FTLWGILQLLRRYPGKVPDLDLMFD VDWPVIK   Y 
Sbjct  112   LVILNGRAYLETYVKSFQTRDVFTLWGILQLLRRYPGKVPDLDLMFDCVDWPVIKSSDYQ  171

Query  915   -LNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVD  1091
              LN     PP LFRYCG+  T+DI FPDWSFWGWPE NIKPWE L  +L EGN K++W+D
Sbjct  172   GLN--ALKPPPLFRYCGNNQTFDIAFPDWSFWGWPETNIKPWEQLMGDLNEGNKKLRWMD  229

Query  1092  REPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHR  1271
             REPYA+WKGNP+VA  R DLLKCNVSEKQDW ARVY QDW +E ++G++QS+LA QC HR
Sbjct  230   REPYAFWKGNPKVAEKRVDLLKCNVSEKQDWNARVYKQDWDKEIEEGFKQSDLAKQCTHR  289

Query  1272  YKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHA  1451
             YKIYIEGSAWSVSEKYILACDS+TLLV P YYDF+TR L+PM+HYWPI+ +DKC+SIK A
Sbjct  290   YKIYIEGSAWSVSEKYILACDSVTLLVTPDYYDFFTRSLVPMQHYWPIKAEDKCRSIKFA  349

Query  1452  VDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELC  1631
             VDWGNNH ++AQE+G A S ++Q +LKM++VYDYMFHLLSEY+KLL+YKP +PP+AVELC
Sbjct  350   VDWGNNHKEKAQELGTAASSFVQNDLKMDFVYDYMFHLLSEYSKLLRYKPKIPPKAVELC  409

Query  1632  SEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             SE M C A GLEK FM++S+VK +P  ++PC+MP P +P+ L
Sbjct  410   SEAMACHAQGLEKTFMLDSMVK-SPKESSPCSMPSPLEPSAL  450



>ref|XP_006394641.1| hypothetical protein EUTSA_v10003948mg [Eutrema salsugineum]
 gb|ESQ31927.1| hypothetical protein EUTSA_v10003948mg [Eutrema salsugineum]
Length=545

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/504 (57%), Positives = 359/504 (71%), Gaps = 29/504 (6%)
 Frame = +3

Query  306   RHFTDTNWRPL--PAIKTLPRSSLAVF-FFMVLCVGAFVSTRLL-DSTVTAQHPTRLSHQ  473
             R+FTDT W P         P  S AVF   ++L VGAF+STRLL D T   +     +  
Sbjct  21    RNFTDTVWSPFVKSGFGISPNRSYAVFSLLILLIVGAFISTRLLLDPTALIEKEAVTTTN  80

Query  474   KIIENEIP----------------PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsp  605
                E   P                 L+CS      +CP N YP++   +       S + 
Sbjct  81    TKTETASPNYPRPATIITQNPREFTLHCSGNETTGTCPRNNYPTTVSFKEDDSTHSSTTA  140

Query  606   tptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSF  785
             T       CPDYFRWI++DL  W ++GI+RE +  A++TANFRL IV G  Y   ++ +F
Sbjct  141   T-------CPDYFRWIHEDLRPWEKTGITREALERAKKTANFRLAIVGGKLYVEKFQDAF  193

Query  786   QSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGD  965
             Q+RD FT+WG LQLLRRYPGK+PDL+LMFD VDWPV+K  ++     + +PP LFRYCG+
Sbjct  194   QTRDVFTIWGFLQLLRRYPGKIPDLELMFDCVDWPVVKAANFA-GANSPSPPPLFRYCGN  252

Query  966   EATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRK  1145
             E T DIVFPDWSFWGW E+NIKPWE L KEL+EGN K  W++REPYAYWKGNP VA TR+
Sbjct  253   EETLDIVFPDWSFWGWSEVNIKPWESLLKELREGNEKTNWINREPYAYWKGNPLVAETRQ  312

Query  1146  DLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYIL  1325
             DL+KCNVSE+ +W AR+YAQDWI+E K+GY+QS+LA QC HR+KIYIEGSAWSVSEKYIL
Sbjct  313   DLMKCNVSEEHEWNARLYAQDWIRESKEGYKQSDLASQCHHRFKIYIEGSAWSVSEKYIL  372

Query  1326  ACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAG  1505
             ACDS+TLLVKPHYYDF+TRGL+P  HYWP+R+ DKC+SIK AV WGN+H Q+AQ+IG A 
Sbjct  373   ACDSVTLLVKPHYYDFFTRGLLPAHHYWPVREHDKCRSIKFAVHWGNSHIQKAQDIGKAA  432

Query  1506  SKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMME  1685
             S++IQ+ELKM+YVYDYMFHLL+EY+KLL++KP +P  A E+CSE M C  +G E++FM E
Sbjct  433   SEFIQQELKMDYVYDYMFHLLTEYSKLLQFKPEIPQNAKEICSETMACPRSGNERKFMTE  492

Query  1686  SLVKAAPSTTAPCTMPPPFDPATL  1757
             SLVK  P+ T PC MPPP+DPA+ 
Sbjct  493   SLVK-HPAQTGPCAMPPPYDPASF  515



>ref|XP_006421921.1| hypothetical protein CICLE_v10004696mg [Citrus clementina]
 gb|ESR35161.1| hypothetical protein CICLE_v10004696mg [Citrus clementina]
Length=536

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/498 (59%), Positives = 362/498 (73%), Gaps = 29/498 (6%)
 Frame = +3

Query  309   HFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQ-----  473
             HFTDT WR    + +  +S +   F +VL +GA VSTRLLDS        R+        
Sbjct  24    HFTDTIWRQF--VMSPAKSYVLFSFIVVLLLGALVSTRLLDSAALDGGANRVVTDRKSLT  81

Query  474   ------KIIENEIP-PLNCSL---RTPMASCPANYYPSSKLTRTRTRIQDspsptptqss  623
                   K   N+I  PLNC+     T   SCP  Y P+S                   S 
Sbjct  82    FDPRITKKPRNKIEYPLNCTAAGSHTHTKSCPGTY-PTSYAPEEDN---------DATSP  131

Query  624   sKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTF  803
             S CP+YFRWI++DL  W  +GI+REMV  AR+TANFRLVIV G AY   Y K+FQSRDTF
Sbjct  132   STCPEYFRWIHEDLRPWARTGITREMVERARKTANFRLVIVKGKAYVETYTKAFQSRDTF  191

Query  804   TLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDI  983
             TLWGILQLLRRYPG++PDLDLMFD VDWPV+ + +Y   D    P  LFRYC ++ T+DI
Sbjct  192   TLWGILQLLRRYPGRIPDLDLMFDCVDWPVVLRNAYCAPDAPAPP-PLFRYCANDQTYDI  250

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCN  1163
             VFPDWSFWGWPE+NIK WE   K+L+EGN +IKW DREPYAYWKGNP VA TR+DL+KCN
Sbjct  251   VFPDWSFWGWPEVNIKSWEPQLKDLEEGNGRIKWSDREPYAYWKGNPTVAPTRQDLMKCN  310

Query  1164  VSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLT  1343
             VSE Q+W ARV+AQDWI+E ++GY+QS+LA QC  R+KIYIEGSAWSVSEKYILACDS+T
Sbjct  311   VSEGQEWNARVFAQDWIKEQQEGYKQSDLASQCRDRFKIYIEGSAWSVSEKYILACDSVT  370

Query  1344  LLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQE  1523
             L+V P YYDFYTRGLMP+ HYWPI D DKC+SIK AVDWGN+H ++A+ +G A SK+IQ+
Sbjct  371   LIVTPKYYDFYTRGLMPLHHYWPINDHDKCRSIKFAVDWGNSHKKKAKAMGRAASKFIQD  430

Query  1524  ELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAA  1703
             ELK++YVYDYMFHLL++Y+KLL+Y+PTVPPEAVE C+E++ C   G  ++FM ESLV+ +
Sbjct  431   ELKLDYVYDYMFHLLNQYSKLLRYQPTVPPEAVEYCAERLACAEEGPARKFMEESLVQ-S  489

Query  1704  PSTTAPCTMPPPFDPATL  1757
             P  T+PCT+PP +DP++L
Sbjct  490   PKETSPCTLPPSYDPSSL  507



>ref|XP_006287442.1| hypothetical protein CARUB_v10000648mg [Capsella rubella]
 gb|EOA20340.1| hypothetical protein CARUB_v10000648mg [Capsella rubella]
Length=544

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/509 (57%), Positives = 362/509 (71%), Gaps = 35/509 (7%)
 Frame = +3

Query  306   RHFTDTNWRPL--PAIKTLPRSSLA-VFFFMVLCVGAFVSTRLL-DSTV------TAQHP  455
             R+F D  W P       + P  S A V   ++L VGAFVSTRLL D TV       A  P
Sbjct  16    RYFIDAVWSPFVKSGFGSSPNRSYALVSLIILLVVGAFVSTRLLLDPTVLIEKEAVAATP  75

Query  456   TRLSHQKIIENEIP--------------PLNCSL-RTPMASCPANYYPSSKLTRTRTRIQ  590
                +    I  + P               L+CS   T   +CP N  P      T     
Sbjct  76    KTKTQTNTISPKYPRPATVITQNPKPQFTLHCSANETTGNTCPKNKDP------TTASFN  129

Query  591   DspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHN  770
             D  +  P  ++  CPDYFRWI++DL  W  +GI+RE +  A +TANFRL IV G  Y   
Sbjct  130   DDDTNHPPTAT--CPDYFRWIHEDLRPWARTGITREALERANKTANFRLAIVGGKVYVEK  187

Query  771   YRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALF  950
             ++ +FQ+RD FT+WG LQLLR+YPGK+PDL+LMFD VDWPV++   +   D  + PP LF
Sbjct  188   FQDAFQTRDVFTIWGFLQLLRKYPGKIPDLELMFDCVDWPVVRAAEFAGVDAPSPPP-LF  246

Query  951   RYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEV  1130
             RYCG+E T DIVFPDWSFWGW E+NIKPWE L KEL+EGN KI W++REPYAYWKGNP V
Sbjct  247   RYCGNEETLDIVFPDWSFWGWAEVNIKPWESLLKELREGNEKINWINREPYAYWKGNPVV  306

Query  1131  AATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVS  1310
             A TR+DL+KCNVSE+ +W AR+YAQDWI+E K+GY+QS+LA+QC HRYKIYIEGSAWSVS
Sbjct  307   AETRQDLMKCNVSEEHEWNARLYAQDWIKESKEGYKQSDLANQCHHRYKIYIEGSAWSVS  366

Query  1311  EKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQE  1490
             EKYILACDS+TLLVKPHYYDF+TRGL+P  HYWP+R+ DKC+SIK AVDWGN+H Q+AQ+
Sbjct  367   EKYILACDSMTLLVKPHYYDFFTRGLLPAHHYWPVREKDKCRSIKFAVDWGNSHIQKAQD  426

Query  1491  IGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEK  1670
             IG A S++IQ+ELKM+YVYDYM+HLL+EY+KLL++KP VPP AVE+CSE M C  +G E+
Sbjct  427   IGKAASEFIQQELKMDYVYDYMYHLLNEYSKLLQFKPEVPPNAVEICSETMACTRSGNER  486

Query  1671  QFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +FM ESLVK  P+ + PC +PPP+DP +L
Sbjct  487   KFMTESLVK-HPAESGPCALPPPYDPVSL  514



>gb|KHN23210.1| O-glucosyltransferase rumi like [Glycine soja]
Length=509

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/473 (60%), Positives = 350/473 (74%), Gaps = 29/473 (6%)
 Frame = +3

Query  339   PAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIPPLNCSLR  518
             P  KTLPRS+  + F +VL + A   TR LD+           H+ I   EIP LNCS  
Sbjct  37    PVTKTLPRSTAVLLFPVVLIIAALAYTRTLDT-----------HKPI---EIP-LNCSAY  81

Query  519   TPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISRE  698
                 +CP N  P  +  ++R             SS+ CP+YFRWI++DL  W  +GI++E
Sbjct  82    NLTGTCPTNQSPIPENDQSRP------------SSATCPEYFRWIHEDLRPWARTGITQE  129

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MV  A++TANF+LVI+ G AY   Y K++Q+RD F++WGILQLLRRYPGK+PDL+LMFD 
Sbjct  130   MVERAKQTANFKLVILKGKAYLETYEKAYQTRDVFSIWGILQLLRRYPGKIPDLELMFDC  189

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPV+    Y     T  PP LFRYCG++AT DIVFPDWSFWGW E+NIKPWE L  EL
Sbjct  190   VDWPVLLVDRYN-GPNTEQPPPLFRYCGNDATLDIVFPDWSFWGWAEVNIKPWEILLGEL  248

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             KEG  +I W++REPYAYWKGNP VA TR DL+KCNVSE QDW AR+YAQDW +E ++GY+
Sbjct  249   KEGTKRIPWLNREPYAYWKGNPVVAETRLDLMKCNVSENQDWNARLYAQDWGRESQEGYK  308

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             +S+LA QC HRYK+YIEGSAWSVSEKYILACDS TLLVKPHYYDF+TRGL+P  HYWPI+
Sbjct  309   KSDLASQCTHRYKVYIEGSAWSVSEKYILACDSPTLLVKPHYYDFFTRGLIPGHHYWPIK  368

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             +DDKC+SIK AVDWGN+H Q+A +IG A S +IQEE+KM+YVYDYMFHLL+ YAKL +YK
Sbjct  369   EDDKCRSIKFAVDWGNSHKQRAHQIGKAASDFIQEEVKMDYVYDYMFHLLNSYAKLFRYK  428

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             P++   A E+C+E MVCGA G  K+FMMESLVK  P+ T PC+MP P+DP TL
Sbjct  429   PSLSANATEICAESMVCGAEGPVKKFMMESLVK-VPANTDPCSMPAPYDPPTL  480



>ref|XP_008377526.1| PREDICTED: protein O-glucosyltransferase 1-like [Malus domestica]
Length=506

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/486 (58%), Positives = 355/486 (73%), Gaps = 40/486 (8%)
 Frame = +3

Query  372   AVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIE-----------NEIP-------  497
             A+F F+ + VGA V TRLL+S+      T  S   I+             +IP       
Sbjct  9     AIFVFLFVLVGALVCTRLLNSSTETLISTTSSQVPILTTKTSQTYPNKTGQIPQNPSSQF  68

Query  498   --PLNCSLRTPMASCPANY----YPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYD  659
               PLNC+      +CP+NY    +P     R  +                CP+YFRWI++
Sbjct  69    EIPLNCTAYNLTTTCPSNYPTTFHPEQDPDRPSS--------------PTCPEYFRWIHE  114

Query  660   DLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRY  839
             DL  W  +GI+R+MV  A RTANF+LVIVNG AY   Y K+FQ+RDT T+WGILQLLR+Y
Sbjct  115   DLRPWAHTGITRDMVERANRTANFKLVIVNGKAYVEQYEKAFQTRDTSTIWGILQLLRKY  174

Query  840   PGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPE  1019
             PGKVPDL++MFD VDWPVI    Y   ++TT PP LFRYCGD++T DIVFPDWSFWGW E
Sbjct  175   PGKVPDLEMMFDCVDWPVILSGDYDGPNSTTPPP-LFRYCGDDSTLDIVFPDWSFWGWAE  233

Query  1020  INIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVY  1199
             INI+PWE L K L+EGN + KW+DREPYAYWKGNP +A  R++L+ CNVS++ DW AR+Y
Sbjct  234   INIRPWETLLKNLEEGNKRSKWLDREPYAYWKGNPTIAEHRQELMTCNVSDQYDWYARLY  293

Query  1200  AQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYT  1379
             AQDW +E ++G+++S+LA QC+HRYKIYIEGSAWSVSEKYILACDS+TL+VKP YYDF+T
Sbjct  294   AQDWSREAQEGFKRSDLASQCVHRYKIYIEGSAWSVSEKYILACDSVTLIVKPRYYDFFT  353

Query  1380  RGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMF  1559
             R LMP+ HYWPI+ DDKC+SIK AVDWGN+H ++AQ IG A SK IQE+LKM+YVYDYMF
Sbjct  354   RTLMPLHHYWPIKYDDKCRSIKFAVDWGNSHKKKAQAIGRASSKLIQEDLKMDYVYDYMF  413

Query  1560  HLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPP  1739
             HLL+EYA LL++KP +P +A+ELCSE M C A GLEK+FMMESLVK  P+ + PC++PPP
Sbjct  414   HLLNEYANLLQFKPRIPQKAIELCSEAMACQAEGLEKKFMMESLVK-GPAVSEPCSLPPP  472

Query  1740  FDPATL  1757
             +DPA+L
Sbjct  473   YDPASL  478



>gb|KDP22277.1| hypothetical protein JCGZ_26108 [Jatropha curcas]
Length=511

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/501 (58%), Positives = 368/501 (73%), Gaps = 25/501 (5%)
 Frame = +3

Query  273   MRETS--EGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTA  446
             M++T+  +G+R++ HFT+   +P   I++  +SS+A+   + L +G  + T  L S    
Sbjct  1     MQQTNLMKGSRVFGHFTEMIRQPF--IQSPVKSSIALVLLLFLLIGVIIYTPFLPSNAIT  58

Query  447   QHPTRLSHQKIIENEI----PPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptpt  614
             + P   +H+ I+  E      PLNC       +CP +Y  +S     R            
Sbjct  59    RRP---AHKSILSTETYKIEVPLNCIGFNLTGTCPRDYPTTSSENPDR------------  103

Query  615   qsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSR  794
             Q    CP+YFRWI++DL  W  +GI+R+MV  A+ TANFRL IVNG AY   + K+FQ+R
Sbjct  104   QLPPTCPEYFRWIHEDLRPWARTGITRDMVERAKTTANFRLTIVNGRAYLEMFEKAFQTR  163

Query  795   DTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEAT  974
             D FTLWGILQLLR+YPG+VPDL++MFD VDWPVI+   Y   D   APP LFRYCG + T
Sbjct  164   DVFTLWGILQLLRKYPGRVPDLEMMFDCVDWPVIRSVDYSGPDAA-APPPLFRYCGTDDT  222

Query  975   WDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLL  1154
              DIVFPDWSFWGW EINIKPWE L KELKEGN + +W++REPYA+WKGNP+VA TR+DL+
Sbjct  223   LDIVFPDWSFWGWAEINIKPWEHLEKELKEGNERSRWMEREPYAFWKGNPDVAETRQDLI  282

Query  1155  KCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACD  1334
             KCNVSE+ DW ARVY QDW +E ++GY+QS LA+QC+HR+KIYIEGSAWSVS+KYILACD
Sbjct  283   KCNVSEEHDWNARVYRQDWGKESQEGYKQSELANQCVHRFKIYIEGSAWSVSQKYILACD  342

Query  1335  SLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKY  1514
             S+TL+VKP YYDF+TRGLMP++HYWPI++DDKCKSIK AVDWGN H Q+AQ IG AGS +
Sbjct  343   SVTLIVKPRYYDFFTRGLMPIQHYWPIKEDDKCKSIKFAVDWGNTHRQKAQAIGKAGSGF  402

Query  1515  IQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLV  1694
             IQ +LKM+ VYDYMFHLL EYAKLL +KPT+P  A ELCSE M C ++G EK FMMES+V
Sbjct  403   IQNDLKMDNVYDYMFHLLHEYAKLLTFKPTIPKNATELCSETMACPSDGSEKNFMMESMV  462

Query  1695  KAAPSTTAPCTMPPPFDPATL  1757
             K  P+ T+PC+MPPP+DP +L
Sbjct  463   K-GPAETSPCSMPPPYDPPSL  482



>ref|XP_003549080.1| PREDICTED: KDEL motif-containing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006599592.1| PREDICTED: KDEL motif-containing protein 2-like isoform X2 [Glycine 
max]
Length=525

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/508 (56%), Positives = 350/508 (69%), Gaps = 32/508 (6%)
 Frame = +3

Query  270   KMRETSEGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLD------  431
             +  E  E    +RHF D+ W   P +K+LPRS+  + F ++L +GAF  TR LD      
Sbjct  12    QQEENHEMVGNFRHFKDSIW--WPVVKSLPRSTAVLLFPVMLIIGAFAYTRTLDTHRMFS  69

Query  432   ---STVTAQHPTRLSHQKI---IENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQD  593
                S+ +AQ  T          I   I PLNC+      +CP N         T T    
Sbjct  70    GASSSKSAQSTTPYGTSPFTVSIRKPIAPLNCTAYNLTGTCPTNLQDHQNSPATAT----  125

Query  594   spsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNY  773
                         CPDYFRWI++DL  W  +GI+++MV  A++TANFRL+I+ G AY   Y
Sbjct  126   ------------CPDYFRWIHEDLRPWARTGITQDMVERAKQTANFRLIILKGRAYLETY  173

Query  774   RKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFR  953
              + +Q+RD F++WGILQLLRRYPGK+PDL+LMFD  DWPV+    Y        PP LFR
Sbjct  174   SRPYQTRDVFSIWGILQLLRRYPGKIPDLELMFDCEDWPVVLADRYN-GPNVEQPPPLFR  232

Query  954   YCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVA  1133
             YCG++AT DIVFPDWSFWGW EINIKPW  L  ELKEG  +I W++REPYAYWKGNP VA
Sbjct  233   YCGNDATLDIVFPDWSFWGWAEINIKPWHILLGELKEGTTRIPWLNREPYAYWKGNPAVA  292

Query  1134  ATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSE  1313
              TR+DL+KCNVSE QDW AR++AQDW +E ++G+ +S+L  QC +RYK+YIEGSAWSVS+
Sbjct  293   ETRQDLIKCNVSENQDWNARLFAQDWFRESQEGFNKSDLPSQCTYRYKVYIEGSAWSVSQ  352

Query  1314  KYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEI  1493
             KYIL+CDS TLLVKP YYDF+TRGL+P+ HYWPI+DDDKC+SIK AVDWGNNH Q+A +I
Sbjct  353   KYILSCDSTTLLVKPKYYDFFTRGLIPVHHYWPIKDDDKCRSIKFAVDWGNNHKQRAHQI  412

Query  1494  GMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQ  1673
             G   S +IQEE+KM+YVYDYMFHLL+ YAKL +YKP+    A ELC E MVC A G  K+
Sbjct  413   GKVASDFIQEEVKMDYVYDYMFHLLNSYAKLFRYKPSKSANATELCVESMVCEAEGSVKK  472

Query  1674  FMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             FMMESLVK  P+ T PCTMP PFDP TL
Sbjct  473   FMMESLVK-VPANTDPCTMPAPFDPPTL  499



>ref|XP_010255431.1| PREDICTED: O-glucosyltransferase rumi homolog [Nelumbo nucifera]
 ref|XP_010255432.1| PREDICTED: O-glucosyltransferase rumi homolog [Nelumbo nucifera]
Length=527

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/505 (57%), Positives = 358/505 (71%), Gaps = 33/505 (7%)
 Frame = +3

Query  288   EGARLYRHFT-DTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRL  464
             +G+ L RHF+ +T +RP  A K   R+   V FF+V+ +G  VS R +D+++ +     L
Sbjct  14    KGSGLQRHFSGETTYRPQLAEKGHART--IVLFFIVVFIGTCVSVRWIDTSIISSGGVSL  71

Query  465   S---------HQKIIENEIPPLNCSLRTPMA-----SCPANYYPSSKLTRTRTRIQDsps  602
                        +   E  + PLNCS    ++     S PA +   S  T   T+      
Sbjct  72    KALLTSSNSPEESEDEGFVIPLNCSQVNNLSQVCSTSFPATFPSGSFPTGATTK------  125

Query  603   ptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKS  782
                     +CP YFRWI++DL  W+ESGI+REMV  AR  +NFRLV+V+G  YY  Y  S
Sbjct  126   --------QCPHYFRWIHEDLRPWKESGITREMVERARTKSNFRLVLVDGRLYYEKYSSS  177

Query  783   FQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCG  962
             FQ+RD FTLWGILQLLRRYPG++PD D+MF+  D PVI+ + Y      TAPP LF YCG
Sbjct  178   FQTRDVFTLWGILQLLRRYPGRLPDFDIMFNCNDRPVIRSRDYE-GPNATAPPPLFHYCG  236

Query  963   DEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATR  1142
             D+ T DIVFPDWSFWGWPEINIKPW  L K+LKEGN +IKW  REPYAYWKGNP+V   R
Sbjct  237   DDWTLDIVFPDWSFWGWPEINIKPWIPLLKDLKEGNQRIKWDKREPYAYWKGNPKVCKAR  296

Query  1143  KDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYI  1322
             +DL++CNV++KQDW  R Y Q+W++E +QG+++SNLADQC HRYK+YIEG+AWSVSEKYI
Sbjct  297   QDLVRCNVTDKQDWNGRFYVQNWVRESRQGFKKSNLADQCTHRYKVYIEGAAWSVSEKYI  356

Query  1323  LACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMA  1502
             LACDS TLLV PH+YDF+TR L+P  HYWPI+D+DKC+SIK AVDWGN H  QA  IG A
Sbjct  357   LACDSPTLLVTPHFYDFFTRSLLPGHHYWPIKDNDKCRSIKFAVDWGNKHKNQALAIGKA  416

Query  1503  GSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMM  1682
             GS +IQEELKM  VYDYMFHLLSEY+KLL+YKPT+PP+AVELCSE M C A GL+K +MM
Sbjct  417   GSNFIQEELKMNNVYDYMFHLLSEYSKLLRYKPTIPPQAVELCSEVMACPAGGLKKVYMM  476

Query  1683  ESLVKAAPSTTAPCTMPPPFDPATL  1757
             ES+VK  P+  +PC +PPPFDP  L
Sbjct  477   ESMVK-GPTYRSPCMLPPPFDPPAL  500



>ref|XP_010273071.1| PREDICTED: O-glucosyltransferase rumi-like [Nelumbo nucifera]
 ref|XP_010273072.1| PREDICTED: O-glucosyltransferase rumi-like [Nelumbo nucifera]
Length=531

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/502 (58%), Positives = 358/502 (71%), Gaps = 22/502 (4%)
 Frame = +3

Query  288   EGARLYRHFTD-TNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRL  464
             EG+ L RHF++ T  RP    K   R+   VFFF+VL +GAF S R +D++V       L
Sbjct  14    EGSGLQRHFSEETRCRPFLLEKGTSRT--MVFFFIVLFLGAFFSVRWIDTSVITSGSASL  71

Query  465   S----------HQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptpt  614
                         +   E    P NCS+      C      S+    T +R  +S S    
Sbjct  72    KAIFTSSSDTPEESESEELEFPFNCSVANLSQIC------STSFPATFSRGDNSSSTAAR  125

Query  615   qsssK-CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQS  791
             ++++  CP YFRWI++DL  W+E+GI+REMV   R+ ANFRLV+V+G  YY  Y  +FQ+
Sbjct  126   RTTAATCPHYFRWIHEDLRPWKETGITREMVERERKRANFRLVVVDGRLYYDKYSGAFQT  185

Query  792   RDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEA  971
             RD FTLWGI+QL+RRYPGK+PDLD+MF+  D P+I+K  Y      TAPPALF YCGD+ 
Sbjct  186   RDVFTLWGIVQLMRRYPGKLPDLDIMFNCDDHPIIRKSDYQ-GPNATAPPALFHYCGDDM  244

Query  972   TWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDL  1151
             T DIVFPDWSFWGWPEINIKPW  L K+LK+GN +IKWV R+ YAYWKGNP V+  R+DL
Sbjct  245   TLDIVFPDWSFWGWPEINIKPWVPLLKDLKQGNQRIKWVQRQRYAYWKGNPYVSPGRQDL  304

Query  1152  LKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILAC  1331
             LKCN ++ QDW AR Y QDW +  KQGY+ SNLADQC HRYK+YIEG AWSVSEKYILAC
Sbjct  305   LKCNHNKHQDWNARFYVQDWERASKQGYKHSNLADQCTHRYKVYIEGRAWSVSEKYILAC  364

Query  1332  DSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSK  1511
             DS TLLV PHYYDF+TR L+P+ HYWPI+D DKC+SIK AVDWGN H +QAQ IG AGSK
Sbjct  365   DSPTLLVTPHYYDFFTRSLLPIHHYWPIKDTDKCRSIKFAVDWGNKHKKQAQAIGKAGSK  424

Query  1512  YIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESL  1691
             +IQE+++ME+VYDYMFHLLS+Y+KLL YKPT+PP AVELCSE M C A GL K+FMMES+
Sbjct  425   FIQEQIRMEFVYDYMFHLLSQYSKLLTYKPTIPPHAVELCSEVMACPAAGLNKEFMMESM  484

Query  1692  VKAAPSTTAPCTMPPPFDPATL  1757
             VK  P+   PCT+PPPFDP  L
Sbjct  485   VK-GPANKTPCTLPPPFDPPAL  505



>ref|XP_009340026.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Pyrus 
x bretschneideri]
Length=504

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/485 (59%), Positives = 354/485 (73%), Gaps = 40/485 (8%)
 Frame = +3

Query  372   AVFFFMVLCVGAFVSTRLLDSTV-----------------------TAQHPTRLSHQKII  482
             A+F F+ + VGA V TRLL+S+                        T Q P   S Q  I
Sbjct  9     AIFLFLFVLVGALVCTRLLNSSTLISTTTSQVPTLTTKTSQTYPNKTGQIPQNPSSQLEI  68

Query  483   ENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDD  662
                  PLNCS      +CP+NY  +    +   R           +S  CP+YFRWI++D
Sbjct  69    -----PLNCSAYNLTTTCPSNYPTTFHPEQDPDR----------PASPTCPEYFRWIHED  113

Query  663   LWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYP  842
             L  W  +GI+R+MV  A RTANF+LVIVNG AY   Y K+FQ+RDTFT+WGILQLLRRYP
Sbjct  114   LRPWAHTGITRDMVERANRTANFKLVIVNGKAYVEQYEKAFQTRDTFTIWGILQLLRRYP  173

Query  843   GKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEI  1022
             GKVPDL++MFD VDWPVI    Y   ++TT PP LFRYCGD+ T D+VFPDWSFWGW EI
Sbjct  174   GKVPDLEMMFDCVDWPVILSGDYDGPNSTTPPP-LFRYCGDDNTLDVVFPDWSFWGWAEI  232

Query  1023  NIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYA  1202
             NI+PWE L K L+EGN + KW+DREPYAYWKGNP +A  R++L+ CNVS++ DW AR+YA
Sbjct  233   NIRPWEILLKNLEEGNKRSKWLDREPYAYWKGNPTIAEHRQELMTCNVSDQYDWYARLYA  292

Query  1203  QDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTR  1382
             QDW +E ++G+++S+LA QC+HRYKIYIEGSAWSVSEKYILACDS+TL+VKP YYDF+TR
Sbjct  293   QDWSREAQEGFKRSDLASQCVHRYKIYIEGSAWSVSEKYILACDSITLIVKPRYYDFFTR  352

Query  1383  GLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFH  1562
              LMP+ HYWPI+ DDKC+SIK AVDWGN+H ++AQ IG A SK IQE+LKM+YVYDYMFH
Sbjct  353   TLMPLHHYWPIKYDDKCRSIKFAVDWGNSHQKKAQAIGKASSKLIQEDLKMDYVYDYMFH  412

Query  1563  LLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPF  1742
             LL+EYA LL++KP +P +A+ELCSE M C A GLEK+FMMESLVK  P+   PC++PPP+
Sbjct  413   LLNEYANLLQFKPRIPQKAIELCSEAMACQAEGLEKKFMMESLVK-GPAVGEPCSLPPPY  471

Query  1743  DPATL  1757
             DPA+L
Sbjct  472   DPASL  476



>emb|CDP05201.1| unnamed protein product [Coffea canephora]
Length=552

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/499 (58%), Positives = 364/499 (73%), Gaps = 39/499 (8%)
 Frame = +3

Query  351   TLPRSSLAVFFFMVLCVGAFVSTRLLDSTV-----TAQHPTRLSHQKIIENEIP------  497
              + RSS+A+ F ++LC+GAF++T LLDS+      +++  +  S +     E P      
Sbjct  10    NMGRSSVAILFLVLLCIGAFLTTHLLDSSSNLIPGSSRQGSTFSAKTSKTPEEPLNRSNK  69

Query  498   ---PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLW  668
                 LNCSL      C  +YYPS  + +        P P+ +   S CPDYFRWI++DL 
Sbjct  70    LEFQLNCSLGDETRICLGSYYPSKFMLQN-------PDPSSSTPQSMCPDYFRWIHEDLS  122

Query  669   AWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGK  848
              WRE+GI+ EMV  A RTANFR+V+VNG AY   + +SFQ+RD F+ WGILQLLRRYPGK
Sbjct  123   PWRETGITEEMVRMAGRTANFRVVVVNGTAYLETFDRSFQTRDVFSQWGILQLLRRYPGK  182

Query  849   VPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINI  1028
             +PDLDLMFD  D PV++K+ +   D    P  +FRYC D+AT DIVFPDWSFWGW EI+ 
Sbjct  183   IPDLDLMFDCDDSPVVRKEFHRGPDAPPPP-PVFRYCKDDATLDIVFPDWSFWGWAEIDT  241

Query  1029  KPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQD  1208
             +PW  L KE+K+GN + KW DR+PYAYWKGNP VA  R DLLKCNVS+K+DW AR+Y QD
Sbjct  242   RPWAPLLKEMKDGNERSKWKDRKPYAYWKGNPHVAEGRVDLLKCNVSDKEDWNARLYVQD  301

Query  1209  WIQEHKQGYQQSNLADQCIHR----------------YKIYIEGSAWSVSEKYILACDSL  1340
             W +E +QGY++S LADQC+HR                YKIYIEGSAWSVS+K ILACDS+
Sbjct  302   WNKEQEQGYKESVLADQCVHRHGSIILCSLSRQFIQLYKIYIEGSAWSVSQKNILACDSV  361

Query  1341  TLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQ  1520
             TLLVKP Y++F++RGLMP++HYWPIR DDKC+SIK+AV+WGN++ +QA+EIG AGS ++Q
Sbjct  362   TLLVKPQYHEFFSRGLMPLQHYWPIRADDKCRSIKYAVEWGNDNEKQAEEIGKAGSSFVQ  421

Query  1521  EELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKA  1700
             EELKM+YVYDYMFHLLS+YAKLLKYKP++PP+A+ELCSE M C A  LEK+FMMES+V  
Sbjct  422   EELKMDYVYDYMFHLLSQYAKLLKYKPSIPPKAIELCSESMACPAQALEKKFMMESMV-G  480

Query  1701  APSTTAPCTMPPPFDPATL  1757
              PS+ APC MPPP+DPA L
Sbjct  481   GPSSEAPCIMPPPYDPAAL  499



>ref|XP_008794191.1| PREDICTED: O-glucosyltransferase rumi homolog [Phoenix dactylifera]
Length=548

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/376 (71%), Positives = 315/376 (84%), Gaps = 2/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYFRWI++DL  W+ +GI++EMV  ARRTANFRLVI++G AY   Y  SFQ+RD FTL
Sbjct  144   CPDYFRWIHEDLRPWKSTGITQEMVERARRTANFRLVILDGRAYVEYYHPSFQTRDVFTL  203

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGILQLLRRYPG++PDL+LMFDTVDWPVI  + Y   + + APP LFRYC ++ T DIVF
Sbjct  204   WGILQLLRRYPGRIPDLELMFDTVDWPVILARDYRRRNAS-APPPLFRYCANDLTLDIVF  262

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGWPEINIKPWE L +ELKEGN +++W+DREPYAYWKGNP VA TR+DLLKCNVS
Sbjct  263   PDWSFWGWPEINIKPWEALQRELKEGNERVRWMDREPYAYWKGNPAVAPTRQDLLKCNVS  322

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             E  DW AR+YAQDW +E   G+++S+LA QCIHRYKIYIEG+ WSVSEKYILACDSLTLL
Sbjct  323   EAYDWNARLYAQDWFKETTGGFKESDLASQCIHRYKIYIEGTTWSVSEKYILACDSLTLL  382

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             V P +YDF+TRGLMP++HYWP++ D+KC+SIK AVDWGN+H Q+A  IG   S +IQE+L
Sbjct  383   VNPRFYDFFTRGLMPVQHYWPVQSDNKCRSIKFAVDWGNSHKQKAHAIGKEASSFIQEKL  442

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KMEYVYDYMFHLLSEYAKLL+YKPT PP AVELCSE M C A GLEK+FMM+S+VK +P 
Sbjct  443   KMEYVYDYMFHLLSEYAKLLRYKPTRPPNAVELCSEYMACPAEGLEKKFMMDSMVK-SPH  501

Query  1710  TTAPCTMPPPFDPATL  1757
              +APCT+PPPF P  L
Sbjct  502   DSAPCTLPPPFSPVEL  517



>ref|XP_006490390.1| PREDICTED: KDEL motif-containing protein 2-like [Citrus sinensis]
Length=536

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/498 (58%), Positives = 361/498 (72%), Gaps = 29/498 (6%)
 Frame = +3

Query  309   HFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQ-----  473
             HFTDT WR    + +  +S +   F +VL +GA VSTRLLDS        R+        
Sbjct  24    HFTDTIWRQF--VMSPAKSYVLFSFIVVLFLGALVSTRLLDSAALDGGANRVVTDRKSLT  81

Query  474   ------KIIENEIP-PLNCSL---RTPMASCPANYYPSSKLTRTRTRIQDspsptptqss  623
                   K   N++  PLNC+     T   SCP  Y P+S                   S 
Sbjct  82    FDPRITKKPRNKVEYPLNCTAAGSHTHTKSCPGTY-PTSYAPEEDN---------DATSP  131

Query  624   sKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTF  803
             S CP+YFRWI++DL  W  +GI+REMV  AR+TANFRLVIV G AY   Y K+FQSRDTF
Sbjct  132   STCPEYFRWIHEDLRPWARTGITREMVERARKTANFRLVIVKGKAYVETYTKAFQSRDTF  191

Query  804   TLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDI  983
             TLWGILQLLRRYPG++PDLDLMFD VDWPV+ + +Y   D    P  LFRYC ++ T+DI
Sbjct  192   TLWGILQLLRRYPGRIPDLDLMFDCVDWPVVLRNAYCAPDAPAPP-PLFRYCANDQTYDI  250

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCN  1163
             VFPDWSFWGWPE+NIK WE   K+L+EGN +IKW DREPYAYWKGNP VA TR+DL+KCN
Sbjct  251   VFPDWSFWGWPEVNIKSWEPQLKDLEEGNRRIKWSDREPYAYWKGNPTVAPTRQDLMKCN  310

Query  1164  VSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLT  1343
             VSE Q+W ARV+AQDWI+E ++GY+QS+LA QC  R+KIYIEGSAWSVSEKYILACDS+T
Sbjct  311   VSEGQEWNARVFAQDWIKEQQEGYKQSDLASQCRDRFKIYIEGSAWSVSEKYILACDSVT  370

Query  1344  LLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQE  1523
             L+V P YYDFYTRGLMP+ HYWPI D DKC+SIK AVDWGN+H ++A+ +G A SK+IQ+
Sbjct  371   LIVTPKYYDFYTRGLMPLHHYWPINDHDKCRSIKFAVDWGNSHKKKAKAMGRAASKFIQD  430

Query  1524  ELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAA  1703
             ELK++YVYDYMFHLL++Y+KLL+Y+PTV PEAVE C+E++ C   G  ++FM ESLV+ +
Sbjct  431   ELKLDYVYDYMFHLLNQYSKLLRYQPTVSPEAVEYCAERLACAEEGPARKFMEESLVQ-S  489

Query  1704  PSTTAPCTMPPPFDPATL  1757
             P  T+PCT+PP +DP++L
Sbjct  490   PKETSPCTLPPSYDPSSL  507



>ref|XP_006353301.1| PREDICTED: O-glucosyltransferase rumi homolog [Solanum tuberosum]
Length=383

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/353 (76%), Positives = 305/353 (86%), Gaps = 2/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MVM A+RTA+FRLVIVNG AY   Y K+FQSRDTFTLWGILQ+LRRYPGK+PDLDLMFD 
Sbjct  1     MVMRAKRTADFRLVIVNGRAYVETYHKAFQSRDTFTLWGILQMLRRYPGKLPDLDLMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPV+K + Y  +    APP LFRYCG++++ DIVFPDWSFWGWPEINIKPWE LSK+L
Sbjct  61    VDWPVLKTEFY-RHPKAPAPPPLFRYCGNDSSLDIVFPDWSFWGWPEINIKPWETLSKDL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             K+GN K+KW DREPYAYWKGNP VA TR+DLLKCNVSEKQDW ARVYAQDW QE KQGY+
Sbjct  120   KKGNEKMKWTDREPYAYWKGNPVVAETRRDLLKCNVSEKQDWNARVYAQDWGQEEKQGYK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             +S+LA QCIHRYKIY+EGSAWSVSEKYILACDS+TLL+KP YYDFYTRGLMP++HYWP++
Sbjct  180   KSDLASQCIHRYKIYVEGSAWSVSEKYILACDSVTLLIKPQYYDFYTRGLMPLQHYWPVK  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             D DKC+SIKHAVDWGN H Q+AQ IG A S +IQE+LKM+YVYDYMFHLLSEYAKLLKYK
Sbjct  240   DKDKCRSIKHAVDWGNTHEQEAQAIGKAASDFIQEQLKMDYVYDYMFHLLSEYAKLLKYK  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             PTVP +AVELCSE M C A GL K+FM+ES+V+  PS   PC MPPPF PA L
Sbjct  300   PTVPRKAVELCSEAMACPAEGLTKKFMLESMVE-GPSDAIPCNMPPPFAPAGL  351



>ref|XP_009601795.1| PREDICTED: KDEL motif-containing protein 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=380

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/353 (77%), Positives = 301/353 (85%), Gaps = 2/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MVM ARRTANFRLVIV G AY   Y+KSFQSRD FTLWGILQ+LRRYPGKVPDLDLMFD 
Sbjct  1     MVMQARRTANFRLVIVKGRAYVETYQKSFQSRDQFTLWGILQMLRRYPGKVPDLDLMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPVIK + Y   +    P  LFRYCG+ A+ DIVFPDWSFWGWPEIN+KPWE LSK L
Sbjct  61    VDWPVIKTEFYRRPNAPAPP-PLFRYCGNNASLDIVFPDWSFWGWPEINLKPWETLSKNL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             +EGN K+KW DRE YAYWKGNP VA TR DLLKCNVSEKQDW AR+YAQDWIQE +QGY+
Sbjct  120   REGNEKVKWTDREQYAYWKGNPVVAETRMDLLKCNVSEKQDWNARLYAQDWIQEQRQGYK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             QS+LA QCIHRYKIYIEGSAWSVSEKYILACDS+TLLV+PHYYDFYTRGLMP+KHYWP++
Sbjct  180   QSDLASQCIHRYKIYIEGSAWSVSEKYILACDSVTLLVEPHYYDFYTRGLMPLKHYWPVK  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             D+DKC+SIKHAVDWGN H Q+AQ IG A S +IQE+LKM+YVYDYMFHLLSEYAKLLKYK
Sbjct  240   DNDKCRSIKHAVDWGNTHQQEAQAIGKAASDFIQEQLKMDYVYDYMFHLLSEYAKLLKYK  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             P VP +AVELCSE M C A G+ K+FM+ESLV+  PS   PCTMPPPF PA L
Sbjct  300   PVVPRKAVELCSEAMACPAEGVTKKFMLESLVE-GPSDAIPCTMPPPFGPAGL  351



>ref|XP_002304487.2| hypothetical protein POPTR_0003s12500g [Populus trichocarpa]
 gb|EEE79466.2| hypothetical protein POPTR_0003s12500g [Populus trichocarpa]
Length=505

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/482 (60%), Positives = 353/482 (73%), Gaps = 21/482 (4%)
 Frame = +3

Query  339   PAIKTLPRSSLAVFFFMVLCVGAFVSTRLLD-STVTAQHPTRL----SHQKII----ENE  491
             P +K    +   + F +VL +   + +  +D S  + Q+ T +     HQ ++    + E
Sbjct  7     PQMKKGLATIRTLLFLLVLFIAVIIYSLWIDASKFSGQNLTNVIISQKHQTLMIITRKPE  66

Query  492   IPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWA  671
               PLNC +     +CP NY  +SK     T+ Q+  S  P     +CP+YFRWI++DL  
Sbjct  67    YFPLNCIITNQTQTCPTNYPKTSK-----TKDQEDTSSKP-----ECPNYFRWIHEDLRP  116

Query  672   WRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKV  851
             W  +GISR+M+  A+ TA+FRL+IV G AY   Y+KS Q+RD FT+WGILQLLRRYPGK+
Sbjct  117   WNATGISRDMLERAKTTAHFRLIIVKGKAYLEKYKKSIQTRDAFTIWGILQLLRRYPGKI  176

Query  852   PDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIK  1031
             PDL+LMFD  D PVI+   Y      T PP LFRYCGD+ T DIVFPDWSFWGW EINIK
Sbjct  177   PDLELMFDCDDLPVIQSSDY-RGPNKTGPPPLFRYCGDKWTEDIVFPDWSFWGWAEINIK  235

Query  1032  PWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDW  1211
             PW+ L  +LKEGN + +W+DREPYAYWKGNP VA TRKDLL CNVS++QDW AR++ QDW
Sbjct  236   PWDKLLIDLKEGNNRSRWIDREPYAYWKGNPFVAETRKDLLTCNVSDQQDWNARLFIQDW  295

Query  1212  IQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLM  1391
             I E +Q ++QSN+A+QC HRYKIYIEG AWSVSEKYILACDS+TLLVKPHYYDF+TR L 
Sbjct  296   ILESQQEFKQSNVANQCTHRYKIYIEGYAWSVSEKYILACDSVTLLVKPHYYDFFTRSLK  355

Query  1392  PMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLS  1571
             P++HYWPIR+DDKCKSIK AVDWGN H Q+AQ IG A S +IQE LKM+YVYDYMFHLL+
Sbjct  356   PVEHYWPIREDDKCKSIKFAVDWGNKHKQKAQAIGKAASDFIQEGLKMDYVYDYMFHLLN  415

Query  1572  EYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPA  1751
             EYAKLL++ P VP  A ELCSE M C A+G E++FMMESLVK APSTT+PCTMPPP+ P 
Sbjct  416   EYAKLLRFTPQVPEGAAELCSEIMACSADGFEREFMMESLVK-APSTTSPCTMPPPYKPL  474

Query  1752  TL  1757
              L
Sbjct  475   VL  476



>ref|XP_010421189.1| PREDICTED: O-glucosyltransferase rumi homolog [Camelina sativa]
Length=543

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/508 (57%), Positives = 359/508 (71%), Gaps = 34/508 (7%)
 Frame = +3

Query  306   RHFTDTNWRPL--PAIKTLPRSSLA-VFFFMVLCVGAFVSTRLL-DSTVTAQHPTRLSHQ  473
             R+FTD  W P     +   P  S A V   ++L VGAF+STRLL D TV  +  T     
Sbjct  16    RNFTDAVWSPFIKSGLGISPNRSYALVSLIILLAVGAFISTRLLLDPTVLTEAVTASPKT  75

Query  474   KIIENEIPP------------------LNCSLR--TPMASCPANYYPSSKLTRTRTRIQD  593
             K   + I P                  L+C     T  ++CP N YP      T T   D
Sbjct  76    KTQTHTISPKYPLPTTVITQNPKPEFTLHCPANETTTGSTCPRNNYP------TTTSFGD  129

Query  594   spsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNY  773
                  P  ++  CPDYFRWI++DL  W ++GI+RE +  A++TANFRL IV    Y   +
Sbjct  130   DNPNHPPTAT--CPDYFRWIHEDLRPWAKTGITREALERAKKTANFRLSIVGRKVYVEKF  187

Query  774   RKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFR  953
             + +FQ+RD FT+WG LQLLR+YPGK+PDL+LMFD VDWPV++   +       +PP LFR
Sbjct  188   QDAFQTRDVFTIWGFLQLLRKYPGKIPDLELMFDCVDWPVVRAAEFA-GVNAPSPPPLFR  246

Query  954   YCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVA  1133
             YCG+E T DIVFPDWSFWGW E+NIKPWE L KEL+EGN +  W++REPYAYWKGNP VA
Sbjct  247   YCGNEETLDIVFPDWSFWGWAEVNIKPWESLLKELREGNERKTWINREPYAYWKGNPVVA  306

Query  1134  ATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSE  1313
              TR+DL+KCNVSE+ +W AR+YAQDWI+E K+GY+QS+LA QC HRYKIYIEGSAWSVSE
Sbjct  307   ETRQDLMKCNVSEEHEWNARLYAQDWIKESKEGYKQSDLASQCHHRYKIYIEGSAWSVSE  366

Query  1314  KYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEI  1493
             KYILACDS+TLLVKPHYYDF+TRGL+P  HYWP+R+ DKC+SIK AVDWGN H Q+AQ+I
Sbjct  367   KYILACDSVTLLVKPHYYDFFTRGLLPAHHYWPVREQDKCRSIKFAVDWGNTHVQKAQDI  426

Query  1494  GMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQ  1673
             G A S +IQ+ELKM+YVYDYM+HLL+EY+KLL +KP +P  AVE+CSE M C  +G E++
Sbjct  427   GKAASDFIQQELKMDYVYDYMYHLLTEYSKLLLFKPEIPLNAVEICSETMACPRSGNERK  486

Query  1674  FMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             FM ESLVK  P+ + PC MPPP+DPA+L
Sbjct  487   FMTESLVK-RPAESGPCAMPPPYDPASL  513



>gb|KFK27674.1| hypothetical protein AALP_AA8G414000 [Arabis alpina]
Length=534

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/501 (58%), Positives = 361/501 (72%), Gaps = 32/501 (6%)
 Frame = +3

Query  306   RHFTDTNWRPL----PAIKTLPRSSLAVFFFMVLCVGAFVSTRLL-DSTV-----TAQHP  455
             R+FTDT W        A  +  RS   V   ++L VGAF+STRLL DST+     T   P
Sbjct  15    RNFTDTFWSLFINKSGAGISPNRSYALVSLLILLIVGAFISTRLLLDSTILIEKETVTSP  74

Query  456   TRLSHQKIIENEIPPLNCSLRTPMA---------SCPANYYPSSKLTRTRTRIQDspspt  608
             T+   Q    N   P     ++P           +CP N YP      T    +D  SP 
Sbjct  75    TKTKPQTNSPNYPSPATVITKSPQEFTLHCSGNETCPRNNYP------TTVSFKDDVSPN  128

Query  609   ptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQ  788
              T     CPDYFRWI++DL  W  +GI+RE +  A+RTANFRLVIV G  Y   ++ +FQ
Sbjct  129   AT-----CPDYFRWIHEDLRPWASTGITREALERAKRTANFRLVIVGGKVYVEKFQDAFQ  183

Query  789   SRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDE  968
             +RD FT+WG LQLLR+YPGK+PDL+LMFD VDWPV+K   +       +PP LFRYCG+E
Sbjct  184   TRDVFTIWGFLQLLRKYPGKIPDLELMFDCVDWPVVKTVDFA-GVNAPSPPPLFRYCGNE  242

Query  969   ATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKD  1148
              T DIVFPDWSFWGW E+NIKPWE L KEL+EGN +  WV+REPYAYWKGNP VA TR+D
Sbjct  243   KTLDIVFPDWSFWGWSEVNIKPWESLLKELREGNKRSDWVNREPYAYWKGNPMVAETRQD  302

Query  1149  LLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILA  1328
             L+KCNV+++ +W AR+YAQDWI+E K+GY+QS+LA QC HRYKIYIEGSAWSVSEKYILA
Sbjct  303   LMKCNVTDEHEWNARLYAQDWIRESKEGYKQSDLASQCHHRYKIYIEGSAWSVSEKYILA  362

Query  1329  CDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGS  1508
             CDS+TLLVKPHYYDF+TRGL+P  HYWP+R+ DKC+SIK AV WGN+H Q+AQ+IG A S
Sbjct  363   CDSVTLLVKPHYYDFFTRGLLPAHHYWPVREHDKCRSIKFAVHWGNSHIQKAQDIGKAAS  422

Query  1509  KYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMES  1688
             ++IQEELKM+YVYDYM+HLL+EY+KLL++KP +P  AVE+CSE M C  +G E++FMMES
Sbjct  423   EFIQEELKMDYVYDYMYHLLTEYSKLLQFKPEIPQSAVEICSETMACPRSGNEQKFMMES  482

Query  1689  LVKAAPSTTAPCTMPPPFDPA  1751
             LVK  P+ T PC MPPP+DPA
Sbjct  483   LVK-HPAETGPCAMPPPYDPA  502



>ref|XP_010255430.1| PREDICTED: O-glucosyltransferase rumi homolog [Nelumbo nucifera]
Length=506

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/491 (57%), Positives = 355/491 (72%), Gaps = 31/491 (6%)
 Frame = +3

Query  300   LYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPT-----RL  464
              ++ ++ T +RPL   K  P ++  +F F VL +GAF+S R +D++  A   T       
Sbjct  15    FHQQYSSTVYRPL---KKGPSTTTLIFLFFVLFIGAFISARWIDASSGAGGSTLKALVAF  71

Query  465   SHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYF  644
             +  +   +EIP LNCS      +C   Y    K  ++ +             +  CP+YF
Sbjct  72    TPSRNRLDEIP-LNCSAANITQTCSVGY--GEKFEQSSS-------------TEVCPEYF  115

Query  645   RWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQ  824
             RWI++DL  W+E+GIS+EMV  A+R+A FRL IVNG AY   YR   + RD FTLWGILQ
Sbjct  116   RWIHEDLRVWKETGISKEMVEGAKRSAFFRLTIVNGTAYTEKYRNIVEGRDVFTLWGILQ  175

Query  825   LLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSF  1004
             L+RRYPG++PDLDLMF+  D PVI+ +         APP LF YCGD  ++DIVFPDWSF
Sbjct  176   LMRRYPGRLPDLDLMFNVGDKPVIRSRP-----KDGAPPPLFHYCGDNWSFDIVFPDWSF  230

Query  1005  WGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDW  1184
             WGWPEINIKPWE L K+LKEGN + KWV+REPYAYWKGNP ++  R++L+ CNVS+KQDW
Sbjct  231   WGWPEINIKPWEPLLKDLKEGNERTKWVEREPYAYWKGNPAMSKGRRELVNCNVSDKQDW  290

Query  1185  GARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHY  1364
               R+Y QDWI+E +QGY+QSNLA+QC HRYKIYIEG AWSVS+KYILACDS+TL++KP Y
Sbjct  291   NGRIYKQDWIRESQQGYKQSNLANQCTHRYKIYIEGIAWSVSQKYILACDSVTLIIKPQY  350

Query  1365  YDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYV  1544
             YDF+TR L+P+ HYWP+RD+DKC+S+K AVDWGNNH Q+AQ IG A S +IQEELKM+YV
Sbjct  351   YDFFTRNLVPLHHYWPMRDEDKCRSMKFAVDWGNNHTQEAQAIGKAASDFIQEELKMDYV  410

Query  1545  YDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPC  1724
             YDY+FHLL+EYAKLL YKP VPP AVELC E M C A+GL+K+FMMES+VK +P+   PC
Sbjct  411   YDYVFHLLNEYAKLLTYKPVVPPNAVELCPEIMACSADGLKKKFMMESMVK-SPAVRGPC  469

Query  1725  TMPPPFDPATL  1757
             T+ P  DPA L
Sbjct  470   TLTPS-DPAHL  479



>gb|KHN42548.1| O-glucosyltransferase rumi like [Glycine soja]
Length=534

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/500 (57%), Positives = 355/500 (71%), Gaps = 35/500 (7%)
 Frame = +3

Query  306   RHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLD---------STVTA----  446
             RH  D  W      K+LPRS+  + F ++L +GA   TR LD         ST +A    
Sbjct  25    RHSRDGIW--WSVAKSLPRSTAVLIFPVMLIIGALTYTRTLDTHPLFSGASSTKSALSTT  82

Query  447   ---QHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptq  617
                  P  +S +K IE    PLNC+      +C  N +P  +  ++              
Sbjct  83    PYNTGPFTVSIRKPIE---IPLNCTAYNLTRTCSTNQFPIPENDQSHP------------  127

Query  618   sssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRD  797
             SS+ CP+YFRWI++DL  W  +GI+++MV  A+ TANF+LVI+ G AY   Y K++Q+RD
Sbjct  128   SSATCPEYFRWIHEDLRPWARTGITQDMVERAKETANFKLVILKGKAYLETYEKAYQTRD  187

Query  798   TFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATW  977
              F++WGILQLLRRYPGK+PDL+LMFD VDWPV+    Y        PP LFRYCG++AT 
Sbjct  188   VFSIWGILQLLRRYPGKIPDLELMFDCVDWPVVLADRYN-GPNVEQPPPLFRYCGNDATL  246

Query  978   DIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLK  1157
             DIVFPDWSFWGW E+NIKPWE L  ELKEG  +I W++REPYAYWKGNP VA TR+DL+K
Sbjct  247   DIVFPDWSFWGWAEVNIKPWEILLTELKEGTKRIPWLNREPYAYWKGNPVVAETRQDLMK  306

Query  1158  CNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDS  1337
             CNVSE QDW AR+Y QDW +E ++GY+ S+LA QC HRYK+YIEGSAWSVSEKYILACDS
Sbjct  307   CNVSENQDWNARLYVQDWGRESQEGYKNSDLASQCTHRYKVYIEGSAWSVSEKYILACDS  366

Query  1338  LTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYI  1517
              TLLVKPHYYDF+TRGL+P+ HYWPI++DDKC+SIK AVDWGN+H Q+A +IG A S +I
Sbjct  367   PTLLVKPHYYDFFTRGLIPVHHYWPIKEDDKCRSIKFAVDWGNSHKQRAHQIGKAASDFI  426

Query  1518  QEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVK  1697
             QEELKM+YVYDYMFHLL+ YAKL +YKP++   A E+C E MVCGA G  K+FMMESLVK
Sbjct  427   QEELKMDYVYDYMFHLLNSYAKLFRYKPSISANATEICVESMVCGAEGPVKKFMMESLVK  486

Query  1698  AAPSTTAPCTMPPPFDPATL  1757
               P+ T PCTMP PFDP +L
Sbjct  487   -VPANTDPCTMPAPFDPPSL  505



>ref|XP_006599594.1| PREDICTED: KDEL motif-containing protein 2-like [Glycine max]
Length=534

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/500 (57%), Positives = 355/500 (71%), Gaps = 35/500 (7%)
 Frame = +3

Query  306   RHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLD---------STVTA----  446
             RH  D  W      K+LPRS+  + F ++L +GA   TR LD         ST +A    
Sbjct  25    RHSRDGIW--WSVAKSLPRSTAVLIFPVMLIIGALTYTRTLDTHPLFSGASSTKSALSTT  82

Query  447   ---QHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptq  617
                  P  +S +K IE    PLNC+      +C  N +P  +  ++              
Sbjct  83    PYNTGPFTVSIRKPIE---IPLNCTAYNLTRTCSTNQFPIPENDQSHP------------  127

Query  618   sssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRD  797
             SS+ CP+YFRWI++DL  W  +GI+++MV  A+ TANF+LVI+ G AY   Y K++Q+RD
Sbjct  128   SSATCPEYFRWIHEDLRPWARTGITQDMVERAKETANFKLVILKGKAYLETYEKAYQTRD  187

Query  798   TFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATW  977
              F++WGILQLLRRYPGK+PDL+LMFD VDWPV+    Y        PP LFRYCG++AT 
Sbjct  188   VFSIWGILQLLRRYPGKIPDLELMFDCVDWPVVLSDRYN-GPNVEQPPPLFRYCGNDATL  246

Query  978   DIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLK  1157
             DIVFPDWSFWGW E+NIKPWE L  ELKEG  +I W++REPYAYWKGNP VA TR+DL+K
Sbjct  247   DIVFPDWSFWGWAEVNIKPWEILLTELKEGTKRIPWLNREPYAYWKGNPVVAETRQDLMK  306

Query  1158  CNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDS  1337
             CNVSE QDW AR+Y QDW +E ++GY+ S+LA QC HRYK+YIEGSAWSVSEKYILACDS
Sbjct  307   CNVSENQDWNARLYVQDWGRESQEGYKNSDLASQCTHRYKVYIEGSAWSVSEKYILACDS  366

Query  1338  LTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYI  1517
              TLLVKPHYYDF+TRGL+P+ HYWPI++DDKC+SIK AVDWGN+H Q+A +IG A S +I
Sbjct  367   PTLLVKPHYYDFFTRGLIPVHHYWPIKEDDKCRSIKFAVDWGNSHKQRAHQIGKAASDFI  426

Query  1518  QEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVK  1697
             QEELKM+YVYDYMFHLL+ YAKL +YKP++   A E+C E MVCGA G  K+FMMESLVK
Sbjct  427   QEELKMDYVYDYMFHLLNSYAKLFRYKPSISANATEICVESMVCGAEGPVKKFMMESLVK  486

Query  1698  AAPSTTAPCTMPPPFDPATL  1757
               P+ T PCTMP PFDP +L
Sbjct  487   -VPANTDPCTMPAPFDPPSL  505



>ref|NP_197774.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB10058.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAT41837.1| At5g23850 [Arabidopsis thaliana]
 dbj|BAD94534.1| putative protein [Arabidopsis thaliana]
 gb|AED93222.1| uncharacterized protein AT5G23850 [Arabidopsis thaliana]
 gb|AHL38609.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=542

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/506 (57%), Positives = 363/506 (72%), Gaps = 33/506 (7%)
 Frame = +3

Query  306   RHFTDTNWRPL--PAIKTLPRSSLAVFFFMVLCV-GAFVSTRLL-DSTVTAQH-------  452
             R +TDT W P     +   P  S A+   ++L + GAF+STRLL D+TV  +        
Sbjct  16    RTYTDTIWSPFVKSGLGISPNRSYALVSLLILLIVGAFISTRLLLDTTVLLEKKAATTTT  75

Query  453   ---------PTRLSHQKIIENEIPP---LNCSLRTPMASCPANYYPSSKLTRTRTRIQDs  596
                      P       +I     P   L+CS     ASCP+N YP      T T  +D 
Sbjct  76    TKTQTQTITPKYPRPTTVITQSPKPEFTLHCSANETTASCPSNKYP------TTTSFEDD  129

Query  597   psptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYR  776
              +  P  ++  CPDYFRWI++DL  W  +GI+RE +  A++TA FRL IV G  Y   ++
Sbjct  130   DTNHPPTAT--CPDYFRWIHEDLRPWSRTGITREALERAKKTATFRLAIVGGKIYVEKFQ  187

Query  777   KSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRY  956
              +FQ+RD FT+WG LQLLR+YPGK+PDL+LMFD VDWPV++   +       +PP LFRY
Sbjct  188   DAFQTRDVFTIWGFLQLLRKYPGKIPDLELMFDCVDWPVVRATEFA-GANAPSPPPLFRY  246

Query  957   CGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA  1136
             CG+E T DIVFPDWSFWGW E+NIKPWE L KEL+EGN + KW++REPYAYWKGNP VA 
Sbjct  247   CGNEETLDIVFPDWSFWGWAEVNIKPWESLLKELREGNERTKWINREPYAYWKGNPMVAE  306

Query  1137  TRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEK  1316
             TR+DL+KCNVSE+ +W AR+YAQDWI+E K+GY+QS+LA QC HRYKIYIEGSAWSVSEK
Sbjct  307   TRQDLMKCNVSEEHEWNARLYAQDWIKESKEGYKQSDLASQCHHRYKIYIEGSAWSVSEK  366

Query  1317  YILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIG  1496
             YILACDS+TLLVKPHYYDF+TRGL+P  HYWP+R+ DKC+SIK AVDWGN+H Q+AQ+IG
Sbjct  367   YILACDSVTLLVKPHYYDFFTRGLLPAHHYWPVREHDKCRSIKFAVDWGNSHIQKAQDIG  426

Query  1497  MAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQF  1676
              A S +IQ++LKM+YVYDYM+HLL+EY+KLL++KP +P  AVE+CSE M C  +G E++F
Sbjct  427   KAASDFIQQDLKMDYVYDYMYHLLTEYSKLLQFKPEIPRNAVEICSETMACLRSGNERKF  486

Query  1677  MMESLVKAAPSTTAPCTMPPPFDPAT  1754
             M ESLVK  P+ + PC MPPP+DPAT
Sbjct  487   MTESLVK-QPADSGPCAMPPPYDPAT  511



>ref|XP_007152278.1| hypothetical protein PHAVU_004G116000g [Phaseolus vulgaris]
 gb|ESW24272.1| hypothetical protein PHAVU_004G116000g [Phaseolus vulgaris]
Length=464

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/457 (60%), Positives = 336/457 (74%), Gaps = 22/457 (5%)
 Frame = +3

Query  387   MVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKL  566
             M +  G   +   L +T     P R+  +        PLNC++     +CP N  P  + 
Sbjct  1     MFIFSGISSAKSSLSTTSPFTIPLRIQRET-------PLNCNVYNNTGTCPTNQNPIQED  53

Query  567   TRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIV  746
              ++R+             S+ CPDYFRWI++DL  W  +GI++EMV  A+ TANF+LVI+
Sbjct  54    DQSRS-------------SATCPDYFRWIHEDLRPWAHTGITQEMVEKAKATANFKLVIL  100

Query  747   NGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDT  926
              G AY   Y K+FQ+RD FTLWGILQLLRRYPGKVPDL+LMFD VDWPV+    Y     
Sbjct  101   KGRAYLETYEKAFQTRDVFTLWGILQLLRRYPGKVPDLELMFDCVDWPVVSANQYS-GPV  159

Query  927   TTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYA  1106
                PP LFRYCG++ T DIVFPDWSFWGW E+NIKPW+ L  ELKEGN KI W++REPYA
Sbjct  160   PQQPPPLFRYCGNDDTLDIVFPDWSFWGWAEVNIKPWQVLLGELKEGNKKIPWLNREPYA  219

Query  1107  YWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYI  1286
             YWKGNP VA TR+DL+KCNVSE QDW AR+YAQDW +E +QG++QS+LA QC HRYK+YI
Sbjct  220   YWKGNPVVAETREDLMKCNVSENQDWNARLYAQDWGRESQQGFKQSDLASQCTHRYKLYI  279

Query  1287  EGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGN  1466
             EGSAWSVSEKYILACDS TLLVKPHYYDF+TRGL+P+ HYWPI++DDKC+SIK AVDWGN
Sbjct  280   EGSAWSVSEKYILACDSTTLLVKPHYYDFFTRGLVPLHHYWPIKEDDKCRSIKFAVDWGN  339

Query  1467  NHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMV  1646
             ++ Q+A +IG A + +IQEELKM+YVYDYMFHLL+EYAKL  YKP++   A ELC E MV
Sbjct  340   SNKQRAIQIGKAANDFIQEELKMDYVYDYMFHLLNEYAKLFTYKPSISGNATELCVESMV  399

Query  1647  CGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             C A GL+K FMMESLVK  P+ T PCTMP PF+P +L
Sbjct  400   CEAEGLKKAFMMESLVK-GPANTNPCTMPAPFEPPSL  435



>gb|KEH17461.1| glycosyltransferase family 90 protein [Medicago truncatula]
Length=497

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/477 (59%), Positives = 343/477 (72%), Gaps = 15/477 (3%)
 Frame = +3

Query  330   RPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIP-PLN  506
             R +  + T   S+L   F +V      ++ +  D T            K   N+I  PLN
Sbjct  6     RTIRDLNTTLLSNLKEVFSVVSSNEPILTNKAYDETPKKPLNQIDETPKKTLNQIEIPLN  65

Query  507   CSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESG  686
             CS      +CP N        +  T  QD  S +       CPDYFRWI++DL  W  +G
Sbjct  66    CSGHNLTGTCPTNN------NQILTNNQDHSSTST------CPDYFRWIHEDLRPWAHTG  113

Query  687   ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDL  866
             +++E +  A++TANF+LVI+ G AY   Y K+FQ+RDTFTLWGILQLLR+YPGK+PDL+L
Sbjct  114   VTKEAIEKAQKTANFKLVILKGKAYLETYEKAFQTRDTFTLWGILQLLRKYPGKLPDLEL  173

Query  867   MFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGL  1046
             MFD VDWPV+    Y        PP LFRYCG++AT DIVFPDWSFWGWPE N+KPWE L
Sbjct  174   MFDCVDWPVVPSDEYS-GPNGVDPPPLFRYCGNDATLDIVFPDWSFWGWPETNVKPWEIL  232

Query  1047  SKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHK  1226
               EL EGN +I W+ REPYAYWKGNP VA TR+DL+KCNVSEKQ+W AR+Y QDW +E +
Sbjct  233   LGELNEGNKRIPWMKREPYAYWKGNPSVAETRQDLMKCNVSEKQEWNARLYDQDWGREAQ  292

Query  1227  QGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHY  1406
             QGY++S+LA QC HRYK+YIEGSAWSVSEKYILACDS TLLVKPHYYDF+TRGL+P+ HY
Sbjct  293   QGYKKSDLAGQCTHRYKVYIEGSAWSVSEKYILACDSPTLLVKPHYYDFFTRGLIPVHHY  352

Query  1407  WPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKL  1586
             WPI++DDKCKSIK AVDWGN+H  +A +IG A S +IQEELKM+YVYDYMFHLL+ YAKL
Sbjct  353   WPIKEDDKCKSIKFAVDWGNSHKTKAHDIGKAASNFIQEELKMDYVYDYMFHLLNSYAKL  412

Query  1587  LKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              +YKP++  +AVELC E MVC A G EK+FMMESLVK  PS T PCTMPPP+DP +L
Sbjct  413   FRYKPSISDKAVELCVESMVCKAEGNEKKFMMESLVK-GPSNTNPCTMPPPYDPPSL  468



>ref|XP_011022725.1| PREDICTED: O-glucosyltransferase rumi-like isoform X2 [Populus 
euphratica]
Length=495

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/469 (61%), Positives = 346/469 (74%), Gaps = 19/469 (4%)
 Frame = +3

Query  372   AVFFFMVLCVGAFVSTRLLD-STVTAQHPTRL----SHQKIIENEIP--PLNCSLRTPMA  530
              + F +VL +   + +  +D S  + Q+ T +    +HQ +I    P  PLNC++     
Sbjct  10    TLLFLLVLFIAVIIYSLWIDASKFSDQNLTNVIISQTHQTLIITRKPEFPLNCTITNQTQ  69

Query  531   SCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMS  710
             +CP NY  +SK     T+ Q+  S  P      CP+YFRWI++DL  W  +GISR+M+  
Sbjct  70    TCPTNYPKTSK-----TKDQEDTSSKPG-----CPNYFRWIHEDLSPWNATGISRDMLER  119

Query  711   ARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWP  890
             A+ TA+FRL+IV G AY   Y+KS Q+RD FT+WGILQLLRRYPGK+ DL+LMFD  D P
Sbjct  120   AKTTAHFRLIIVKGKAYLEKYKKSIQTRDAFTIWGILQLLRRYPGKILDLELMFDCDDRP  179

Query  891   VIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGN  1070
             VI+   Y      T PP LFRYCGD+ T DIVFPDWSFWGW EINIKPW+ L  +LKEGN
Sbjct  180   VIQSSDY-RGPNKTGPPPLFRYCGDKWTEDIVFPDWSFWGWAEINIKPWDKLLIDLKEGN  238

Query  1071  VKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNL  1250
              + +W+DREPYAYWKGNP VA TRKDLL CNVS++QDW AR++ QDWI E +Q ++QSN+
Sbjct  239   NRSRWIDREPYAYWKGNPFVAETRKDLLTCNVSDQQDWNARLFIQDWILESQQEFKQSNV  298

Query  1251  ADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDK  1430
             A+QC HRYKIYIEG AWSVSEKYILACDS+TLLVKPHYYDF+TR L P +HYWPIR+DDK
Sbjct  299   ANQCTHRYKIYIEGYAWSVSEKYILACDSVTLLVKPHYYDFFTRSLKPGEHYWPIREDDK  358

Query  1431  CKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVP  1610
             CKSIK AVDWGN H Q+AQ IG A S +IQE LKM+YVYDYMFHLL+EYAKLL++ P VP
Sbjct  359   CKSIKFAVDWGNKHQQKAQAIGKAASDFIQEGLKMDYVYDYMFHLLNEYAKLLRFMPQVP  418

Query  1611  PEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
               A ELCSE M C A+G E++FMMESLVK  PSTT+PCTMPPP+ P  L
Sbjct  419   EGAAELCSEIMACSADGFEREFMMESLVK-GPSTTSPCTMPPPYKPLVL  466



>ref|XP_011022723.1| PREDICTED: O-glucosyltransferase rumi-like isoform X1 [Populus 
euphratica]
 ref|XP_011022724.1| PREDICTED: O-glucosyltransferase rumi-like isoform X1 [Populus 
euphratica]
Length=499

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/469 (61%), Positives = 346/469 (74%), Gaps = 19/469 (4%)
 Frame = +3

Query  372   AVFFFMVLCVGAFVSTRLLD-STVTAQHPTRL----SHQKIIENEIP--PLNCSLRTPMA  530
              + F +VL +   + +  +D S  + Q+ T +    +HQ +I    P  PLNC++     
Sbjct  10    TLLFLLVLFIAVIIYSLWIDASKFSDQNLTNVIISQTHQTLIITRKPEFPLNCTITNQTQ  69

Query  531   SCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMS  710
             +CP NY  +SK     T+ Q+  S  P      CP+YFRWI++DL  W  +GISR+M+  
Sbjct  70    TCPTNYPKTSK-----TKDQEDTSSKPG-----CPNYFRWIHEDLSPWNATGISRDMLER  119

Query  711   ARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWP  890
             A+ TA+FRL+IV G AY   Y+KS Q+RD FT+WGILQLLRRYPGK+ DL+LMFD  D P
Sbjct  120   AKTTAHFRLIIVKGKAYLEKYKKSIQTRDAFTIWGILQLLRRYPGKILDLELMFDCDDRP  179

Query  891   VIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGN  1070
             VI+   Y      T PP LFRYCGD+ T DIVFPDWSFWGW EINIKPW+ L  +LKEGN
Sbjct  180   VIQSSDY-RGPNKTGPPPLFRYCGDKWTEDIVFPDWSFWGWAEINIKPWDKLLIDLKEGN  238

Query  1071  VKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNL  1250
              + +W+DREPYAYWKGNP VA TRKDLL CNVS++QDW AR++ QDWI E +Q ++QSN+
Sbjct  239   NRSRWIDREPYAYWKGNPFVAETRKDLLTCNVSDQQDWNARLFIQDWILESQQEFKQSNV  298

Query  1251  ADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDK  1430
             A+QC HRYKIYIEG AWSVSEKYILACDS+TLLVKPHYYDF+TR L P +HYWPIR+DDK
Sbjct  299   ANQCTHRYKIYIEGYAWSVSEKYILACDSVTLLVKPHYYDFFTRSLKPGEHYWPIREDDK  358

Query  1431  CKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVP  1610
             CKSIK AVDWGN H Q+AQ IG A S +IQE LKM+YVYDYMFHLL+EYAKLL++ P VP
Sbjct  359   CKSIKFAVDWGNKHQQKAQAIGKAASDFIQEGLKMDYVYDYMFHLLNEYAKLLRFMPQVP  418

Query  1611  PEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
               A ELCSE M C A+G E++FMMESLVK  PSTT+PCTMPPP+ P  L
Sbjct  419   EGAAELCSEIMACSADGFEREFMMESLVK-GPSTTSPCTMPPPYKPLVL  466



>ref|XP_009400272.1| PREDICTED: O-glucosyltransferase rumi homolog [Musa acuminata 
subsp. malaccensis]
Length=569

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/371 (69%), Positives = 314/371 (85%), Gaps = 2/371 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYFRWI++DL  W+ +GI+R+MV  ARRTANFRLV++NG AY   Y  SFQ+RD FT+
Sbjct  167   CPDYFRWIHEDLRPWKSTGITRKMVERARRTANFRLVVLNGKAYVQRYCHSFQTRDVFTI  226

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGILQL RRYPG++PDLDLMFD VDWP+++   Y   + + APP LFRYCGDE+T DIVF
Sbjct  227   WGILQLFRRYPGRIPDLDLMFDCVDWPIVRASDYRRRNAS-APPPLFRYCGDESTLDIVF  285

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGW EINIKPWE L  ELK+GN +++W+DREPYAYWKGNP VA TR+DLL+CNVS
Sbjct  286   PDWSFWGWAEINIKPWEVLRSELKDGNGRVRWMDREPYAYWKGNPAVATTRQDLLRCNVS  345

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             E  DW AR+YAQDW++E ++G+++S+LA+QCIHRYKIYIEGSAWSVSEKYILACDSL LL
Sbjct  346   EAHDWNARLYAQDWLKESREGFKESDLANQCIHRYKIYIEGSAWSVSEKYILACDSLALL  405

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             V P YYDF+TRGLMP++HYWPIRDDDKC+SIK AVDWGN+H Q+AQ IG   S +I E++
Sbjct  406   VTPKYYDFFTRGLMPLQHYWPIRDDDKCRSIKFAVDWGNSHKQKAQAIGKEASNFILEKV  465

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             K++YVYDYMFHLL+EYAKLL+YKPT+P  +VELC+E M C A GLEK+FM ESLV +A +
Sbjct  466   KIDYVYDYMFHLLNEYAKLLRYKPTIPEGSVELCAESMACSAKGLEKKFMTESLVGSA-N  524

Query  1710  TTAPCTMPPPF  1742
              ++PC MPPP+
Sbjct  525   DSSPCMMPPPY  535



>ref|XP_009150906.1| PREDICTED: O-glucosyltransferase rumi homolog [Brassica rapa]
Length=534

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/510 (57%), Positives = 362/510 (71%), Gaps = 37/510 (7%)
 Frame = +3

Query  291   GARLYRHFTDTNWRPLPAIKTLP----RSSLAVFFFMVLCVGAFVSTR-LLDSTVTAQHP  455
             G    R+FT  NW P            RS   +    +L VGAF+STR LLD TV  +  
Sbjct  11    GGGHSRNFT--NWSPFVKSSGFGISPNRSYALLSLLTLLIVGAFISTRILLDPTVLLEKE  68

Query  456   ---TRLSHQKIIENEIPP-------------LNCSLRTPMASCPANYYPSSKLTRTRTRI  587
                T+     I     PP             L+CS     A+CP N YP+     T +  
Sbjct  69    AVTTKTRSHTIFPKYPPPTPVTTQSPKPEFTLHCSANDTNATCPRNNYPA-----TESFG  123

Query  588   QDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYH  767
             +D+P+ T       CPDYFRWI++DL  W ++GI+RE +  AR+TANFRL IV G  Y  
Sbjct  124   EDAPTAT-------CPDYFRWIHEDLRPWAKTGITREALERARKTANFRLAIVGGRVYVE  176

Query  768   NYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPAL  947
              ++ +FQ+RD FT+WG LQLLR+YPGK+PDL+LMFD VDWPV++   +   D  + PP L
Sbjct  177   KFQDAFQTRDVFTIWGFLQLLRKYPGKIPDLELMFDCVDWPVVRALDFAGVDAPSPPP-L  235

Query  948   FRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPE  1127
             FRYCG+E T DIVFPDWSFWGW E+NIKPWE L KEL+EGN +  W++REPYAYWKGNP 
Sbjct  236   FRYCGNEETLDIVFPDWSFWGWSEVNIKPWESLLKELREGNQRSTWINREPYAYWKGNPS  295

Query  1128  VAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSV  1307
             VA TR+DL+KCNVSE+ +W ARVYAQDWI+E K+GY+QS+LA QC HRYKIYIEGSAWSV
Sbjct  296   VAETRQDLMKCNVSEEHEWNARVYAQDWIRESKEGYKQSDLASQCHHRYKIYIEGSAWSV  355

Query  1308  SEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQ  1487
             SEKYILACDS+TLLV+PHYYDF+TRGL+P  HYWP+R+ DKC+SIK AV WGN+H Q+AQ
Sbjct  356   SEKYILACDSVTLLVRPHYYDFFTRGLLPAHHYWPVREHDKCRSIKFAVHWGNSHIQKAQ  415

Query  1488  EIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLE  1667
             +IG   S++IQ+ELKM+YVYDYM+HLL+ YAKLL++KP +P  A+E+CSE M C  +G E
Sbjct  416   DIGKTASEFIQQELKMDYVYDYMYHLLTGYAKLLQFKPEIPQNAMEICSETMACPRSGNE  475

Query  1668  KQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             ++FM ESLVK  P+ T PCTMPPP+DPA+ 
Sbjct  476   RKFMTESLVK-HPAETGPCTMPPPYDPASF  504



>gb|KEH17460.1| glycosyltransferase family 90 protein [Medicago truncatula]
Length=508

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/510 (56%), Positives = 350/510 (69%), Gaps = 53/510 (10%)
 Frame = +3

Query  231   VVYIRNMVRPHILKMRETSEGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAF  410
             +VY R +  P +  +  ++E     + + +T  +PL  I   P+ +L             
Sbjct  22    LVYARFLETPEVFSVVSSNEPILTNKAYDETPKKPLNQIDETPKKTL-------------  68

Query  411   VSTRLLDSTVTAQHPTRLSHQKIIENEIP-PLNCSLRTPMASCPANYYPSSKLTRTRTRI  587
                                      N+I  PLNCS      +CP N        +  T  
Sbjct  69    -------------------------NQIEIPLNCSGHNLTGTCPTNN------NQILTNN  97

Query  588   QDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYH  767
             QD  S +       CPDYFRWI++DL  W  +G+++E +  A++TANF+LVI+ G AY  
Sbjct  98    QDHSSTST------CPDYFRWIHEDLRPWAHTGVTKEAIEKAQKTANFKLVILKGKAYLE  151

Query  768   NYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPAL  947
              Y K+FQ+RDTFTLWGILQLLR+YPGK+PDL+LMFD VDWPV+    Y        PP L
Sbjct  152   TYEKAFQTRDTFTLWGILQLLRKYPGKLPDLELMFDCVDWPVVPSDEYS-GPNGVDPPPL  210

Query  948   FRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPE  1127
             FRYCG++AT DIVFPDWSFWGWPE N+KPWE L  EL EGN +I W+ REPYAYWKGNP 
Sbjct  211   FRYCGNDATLDIVFPDWSFWGWPETNVKPWEILLGELNEGNKRIPWMKREPYAYWKGNPS  270

Query  1128  VAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSV  1307
             VA TR+DL+KCNVSEKQ+W AR+Y QDW +E +QGY++S+LA QC HRYK+YIEGSAWSV
Sbjct  271   VAETRQDLMKCNVSEKQEWNARLYDQDWGREAQQGYKKSDLAGQCTHRYKVYIEGSAWSV  330

Query  1308  SEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQ  1487
             SEKYILACDS TLLVKPHYYDF+TRGL+P+ HYWPI++DDKCKSIK AVDWGN+H  +A 
Sbjct  331   SEKYILACDSPTLLVKPHYYDFFTRGLIPVHHYWPIKEDDKCKSIKFAVDWGNSHKTKAH  390

Query  1488  EIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLE  1667
             +IG A S +IQEELKM+YVYDYMFHLL+ YAKL +YKP++  +AVELC E MVC A G E
Sbjct  391   DIGKAASNFIQEELKMDYVYDYMFHLLNSYAKLFRYKPSISDKAVELCVESMVCKAEGNE  450

Query  1668  KQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             K+FMMESLVK  PS T PCTMPPP+DP +L
Sbjct  451   KKFMMESLVK-GPSNTNPCTMPPPYDPPSL  479



>ref|XP_009793762.1| PREDICTED: O-glucosyltransferase rumi homolog [Nicotiana sylvestris]
 ref|XP_009793763.1| PREDICTED: O-glucosyltransferase rumi homolog [Nicotiana sylvestris]
 ref|XP_009793764.1| PREDICTED: O-glucosyltransferase rumi homolog [Nicotiana sylvestris]
Length=503

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/486 (58%), Positives = 352/486 (72%), Gaps = 20/486 (4%)
 Frame = +3

Query  303   YRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKII  482
             YR  TD+ W P    K   + SL +  F+++ +G+++ T +LD+T       +   ++  
Sbjct  11    YRRSTDSFWLPHYINKPYSKHSLLLLVFLLV-LGSYMWTTVLDTTSAVNKVLQSRTREF-  68

Query  483   ENEIPPLNCSLRTPMASCPANYYPSS-KLTRTRTRIQDspsptptqsssKCPDYFRWIYD  659
                  PLNCS   P  +CP N+YP   K+   +    +           +CP YF WI++
Sbjct  69    -----PLNCSSGNPTKTCPVNHYPPDYKIINNKPSSANP----------RCPHYFHWIHE  113

Query  660   DLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRY  839
             DL  WR++GI++EMV  A RTANFRLVI+NG AY   Y K FQ+RD FTLWGILQLLRRY
Sbjct  114   DLKLWRKTGITKEMVERANRTANFRLVILNGRAYVETYEKGFQTRDVFTLWGILQLLRRY  173

Query  840   PGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPE  1019
             PGK+PDLDLMFD VDWPVI+   +V  D   APP LFRYCGD  T DIVFPDWSFWGW E
Sbjct  174   PGKIPDLDLMFDCVDWPVIRASDFV-GDNAIAPPPLFRYCGDSETLDIVFPDWSFWGWAE  232

Query  1020  INIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVY  1199
             INIKPW+ L K+L++GN K KW DREPYAYWKGNPEVA  R +L+KCNVSE Q+W AR+Y
Sbjct  233   INIKPWQDLLKDLEKGNKKQKWQDREPYAYWKGNPEVAEKRMELVKCNVSENQEWNARIY  292

Query  1200  AQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYT  1379
              QDW +E KQG++ S+L +QC HRYKIYIEGSAWSVSEKYILACDS++LLV PHYYDF++
Sbjct  293   VQDWKKEIKQGFKNSDLGNQCHHRYKIYIEGSAWSVSEKYILACDSVSLLVTPHYYDFFS  352

Query  1380  RGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMF  1559
             R LMP  HYWPI ++DKC SIK AVDWGN + ++AQ+IG + S +IQE+LKMEYVYDYMF
Sbjct  353   RSLMPQVHYWPINENDKCGSIKFAVDWGNRNKKKAQKIGRSASNFIQEDLKMEYVYDYMF  412

Query  1560  HLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPP  1739
             HLL+EYAKLL+YKP+VP +A ELCSE M C A G+EK+ MMES+VK  P   +PC MP P
Sbjct  413   HLLNEYAKLLRYKPSVPEKATELCSEIMACPAEGIEKKLMMESMVK-GPVDESPCKMPIP  471

Query  1740  FDPATL  1757
             F+  +L
Sbjct  472   FNQLSL  477



>ref|XP_006490389.1| PREDICTED: protein O-glucosyltransferase 1-like [Citrus sinensis]
Length=526

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/512 (56%), Positives = 364/512 (71%), Gaps = 30/512 (6%)
 Frame = +3

Query  267   LKMRETSE--GARLYRHFTDTNWRPLPAIKTLPRSSLAVF-FFMVLCVGAFVSTRLLDST  437
             ++ R++S   G     HFTDT WR    I++ P  S A+F F  +L VGA +STRLLDST
Sbjct  1     MQQRQSSNVHGPGHSGHFTDTIWRQF--IQS-PAKSYALFAFIFLLLVGALISTRLLDST  57

Query  438   VTAQHPTRLSHQKIIENEIP------------PLNCSLRTPMASCPANYYPSSKLTRTRT  581
                    +    +  + + P            PL C+      +CP  Y P+S      T
Sbjct  58    ALGGGTNKKLRDRKGQTDAPDITKKHYNKTEYPLKCTDGNNTKTCPGTY-PTS-----YT  111

Query  582   RIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAY  761
               +D  SP        CPDYFRWI++DL  W  +GI+REMV  A  TANFRLVIV G AY
Sbjct  112   PEEDHDSPLAPT----CPDYFRWIHEDLRPWARTGITREMVERANETANFRLVIVKGRAY  167

Query  762   YHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPP  941
                  K+FQSRDTFTLWGILQLLRRYPGK+PDLDLMFD VDWP++ K +Y +     APP
Sbjct  168   VKRNIKAFQSRDTFTLWGILQLLRRYPGKIPDLDLMFDCVDWPILLKSNYSV-PGAPAPP  226

Query  942   ALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGN  1121
              LFRYC ++ T+DIVFPDWSFWGWPE+NIK W  + K+L+EGN ++ W DREPYAYWKGN
Sbjct  227   PLFRYCANDQTFDIVFPDWSFWGWPEVNIKSWGKILKDLEEGNRRMNWTDREPYAYWKGN  286

Query  1122  PEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAW  1301
             P VA++R+DL+KCNVSE Q+W AR+Y QDW +E ++GY+QS+LA QC HR+KIYIEGSAW
Sbjct  287   PVVASSRQDLMKCNVSEGQEWNARLYVQDWKKEKQKGYKQSDLASQCKHRFKIYIEGSAW  346

Query  1302  SVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQ  1481
             SVSEKYILACDS+TL V P+Y DF+TRGL+PM H+WPI   DKC+SIK AVDWGNNH  +
Sbjct  347   SVSEKYILACDSVTLYVTPNYTDFFTRGLIPMHHFWPINVYDKCRSIKFAVDWGNNHTGK  406

Query  1482  AQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANG  1661
             AQEIG A S++IQEELKM+YVYDYMFHLL++Y+KL +Y+PT+P  AVE C+E M C   G
Sbjct  407   AQEIGRAASRFIQEELKMDYVYDYMFHLLNQYSKLFRYQPTIPTGAVEYCAETMACPEEG  466

Query  1662  LEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             + ++ M ESL + +P  T+PCT+PPP+DP++L
Sbjct  467   MARKLMEESL-ETSPKETSPCTLPPPYDPSSL  497



>ref|XP_010671883.1| PREDICTED: O-glucosyltransferase rumi homolog [Beta vulgaris 
subsp. vulgaris]
Length=568

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/443 (63%), Positives = 338/443 (76%), Gaps = 19/443 (4%)
 Frame = +3

Query  429   DSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspspt  608
             +S  T    +R +H KIIE    PL CS  +   +CPA+Y    +L              
Sbjct  116   NSYSTTTETSRKAH-KIIEV---PLKCSDGSIPQTCPADYPEKMELD------------P  159

Query  609   ptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQ  788
                  S CP+YFRWIY+DL  W+++GI REMV  A+RTANFRLVI NG AY   ++KS+Q
Sbjct  160   DAPPPSTCPEYFRWIYEDLRPWQKNGIIREMVEGAKRTANFRLVISNGKAYVERFQKSWQ  219

Query  789   SRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDE  968
             +RD FTLWGILQLLR+YPG+VPDL+LMFD VDWPVI K+ +  N+   APP LFRYCGD+
Sbjct  220   TRDVFTLWGILQLLRKYPGRVPDLELMFDCVDWPVISKRFHWPNNA--APPPLFRYCGDD  277

Query  969   ATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKD  1148
              TWDIVFPDWSFWGW EIN+KPWE LSKELKEGN ++K+ DREPYAYWKGNP VA  R D
Sbjct  278   GTWDIVFPDWSFWGWAEINMKPWEFLSKELKEGNKRVKFEDREPYAYWKGNPFVAPHRMD  337

Query  1149  LLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILA  1328
             LLKCNV++KQDW AR+Y QDW +E +QG+++S+LA QC  RYKIYIEGSAWSVSEKYILA
Sbjct  338   LLKCNVTDKQDWQARLYIQDWAKEAQQGFKKSDLASQCTDRYKIYIEGSAWSVSEKYILA  397

Query  1329  CDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGS  1508
             CDS+ LLVKP YYDF++R LMP +HYWP+R DDKC+SIK AV+WGNNH Q+AQ IG A S
Sbjct  398   CDSVALLVKPLYYDFFSRSLMPTQHYWPVRQDDKCRSIKFAVEWGNNHMQKAQAIGKAAS  457

Query  1509  KYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMES  1688
             +++ E+LKM+Y+YDYM HLL+EYAKLLK+KPT+P  AVELCSE M C A   EK+FM ES
Sbjct  458   EFVLEDLKMDYIYDYMLHLLTEYAKLLKFKPTIPKNAVELCSETMACSATDSEKKFMTES  517

Query  1689  LVKAAPSTTAPCTMPPPFDPATL  1757
             LVK  PS  +PCTMPPP+D AT 
Sbjct  518   LVK-GPSDKSPCTMPPPYDRATF  539



>emb|CDX80388.1| BnaC07g30560D [Brassica napus]
Length=535

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/511 (56%), Positives = 358/511 (70%), Gaps = 38/511 (7%)
 Frame = +3

Query  291   GARLYRHFTDTNWRPL----PAIKTLPRSSLAVFFFMVL-CVGAFVSTR-LLDSTVTAQH  452
             G    R+FT  NW P           P  S A+   + L  VGAF+STR LLD TV  + 
Sbjct  11    GGGHSRNFT--NWSPFVKSSSGFGISPNRSYALLSLLTLLIVGAFISTRILLDPTVLLEK  68

Query  453   P---TRLSHQKIIENEIPP-------------LNCSLRTPMASCPANYYPSSKLTRTRTR  584
                 T+     I     PP             L+CS     A+CP N YP++      T 
Sbjct  69    EAVTTKTRSHTIFPKYPPPTPVTTQSPKPEFTLHCSANDTNATCPRNSYPATASFGEDT-  127

Query  585   IQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYY  764
                         ++ CPDYFRWI++DL  W ++GISRE +  A++TANFRL IV G  Y 
Sbjct  128   -----------PTATCPDYFRWIHEDLRPWAKTGISREALERAKKTANFRLAIVGGRVYL  176

Query  765   HNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPA  944
               ++ +FQ+RD FT+WG LQLLR+YPGK+PDL+LMFD VDWPV++  ++   D  + PP 
Sbjct  177   EKFQDAFQTRDVFTIWGFLQLLRKYPGKIPDLELMFDCVDWPVVRALNFAGVDAPSPPP-  235

Query  945   LFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNP  1124
             LFRYCG+E T DIVFPDWSFWGW E+NIKPWE L KEL+EGN +  W++REPYAYWKGNP
Sbjct  236   LFRYCGNEETLDIVFPDWSFWGWSEVNIKPWESLLKELREGNQRTTWINREPYAYWKGNP  295

Query  1125  EVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWS  1304
              VA TR+DL+KCNVSE+ +W ARVYAQDWI+E K+GY+QS+LA QC HRYKIYIEGSAWS
Sbjct  296   SVADTRQDLMKCNVSEEHEWNARVYAQDWIRESKEGYKQSDLASQCHHRYKIYIEGSAWS  355

Query  1305  VSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQA  1484
             VSEKYILACDS+TLLV PHYYDF+TRGL+P  HYWP+R+ DKC+SIK AV WGN+H Q+A
Sbjct  356   VSEKYILACDSVTLLVNPHYYDFFTRGLLPAHHYWPVREHDKCRSIKFAVHWGNSHIQKA  415

Query  1485  QEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGL  1664
             Q+IG   S++IQ+ELKM+YVYDYM+HLL+ YAKLL++KP +P  A+E+CSE M C  +G 
Sbjct  416   QDIGKTASEFIQQELKMDYVYDYMYHLLTGYAKLLQFKPEIPQNAMEICSETMACPRSGN  475

Query  1665  EKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             E++FM ESLVK  P+ T PC MPPP+DPA+ 
Sbjct  476   ERKFMTESLVK-HPAETGPCAMPPPYDPASF  505



>ref|XP_010550767.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010550768.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X3 [Tarenaya 
hassleriana]
Length=535

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/496 (56%), Positives = 357/496 (72%), Gaps = 39/496 (8%)
 Frame = +3

Query  333   PLPAIKTLPRSSLAVF-FFMVLCVGAFVSTRLL------------DSTVTAQHPTRLSHQ  473
             PL      P  S A+F F ++L +GAF S+RLL             +T     P   S +
Sbjct  26    PLVKTGGSPNKSYAIFSFLILLLLGAFFSSRLLLDPSVLVEREAVSTTKATAAPADASSR  85

Query  474   K------IIENEIP--PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssK  629
             K      +I  + P  PL C+  +  ++CP + YP++ L                  S+ 
Sbjct  86    KDPRENTVITEKPPEFPLTCTSLSDNSTCPRDNYPTATLA-------------GDSPSAA  132

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP+YFRWI++DL  W  +GI+R+ V  A++TANFRLVIV G  Y   + ++FQ+RD FT+
Sbjct  133   CPEYFRWIHEDLRPWARTGITRDAVERAKKTANFRLVIVGGRVYVEKFNEAFQTRDVFTI  192

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WG LQL+RRYPGK+PDL+LMFD VDWPVIK   +        PP LFRYCG++ T DIVF
Sbjct  193   WGFLQLVRRYPGKIPDLELMFDCVDWPVIKAAEFA----GAEPPPLFRYCGNDETLDIVF  248

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGW E+NIKPWEG+ +EL + N K KW++REPYAYWKGNP VA TR+DL+KCNVS
Sbjct  249   PDWSFWGWAEVNIKPWEGVLRELGDANRKTKWLEREPYAYWKGNPTVAETRQDLMKCNVS  308

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             E+ DW AR+Y+QDW +E K+GY+QS+LA QC+HRYKIYIEGSAWSVSEKYILACDS+TLL
Sbjct  309   EEHDWNARLYSQDWARESKEGYKQSDLASQCVHRYKIYIEGSAWSVSEKYILACDSVTLL  368

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VKP YYDF+TRGL+P +H+WPI+DDDKC+SIK AVDW N+H ++A+E+G  GS++I ++L
Sbjct  369   VKPRYYDFFTRGLLPAQHFWPIKDDDKCRSIKFAVDWANSHARKAEEMGKKGSEFIMQQL  428

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KMEYVYDYM+HLL+EY+KLL++KP VP +AVE+CSE M C  +G E++FM ESLVK  PS
Sbjct  429   KMEYVYDYMYHLLTEYSKLLRFKPEVPRQAVEVCSESMACPRDGNERKFMRESLVK-RPS  487

Query  1710  TTAPCTMPPPFDPATL  1757
              T PC MPPP+DPA+ 
Sbjct  488   ETGPCLMPPPYDPASF  503



>ref|XP_002872075.1| hypothetical protein ARALYDRAFT_910396 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48334.1| hypothetical protein ARALYDRAFT_910396 [Arabidopsis lyrata subsp. 
lyrata]
Length=543

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/507 (56%), Positives = 356/507 (70%), Gaps = 32/507 (6%)
 Frame = +3

Query  306   RHFTDTNWRPLPAIK---TLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQ---------  449
             R FTD+ W P        +  RS   +   ++L  GAF+STRLL  T T           
Sbjct  16    RTFTDSIWSPFFKSGFGISSNRSYALISLLILLIAGAFISTRLLLDTTTVLIEKEAVTTT  75

Query  450   --------HPTRLSHQKIIENEIPP---LNCSLRTPMASCPANYYPSSKLTRTRTRIQDs  596
                      P       +I     P   L+CS     ASCP+N YP+     T +  +D 
Sbjct  76    TQTQTQTISPKYPRPTTVITQSPKPEFTLHCSANETTASCPSNKYPT-----TASFGEDD  130

Query  597   psptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYR  776
              +  P  ++  CPDYFRWI++DL  W  +GI+RE +  A++TANFRL I++G  Y   ++
Sbjct  131   DTNHPPNAT--CPDYFRWIHEDLRPWSSTGITREALERAKKTANFRLAIIDGKIYVEKFQ  188

Query  777   KSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRY  956
              +FQ+RD FT+WG LQLLR+YPGK+PDL+LMFD VDWPV+K   +       +PP LFRY
Sbjct  189   DAFQTRDVFTIWGFLQLLRKYPGKIPDLELMFDCVDWPVVKASEFT-GANAPSPPPLFRY  247

Query  957   CGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA  1136
             CG+E T DIVFPDWSFWGW E+NIKPWE L KEL+EGN + KW++REPYAYWKGNP VA 
Sbjct  248   CGNEETLDIVFPDWSFWGWAEVNIKPWESLLKELREGNQRTKWINREPYAYWKGNPMVAE  307

Query  1137  TRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEK  1316
             TR+DL+KCNVSE+ +W AR+Y QDWI+E  +GY+QS+LA QC HRYKIYIEGSAWSVSEK
Sbjct  308   TRQDLMKCNVSEEHEWNARLYVQDWIKESNEGYKQSDLASQCHHRYKIYIEGSAWSVSEK  367

Query  1317  YILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIG  1496
             YILACDS+TLLVKPHYYDF+TRGL+P  HYWP+R+ DKC+SIK AVDWGN+H Q+AQ+IG
Sbjct  368   YILACDSVTLLVKPHYYDFFTRGLLPAHHYWPVREHDKCRSIKFAVDWGNSHIQKAQDIG  427

Query  1497  MAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQF  1676
              A S +IQ ELKM+YVYDYM+HLL+EY+KLL++KP +P  A E+CSE M C  +G E++F
Sbjct  428   KAASDFIQHELKMDYVYDYMYHLLTEYSKLLRFKPEIPQNAAEICSETMACPRSGNERKF  487

Query  1677  MMESLVKAAPSTTAPCTMPPPFDPATL  1757
             M ES VK  P+ + PC MPPP+DPA L
Sbjct  488   MTESFVK-HPAESGPCAMPPPYDPALL  513



>gb|KDO60000.1| hypothetical protein CISIN_1g043671mg [Citrus sinensis]
Length=525

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/512 (56%), Positives = 364/512 (71%), Gaps = 30/512 (6%)
 Frame = +3

Query  267   LKMRETSE--GARLYRHFTDTNWRPLPAIKTLPRSSLAVF-FFMVLCVGAFVSTRLLDST  437
             ++ R++S   G     HFTDT WR    I++ P  S A+F F  +L VGA +STRLLDST
Sbjct  1     MQQRQSSNVHGPGHSGHFTDTIWRQF--IQS-PAKSYALFAFIFLLLVGALISTRLLDST  57

Query  438   VTAQHPTRLSHQKIIENEIP------------PLNCSLRTPMASCPANYYPSSKLTRTRT  581
                    +    +  + + P            PL C+      +CP  Y P+S      T
Sbjct  58    ALGGGTNKKLRDRKGQTDAPDITKKHYNKTEYPLKCTDGNNTKTCPGTY-PTS-----YT  111

Query  582   RIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAY  761
               +D  SP        CPDYFRWI++DL  W  +GI+REMV  A  TANFRLVIV G AY
Sbjct  112   PEEDHDSPLAPT----CPDYFRWIHEDLRPWARTGITREMVERANETANFRLVIVKGRAY  167

Query  762   YHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPP  941
                  K+FQSRDTFTLWGILQLLRRYPGK+PDLDLMFD VDWP++ K +Y +     APP
Sbjct  168   VKRNIKAFQSRDTFTLWGILQLLRRYPGKIPDLDLMFDCVDWPILLKSNYSV-PGAPAPP  226

Query  942   ALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGN  1121
              LFRYC ++ T+DIVFPDWSFWGWPE+NIK W  + K+L+EGN ++ W DREPYAYWKGN
Sbjct  227   PLFRYCANDQTFDIVFPDWSFWGWPEVNIKSWGKILKDLEEGNRRMNWTDREPYAYWKGN  286

Query  1122  PEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAW  1301
             P VA++R+DL+KCNVSE Q+W AR+Y QDW +E ++GY+QS+LA QC HR+KIYIEGSAW
Sbjct  287   PVVASSRQDLMKCNVSEGQEWNARLYVQDWKREKQKGYKQSDLASQCKHRFKIYIEGSAW  346

Query  1302  SVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQ  1481
             SVSEKYILACDS+TL V P+Y DF+TRGL+PM H+WP+   DKC+SIK AVDWGNNH  +
Sbjct  347   SVSEKYILACDSVTLYVTPNYTDFFTRGLIPMHHFWPMNVYDKCRSIKFAVDWGNNHTGK  406

Query  1482  AQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANG  1661
             AQEIG A S++IQEELKM+YVYDYMFHLL++Y+KL +Y+PT+P  AVE C+E M C   G
Sbjct  407   AQEIGRAASRFIQEELKMDYVYDYMFHLLNQYSKLFRYQPTIPTGAVEYCAETMACPEEG  466

Query  1662  LEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             + ++ M ESL + +P  T+PCT+PPP+DP++L
Sbjct  467   MARKLMEESL-EQSPKETSPCTLPPPYDPSSL  497



>ref|XP_002510787.1| KDEL motif-containing protein 1 precursor, putative [Ricinus 
communis]
 gb|EEF51389.1| KDEL motif-containing protein 1 precursor, putative [Ricinus 
communis]
Length=506

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/492 (57%), Positives = 357/492 (73%), Gaps = 18/492 (4%)
 Frame = +3

Query  288   EGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTR--  461
             +G+ +  H T+   RPL  +    +SS A    + L VG  +STR   + +T     +  
Sbjct  2     QGSGVVGHLTEPIMRPLLLLPG--KSSAAFLLLVFLLVGMLLSTRFQFNAITGYSAPKST  59

Query  462   LSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDY  641
             +  +K     + PLNC       +CP +Y  +S     R+            S   CP+Y
Sbjct  60    VPLEKPDNRLVIPLNCHALNLTRTCPTDYPSTSSQDPNRS------------SPPTCPEY  107

Query  642   FRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGIL  821
             FRWI++DL  W  +GI+RE +  A+ TANFRLVI+NG AY   Y KSFQ+RD FTLWGIL
Sbjct  108   FRWIHEDLRPWVRTGITRETMERAKATANFRLVILNGTAYLEMYEKSFQTRDVFTLWGIL  167

Query  822   QLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWS  1001
             QLLR+YPG+VPDL++MFD VDWPV+K   Y    +  +PP LFRYCG++ T DIVFPDWS
Sbjct  168   QLLRKYPGRVPDLEMMFDCVDWPVVKSVDYS-GSSAISPPPLFRYCGNDETLDIVFPDWS  226

Query  1002  FWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQD  1181
             +WGW E NIKPWE + K+LKEGN + KW +REPYAYWKGNP VA TR DL+KCNVS++ D
Sbjct  227   YWGWVETNIKPWEKIVKDLKEGNQRSKWKEREPYAYWKGNPNVAETRLDLMKCNVSQEHD  286

Query  1182  WGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPH  1361
             W AR+Y QDW++E +QGY+QS+LA+QC HRYKIYIEGSAWSVSEKYILACDS+TL+VKPH
Sbjct  287   WNARLYTQDWVRESQQGYKQSDLANQCNHRYKIYIEGSAWSVSEKYILACDSVTLIVKPH  346

Query  1362  YYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEY  1541
             YYDF+TRGLMP  HYWPI++DDKCKSIK AVDWGN+H Q+AQ IG A S +IQE+LKM+Y
Sbjct  347   YYDFFTRGLMPNHHYWPIKEDDKCKSIKFAVDWGNSHKQKAQAIGKAASDFIQEDLKMDY  406

Query  1542  VYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAP  1721
             VYDYMFHLL+EYA+LL +KPT+P  A +LC+E M C A+GL K+ MM+S+V+  P+ T+P
Sbjct  407   VYDYMFHLLNEYARLLTFKPTIPQNATKLCAETMACPADGLAKKLMMDSMVE-GPADTSP  465

Query  1722  CTMPPPFDPATL  1757
             CTMP  +DP++L
Sbjct  466   CTMPSSYDPSSL  477



>ref|XP_010660876.1| PREDICTED: O-glucosyltransferase rumi homolog [Vitis vinifera]
Length=531

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/519 (55%), Positives = 365/519 (70%), Gaps = 33/519 (6%)
 Frame = +3

Query  240   IRNMVRPHILKMRETSEGARLYRHFTDTNWRPLPAIKTLPRS-SLAVF----FFMVLCVG  404
             I+NM R     ++ +  G    R F+      LP +K  P + S+ ++    FF++    
Sbjct  4     IQNMQRFSTAILQRSQLG----RDFSGLRIFRLPLMKKAPAACSITIYTFFLFFILFVAA  59

Query  405   AFVS--------TRLLDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSS  560
             AF+S          L++++     P   +H+K     + PLNCS R    +CP NY P++
Sbjct  60    AFISFFCFSSRFIFLVNNSERKAVPISENHRKTPRPIVVPLNCSARNLTQTCPGNY-PTT  118

Query  561   KLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLV  740
               T    +               CPDYFRWI++DL  W+ +GISR+MV  A+R+A+FRLV
Sbjct  119   FDTDLAWK-------------PVCPDYFRWIHEDLKPWKTTGISRDMVERAKRSAHFRLV  165

Query  741   IVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLN  920
             IV G  Y   Y+KS Q+RD FT+WGILQLLRRYPGK+ DL+L FD  D PVI+   +   
Sbjct  166   IVKGKVYIEKYKKSIQTRDVFTIWGILQLLRRYPGKLLDLELTFDCNDRPVIRSGDH-RG  224

Query  921   DTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREP  1100
               +T+PP LFRYCGD  T D+VFPDWSFWGWPEIN+KPW  L K+LKEGN + KW++REP
Sbjct  225   PNSTSPPPLFRYCGDRWTLDVVFPDWSFWGWPEINMKPWGNLLKDLKEGNNRTKWMEREP  284

Query  1101  YAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKI  1280
             YAYWKGNP VA TR+DLL CNVS+ QDW AR++ QDW+ E +QGY+QS++++QC HRYKI
Sbjct  285   YAYWKGNPLVAETRRDLLTCNVSDVQDWNARLFVQDWMLESQQGYKQSDVSNQCTHRYKI  344

Query  1281  YIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDW  1460
             YIEG AWSVSEKYILACDS+TL+VKP YYDF+ R L P+ HYWPI+D+DKC+SIK AVDW
Sbjct  345   YIEGWAWSVSEKYILACDSVTLMVKPRYYDFFMRSLQPVHHYWPIKDNDKCRSIKFAVDW  404

Query  1461  GNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEK  1640
             GN+H Q+AQ IG A S +IQEELKM+YVYDYMFHLL+EYAKLL++KPT+P  AVE+CSE 
Sbjct  405   GNSHKQKAQAIGKAASDFIQEELKMDYVYDYMFHLLNEYAKLLRFKPTIPEGAVEVCSET  464

Query  1641  MVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             + C A G+EK+FMMESLV  +PS T+PC +PPP+DP  L
Sbjct  465   VACSAEGVEKKFMMESLVN-SPSVTSPCALPPPYDPPVL  502



>emb|CDX88050.1| BnaA06g26410D [Brassica napus]
Length=534

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/510 (56%), Positives = 360/510 (71%), Gaps = 37/510 (7%)
 Frame = +3

Query  291   GARLYRHFTDTNWRPLPAIKTLP----RSSLAVFFFMVLCVGAFVSTR-LLDSTVTAQHP  455
             G    R+FT  NW P            RS   +    +L VGAF+STR LLD TV  +  
Sbjct  11    GGGHSRNFT--NWSPFVKSSGFGISPNRSYALLSLLTLLIVGAFISTRILLDPTVLLEKE  68

Query  456   ---TRLSHQKIIENEIPP-------------LNCSLRTPMASCPANYYPSSKLTRTRTRI  587
                T+     I     PP             L+CS     A+CP N YP+     T +  
Sbjct  69    AVTTKTRSHTIFPKYPPPTPVTTQSPKPEFTLHCSANDTNATCPRNNYPA-----TASFG  123

Query  588   QDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYH  767
             +D+P+ T       CPDYFRWI++DL  W ++GI+RE +  A++TANFRL IV G  Y  
Sbjct  124   EDAPTAT-------CPDYFRWIHEDLRPWAKTGITREALERAKKTANFRLAIVGGRVYVE  176

Query  768   NYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPAL  947
              ++ +FQ+RD FT+WG LQLLR+YPGK+PDL+LMFD VDWPV++   +   D  + PP L
Sbjct  177   KFQDAFQTRDVFTIWGFLQLLRKYPGKIPDLELMFDCVDWPVVRALDFAGVDAPSPPP-L  235

Query  948   FRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPE  1127
             FRYCG+E T DIVFPDWSFWGW E+NIKPWE L KEL+EGN +  W++REPYAYWKGNP 
Sbjct  236   FRYCGNEETLDIVFPDWSFWGWSEVNIKPWESLLKELREGNQRTTWINREPYAYWKGNPS  295

Query  1128  VAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSV  1307
             VA TR+DL+KCNVSE+ +W ARVYAQDWI+E K+GY+QS+LA QC HRYKIYIEGSAWSV
Sbjct  296   VAETRQDLMKCNVSEEHEWNARVYAQDWIRESKEGYKQSDLASQCHHRYKIYIEGSAWSV  355

Query  1308  SEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQ  1487
             SEKYILACDS+TLLVKPHYYDF+TRGL+P  HYWP+R+ DKC+SIK AV WGN+H Q+AQ
Sbjct  356   SEKYILACDSVTLLVKPHYYDFFTRGLLPAHHYWPVREHDKCRSIKFAVHWGNSHIQKAQ  415

Query  1488  EIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLE  1667
             +IG   S++IQ+ELKM+YVYDYM+HLL+ YAKLL++KP +P  A+E+CSE M C  +G E
Sbjct  416   DIGKTASEFIQQELKMDYVYDYMYHLLTGYAKLLQFKPEIPQNAMEICSETMACPRSGNE  475

Query  1668  KQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             ++FM ESLVK  P+ T PC MP P+DPA+ 
Sbjct  476   RKFMTESLVK-HPAETGPCAMPTPYDPASF  504



>ref|XP_010550766.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Tarenaya 
hassleriana]
Length=535

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/496 (56%), Positives = 355/496 (72%), Gaps = 39/496 (8%)
 Frame = +3

Query  333   PLPAIKTLPRSSLAVF-FFMVLCVGAFVSTRLL------------DSTVTAQHPTRLSHQ  473
             PL      P  S A+F F ++L +GAF S+RLL             +T     P   S +
Sbjct  26    PLVKTGGSPNKSYAIFSFLILLLLGAFFSSRLLLDPSVLVEREAVSTTKATAAPADASSR  85

Query  474   K------IIENEIP--PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssK  629
             K      +I  + P  PL C+  +  ++CP + YP++ L                  S+ 
Sbjct  86    KDPRENTVITEKPPEFPLTCTSLSDNSTCPRDNYPTATLA-------------GDSPSAA  132

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP+YFRWI++DL  W  +GI+R+ V  A++TANFRLVIV G  Y   + ++FQ+RD FT+
Sbjct  133   CPEYFRWIHEDLRPWARTGITRDAVERAKKTANFRLVIVGGRVYVEKFNEAFQTRDVFTI  192

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WG LQL+RRYPGK+PDL+LMFD VDWPVIK   +        PP LFRYCG++ T DIVF
Sbjct  193   WGFLQLVRRYPGKIPDLELMFDCVDWPVIKAAEFA----GAEPPPLFRYCGNDETLDIVF  248

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGW E+NIKPWEG+ +EL + N K KW++REPYAYWKGNP VA TR+DL+KCNVS
Sbjct  249   PDWSFWGWAEVNIKPWEGVLRELGDANRKTKWLEREPYAYWKGNPTVAETRQDLMKCNVS  308

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             E+ DW AR+Y+QDW +E K+GY+QS+LA QC+HRYKIYIEGSAWSVSEKYILACDS+TLL
Sbjct  309   EEHDWNARLYSQDWARESKEGYKQSDLASQCVHRYKIYIEGSAWSVSEKYILACDSVTLL  368

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VKP YYDF+TRGL+P +H+WPI+DDDKC+SIK AVDW N+H ++A+E+G  GS++I ++L
Sbjct  369   VKPRYYDFFTRGLLPAQHFWPIKDDDKCRSIKFAVDWANSHARKAEEMGKKGSEFIMQQL  428

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KMEYVYDYM+HLL+EY+KLL++KP VP +A E CSE M C  +G E++FM ESLVK  PS
Sbjct  429   KMEYVYDYMYHLLTEYSKLLRFKPEVPRQAGEGCSESMACPRDGNERKFMRESLVK-RPS  487

Query  1710  TTAPCTMPPPFDPATL  1757
              T PC MPPP+DPA+ 
Sbjct  488   ETGPCLMPPPYDPASF  503



>ref|XP_006421920.1| hypothetical protein CICLE_v10007061mg [Citrus clementina]
 gb|ESR35160.1| hypothetical protein CICLE_v10007061mg [Citrus clementina]
Length=501

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/500 (58%), Positives = 360/500 (72%), Gaps = 31/500 (6%)
 Frame = +3

Query  267   LKMRETSE--GARLYRHFTDTNWRPLPAIKTLPRSSLAVF-FFMVLCVGAFVSTRLLDST  437
             ++ R++S   G     HFTDT WR    I++ P  S A+F F  +L VGA +S RLLDST
Sbjct  1     MQQRQSSNVHGPGHSGHFTDTIWRQF--IQS-PAKSYALFAFIFLLLVGALISARLLDST  57

Query  438   VTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptq  617
                 H  +  +         PL C+      +CP  Y P+S      T  +D  SP    
Sbjct  58    ----HYNKTEY---------PLKCTDGNNTKTCPGTY-PTS-----YTPEEDHDSPLAPT  98

Query  618   sssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRD  797
                 CPDYFRWI++DL  W  +GI+REMV  A  TANFRLVIV G AY     K+FQSRD
Sbjct  99    ----CPDYFRWIHEDLRPWARTGITREMVERANETANFRLVIVKGRAYVKRNIKAFQSRD  154

Query  798   TFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATW  977
             TFTLWGILQLLRRYPGK+PDLDLMFD VDWP++ K +Y +     APP LFRYC ++ T+
Sbjct  155   TFTLWGILQLLRRYPGKIPDLDLMFDCVDWPILLKSNYSV-PGAPAPPPLFRYCANDQTF  213

Query  978   DIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLK  1157
             DIVFPDWSFWGWPE+NIK W  + K+L+EGN ++ W DREPYAYWKGNP VA++R+DL+K
Sbjct  214   DIVFPDWSFWGWPEVNIKSWGKILKDLEEGNRRMNWTDREPYAYWKGNPVVASSRQDLMK  273

Query  1158  CNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDS  1337
             CNVSE Q+W AR+Y QDW +E ++GY+QS LA QC HR+KIYIEGSAWSVSEKYILACDS
Sbjct  274   CNVSEGQEWNARLYVQDWKREKQKGYKQSELASQCKHRFKIYIEGSAWSVSEKYILACDS  333

Query  1338  LTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYI  1517
             +TL V P+Y DF+TRGL+PM H+WPI   DKC+SIK AVDWGNNH  +AQEIG A S++I
Sbjct  334   VTLYVTPNYTDFFTRGLIPMHHFWPINVYDKCRSIKFAVDWGNNHTGKAQEIGRAASRFI  393

Query  1518  QEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVK  1697
             QEELKM+YVYDYMFHLL++Y+KL +Y+PT+P  AVE C+E M C   G+ ++ M ESL +
Sbjct  394   QEELKMDYVYDYMFHLLNQYSKLFRYQPTIPTGAVEYCAETMACPEEGMARKLMEESL-E  452

Query  1698  AAPSTTAPCTMPPPFDPATL  1757
              +P  T+PCT+PPP+DP++L
Sbjct  453   QSPKETSPCTLPPPYDPSSL  472



>ref|XP_007040187.1| Glycosyltransferase isoform 1 [Theobroma cacao]
 gb|EOY24688.1| Glycosyltransferase isoform 1 [Theobroma cacao]
Length=516

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/506 (55%), Positives = 362/506 (72%), Gaps = 38/506 (8%)
 Frame = +3

Query  291   GARLYRHFTDTN-WRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLS  467
             G+ L RH  +   WRP   +K  P ++ A+ F  VL V AF S+  +D++        L 
Sbjct  4     GSGLARHVLEMPFWRP--PLKRKPATTAALLFLTVLLVAAFTSSSWIDTSSFLTE--NLR  59

Query  468   HQKIIENEIP---------PLNC-SLRTPMASCPANY---YPSSKLTRTRTRIQDspspt  608
             ++ II +E P         PL C S +    +CP NY   + +  L  +   +       
Sbjct  60    NKTIIISEKPKIPIQKIEIPLGCTSSKNQTQTCPTNYPKTFQTEDLDPSSNHV-------  112

Query  609   ptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQ  788
                    CPDYFRWI++DL  W+ SGI+R+MV  A RTA FRLVI+ G AY  NYRK+ Q
Sbjct  113   -------CPDYFRWIHEDLRPWKTSGITRDMVERANRTATFRLVIIGGKAYVENYRKAIQ  165

Query  789   SRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDE  968
             +RD FT+WG+LQLLR+YPG++PDL++MFDT D PV++ + Y      T PP LFRYCGD+
Sbjct  166   TRDVFTIWGVLQLLRKYPGRLPDLEIMFDTEDKPVVRSRDY-RGPNATGPPPLFRYCGDK  224

Query  969   ATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKD  1148
              T DIVFPDWSFWGW EINIKPW  + K++++GN + KW+DREPYAYWKGNP V   R+D
Sbjct  225   ETLDIVFPDWSFWGWAEINIKPWHSILKDVRQGNNQTKWIDREPYAYWKGNPFVDGKRQD  284

Query  1149  LLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILA  1328
             LLKCNVS++QDW AR++ QDWI E +QG++QSN+ADQC +RYKIYIEG AWSVSEKYILA
Sbjct  285   LLKCNVSDQQDWNARLFIQDWILEGQQGFKQSNVADQCTYRYKIYIEGYAWSVSEKYILA  344

Query  1329  CDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGS  1508
             CDS+TL+V+P YYDF+ R + P++HYWPIRDDDKC+S+K AVDWGNNH ++AQEIG A S
Sbjct  345   CDSVTLIVQPQYYDFFMRSMQPVEHYWPIRDDDKCRSLKFAVDWGNNHKKKAQEIGKAAS  404

Query  1509  KYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLE---KQFM  1679
              +++E+LKM+Y+YDYM+HLL+EYAKLLK++P +P  AVELCSE M C A G+E   K+FM
Sbjct  405   SFMEEQLKMDYIYDYMYHLLNEYAKLLKFEPRIPEGAVELCSEVMACHAEGIEGRKKKFM  464

Query  1680  MESLVKAAPSTTAPCTMPPPFDPATL  1757
             MESLVK  PS ++PCT+ PP++P  L
Sbjct  465   MESLVK-GPSVSSPCTL-PPYEPQAL  488



>ref|XP_006439571.1| hypothetical protein CICLE_v10019647mg [Citrus clementina]
 gb|ESR52811.1| hypothetical protein CICLE_v10019647mg [Citrus clementina]
Length=536

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/519 (56%), Positives = 358/519 (69%), Gaps = 27/519 (5%)
 Frame = +3

Query  246   NMVRPHILKMRETSEGARLYRHFTD---TNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVS  416
             N++   +   R  S G  L RHF++   T WR  P +K    ++  +  F+ L +     
Sbjct  2     NLLSNQLTMQRFCSSG--LVRHFSEVLITLWRWRPRVKKNLGTTTTLLLFLPLLIATAFI  59

Query  417   TRLLDSTVTAQHPTRLSHQKII-------ENEIP-----PLNCSLRTPMASCPANYYPSS  560
             + L +S  +      +S  K +       +N  P     PLNC ++    +CP NY    
Sbjct  60    SSLWNSDTSNFSVHNISRNKTVIIVSRKPQNRPPKRITTPLNC-VKNQTQTCPTNY---P  115

Query  561   KLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLV  740
             K ++T+  I D      +     CPDYFRWI++DL  W+ +GI+R+M+  A +TA+FRLV
Sbjct  116   KTSQTQKSISDYSITPTST----CPDYFRWIHEDLSPWKVTGITRDMLERANQTAHFRLV  171

Query  741   IVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLN  920
             +VN   Y H Y++S Q+RD FT+WGILQLLR+YPG++PDL+LMFD  D PV+  + Y   
Sbjct  172   LVNNKVYIHKYKQSIQTRDVFTIWGILQLLRKYPGRLPDLELMFDCDDRPVVLSRDYS-G  230

Query  921   DTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREP  1100
                  PP LFRY GD  T DIVFPDWSFWGW EINI PWE L +ELKEGN +  W+DREP
Sbjct  231   PNNKGPPPLFRYSGDRWTMDIVFPDWSFWGWAEININPWESLLRELKEGNNRRNWIDREP  290

Query  1101  YAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKI  1280
             YAYWKGNP VA TR+DLL CN+S+K DW AR+Y QDWI E K+G+QQSNLA QC HRYKI
Sbjct  291   YAYWKGNPFVAETRRDLLTCNLSDKHDWNARLYVQDWILESKRGFQQSNLASQCAHRYKI  350

Query  1281  YIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDW  1460
             YIEG AWSVSEKYILACDS+TLLVKP+++DF+ R L P++HYWPIRD DKCKSIK AVDW
Sbjct  351   YIEGYAWSVSEKYILACDSMTLLVKPYFHDFFIRYLQPLRHYWPIRDKDKCKSIKFAVDW  410

Query  1461  GNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEK  1640
             GN H Q+AQEIG A S +IQEELKMEYVYDYMFHLL+EYAKLLK+KP  P  AVE+CSE 
Sbjct  411   GNTHKQKAQEIGRAASNFIQEELKMEYVYDYMFHLLNEYAKLLKFKPVAPDGAVEVCSET  470

Query  1641  MVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             M C ANG  K+FMMESLVK  PS T PCT+PPP++P  L
Sbjct  471   MACNANGSHKKFMMESLVK-GPSITNPCTLPPPYEPKVL  508



>ref|XP_010089133.1| hypothetical protein L484_024308 [Morus notabilis]
 gb|EXB37380.1| hypothetical protein L484_024308 [Morus notabilis]
Length=530

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/473 (59%), Positives = 351/473 (74%), Gaps = 17/473 (4%)
 Frame = +3

Query  363   SSLAVFFFMVLCVGAFV-STRLLDSTVTAQHPTRLSHQKIIENEIPP------LNCSLRT  521
             S+ A  F M++ V AF+ S  +  S ++  +    +   I +++ PP      LNC+  T
Sbjct  36    STSAALFLMLIVVAAFLLSFGINTSKLSIDNFIYQTAITIQKDQNPPRRVEFPLNCTYFT  95

Query  522   PMAS-CPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISRE  698
                  CP NY P+S  + +  ++  S +P        CPDYFRWI++DL  W+ +GI+R+
Sbjct  96    NQTKFCPTNY-PASFESESVDQVDQSSNPV-------CPDYFRWIHEDLRPWKATGITRD  147

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MV  A  TA+FRLV+V G AY   Y+KS QSRD FT+WGILQLLRRYPGK+PDL+LMFD 
Sbjct  148   MVERANSTAHFRLVVVKGKAYVEKYKKSIQSRDLFTIWGILQLLRRYPGKIPDLELMFDC  207

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
              D PV+K ++Y   + T  PP LFRYCGD  T DIVFPDWSFWGW EINIKPWE L KE+
Sbjct  208   DDRPVVKTRAYTGPNMTQDPPPLFRYCGDRWTMDIVFPDWSFWGWAEINIKPWESLLKEI  267

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             K+GN  IKW++REP+AYWKGNP VA  R+DLLKCNVSE QDW AR++ QDWI E++QGY+
Sbjct  268   KQGNENIKWMEREPFAYWKGNPHVADGRRDLLKCNVSETQDWNARLFIQDWILEYQQGYK  327

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
              SN+A+QC HRYKIYIEG AWSVSEKYIL+CDS+TLLVKP YYDF+TR L P++HYWPIR
Sbjct  328   HSNVANQCTHRYKIYIEGWAWSVSEKYILSCDSVTLLVKPRYYDFFTRSLQPLRHYWPIR  387

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             D+DKC+SIK AVDWGNN+ ++AQ IG A S  IQEE+KM+YVYDYMFHLL EY+KLLK++
Sbjct  388   DNDKCRSIKFAVDWGNNNKEKAQAIGKAASDLIQEEVKMDYVYDYMFHLLIEYSKLLKFE  447

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             PTVP  AVELC+E + C A G EK+FM ESLVK +P+ T PCTMP P++P  L
Sbjct  448   PTVPEGAVELCAETVACPAEGQEKKFMNESLVK-SPAVTTPCTMPHPYEPQVL  499



>emb|CDP07206.1| unnamed protein product [Coffea canephora]
Length=454

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/376 (67%), Positives = 314/376 (84%), Gaps = 2/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYFRWI++DLW WRE+GI+  MV +A+RTA+FRLV+VNG  Y   YR+SFQ+RD FT 
Sbjct  52    CPDYFRWIHEDLWPWRETGITLGMVEAAKRTASFRLVVVNGTVYVETYRRSFQTRDVFTQ  111

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGILQLLR YPG++PDLD++F   D P + KQ Y  N   TAPPALF Y GD+AT+DI+F
Sbjct  112   WGILQLLRLYPGRLPDLDMIFSCADQPTVVKQFYP-NPNATAPPALFSYDGDDATFDILF  170

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGWPEI IKPWE LSK+LKEGN +++WVD+EP AYWKGN ++  +RKDLL+CNVS
Sbjct  171   PDWSFWGWPEIAIKPWEQLSKDLKEGNERMQWVDKEPQAYWKGNAKLTLSRKDLLRCNVS  230

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
              KQDW AR+Y QDW  E +Q ++ SNLA+QCIHR+KIYIEG  WSVS+KYILACDS+TL+
Sbjct  231   GKQDWNARIYQQDWHGEERQDFKNSNLANQCIHRFKIYIEGFGWSVSQKYILACDSVTLM  290

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VKPHYY+F++R LMP++HYWPIRD +KC+SIKHAV+WGNNH ++AQ IG A S+++QEEL
Sbjct  291   VKPHYYEFFSRSLMPLQHYWPIRDINKCRSIKHAVEWGNNHQEEAQAIGKAASRFVQEEL  350

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             +M+YVYDYMFHLL EYAKLLKYKP+ PP A+E+CSE M C A+GL  ++MM+S+V  +PS
Sbjct  351   QMKYVYDYMFHLLKEYAKLLKYKPSTPPNAIEVCSESMACPADGLVMKYMMDSVV-TSPS  409

Query  1710  TTAPCTMPPPFDPATL  1757
               APCTMPPP+DPAT 
Sbjct  410   IEAPCTMPPPYDPATF  425



>emb|CAN69493.1| hypothetical protein VITISV_037876 [Vitis vinifera]
Length=378

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/353 (75%), Positives = 302/353 (86%), Gaps = 2/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MV  A+RTA F+LVI+NG AY   Y+++FQ+RD FTLWGILQLLRRYPGKVPDL+LMFD 
Sbjct  1     MVERAKRTATFKLVILNGRAYVEKYQRAFQTRDVFTLWGILQLLRRYPGKVPDLELMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPVIK + Y     TTAPP LFRYCGD+AT DIVFPDWSFWGWPEI IKPWE L K+L
Sbjct  61    VDWPVIKSKEY-HGPNTTAPPPLFRYCGDDATLDIVFPDWSFWGWPEIXIKPWESLLKDL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             KEGN + +W++REPYAYWKGNP VAATR DLLKCNVS+KQDW ARVY QDWI E ++GY+
Sbjct  120   KEGNKRSRWMEREPYAYWKGNPAVAATRLDLLKCNVSDKQDWNARVYTQDWIXESQEGYK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             QS+LA QCIHRYKIYIEGSAWSVS+KYILACDS+TLLVKPHYYDF+TR LMP+ HYWPIR
Sbjct  180   QSDLASQCIHRYKIYIEGSAWSVSQKYILACDSVTLLVKPHYYDFFTRSLMPVHHYWPIR  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             +DDKC+SIK AVDWGN H Q+AQ IG A S +IQE+LKM+ VYDYMFHLL+EYAKLLK+K
Sbjct  240   EDDKCRSIKFAVDWGNRHKQKAQSIGKAASDFIQEDLKMDNVYDYMFHLLNEYAKLLKFK  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             PTVP +AVELCSE+M CGA GL+K+FMMES+VK  P   +PCTMPPPF P  L
Sbjct  300   PTVPEKAVELCSERMGCGAEGLKKKFMMESMVK-YPMDASPCTMPPPFSPLEL  351



>ref|XP_006404195.1| hypothetical protein EUTSA_v10010269mg [Eutrema salsugineum]
 gb|ESQ45648.1| hypothetical protein EUTSA_v10010269mg [Eutrema salsugineum]
Length=543

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/454 (59%), Positives = 336/454 (74%), Gaps = 14/454 (3%)
 Frame = +3

Query  414   STRLLDSTVTAQHPTRLSHQKIIENEIPP---LNC---SLRTPMASCPANYYPSSKLTRT  575
             S  + ++   A  P      K+I  E P    LNC   S    + +CP N YP+S   R+
Sbjct  68    SVTVTETETPAVSPKHPQSTKLITEEKPKEFTLNCAAFSGNETVITCPRNRYPTS--LRS  125

Query  576   RTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGI  755
               R  D     P      CPDYFRWI++DL  W ++GI+RE +  A  TANFRL I+NG 
Sbjct  126   GAREDDPERSPPAT----CPDYFRWIHEDLRPWEKTGITREALERANATANFRLAIINGR  181

Query  756   AYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTA  935
              Y   +R++FQ+RD FT+WG +QLLRRYPGK+PDL+LMFD VDWPV+K   +   D  T 
Sbjct  182   IYVEKFREAFQTRDVFTIWGFVQLLRRYPGKIPDLELMFDCVDWPVVKAAEFAGVDQLTP  241

Query  936   PPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWK  1115
             PP LFRYCG+  T DIVFPDWS+WGW E+NIKPWE L KEL+EGN + KW+DREPYAYWK
Sbjct  242   PP-LFRYCGNNETLDIVFPDWSYWGWAEVNIKPWESLLKELREGNQRTKWIDREPYAYWK  300

Query  1116  GNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGS  1295
             GNP VA TR+DL+KCNVSE  DW AR+Y QDW++E K+GY+QS+LA QC HRYKIYIEGS
Sbjct  301   GNPTVAETRQDLMKCNVSEDYDWKARLYPQDWVRESKEGYKQSDLASQCHHRYKIYIEGS  360

Query  1296  AWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHH  1475
             AWSVSEKYILACDS+TLLVKPHYYDF+TRG+ P  HYWP+++DDKC+SIK AVD+GN H 
Sbjct  361   AWSVSEKYILACDSVTLLVKPHYYDFFTRGMFPGHHYWPVKEDDKCRSIKFAVDFGNLHM  420

Query  1476  QQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGA  1655
              +AQ+IG   S+++Q+ELKM+YVYDYM+HLL++Y+KLL++KP +P  A ELCSE M C  
Sbjct  421   LKAQDIGKKASEFVQQELKMDYVYDYMYHLLTQYSKLLRFKPKIPQNATELCSEAMACPR  480

Query  1656  NGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +G E++FMMESLVK  P+ T PC MPPP+DPA+ 
Sbjct  481   DGNERKFMMESLVK-RPAETGPCAMPPPYDPASF  513



>ref|XP_009601762.1| PREDICTED: O-glucosyltransferase rumi homolog [Nicotiana tomentosiformis]
 ref|XP_009601769.1| PREDICTED: O-glucosyltransferase rumi homolog [Nicotiana tomentosiformis]
Length=503

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/486 (58%), Positives = 348/486 (72%), Gaps = 20/486 (4%)
 Frame = +3

Query  303   YRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKII  482
             YR  TD+ W P    K   R S+ +  F ++ +G+++ T +LD+T       +   ++  
Sbjct  11    YRRSTDSFWLPHYINKPYARHSVLLLVFFLV-LGSYMWTTILDTTTAVNKVLQSRTREF-  68

Query  483   ENEIPPLNCSLRTPMASCPANYYPSS-KLTRTRTRIQDspsptptqsssKCPDYFRWIYD  659
                  PLNCS       CP NYYP   K+   +           + ++ +CP YF WI++
Sbjct  69    -----PLNCSSSILTRICPVNYYPPDYKIINNKP----------SSANPRCPHYFHWIHE  113

Query  660   DLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRY  839
             DL  WR++GI++EMV  A RTANFRLVI+NG AY   Y K FQ+RD FTLWGILQLLRRY
Sbjct  114   DLKPWRKTGITKEMVERANRTANFRLVILNGRAYVETYEKGFQTRDVFTLWGILQLLRRY  173

Query  840   PGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPE  1019
             PGK+PDLDLMFD VDWPVI+   +   D    PP LFRYCGD  T DIVFPDWSFWGW E
Sbjct  174   PGKIPDLDLMFDCVDWPVIRSSDFT-GDNAPVPPPLFRYCGDSETLDIVFPDWSFWGWAE  232

Query  1020  INIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVY  1199
             INIKPW+ L K+L++G+ K KW DREPYAYWKGNPEVA  R +L+KCNVSE Q+W AR+Y
Sbjct  233   INIKPWQDLLKDLEKGSKKQKWQDREPYAYWKGNPEVAEKRMELVKCNVSENQEWNARIY  292

Query  1200  AQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYT  1379
              QDW +E KQG++ S+L +QC HRYKIYIEGSAWSVSEKYILACDS+ LLVKPHYYDF++
Sbjct  293   VQDWKKEIKQGFKNSDLGNQCHHRYKIYIEGSAWSVSEKYILACDSVALLVKPHYYDFFS  352

Query  1380  RGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMF  1559
             R LMP+ HYWPI ++DKC SIK AVDWGN+H+++AQ+IG   S +IQE+LKME VYDYMF
Sbjct  353   RSLMPLVHYWPINENDKCGSIKFAVDWGNSHNKKAQKIGRTASNFIQEDLKMEDVYDYMF  412

Query  1560  HLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPP  1739
             HLL+EYAKLL+YKP+VP +A ELCSE M C A G+EK+ MMES+VK  P   +PC M  P
Sbjct  413   HLLNEYAKLLRYKPSVPEKATELCSEIMACQAEGIEKKLMMESMVK-GPIDESPCKMRIP  471

Query  1740  FDPATL  1757
             F   +L
Sbjct  472   FSQLSL  477



>ref|XP_006476587.1| PREDICTED: O-glucosyltransferase rumi-like isoform X2 [Citrus 
sinensis]
Length=536

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/420 (65%), Positives = 322/420 (77%), Gaps = 10/420 (2%)
 Frame = +3

Query  498   PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWR  677
             PLNC ++    +CP NY    K ++T+  I D   P  +     CPDYFRWI++DL  W+
Sbjct  99    PLNC-VKNQTQTCPTNY---PKTSQTQESISDYSIPPTST----CPDYFRWIHEDLSPWK  150

Query  678   ESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPD  857
              +GI+R+M+  A +TA+FRL++VN   Y H Y++S Q+RD FT+WGILQLLR+YPG++PD
Sbjct  151   VTGITRDMLERANQTAHFRLILVNNKVYIHKYKQSIQTRDVFTIWGILQLLRKYPGRLPD  210

Query  858   LDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPW  1037
             L+LMFD  D PVI+ + Y        PP LFRY GD  T DIVFPDWSFWGW EINIKPW
Sbjct  211   LELMFDCDDRPVIRSRDYS-GPNNKGPPPLFRYSGDRWTMDIVFPDWSFWGWAEINIKPW  269

Query  1038  EGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQ  1217
             E L +ELKEGN    WVDREPYAYWKGNP VA TR+DLL CN+S+K DW AR+Y QDWI 
Sbjct  270   ESLLRELKEGNNGRNWVDREPYAYWKGNPFVAETRRDLLTCNLSDKHDWNARLYVQDWIL  329

Query  1218  EHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPM  1397
             E KQG+QQSNLA QC HRYKIYIEG AWSVSEKYILACDS TL+VKP+++DF+ R L P+
Sbjct  330   ESKQGFQQSNLASQCAHRYKIYIEGYAWSVSEKYILACDSTTLIVKPYFHDFFIRYLQPL  389

Query  1398  KHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEY  1577
             +HYWPIRD DKCKSIK AVDWGN H Q+AQEIG A S +IQEELKMEYVYDYMFHLL+EY
Sbjct  390   RHYWPIRDKDKCKSIKFAVDWGNTHKQKAQEIGRAASNFIQEELKMEYVYDYMFHLLNEY  449

Query  1578  AKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             AKLLK+KP  P  AVE+CSE M C ANG  K+FMMESLVK  PS T+PCT+PPP++P  L
Sbjct  450   AKLLKFKPVAPDGAVEVCSETMACTANGSHKKFMMESLVK-GPSITSPCTLPPPYEPKVL  508



>emb|CBI34690.3| unnamed protein product [Vitis vinifera]
Length=497

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/468 (58%), Positives = 343/468 (73%), Gaps = 24/468 (5%)
 Frame = +3

Query  378   FFFMVLCVGAFVS--------TRLLDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMAS  533
              FF++    AF+S          L++++     P   +H+K     + PLNCS R    +
Sbjct  17    LFFILFVAAAFISFFCFSSRFIFLVNNSERKAVPISENHRKTPRPIVVPLNCSARNLTQT  76

Query  534   CPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSA  713
             CP NY P++  T    +               CPDYFRWI++DL  W+ +GISR+MV  A
Sbjct  77    CPGNY-PTTFDTDLAWK-------------PVCPDYFRWIHEDLKPWKTTGISRDMVERA  122

Query  714   RRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPV  893
             +R+A+FRLVIV G  Y   Y+KS Q+RD FT+WGILQLLRRYPGK+ DL+L FD  D PV
Sbjct  123   KRSAHFRLVIVKGKVYIEKYKKSIQTRDVFTIWGILQLLRRYPGKLLDLELTFDCNDRPV  182

Query  894   IKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNV  1073
             I+   +     +T+PP LFRYCGD  T D+VFPDWSFWGWPEIN+KPW  L K+LKEGN 
Sbjct  183   IRSGDH-RGPNSTSPPPLFRYCGDRWTLDVVFPDWSFWGWPEINMKPWGNLLKDLKEGNN  241

Query  1074  KIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLA  1253
             + KW++REPYAYWKGNP VA TR+DLL CNVS+ QDW AR++ QDW+ E +QGY+QS+++
Sbjct  242   RTKWMEREPYAYWKGNPLVAETRRDLLTCNVSDVQDWNARLFVQDWMLESQQGYKQSDVS  301

Query  1254  DQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKC  1433
             +QC HRYKIYIEG AWSVSEKYILACDS+TL+VKP YYDF+ R L P+ HYWPI+D+DKC
Sbjct  302   NQCTHRYKIYIEGWAWSVSEKYILACDSVTLMVKPRYYDFFMRSLQPVHHYWPIKDNDKC  361

Query  1434  KSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPP  1613
             +SIK AVDWGN+H Q+AQ IG A S +IQEELKM+YVYDYMFHLL+EYAKLL++KPT+P 
Sbjct  362   RSIKFAVDWGNSHKQKAQAIGKAASDFIQEELKMDYVYDYMFHLLNEYAKLLRFKPTIPE  421

Query  1614  EAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              AVE+CSE + C A G+EK+FMMESLV  +PS T+PC +PPP+DP  L
Sbjct  422   GAVEVCSETVACSAEGVEKKFMMESLVN-SPSVTSPCALPPPYDPPVL  468



>emb|CDP05197.1| unnamed protein product [Coffea canephora]
Length=493

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/462 (59%), Positives = 344/462 (74%), Gaps = 15/462 (3%)
 Frame = +3

Query  378   FFFMVLC--VGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIP-PLNCSLRTPMASCPANY  548
             FFF+ L    G +    +      +++P      K   N I  PL C++     +CP  Y
Sbjct  14    FFFLELNWNAGNYPRKSIFSGVTFSKYPLHDPWTKPRRNPIEIPLTCAVTNSTRTCPTTY  73

Query  549   YPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTAN  728
             +P +   R               +   CPDYFRWI++DL  WRE+GIS +MV +A+R A 
Sbjct  74    HPPNLSARDED----------AAAPEACPDYFRWIHEDLSPWRETGISLDMVEAAKRRAY  123

Query  729   FRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQS  908
             FRLVIVNG  Y   Y++SFQ+RD FT WGILQLLRRYPGK+PDLDL+F   D P I K+ 
Sbjct  124   FRLVIVNGTVYVETYQRSFQTRDVFTQWGILQLLRRYPGKLPDLDLIFSCADQPGIVKEC  183

Query  909   YVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWV  1088
             Y  ++ T APP LF Y GD++T DIVFPDWSFWGWPEI IKPWE LSKELKEGN +++WV
Sbjct  184   YPKSNAT-APPPLFGYDGDDSTVDIVFPDWSFWGWPEIVIKPWEQLSKELKEGNRRMRWV  242

Query  1089  DREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIH  1268
             DRE +AYWKGN  + A+R+DLLKC+VS+KQDW ARVY QDW +E +QG++ SNLADQCIH
Sbjct  243   DREAHAYWKGNARLTASRRDLLKCHVSDKQDWNARVYYQDWHREQRQGFKNSNLADQCIH  302

Query  1269  RYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKH  1448
             R+KIYIEG  WSVSEKYILACDS++L+V+P YYDF+TR L+P++HYWPIR++DKC+SIK+
Sbjct  303   RFKIYIEGIGWSVSEKYILACDSVSLVVRPRYYDFFTRSLIPLQHYWPIRENDKCRSIKY  362

Query  1449  AVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVEL  1628
             AV WGN H ++AQ IG A S ++QEEL+M+YVYDYMFHLL+EYAKLLKYKP+VPP+A+EL
Sbjct  363   AVHWGNTHQEEAQAIGKAASDFVQEELQMKYVYDYMFHLLTEYAKLLKYKPSVPPKAIEL  422

Query  1629  CSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPAT  1754
             CSE M C A+GL K++M++S+V  +PS  APCT+PPP+DP T
Sbjct  423   CSELMACPADGLVKKYMVDSVV-TSPSEAAPCTVPPPYDPPT  463



>ref|XP_007040188.1| Glycosyltransferase isoform 2 [Theobroma cacao]
 gb|EOY24689.1| Glycosyltransferase isoform 2 [Theobroma cacao]
Length=492

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/496 (55%), Positives = 354/496 (71%), Gaps = 42/496 (8%)
 Frame = +3

Query  291   GARLYRHFTDTN-WRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLS  467
             G+ L RH  +   WRP   +K  P ++ A+ F  VL V AF S+  +D+ +         
Sbjct  4     GSGLARHVLEMPFWRP--PLKRKPATTAALLFLTVLLVAAFTSSSWIDTKI---------  52

Query  468   HQKIIENEIPPLNCSLRTPMASCPANY---YPSSKLTRTRTRIQDspsptptqsssKCPD  638
                    EIP    S +    +CP NY   + +  L  +   +              CPD
Sbjct  53    -------EIPLGCTSSKNQTQTCPTNYPKTFQTEDLDPSSNHV--------------CPD  91

Query  639   YFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGI  818
             YFRWI++DL  W+ SGI+R+MV  A RTA FRLVI+ G AY  NYRK+ Q+RD FT+WG+
Sbjct  92    YFRWIHEDLRPWKTSGITRDMVERANRTATFRLVIIGGKAYVENYRKAIQTRDVFTIWGV  151

Query  819   LQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDW  998
             LQLLR+YPG++PDL++MFDT D PV++ + Y      T PP LFRYCGD+ T DIVFPDW
Sbjct  152   LQLLRKYPGRLPDLEIMFDTEDKPVVRSRDY-RGPNATGPPPLFRYCGDKETLDIVFPDW  210

Query  999   SFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQ  1178
             SFWGW EINIKPW  + K++++GN + KW+DREPYAYWKGNP V   R+DLLKCNVS++Q
Sbjct  211   SFWGWAEINIKPWHSILKDVRQGNNQTKWIDREPYAYWKGNPFVDGKRQDLLKCNVSDQQ  270

Query  1179  DWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKP  1358
             DW AR++ QDWI E +QG++QSN+ADQC +RYKIYIEG AWSVSEKYILACDS+TL+V+P
Sbjct  271   DWNARLFIQDWILEGQQGFKQSNVADQCTYRYKIYIEGYAWSVSEKYILACDSVTLIVQP  330

Query  1359  HYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKME  1538
              YYDF+ R + P++HYWPIRDDDKC+S+K AVDWGNNH ++AQEIG A S +++E+LKM+
Sbjct  331   QYYDFFMRSMQPVEHYWPIRDDDKCRSLKFAVDWGNNHKKKAQEIGKAASSFMEEQLKMD  390

Query  1539  YVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLE---KQFMMESLVKAAPS  1709
             Y+YDYM+HLL+EYAKLLK++P +P  AVELCSE M C A G+E   K+FMMESLVK  PS
Sbjct  391   YIYDYMYHLLNEYAKLLKFEPRIPEGAVELCSEVMACHAEGIEGRKKKFMMESLVK-GPS  449

Query  1710  TTAPCTMPPPFDPATL  1757
              ++PCT+ PP++P  L
Sbjct  450   VSSPCTL-PPYEPQAL  464



>gb|KFK34190.1| hypothetical protein AALP_AA5G112800 [Arabis alpina]
Length=553

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/507 (56%), Positives = 364/507 (72%), Gaps = 30/507 (6%)
 Frame = +3

Query  303   YRHFTDTNWRPLPAIKTLP--RSSLAVFFFMVLCVGAFVSTRLL-DSTVTAQHPTR--LS  467
             YRHF DT   PL    T+   RS      F+ L +GAF+STRLL D +V  +  T     
Sbjct  25    YRHF-DTILSPLVKTSTVASNRSYAFFSLFLFLLLGAFLSTRLLLDPSVLIEKETAKVTE  83

Query  468   HQKIIENEIPP--------------LNCS--LRTPMASCPANYYPSSKLTRTRTRIQDsp  599
              QKI E+   P              LNC+        +CP N YP+S  +  R       
Sbjct  84    SQKITESPKYPQATKLITEKPKEFTLNCADFSGNGTVTCPRNNYPTSFRSSVR------E  137

Query  600   sptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRK  779
               +    S+ CPDYFRWI++DL  W ++GI+RE +  A  TANFRL I++G  Y   +R+
Sbjct  138   DNSSHSPSATCPDYFRWIHEDLRPWEKTGITREALERANATANFRLAIIDGRIYVEKFRE  197

Query  780   SFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYV-LNDTTTAPPALFRY  956
             +FQ+RD FT+WG +QLL+RYPGK+PDL++MFD VDWPV+K   +  ++ +T +PP LFRY
Sbjct  198   AFQTRDVFTIWGFVQLLQRYPGKIPDLEIMFDCVDWPVVKAAEFAGVDQSTPSPPPLFRY  257

Query  957   CGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA  1136
             CG+  T DIVFPDWS+WGW E+NIKPWE L KEL+EGN K KW+DREPYAYWKGNP VA 
Sbjct  258   CGNNETLDIVFPDWSYWGWAEVNIKPWESLLKELREGNQKTKWIDREPYAYWKGNPTVAE  317

Query  1137  TRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEK  1316
             TR DL+KCNVSE+ DW AR+Y QDW++E K+GY++S LA+QC HRYKIYIEGSAWSVSEK
Sbjct  318   TRLDLMKCNVSEEYDWKARLYKQDWVKESKEGYKESALANQCHHRYKIYIEGSAWSVSEK  377

Query  1317  YILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIG  1496
             YILACDS+TL+VKPHYYDF+TRG+ P  HYWP+++DDKC+SIK AVDWGN H  +AQ+IG
Sbjct  378   YILACDSVTLMVKPHYYDFFTRGMFPGHHYWPVKEDDKCRSIKFAVDWGNLHMLKAQDIG  437

Query  1497  MAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQF  1676
                S+++Q+ELKMEYVYDYM+HLL++Y+KLL++KP +P  A ELCSE M C  +G E++F
Sbjct  438   KKASEFVQQELKMEYVYDYMYHLLTQYSKLLRFKPEIPQNATELCSEAMACPRDGNEQKF  497

Query  1677  MMESLVKAAPSTTAPCTMPPPFDPATL  1757
             MMESLVK  P+ T PCTMPPP+DPA+ 
Sbjct  498   MMESLVK-HPAETGPCTMPPPYDPASF  523



>ref|XP_010255435.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Nelumbo 
nucifera]
Length=380

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/353 (75%), Positives = 296/353 (84%), Gaps = 2/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MV  A++TANFRLVIV G AY   Y+++FQSRD FTLWGILQLLRRYPGK+PDL+LMFD 
Sbjct  1     MVERAKKTANFRLVIVRGRAYIEKYKRAFQSRDVFTLWGILQLLRRYPGKLPDLELMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPVIK Q Y      TAPP LFRYCGD  T DIVFPDWSFWGWPEINIKPWE L KEL
Sbjct  61    VDWPVIKSQ-YYRGPNATAPPPLFRYCGDHRTLDIVFPDWSFWGWPEINIKPWESLLKEL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             +EGN + KW+ REPYAYWKGNP VAATR+DLLKCNVS + DW AR+YAQDWIQE  QGY+
Sbjct  120   REGNGRTKWMQREPYAYWKGNPAVAATRQDLLKCNVSHQHDWNARLYAQDWIQELHQGYK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             QS+LA QC HRYKIYIEGSAWSVSEKYILACDS+TL+VKP YYDF++R L+P+ HYWPIR
Sbjct  180   QSDLAKQCSHRYKIYIEGSAWSVSEKYILACDSVTLIVKPQYYDFFSRSLVPVHHYWPIR  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             DDDKC+SIK AVDWGN+H Q+AQ IG A S  +QEELKM+YVYDYMFHLLSEYAKLL YK
Sbjct  240   DDDKCRSIKFAVDWGNSHKQKAQAIGKAASNLVQEELKMDYVYDYMFHLLSEYAKLLTYK  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             PTVPP+AVELCSE M C A+GL K+ MMES+VK +P+ T PC +P PFDP  L
Sbjct  300   PTVPPQAVELCSETMACHADGLTKKLMMESMVK-SPTYTKPCALPTPFDPLAL  351



>ref|XP_006476586.1| PREDICTED: O-glucosyltransferase rumi-like isoform X1 [Citrus 
sinensis]
Length=537

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/421 (65%), Positives = 322/421 (76%), Gaps = 11/421 (3%)
 Frame = +3

Query  498   PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWR  677
             PLNC ++    +CP NY    K ++T+  I D   P  +     CPDYFRWI++DL  W+
Sbjct  99    PLNC-VKNQTQTCPTNY---PKTSQTQESISDYSIPPTST----CPDYFRWIHEDLSPWK  150

Query  678   ESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPD  857
              +GI+R+M+  A +TA+FRL++VN   Y H Y++S Q+RD FT+WGILQLLR+YPG++PD
Sbjct  151   VTGITRDMLERANQTAHFRLILVNNKVYIHKYKQSIQTRDVFTIWGILQLLRKYPGRLPD  210

Query  858   LDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPW  1037
             L+LMFD  D PVI+ + Y        PP LFRY GD  T DIVFPDWSFWGW EINIKPW
Sbjct  211   LELMFDCDDRPVIRSRDYS-GPNNKGPPPLFRYSGDRWTMDIVFPDWSFWGWAEINIKPW  269

Query  1038  EGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQ  1217
             E L +ELKEGN    WVDREPYAYWKGNP VA TR+DLL CN+S+K DW AR+Y QDWI 
Sbjct  270   ESLLRELKEGNNGRNWVDREPYAYWKGNPFVAETRRDLLTCNLSDKHDWNARLYVQDWIL  329

Query  1218  EHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPM  1397
             E KQG+QQSNLA QC HRYKIYIEG AWSVSEKYILACDS TL+VKP+++DF+ R L P+
Sbjct  330   ESKQGFQQSNLASQCAHRYKIYIEGYAWSVSEKYILACDSTTLIVKPYFHDFFIRYLQPL  389

Query  1398  KHYWPIRDDDKCKSIKHAVDWGNNHHQ-QAQEIGMAGSKYIQEELKMEYVYDYMFHLLSE  1574
             +HYWPIRD DKCKSIK AVDWGN H Q QAQEIG A S +IQEELKMEYVYDYMFHLL+E
Sbjct  390   RHYWPIRDKDKCKSIKFAVDWGNTHKQKQAQEIGRAASNFIQEELKMEYVYDYMFHLLNE  449

Query  1575  YAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPAT  1754
             YAKLLK+KP  P  AVE+CSE M C ANG  K+FMMESLVK  PS T+PCT+PPP++P  
Sbjct  450   YAKLLKFKPVAPDGAVEVCSETMACTANGSHKKFMMESLVK-GPSITSPCTLPPPYEPKV  508

Query  1755  L  1757
             L
Sbjct  509   L  509



>emb|CDP09762.1| unnamed protein product [Coffea canephora]
Length=508

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/487 (57%), Positives = 348/487 (71%), Gaps = 29/487 (6%)
 Frame = +3

Query  345   IKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTA-----------QHPTRLSHQKIIENE  491
             +K  PR+S  +   + L V  ++S+  ++ST  A             P R S ++ IE  
Sbjct  1     MKKGPRTSATIMVLLFLLVAVWISSSWINSTTLAVSNERKQQMIVSTPQRNSAKRKIEVS  60

Query  492   IPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWA  671
                LNCSL     +CP+NY  +   T + T            S+  CPDYFRWI++DL  
Sbjct  61    ---LNCSLGNLTQTCPSNYPTTFGFTESET--------DDGLSNVTCPDYFRWIHEDLKP  109

Query  672   WRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKV  851
             ++ SGI+R+MV  A+ TA+FRLVIV G  Y   Y+KS Q+RD FTLWGILQLLRRYPG++
Sbjct  110   FKSSGITRDMVERAKGTAHFRLVIVKGKVYVEKYKKSIQTRDVFTLWGILQLLRRYPGRL  169

Query  852   PDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGW-----P  1016
             PDL+LMFD  D PVI+  S+       APP LFRYCGD  T DIVFPDWSFWGW      
Sbjct  170   PDLELMFDCDDRPVIQSSSH-RGPNAKAPPPLFRYCGDPWTLDIVFPDWSFWGWQNGCRA  228

Query  1017  EINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARV  1196
             EINIKPWE + KELK+GN +IKW+ REPYAYWKGNP VA TRKDLLKCN S+K+DW AR+
Sbjct  229   EINIKPWENILKELKDGNNRIKWMKREPYAYWKGNPFVADTRKDLLKCNASDKEDWNARL  288

Query  1197  YAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFY  1376
             + QDWI+E++QGY+QS+LA QC +RYKIYIEG AWSVSEKYILACDS TLLV  ++YDF+
Sbjct  289   FIQDWIREYEQGYKQSDLASQCTYRYKIYIEGYAWSVSEKYILACDSPTLLVNTNFYDFF  348

Query  1377  TRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYM  1556
              R + P+ HYWPIR+DDKC+S+K AVDWGN+H Q+AQ IG A S +IQEELKME+VYDYM
Sbjct  349   LRSMQPVHHYWPIRNDDKCRSLKFAVDWGNSHKQKAQAIGKAASDFIQEELKMEFVYDYM  408

Query  1557  FHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPP  1736
             FHLL EYAKL +++P +P  A+E+CSE M C +NG EK+FM+ESLVK +PS   PCT+PP
Sbjct  409   FHLLYEYAKLSRFEPKIPEGAMEICSETMACHSNGTEKKFMLESLVK-SPSDNTPCTLPP  467

Query  1737  PFDPATL  1757
             P++P  L
Sbjct  468   PYEPRVL  474



>ref|XP_007040189.1| Glycosyltransferase isoform 3 [Theobroma cacao]
 gb|EOY24690.1| Glycosyltransferase isoform 3 [Theobroma cacao]
Length=493

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/497 (55%), Positives = 354/497 (71%), Gaps = 43/497 (9%)
 Frame = +3

Query  291   GARLYRHFTDTN-WRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLS  467
             G+ L RH  +   WRP   +K  P ++ A+ F  VL V AF S+  +D+ +         
Sbjct  4     GSGLARHVLEMPFWRP--PLKRKPATTAALLFLTVLLVAAFTSSSWIDTKI---------  52

Query  468   HQKIIENEIPPLNCSLRTPMASCPANY---YPSSKLTRTRTRIQDspsptptqsssKCPD  638
                    EIP    S +    +CP NY   + +  L  +   +              CPD
Sbjct  53    -------EIPLGCTSSKNQTQTCPTNYPKTFQTEDLDPSSNHV--------------CPD  91

Query  639   YFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGI  818
             YFRWI++DL  W+ SGI+R+MV  A RTA FRLVI+ G AY  NYRK+ Q+RD FT+WG+
Sbjct  92    YFRWIHEDLRPWKTSGITRDMVERANRTATFRLVIIGGKAYVENYRKAIQTRDVFTIWGV  151

Query  819   LQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDW  998
             LQLLR+YPG++PDL++MFDT D PV++ + Y      T PP LFRYCGD+ T DIVFPDW
Sbjct  152   LQLLRKYPGRLPDLEIMFDTEDKPVVRSRDY-RGPNATGPPPLFRYCGDKETLDIVFPDW  210

Query  999   SFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQ  1178
             SFWGW EINIKPW  + K++++GN + KW+DREPYAYWKGNP V   R+DLLKCNVS++Q
Sbjct  211   SFWGWAEINIKPWHSILKDVRQGNNQTKWIDREPYAYWKGNPFVDGKRQDLLKCNVSDQQ  270

Query  1179  DWGARVY-AQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVK  1355
             DW AR++  QDWI E +QG++QSN+ADQC +RYKIYIEG AWSVSEKYILACDS+TL+V+
Sbjct  271   DWNARLFIQQDWILEGQQGFKQSNVADQCTYRYKIYIEGYAWSVSEKYILACDSVTLIVQ  330

Query  1356  PHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKM  1535
             P YYDF+ R + P++HYWPIRDDDKC+S+K AVDWGNNH ++AQEIG A S +++E+LKM
Sbjct  331   PQYYDFFMRSMQPVEHYWPIRDDDKCRSLKFAVDWGNNHKKKAQEIGKAASSFMEEQLKM  390

Query  1536  EYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLE---KQFMMESLVKAAP  1706
             +Y+YDYM+HLL+EYAKLLK++P +P  AVELCSE M C A G+E   K+FMMESLVK  P
Sbjct  391   DYIYDYMYHLLNEYAKLLKFEPRIPEGAVELCSEVMACHAEGIEGRKKKFMMESLVK-GP  449

Query  1707  STTAPCTMPPPFDPATL  1757
             S ++PCT+ PP++P  L
Sbjct  450   SVSSPCTL-PPYEPQAL  465



>ref|XP_002875936.1| hypothetical protein ARALYDRAFT_485256 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52195.1| hypothetical protein ARALYDRAFT_485256 [Arabidopsis lyrata subsp. 
lyrata]
Length=539

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/421 (61%), Positives = 320/421 (76%), Gaps = 10/421 (2%)
 Frame = +3

Query  501   LNCS--LRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAW  674
             LNC+        +CP N YP+S  +       D            CPDYFRWI++DL  W
Sbjct  97    LNCAGFAGNDTVTCPKNNYPTSFRSSVGEGESDRSLSAT------CPDYFRWIHEDLRPW  150

Query  675   RESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVP  854
              ++GI+RE +  A  TANFRL I+NG  Y   +R++FQ+RD FT+WG +QLLRRYPGK+P
Sbjct  151   EKTGITREALERANATANFRLAIINGRIYVEKFREAFQTRDVFTIWGFVQLLRRYPGKIP  210

Query  855   DLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKP  1034
             DL+LMFD VDWPV+K   +   D    PP LFRYC ++ T DIVFPDWS+WGW E+NIKP
Sbjct  211   DLELMFDCVDWPVVKAAEFAGVDQP-PPPPLFRYCANDETLDIVFPDWSYWGWAEVNIKP  269

Query  1035  WEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWI  1214
             WE L KEL+EGN + KW+DREPYAYWKGNP VA TR DL+KCN+SE+ DW AR+Y QDW+
Sbjct  270   WESLLKELREGNQRTKWIDREPYAYWKGNPTVAETRLDLMKCNLSEEYDWKARLYKQDWV  329

Query  1215  QEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMP  1394
             +E K+GY+QS+LA QC HRYKIYIEGSAWSVSEKYILACDS+TLLVKPHYYDF+TRG+ P
Sbjct  330   KESKEGYKQSDLASQCHHRYKIYIEGSAWSVSEKYILACDSVTLLVKPHYYDFFTRGMFP  389

Query  1395  MKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSE  1574
               HYWP+++DDKC+SIK AVDWGN H ++AQ+IG   S+++Q+ELKM+YVYDYMFHLL +
Sbjct  390   GHHYWPVKEDDKCRSIKFAVDWGNLHMRKAQDIGKKASEFVQQELKMDYVYDYMFHLLIQ  449

Query  1575  YAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPAT  1754
             Y+KLL++KP +P  + ELCSE M C  +G E++FMMESLVK  P+ T PC MPPP+DPA+
Sbjct  450   YSKLLRFKPEIPQNSTELCSEAMACPRDGNERKFMMESLVK-HPAETGPCAMPPPYDPAS  508

Query  1755  L  1757
              
Sbjct  509   F  509



>ref|XP_009149777.1| PREDICTED: O-glucosyltransferase rumi homolog [Brassica rapa]
Length=547

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/452 (58%), Positives = 334/452 (74%), Gaps = 13/452 (3%)
 Frame = +3

Query  417   TRLLDSTVTAQHPTRLSHQKIIENEIPP---LNCSLRTPMAS--CPANYYPSSKLTRTRT  581
             T L+  T+ A    +      +  E P    LNC   +  A+  CP + YP+S L  +R 
Sbjct  74    TALVTETLKAGESPKYPQSTKLITEKPKEFKLNCPAFSDNATVTCPRDNYPTSLLPGSR-  132

Query  582   RIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAY  761
                     +     + CPDYFRWI++DL  W ++GI+RE +  A  TANFRL I++G  Y
Sbjct  133   -----KDDSGRSPPATCPDYFRWIHEDLRPWEKTGITREALERANATANFRLAIIDGRIY  187

Query  762   YHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPP  941
                 R++FQ+RD FT+WG +QLLRRYPGK+PDL+LMFD VDWPV+K  ++   +  T PP
Sbjct  188   VEKLREAFQTRDVFTIWGFVQLLRRYPGKIPDLELMFDCVDWPVVKAAAFGGFEQLTPPP  247

Query  942   ALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGN  1121
              LFRYCG+  T DIVFPDWS+WGW E+NIKPWE L KELKEGN + KWVDREPYAYWKGN
Sbjct  248   -LFRYCGNNETLDIVFPDWSYWGWAEVNIKPWESLLKELKEGNQRSKWVDREPYAYWKGN  306

Query  1122  PEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAW  1301
             P VA TR DL+KCNVSE  DW AR+Y QDW +E K+GY+QS+LA QC HRYKIYIEGSAW
Sbjct  307   PTVADTRLDLMKCNVSEGHDWKARLYQQDWARESKEGYKQSDLASQCHHRYKIYIEGSAW  366

Query  1302  SVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQ  1481
             SVSEKYILACDS+TLLV PHYYDF+TRG++P +HYWP+++DDKC+SIK AVDWGN H  +
Sbjct  367   SVSEKYILACDSVTLLVNPHYYDFFTRGMLPGQHYWPVKEDDKCRSIKFAVDWGNQHKLK  426

Query  1482  AQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANG  1661
             AQ+IG   S+++Q+ELKM+YVYDYM+HLL++Y+KLL++KP +P  + ELCSE M C  +G
Sbjct  427   AQDIGKKASEFVQQELKMDYVYDYMYHLLTQYSKLLRFKPEIPKNSTELCSETMACPRDG  486

Query  1662  LEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              E++FMMESLV   P+ T PCTMPPP+DPA+ 
Sbjct  487   NERKFMMESLV-THPAETGPCTMPPPYDPASF  517



>ref|XP_006842991.1| hypothetical protein AMTR_s00076p00109920 [Amborella trichopoda]
 gb|ERN04666.1| hypothetical protein AMTR_s00076p00109920 [Amborella trichopoda]
Length=496

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/478 (59%), Positives = 344/478 (72%), Gaps = 31/478 (6%)
 Frame = +3

Query  363   SSLAVFFFMVLCVGAFVSTRLLD-STVTAQHPTRLSHQKIIENEIPP-----------LN  506
             S  ++ F + L +GA +S R +D ST++A+    L+ +        P           LN
Sbjct  10    SRTSLLFLLALFIGAIISARWIDVSTLSAKGAKELAARSKPSVYKSPQKPRPPLPERPLN  69

Query  507   CS-LRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRES  683
             C+ + T  +S P   +PS         IQ+   PT T     CPDYFRWI++DL  W+ +
Sbjct  70    CTPINTNCSSLPWPPFPS---------IQNLDPPTST-----CPDYFRWIHEDLKPWKGT  115

Query  684   GISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLD  863
             GI++EMV  ARRTA FRL++++G  Y   Y K++Q RD FT+WG+LQL RRY G+VPDLD
Sbjct  116   GITQEMVERARRTATFRLLVIDGKVYVERYAKAYQCRDDFTIWGMLQLFRRYSGRVPDLD  175

Query  864   LMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEG  1043
             LMFD VDWPV+K+  Y        PP LFRYCGD+ + DIVFPDWSFWGWPEINI+PWE 
Sbjct  176   LMFDCVDWPVVKRWDY---RGRVVPPPLFRYCGDKDSLDIVFPDWSFWGWPEINIEPWEA  232

Query  1044  LSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEH  1223
             L K+L +GN KIKW++R+P AYWKGNP VA TRKDLLKCNV+E QDW ARVY QDWI+E 
Sbjct  233   LLKDLDDGNKKIKWMNRDPTAYWKGNPYVADTRKDLLKCNVTETQDWNARVYVQDWIKES  292

Query  1224  KQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKH  1403
             +QGY++SNLA+QC HRYKIYIEGSAWSVSEKYILACDS TLLV PHYYDF TR LMP  H
Sbjct  293   QQGYKESNLANQCTHRYKIYIEGSAWSVSEKYILACDSPTLLVTPHYYDFVTRALMPTHH  352

Query  1404  YWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAK  1583
             YWPI+ DDKC+SIK+AVDWGN+H Q+AQ IG   S +I E++KM YVYDYMFHLLSEY+K
Sbjct  353   YWPIKGDDKCRSIKYAVDWGNSHKQKAQAIGKTASSFILEDVKMAYVYDYMFHLLSEYSK  412

Query  1584  LLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             LL+YKPTVP +AV+ CSE M C A G  ++FM ES VK  PS + PC +PPPF+P  L
Sbjct  413   LLRYKPTVPEKAVQYCSESMACPAKGNYEKFMKESFVK-VPSDSEPCILPPPFEPPAL  469



>emb|CDY08097.1| BnaA06g16290D [Brassica napus]
Length=547

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/421 (61%), Positives = 324/421 (77%), Gaps = 10/421 (2%)
 Frame = +3

Query  501   LNCSLRTPMAS--CPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAW  674
             LNC   +  A+  CP + YP+S L  +R         +     + CPDYFRWI++DL  W
Sbjct  105   LNCPAFSDNATVTCPRDNYPTSLLPGSR------EDDSGRSPPATCPDYFRWIHEDLRPW  158

Query  675   RESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVP  854
              ++GI+RE +  A  TANFRL I++G  Y    R++FQ+RD FT+WG +QLLRRYPGK+P
Sbjct  159   EKTGITREALERANATANFRLAIIDGRIYVEKLREAFQTRDVFTIWGFVQLLRRYPGKIP  218

Query  855   DLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKP  1034
             DL+LMFD VDWPV+K  ++   +  T PP LFRYCG+  T DIVFPDWS+WGW E+NIKP
Sbjct  219   DLELMFDCVDWPVVKAAAFGGFEQLTPPP-LFRYCGNNETLDIVFPDWSYWGWAEVNIKP  277

Query  1035  WEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWI  1214
             WE L KELKEGN + KWVDREPYAYWKGNP VA TR DL+KCNVSE  DW AR+Y QDW 
Sbjct  278   WESLLKELKEGNQRSKWVDREPYAYWKGNPTVADTRLDLMKCNVSEGHDWKARLYQQDWA  337

Query  1215  QEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMP  1394
             +E K+GY+QS+LA QC HRYKIYIEGSAWSVSEKYILACDS+TLLV PHYYDF+TRG++P
Sbjct  338   RESKEGYKQSDLASQCHHRYKIYIEGSAWSVSEKYILACDSVTLLVNPHYYDFFTRGMLP  397

Query  1395  MKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSE  1574
              +HYWP+++DDKC+SIK AVDWGN H  +AQ+IG   S+++Q+ELKM+YVYDYM+HLL++
Sbjct  398   GQHYWPVKEDDKCRSIKFAVDWGNQHKLKAQDIGKKASEFVQQELKMDYVYDYMYHLLTQ  457

Query  1575  YAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPAT  1754
             Y+KLL++KP +P  + ELCSE M C  +G E++FMMESLV   P+ T PCTMPPP+DPA+
Sbjct  458   YSKLLRFKPEIPKNSTELCSETMACPRDGNERKFMMESLV-THPAETGPCTMPPPYDPAS  516

Query  1755  L  1757
              
Sbjct  517   F  517



>ref|XP_010426402.1| PREDICTED: protein O-glucosyltransferase 1-like [Camelina sativa]
Length=548

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/460 (57%), Positives = 339/460 (74%), Gaps = 14/460 (3%)
 Frame = +3

Query  390   VLCVGAFVSTRLLDSTVTAQHP--TRLSHQKIIENEIPPLNCSLRT--PMASCPANYYPS  557
             VL     V+    ++T + ++P  T+L  +K   N+   LNC+  +     +CP N YP+
Sbjct  69    VLIEKETVTVTQREATQSPKYPQSTKLITEK--PNKDFTLNCAAFSGNDTVTCPRNSYPT  126

Query  558   SKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRL  737
             S  +       D            CPDYFRWI++DL  W ++GI+RE +  A  TA FRL
Sbjct  127   SFRSNVGEDESDRSPSAT------CPDYFRWIHEDLRPWEKTGITREALERANATAIFRL  180

Query  738   VIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVL  917
              I++G  Y  N+R++FQ+RD FT+WG +QLLRRYPGK+PDL+LMFD VDWPV+K   Y  
Sbjct  181   AIIDGRIYVENFREAFQTRDVFTIWGFVQLLRRYPGKIPDLELMFDCVDWPVVKAAEYSG  240

Query  918   NDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDRE  1097
              D   +PP LFRYC +  T DIVFPDWS+WGW E+NIKPWE L K+L EGN + KW+DRE
Sbjct  241   VDQP-SPPPLFRYCANNETLDIVFPDWSYWGWAEVNIKPWESLLKDLNEGNQRTKWIDRE  299

Query  1098  PYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYK  1277
             PYAYWKGNP VA TR DL+KCN+SE+ DW AR+Y QDW++E K+GY+ S+LA QC HRYK
Sbjct  300   PYAYWKGNPTVADTRLDLMKCNLSEEYDWKARLYKQDWVKESKEGYKTSDLASQCHHRYK  359

Query  1278  IYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVD  1457
             IYIEGSAWSVSEKYILACDS+TL+VKPHYYDF+TRG+ P  HYWP+++DDKC+SIK AVD
Sbjct  360   IYIEGSAWSVSEKYILACDSVTLMVKPHYYDFFTRGMFPGHHYWPVKEDDKCRSIKFAVD  419

Query  1458  WGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSE  1637
             WGN H ++AQ+IG   S+++Q+ELKM+YVYDYMFHLL++Y+KLL++KP +P  + ELCSE
Sbjct  420   WGNLHMRKAQDIGRKASEFVQQELKMDYVYDYMFHLLTQYSKLLRFKPEIPRNSTELCSE  479

Query  1638  KMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              M C  NG E++FMMESLVK  P+ T PCTMPPP+DPA+ 
Sbjct  480   AMACPRNGNERKFMMESLVK-HPAETGPCTMPPPYDPASF  518



>ref|XP_004298753.1| PREDICTED: O-glucosyltransferase rumi homolog [Fragaria vesca 
subsp. vesca]
Length=511

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/493 (56%), Positives = 353/493 (72%), Gaps = 19/493 (4%)
 Frame = +3

Query  291   GARLYR--HFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRL  464
             G+RL R  H      R    IK  P ++  +FF   L + A +S+  +  +   Q     
Sbjct  4     GSRLVRPLHLQGAKKRLASLIKRPPANT--IFFLGFLIIAAILSSFWIHLSSANQTEVIT  61

Query  465   SHQKIIENEIP-PLNCSLR-TPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPD  638
                +I    +  PLNCS+      SCP NY  +    R               S++ CPD
Sbjct  62    DKHEISPKVVEFPLNCSIGINQTQSCPTNYPIAFSTDRLDA-----------SSNTTCPD  110

Query  639   YFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGI  818
             YFR+I++DL  WR +GI+R+MV +A++TA+FRLVIV+G AY   Y+KS Q+RD FT+WGI
Sbjct  111   YFRFIHEDLKPWRGTGITRDMVENAKKTAHFRLVIVDGKAYVEKYKKSIQTRDVFTIWGI  170

Query  819   LQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDW  998
             LQLLRRYPGKVPDL+LMFD  D PVI+ + Y   ++T  PP LFRYCGD  T DIVFPDW
Sbjct  171   LQLLRRYPGKVPDLELMFDCDDIPVIRSRDYRGQNSTQVPP-LFRYCGDRWTKDIVFPDW  229

Query  999   SFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQ  1178
             SFWGW EINIKPW  L K++K+GN + KW++REPYAYWKGNP VA TR+DLLKCNVS+ Q
Sbjct  230   SFWGWAEINIKPWGSLLKDVKKGNERSKWMEREPYAYWKGNPFVAETRRDLLKCNVSDTQ  289

Query  1179  DWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKP  1358
             +W AR++ QDWI E +QG++QS++A+QC HRYKIYIEG AWSVSEKYILACDS+TLLVKP
Sbjct  290   EWNARLFIQDWILESQQGFKQSDVANQCTHRYKIYIEGYAWSVSEKYILACDSVTLLVKP  349

Query  1359  HYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKME  1538
             +YYDF+TR L P+ HYWPIR+ +KCKSIK AVDWGNNH Q+AQ IG A S +IQ+ELKM+
Sbjct  350   NYYDFFTRSLRPVHHYWPIRNGNKCKSIKFAVDWGNNHKQKAQAIGKAASNFIQQELKMD  409

Query  1539  YVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTA  1718
             YVYDYMFHLLSEYAKL K++P +P  A  LC+E + C A+  +K+FM ESL+K +PS T+
Sbjct  410   YVYDYMFHLLSEYAKLSKFEPRIPEGATHLCAETLACPADESQKKFMTESLMK-SPSMTS  468

Query  1719  PCTMPPPFDPATL  1757
             PC +PPP++P  L
Sbjct  469   PCIVPPPYEPQDL  481



>ref|XP_010503544.1| PREDICTED: protein O-glucosyltransferase 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010503545.1| PREDICTED: protein O-glucosyltransferase 1-like isoform X2 [Camelina 
sativa]
Length=548

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/421 (61%), Positives = 321/421 (76%), Gaps = 10/421 (2%)
 Frame = +3

Query  501   LNCSLRTP--MASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAW  674
             LNC+  +     SCP N YP+S  +       D            CPDYFRWI++DL  W
Sbjct  106   LNCAAFSGNGTVSCPRNSYPTSFRSNAGEDESDRSPSAT------CPDYFRWIHEDLRPW  159

Query  675   RESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVP  854
              ++GI+RE +  A  TA FRL I++G  Y  N+R++FQ+RD FT+WG +QLLRRYPGK+P
Sbjct  160   EKTGITREALERANATAIFRLAIIDGRIYVENFREAFQTRDVFTIWGFVQLLRRYPGKIP  219

Query  855   DLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKP  1034
             DL+LMFD VDWPV+K   Y   D  + PP LFRYC +  T DIVFPDWS+WGW E+NIKP
Sbjct  220   DLELMFDCVDWPVVKAAEYSGVDQPSPPP-LFRYCANNETLDIVFPDWSYWGWAEVNIKP  278

Query  1035  WEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWI  1214
             WE L K+L EGN + KW+DREPYAYWKGNP VA TR DL+KCN+SE+ DW AR+Y QDW+
Sbjct  279   WESLLKDLNEGNQRTKWIDREPYAYWKGNPTVAETRLDLMKCNLSEQYDWKARLYKQDWV  338

Query  1215  QEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMP  1394
             +E K+GY+ S+LA QC HRYKIYIEGSAWSVSEKYILACDS+TL+VKPHYYDF+TRG+ P
Sbjct  339   KESKEGYKTSDLASQCHHRYKIYIEGSAWSVSEKYILACDSVTLMVKPHYYDFFTRGMFP  398

Query  1395  MKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSE  1574
               HYWP+++DDKC+SIK AVDWGN H ++AQ+IG   S+++Q+ELKM+YVYDYMFHLL++
Sbjct  399   GHHYWPVKEDDKCRSIKFAVDWGNLHMRKAQDIGRKASEFVQQELKMDYVYDYMFHLLTQ  458

Query  1575  YAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPAT  1754
             Y+KLL++KP +P  + ELCSE M C  +G E++FMMESLVK  P+ T PCTMPPP+DPA+
Sbjct  459   YSKLLRFKPEIPQNSTELCSEAMACPRDGNERKFMMESLVK-HPAETGPCTMPPPYDPAS  517

Query  1755  L  1757
              
Sbjct  518   F  518



>ref|XP_010515234.1| PREDICTED: O-glucosyltransferase rumi homolog [Camelina sativa]
Length=548

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/460 (57%), Positives = 339/460 (74%), Gaps = 14/460 (3%)
 Frame = +3

Query  390   VLCVGAFVSTRLLDSTVTAQHP--TRLSHQKIIENEIPPLNCSLRTP--MASCPANYYPS  557
             VL     V+    ++T + ++P  T+L  +K I+     LNC+  +     +CP N YP+
Sbjct  69    VLIEKETVTVTQREATESPKYPQSTKLITEKPIKEFT--LNCAAFSGNGTVTCPRNSYPT  126

Query  558   SKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRL  737
             S  +       D            CPDYFRWI++DL  W ++GI+RE +  A  TA FRL
Sbjct  127   SYRSNAGEDESDRSPSAT------CPDYFRWIHEDLRPWEKTGITREALERANATAIFRL  180

Query  738   VIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVL  917
              I++G  Y   +R++FQ+RD FT+WG +QLLRRYPGK+PDL+LMFD VDWPV+K   Y  
Sbjct  181   AIIDGRIYVEKFREAFQTRDVFTIWGFVQLLRRYPGKIPDLELMFDCVDWPVVKAAEYAG  240

Query  918   NDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDRE  1097
              D  + PP LFRYC +  T DIVFPDWS+WGW E+NIKPWE L K+L EGN + KW+DRE
Sbjct  241   VDQPSPPP-LFRYCANNETLDIVFPDWSYWGWAEVNIKPWESLLKDLNEGNQRTKWIDRE  299

Query  1098  PYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYK  1277
             PYAYWKGNP VA TR DL+KCN+SE+ DW AR+Y QDW++E K+GY+ S+LA QC HRYK
Sbjct  300   PYAYWKGNPTVAETRLDLMKCNLSEQYDWKARLYKQDWVKESKEGYKTSDLASQCHHRYK  359

Query  1278  IYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVD  1457
             IYIEGSAWSVSEKYILACDS+TL+VKPHYYDF+TRG+ P  HYWP+++DDKC+SIK AVD
Sbjct  360   IYIEGSAWSVSEKYILACDSVTLMVKPHYYDFFTRGMFPGHHYWPVKEDDKCRSIKFAVD  419

Query  1458  WGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSE  1637
             WGN H ++AQ+IG   S+++Q+ELKM+YVYDYMFHLL++Y+KLL++KP +P  ++ELCSE
Sbjct  420   WGNLHMRKAQDIGKKASEFVQQELKMDYVYDYMFHLLTQYSKLLRFKPEIPQNSIELCSE  479

Query  1638  KMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              M C  +G E++FMMESLVK  P+ T PCTMPPP+DPA+ 
Sbjct  480   AMACPRDGNERKFMMESLVK-HPAETGPCTMPPPYDPASF  518



>ref|XP_007209901.1| hypothetical protein PRUPE_ppa004159mg [Prunus persica]
 gb|EMJ11100.1| hypothetical protein PRUPE_ppa004159mg [Prunus persica]
Length=526

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/509 (56%), Positives = 354/509 (70%), Gaps = 35/509 (7%)
 Frame = +3

Query  291   GARLYRHF----TDTNWRPL-----PAIKTLPRSSLAVFFFMVLCVGAF---VSTRLLDS  434
             G+RL R F    T ++W P      PAI     + L +  F++     F   +       
Sbjct  4     GSRLVRPFQFQGTSSDWLPSSITKSPAIAAATNTILFLGLFIISAAILFSYWIQISNFQI  63

Query  435   TVTAQHPTRLSHQ-----KIIENEIPPLNCSLRTPM---ASCPANYYPSSKLTRTRTRIQ  590
               +A     +S++     K+IE    PLNCS+ + +    +CP +Y        T   + 
Sbjct  64    GNSANETILISNKYQEPFKVIEF---PLNCSIGSNINQTQTCPTSY------PTTFGNLD  114

Query  591   DspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHN  770
             D    +       CPDYFR+I+ DL  W+ +GI+R+MV  A+ TA+FRLVIV G AY   
Sbjct  115   DLEPSSSPI----CPDYFRFIHQDLMPWKATGITRDMVERAKETAHFRLVIVKGKAYVEK  170

Query  771   YRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALF  950
             Y+KS Q+RD FT+WGILQLLRRYPG++PDL+LMFD  D PVI+ + +   ++T  PP LF
Sbjct  171   YKKSIQTRDVFTIWGILQLLRRYPGRLPDLELMFDCDDKPVIRSRDFRGPNSTQVPP-LF  229

Query  951   RYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEV  1130
             RYCGD  T DIVFPDWSFWGW EINIKPWEGL K+LK+GN + KW++REPYAYWKGNP V
Sbjct  230   RYCGDRWTKDIVFPDWSFWGWAEINIKPWEGLLKDLKKGNDRRKWMEREPYAYWKGNPFV  289

Query  1131  AATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVS  1310
             A +RKDLLKCNVS+ QDW AR++ QDWI E +QG++QS++A QC HRYKIYIEG AWSVS
Sbjct  290   AESRKDLLKCNVSDSQDWNARLFIQDWILESQQGFKQSDVASQCTHRYKIYIEGYAWSVS  349

Query  1311  EKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQE  1490
             EKYILACDS+TL+VKP YYDF+TR L P+ HYWPIR DDKCKSIK AVDWGNNH Q+AQ 
Sbjct  350   EKYILACDSVTLIVKPQYYDFFTRSLQPVHHYWPIRHDDKCKSIKFAVDWGNNHKQKAQA  409

Query  1491  IGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEK  1670
             IG A S +IQ+ELKM++VYDYMFHLL+EYAKLL+++P +P  A  LCSE M C A   EK
Sbjct  410   IGKAASDFIQQELKMDFVYDYMFHLLNEYAKLLRFEPKIPEGATHLCSESMACPAAESEK  469

Query  1671  QFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +FM ESLVK +PS T+PCTMPP F P  L
Sbjct  470   KFMTESLVK-SPSVTSPCTMPPAFKPQAL  497



>emb|CDY05887.1| BnaC08g20640D [Brassica napus]
Length=547

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/421 (61%), Positives = 323/421 (77%), Gaps = 10/421 (2%)
 Frame = +3

Query  501   LNCSLRTPMAS--CPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAW  674
             LNC   +  A+  CP + YP+S L  +R         +     + CPDYFRWI++DL  W
Sbjct  105   LNCPAFSDNATVTCPRDNYPTSLLPGSR------EDDSGRSPPATCPDYFRWIHEDLRPW  158

Query  675   RESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVP  854
              ++GI+RE +  A  TANFRL I++G  Y    R++FQ+RD FT+WG +QLLRRYPGK+P
Sbjct  159   EKTGITREALERANATANFRLAIIDGRIYVEKLREAFQTRDVFTIWGFVQLLRRYPGKIP  218

Query  855   DLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKP  1034
             DL+LMFD VDWPV+K   +   +  T PP LFRYCG+  T DIVFPDWS+WGW E+NIKP
Sbjct  219   DLELMFDCVDWPVVKAVEFGGVEQLTPPP-LFRYCGNNETLDIVFPDWSYWGWAEVNIKP  277

Query  1035  WEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWI  1214
             WE L KEL+EGN + KWV+REPYAYWKGNP VA TR DL+KCNVSE  DW AR+Y QDW 
Sbjct  278   WESLLKELREGNQRSKWVNREPYAYWKGNPTVADTRLDLMKCNVSEGHDWKARLYQQDWA  337

Query  1215  QEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMP  1394
             +E K+GY+QS+LA QC HRYKIYIEGSAWSVSEKYILACDS+TLLV PHYYDF+TRG++P
Sbjct  338   RESKEGYKQSDLASQCHHRYKIYIEGSAWSVSEKYILACDSVTLLVNPHYYDFFTRGMLP  397

Query  1395  MKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSE  1574
              +HYWP+++DDKC+SIK AVDWGN H  +AQ+IG   S+++Q+ELKM+YVYDYM+HLL++
Sbjct  398   GQHYWPVKEDDKCRSIKFAVDWGNQHKLKAQDIGKKASEFVQQELKMDYVYDYMYHLLTQ  457

Query  1575  YAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPAT  1754
             Y+KLL++KP +P  + ELCSE M C  +G E++FMMESLV   P+ T PCTMPPP+DPA+
Sbjct  458   YSKLLRFKPEIPKNSTELCSETMACPRDGNERKFMMESLV-THPAETGPCTMPPPYDPAS  516

Query  1755  L  1757
              
Sbjct  517   F  517



>ref|XP_008813821.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Phoenix 
dactylifera]
Length=457

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/373 (67%), Positives = 307/373 (82%), Gaps = 6/373 (2%)
 Frame = +3

Query  639   YFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGI  818
             YFRWI++DL  W+ +GI++EMV  AR TA+FRLVI++G  Y   YR+SFQ+RD FTLWGI
Sbjct  70    YFRWIHEDLRPWKSTGITQEMVERARETAHFRLVILHGRVYMERYRRSFQTRDVFTLWGI  129

Query  819   LQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDW  998
             LQLLRRYP ++PDL+LMF+T DWPV++     L     APP LF YC D++  DIVFPDW
Sbjct  130   LQLLRRYPDRIPDLELMFNTHDWPVVQAGRNAL-----APPPLFHYCADDSALDIVFPDW  184

Query  999   SFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQ  1178
             +FWGWPEIN+KPWE L++ELKEGN +++W+DREPYAYWKGNP VAATRKDLLKCNVSE  
Sbjct  185   TFWGWPEINLKPWELLNRELKEGNERVRWMDREPYAYWKGNPAVAATRKDLLKCNVSEAH  244

Query  1179  DWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKP  1358
             DW AR+YA +W +E + GY++S+L  QCIHRYKIYIEG+AWSVSEKYILAC+SLTLLVKP
Sbjct  245   DWNARIYALNWRKETQIGYKESDLGSQCIHRYKIYIEGAAWSVSEKYILACNSLTLLVKP  304

Query  1359  HYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKME  1538
              YYDF+TR LMP++HYWP+R DDKC+SIK AVDWGN+H Q+AQ IG   S +IQE+LKME
Sbjct  305   RYYDFFTRSLMPLQHYWPVRSDDKCRSIKFAVDWGNSHKQKAQAIGKEASNFIQEKLKME  364

Query  1539  YVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTA  1718
             YVYDYM HLL+EY+KLL+YKPT P +A+ELCS+ M C A  LEK+FMMES+VK +P  +A
Sbjct  365   YVYDYMLHLLTEYSKLLRYKPTRPRKAIELCSKSMACPAKALEKKFMMESMVK-SPHDSA  423

Query  1719  PCTMPPPFDPATL  1757
             PC +PPPF P  L
Sbjct  424   PCKLPPPFKPVEL  436



>ref|NP_190467.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB62012.1| putative protein [Arabidopsis thaliana]
 gb|AEE78479.1| uncharacterized protein AT3G48980 [Arabidopsis thaliana]
 gb|AHL38735.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=539

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/460 (57%), Positives = 336/460 (73%), Gaps = 15/460 (3%)
 Frame = +3

Query  390   VLCVGAFVSTRLLDSTVTAQHP--TRLSHQKIIENEIPPLNCSLRT--PMASCPANYYPS  557
             VL     VS    ++T + ++P  T+L  +K  E     LNC+  +     +CP + YP+
Sbjct  61    VLIEKEAVSVTERETTQSPEYPQSTKLITEKPKEFT---LNCAAFSGNDTGTCPKDNYPT  117

Query  558   SKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRL  737
             S  +       D            CPDYFRWI++DL  W ++GI+RE +  A  TA FRL
Sbjct  118   SFRSSAGEGESDRSPSAT------CPDYFRWIHEDLRPWEKTGITREALERANATAIFRL  171

Query  738   VIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVL  917
              I+NG  Y   +R++FQ+RD FT+WG +QLLRRYPGK+PDL+LMFD VDWPV+K   +  
Sbjct  172   AIINGRIYVEKFREAFQTRDVFTIWGFVQLLRRYPGKIPDLELMFDCVDWPVVKAAEFAG  231

Query  918   NDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDRE  1097
              D    PP LFRYC ++ T DIVFPDWS+WGW E+NIKPWE L KEL+EGN + KW+DRE
Sbjct  232   VDQP-PPPPLFRYCANDETLDIVFPDWSYWGWAEVNIKPWESLLKELREGNQRTKWIDRE  290

Query  1098  PYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYK  1277
             PYAYWKGNP VA TR DL+KCN+SE  DW AR+Y QDW++E K+GY+QS+LA QC HRYK
Sbjct  291   PYAYWKGNPTVAETRLDLMKCNLSEVYDWKARLYKQDWVKESKEGYKQSDLASQCHHRYK  350

Query  1278  IYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVD  1457
             IYIEGSAWSVSEKYILACDS+TL+VKPHYYDF+TRG+ P  HYWP+++DDKC+SIK AVD
Sbjct  351   IYIEGSAWSVSEKYILACDSVTLMVKPHYYDFFTRGMFPGHHYWPVKEDDKCRSIKFAVD  410

Query  1458  WGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSE  1637
             WGN H ++AQ+IG   S+++Q+ELKM+YVYDYMFHLL +Y+KLL++KP +P  + ELCSE
Sbjct  411   WGNLHMRKAQDIGKKASEFVQQELKMDYVYDYMFHLLIQYSKLLRFKPEIPQNSTELCSE  470

Query  1638  KMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              M C  +G E++FMMESLVK  P+ T PC MPPP+DPA+ 
Sbjct  471   AMACPRDGNERKFMMESLVK-RPAETGPCAMPPPYDPASF  509



>ref|XP_006290867.1| hypothetical protein CARUB_v10016976mg [Capsella rubella]
 gb|EOA23765.1| hypothetical protein CARUB_v10016976mg [Capsella rubella]
Length=539

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/421 (60%), Positives = 323/421 (77%), Gaps = 18/421 (4%)
 Frame = +3

Query  501   LNCSLRT--PMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAW  674
             LNC+  +     +CP N YP+S  +                  + CPDYFRWI++DL  W
Sbjct  105   LNCAAFSGNDTVTCPRNSYPTSFRSNAEP--------------ATCPDYFRWIHEDLRPW  150

Query  675   RESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVP  854
              ++GI+RE +  A  TA FRL I++G  Y  N+R++FQ+RD FT+WG +QLLRRYPGK+P
Sbjct  151   EKTGITREALERANATAIFRLAIIDGRIYVENFREAFQTRDVFTIWGFVQLLRRYPGKIP  210

Query  855   DLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKP  1034
             DL+LMFD VDWPV+K + Y   D  + PP LFRYC ++ T DIVFPDWS+WGW E+NIKP
Sbjct  211   DLELMFDCVDWPVVKAEEYSGVDKPSPPP-LFRYCANDETLDIVFPDWSYWGWAEVNIKP  269

Query  1035  WEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWI  1214
             WE L K+L EGN + KW+DREPYAYWKGNP VA TR DL+KCN+SE+ DW AR+Y QDW+
Sbjct  270   WESLLKDLSEGNQRTKWIDREPYAYWKGNPTVAETRLDLMKCNLSEEYDWKARLYKQDWL  329

Query  1215  QEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMP  1394
             +E K+GY+QS+LA QC HRYKIYIEGSAWSVSEKYILACDS+TL+VKPHYYDF+TRG+ P
Sbjct  330   KESKEGYKQSDLASQCHHRYKIYIEGSAWSVSEKYILACDSVTLMVKPHYYDFFTRGMFP  389

Query  1395  MKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSE  1574
               HYWP+++DDKC+SIK AVDWGN H ++AQ+IG   S+++Q+ELKM+YVYDYMFHLL++
Sbjct  390   GHHYWPVKEDDKCRSIKFAVDWGNLHMRKAQDIGKKASEFVQQELKMDYVYDYMFHLLTQ  449

Query  1575  YAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPAT  1754
             Y+KLL++KP +P  + E+CSE M C  +G E++FMMESLVK  P+ T PC MPPP+DPA+
Sbjct  450   YSKLLRFKPEIPQNSTEVCSETMACPRDGNERKFMMESLVK-RPAETGPCAMPPPYDPAS  508

Query  1755  L  1757
              
Sbjct  509   F  509



>ref|XP_008813820.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Phoenix 
dactylifera]
Length=527

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/373 (67%), Positives = 307/373 (82%), Gaps = 6/373 (2%)
 Frame = +3

Query  639   YFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGI  818
             YFRWI++DL  W+ +GI++EMV  AR TA+FRLVI++G  Y   YR+SFQ+RD FTLWGI
Sbjct  140   YFRWIHEDLRPWKSTGITQEMVERARETAHFRLVILHGRVYMERYRRSFQTRDVFTLWGI  199

Query  819   LQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDW  998
             LQLLRRYP ++PDL+LMF+T DWPV++     L     APP LF YC D++  DIVFPDW
Sbjct  200   LQLLRRYPDRIPDLELMFNTHDWPVVQAGRNAL-----APPPLFHYCADDSALDIVFPDW  254

Query  999   SFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQ  1178
             +FWGWPEIN+KPWE L++ELKEGN +++W+DREPYAYWKGNP VAATRKDLLKCNVSE  
Sbjct  255   TFWGWPEINLKPWELLNRELKEGNERVRWMDREPYAYWKGNPAVAATRKDLLKCNVSEAH  314

Query  1179  DWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKP  1358
             DW AR+YA +W +E + GY++S+L  QCIHRYKIYIEG+AWSVSEKYILAC+SLTLLVKP
Sbjct  315   DWNARIYALNWRKETQIGYKESDLGSQCIHRYKIYIEGAAWSVSEKYILACNSLTLLVKP  374

Query  1359  HYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKME  1538
              YYDF+TR LMP++HYWP+R DDKC+SIK AVDWGN+H Q+AQ IG   S +IQE+LKME
Sbjct  375   RYYDFFTRSLMPLQHYWPVRSDDKCRSIKFAVDWGNSHKQKAQAIGKEASNFIQEKLKME  434

Query  1539  YVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTA  1718
             YVYDYM HLL+EY+KLL+YKPT P +A+ELCS+ M C A  LEK+FMMES+VK +P  +A
Sbjct  435   YVYDYMLHLLTEYSKLLRYKPTRPRKAIELCSKSMACPAKALEKKFMMESMVK-SPHDSA  493

Query  1719  PCTMPPPFDPATL  1757
             PC +PPPF P  L
Sbjct  494   PCKLPPPFKPVEL  506



>ref|XP_007038694.1| Glycosyltransferase isoform 3 [Theobroma cacao]
 gb|EOY23195.1| Glycosyltransferase isoform 3 [Theobroma cacao]
Length=485

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/511 (57%), Positives = 345/511 (68%), Gaps = 68/511 (13%)
 Frame = +3

Query  267   LKMRETS----EGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDS  434
             + MRE +     G+ L+  FT+T WRP    K+  RSS     F+VL VGAF ST LLD+
Sbjct  3     INMRENNMQQGNGSGLFSQFTETIWRPF--AKSSARSSAIFVVFIVLLVGAF-STHLLDT  59

Query  435   TV----TAQHP------TRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTR  584
             T      AQ P      +R + +K  +    PLNC+ R    +CP N           T 
Sbjct  60    TTFLGSLAQKPMLSTRTSRGNPKKPRQQRDIPLNCTARNLTRACPTN---------DPTA  110

Query  585   IQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYY  764
             I++ P  +       CPDYFRWI++DL  W  +GIS +M+  A +TANFRLV+VNG AY 
Sbjct  111   IEEEPDSSLNAM---CPDYFRWIHEDLRPWAYTGISMDMLKRAEKTANFRLVVVNGRAYV  167

Query  765   HNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPA  944
               YR+SFQ+RD FTLWGILQLLRRYPGKVPDLDLMFD VDWPVIK   Y   + TT PP 
Sbjct  168   QRYRRSFQTRDVFTLWGILQLLRRYPGKVPDLDLMFDCVDWPVIKTSDYGGPNATTPPP-  226

Query  945   LFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNP  1124
             LFRYC D+ T DIVFPDWSFWGWPEINIKPW  L  +L EGN ++ W  REP+AYWKGNP
Sbjct  227   LFRYCKDDETLDIVFPDWSFWGWPEINIKPWVPLLNDLMEGNKRMGWEGREPHAYWKGNP  286

Query  1125  EVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWS  1304
              VA TR+DLLKCNVS+KQDWGARVYAQDW +E +QGY+QS+LA+QCIH            
Sbjct  287   NVATTRQDLLKCNVSDKQDWGARVYAQDWARESQQGYKQSDLANQCIH------------  334

Query  1305  VSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQA  1484
                                      R L PM+HYWPI+DDDKC+SIKHAVDWGN H Q+A
Sbjct  335   -------------------------RSLEPMRHYWPIKDDDKCRSIKHAVDWGNGHQQEA  369

Query  1485  QEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGL  1664
             Q IG A S++I+E LKM+YVYDYMFHLL+EYAKLL+YKPTVP +AVELCSE M C A GL
Sbjct  370   QAIGKAASEFIKEGLKMDYVYDYMFHLLNEYAKLLRYKPTVPRKAVELCSETMACPAEGL  429

Query  1665  EKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +K+FMMES+VK  PS T+PCTMPPP+DPA+L
Sbjct  430   QKKFMMESMVK-GPSVTSPCTMPPPYDPASL  459



>ref|XP_010053285.1| PREDICTED: O-glucosyltransferase rumi homolog [Eucalyptus grandis]
Length=525

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/460 (59%), Positives = 338/460 (73%), Gaps = 24/460 (5%)
 Frame = +3

Query  405   AFVSTRLLD-STVTAQHPTRLS---HQKIIENEIP-----PLNCSLRTPMASCPANYYPS  557
             AF  T  +D ST++A +P+  S     K   N  P     PLNCS      +CP NY P 
Sbjct  51    AFNFTLKIDTSTISAGNPSNQSIVISDKNQPNLQPKKLEFPLNCSSENQTQTCPTNY-PM  109

Query  558   SKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRL  737
             S L +  +   D            CPDYFRWI++DL  W++SGI+R+MV  A+RTA+FRL
Sbjct  110   SFLPQDPSTEPD------------CPDYFRWIHEDLRPWKDSGITRDMVERAKRTAHFRL  157

Query  738   VIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVL  917
             VI+ G AY   YRKS Q+RD FT+WGILQLLRRYPG++PDL+LMFD  D PVI+ + Y  
Sbjct  158   VIIKGKAYVEKYRKSIQTRDKFTIWGILQLLRRYPGRIPDLELMFDCNDRPVIQSRHY-R  216

Query  918   NDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDRE  1097
                 T+PP LFRYCGD  T DIVFPDWSFWGW EINI PWE +  ELK+GN + KW++RE
Sbjct  217   GQNGTSPPPLFRYCGDRWTMDIVFPDWSFWGWAEINIMPWERVQMELKQGNERKKWIERE  276

Query  1098  PYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYK  1277
             P+AYWKGNP VA TR+DLLKCNVSE QDW AR++ QDWI E +QG++ S+LA QC HR+K
Sbjct  277   PHAYWKGNPFVAETRRDLLKCNVSETQDWNARLFIQDWILESQQGFKNSDLASQCTHRFK  336

Query  1278  IYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVD  1457
             IYIEG AWSVSEKYIL+CDS TLLVKP +YDF+TR L P++HYWPIR +DKC+S+K AVD
Sbjct  337   IYIEGHAWSVSEKYILSCDSTTLLVKPWFYDFFTRSLNPLQHYWPIRTEDKCRSLKFAVD  396

Query  1458  WGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSE  1637
             WGN+H Q+AQEIG A S +IQE++KM  VYDYM HL++EYAKLL+++P VP  AVE+CSE
Sbjct  397   WGNSHKQKAQEIGKASSDFIQEQVKMSNVYDYMLHLMNEYAKLLRFEPEVPEGAVEVCSE  456

Query  1638  KMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              + C A G E++FM+ESL   +PS T PCTMPPP++P ++
Sbjct  457   LVACPAGGTEREFMVESLT-MSPSATGPCTMPPPYEPKSV  495



>ref|XP_008238869.1| PREDICTED: O-glucosyltransferase rumi [Prunus mume]
Length=526

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/509 (55%), Positives = 355/509 (70%), Gaps = 35/509 (7%)
 Frame = +3

Query  291   GARLYRHF----TDTNWRPL-----PAIKTLPRSSLAVFFFMVLCVGAF---VSTRLLDS  434
             G+RL R F    T ++W P      PAI     + L +  F++    +F   +       
Sbjct  4     GSRLVRPFQFQGTSSDWLPSSFTKGPAIAAATNTILFLGLFIISAAISFSYWIQISNFQI  63

Query  435   TVTAQHPTRLSHQ-----KIIENEIPPLNCSLRTPM---ASCPANYYPSSKLTRTRTRIQ  590
               +A     +S++     K+IE    PLNCS+ + +    +CP +Y        T   + 
Sbjct  64    GNSANETILISNKYQEPFKVIEF---PLNCSIGSNINHTQTCPTSY------PTTFGNLD  114

Query  591   DspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHN  770
             D    +       CPDYFR+I+ DL  W+ +GI+R+MV  A+ TA+FRLVIV G AY   
Sbjct  115   DLEPSSSPV----CPDYFRFIHQDLMPWKATGITRDMVERAKETAHFRLVIVKGKAYVEK  170

Query  771   YRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALF  950
             Y+KS Q+RD FT+WGILQLLRRYPG++PDL+LMFD  D PVI+ + +   ++T  PP LF
Sbjct  171   YKKSIQTRDVFTIWGILQLLRRYPGRLPDLELMFDCNDKPVIRSRDFRGPNSTQVPP-LF  229

Query  951   RYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEV  1130
             RYCGD  T DIVFPDWSFWGW EINIKPWE L K+LK+GN + KW++REPYAYWKGNP V
Sbjct  230   RYCGDRWTKDIVFPDWSFWGWAEINIKPWESLLKDLKKGNDRRKWMEREPYAYWKGNPFV  289

Query  1131  AATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVS  1310
             A +RKDLLKCNVS+ QDW AR++ QDWI E +QG++QS++A QC HRYKIYIEG AWSVS
Sbjct  290   AESRKDLLKCNVSDSQDWNARLFIQDWILESQQGFKQSDVASQCTHRYKIYIEGYAWSVS  349

Query  1311  EKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQE  1490
             EKYILACDS+TL+VKP YYDF+TR L P+ HYWP+R DDKCKSIK AVDWGNNH Q+AQ 
Sbjct  350   EKYILACDSVTLIVKPQYYDFFTRSLQPVHHYWPVRHDDKCKSIKFAVDWGNNHKQKAQA  409

Query  1491  IGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEK  1670
             IG A S +IQ+ELKM++VYDYMFHLL+EYAKLL+++P +P  A  LCSE M C A+  EK
Sbjct  410   IGKAASDFIQQELKMDFVYDYMFHLLNEYAKLLRFEPKIPEGATHLCSESMACPASESEK  469

Query  1671  QFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +FM ESLVK +PS T+PCTMPP + P  L
Sbjct  470   RFMTESLVK-SPSVTSPCTMPPAYKPQVL  497



>ref|XP_010053287.1| PREDICTED: O-glucosyltransferase rumi homolog [Eucalyptus grandis]
 gb|KCW77550.1| hypothetical protein EUGRSUZ_D01866 [Eucalyptus grandis]
Length=525

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/447 (60%), Positives = 331/447 (74%), Gaps = 23/447 (5%)
 Frame = +3

Query  432   STVTAQHPTRLSHQKIIENEIP--------PLNCSLRTPMASCPANYYPSSKLTRTRTRI  587
             ST++A +P+  S     +N++         PLNCS      +CP NY P+S   +  +  
Sbjct  61    STISAGNPSNQSIVISDKNQLNLQPKKLEFPLNCSSENQTQTCPTNY-PTSFSPQDPSTE  119

Query  588   QDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYH  767
              D            CPDYFRWI++DL  W++SGI+R+MV  A+ TA+FRLVI+ G AY  
Sbjct  120   PD------------CPDYFRWIHEDLRPWKDSGITRDMVERAKPTAHFRLVIIKGKAYVE  167

Query  768   NYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPAL  947
              YRKS Q+RD FT+WGILQLLRRYPG++PDL+LMFD  D PVI+ + Y      T+PP L
Sbjct  168   KYRKSIQTRDMFTVWGILQLLRRYPGQIPDLELMFDCDDQPVIQSRHY-RGKNATSPPPL  226

Query  948   FRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPE  1127
             FRYCGD  T DIVFPDWSFWGW EINIKPWE L  ELK+GN + KW++REP+AYWKGNP 
Sbjct  227   FRYCGDRWTMDIVFPDWSFWGWAEINIKPWERLQMELKQGNERKKWIEREPHAYWKGNPF  286

Query  1128  VAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSV  1307
             VA +R+DLLKCNVSE QDW AR++ QDWI E +QG++ S+LA QC HR+KIYIEG AWSV
Sbjct  287   VAESRRDLLKCNVSETQDWNARLFIQDWILESQQGFKNSDLARQCAHRFKIYIEGYAWSV  346

Query  1308  SEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQ  1487
             SEKYILACDS TLLVKP +YDF+TR L P++HYWPIR +DKC+S+K AVDWGN+H Q+A+
Sbjct  347   SEKYILACDSTTLLVKPQFYDFFTRSLNPLQHYWPIRTEDKCRSLKFAVDWGNSHKQKAR  406

Query  1488  EIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLE  1667
             EIG A S +IQE +KM  VYDYMF L++EYAKLL+++P VP  AVE+CSE M C A G E
Sbjct  407   EIGKASSDFIQERVKMSNVYDYMFQLMNEYAKLLRFEPEVPEGAVEVCSELMACPAGGTE  466

Query  1668  KQFMMESLVKAAPSTTAPCTMPPPFDP  1748
             K+FM+ESL   +PS T PCTMPPP++P
Sbjct  467   KEFMVESLT-MSPSATGPCTMPPPYEP  492



>dbj|BAE99650.1| hypothetical protein [Arabidopsis thaliana]
Length=433

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/410 (61%), Positives = 314/410 (77%), Gaps = 8/410 (2%)
 Frame = +3

Query  528   ASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVM  707
              +CP + YP+S  +       D            CPDYFRWI++DL  W ++GI+RE + 
Sbjct  2     GTCPKDNYPTSFRSSAGEGESDRSPSAT------CPDYFRWIHEDLRPWEKTGITREALE  55

Query  708   SARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDW  887
              A  TA FRL I+NG  Y   +R++FQ+RD FT+WG +QLLRRYPGK+PDL+LMFD VDW
Sbjct  56    RANATAIFRLAIINGRIYVEKFREAFQTRDVFTIWGFVQLLRRYPGKIPDLELMFDCVDW  115

Query  888   PVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEG  1067
             PV+K   +   D    PP LFRYC ++ T DIVFPDWS+WGW E+NIKPWE L KEL+EG
Sbjct  116   PVVKAAEFAGVDQP-PPPPLFRYCANDETLDIVFPDWSYWGWAEVNIKPWESLLKELREG  174

Query  1068  NVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSN  1247
             N + KW+DREPYAYWKGNP VA TR DL+KCN+SE  DW AR+Y QDW++E K+GY+QS+
Sbjct  175   NQRTKWIDREPYAYWKGNPTVAETRLDLMKCNLSEVYDWKARLYKQDWVKESKEGYKQSD  234

Query  1248  LADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDD  1427
             LA QC HRYKIYIEGSAWSVSEKYILACDS+TL+VKPHYYDF+TRG+ P  HYWP+++DD
Sbjct  235   LASQCHHRYKIYIEGSAWSVSEKYILACDSVTLMVKPHYYDFFTRGMFPGHHYWPVKEDD  294

Query  1428  KCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTV  1607
             KC+SIK AVDWGN H ++AQ+IG   S+++Q+ELKM+YVYDYMFHLL +Y+KLL++KP +
Sbjct  295   KCRSIKFAVDWGNLHMRKAQDIGKKASEFVQQELKMDYVYDYMFHLLIQYSKLLRFKPEI  354

Query  1608  PPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             P  + ELCSE M C  +G E++FMMESLVK  P+ T PC MPPP+DPA+ 
Sbjct  355   PQNSTELCSEAMACPRDGNERKFMMESLVK-RPAETGPCAMPPPYDPASF  403



>ref|XP_003517464.1| PREDICTED: KDEL motif-containing protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006573770.1| PREDICTED: KDEL motif-containing protein 1-like isoform X2 [Glycine 
max]
Length=522

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 302/375 (81%), Gaps = 7/375 (2%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP+YFRWI++D+ AW+E GISREMV  A+++A+FRLV+  G  Y   Y+KS Q+R+ FT+
Sbjct  121   CPEYFRWIHEDVGAWKERGISREMVERAKKSAHFRLVVKRGRVYVERYKKSIQTREVFTM  180

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGI+QLLR+YPGKV DL+LMFD  D PVI+  S         PP LFRYCGD  T DIVF
Sbjct  181   WGIVQLLRKYPGKVADLELMFDCDDLPVIRGSSLA------GPPPLFRYCGDRWTDDIVF  234

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGW EINI+PWE + KE+++GN +IKW DREPYAYWKGNP VA TR+DLLKCNVS
Sbjct  235   PDWSFWGWAEINIRPWEHVLKEMEKGNRRIKWNDREPYAYWKGNPFVAETRQDLLKCNVS  294

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
               QDW AR+Y QDWIQE +QG+  SNLA QC HRYKIYIEG AWSVSEKYILACDS+TL+
Sbjct  295   TTQDWNARLYVQDWIQESQQGFNNSNLASQCTHRYKIYIEGYAWSVSEKYILACDSVTLM  354

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VKP +YDF+ R L PM+HYWPIRD  KCKSIKHAVDWGNNH ++AQ+IG A SK+IQEEL
Sbjct  355   VKPRFYDFFIRSLQPMQHYWPIRDKGKCKSIKHAVDWGNNHKEEAQKIGKAASKFIQEEL  414

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KM+YVYDYMFHLL+EYAKLLK++P VP  A ELC E M C  +GLE++FM ES+V+  PS
Sbjct  415   KMDYVYDYMFHLLNEYAKLLKFEPRVPEGAEELCVEAMACTRSGLERKFMTESMVR-EPS  473

Query  1710  TTAPCTMPPPFDPAT  1754
             T APC++PPP +P +
Sbjct  474   TKAPCSLPPPLEPTS  488



>ref|XP_004953263.1| PREDICTED: protein O-glucosyltransferase 1-like [Setaria italica]
Length=550

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/374 (66%), Positives = 303/374 (81%), Gaps = 3/374 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             CP YFR+I++DL  WR +G I+R MV  AR TANFRLV++ G AY      +FQ+RD FT
Sbjct  147   CPAYFRYIHEDLHPWRAAGGITRAMVDRARATANFRLVVIRGRAYIERIAPAFQTRDLFT  206

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WGILQLLRRYPG+VPDLDLMFD VDWPV+    Y   + T  PP +FRYCGD  T D+V
Sbjct  207   IWGILQLLRRYPGRVPDLDLMFDCVDWPVVHADQYEGENATVLPP-VFRYCGDNETLDVV  265

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGWPEINIKPW+ L KEL  GN +++W+DREPYAYWKGNP+VAATR++L+KCNV
Sbjct  266   FPDWSFWGWPEINIKPWDALQKELDSGNKRVRWMDREPYAYWKGNPDVAATRQELVKCNV  325

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTL  1346
             S + +W AR+Y QDW++E K GY+QS+LA QC HRYKIYIEGSAWSVSEKYILACDS+TL
Sbjct  326   SSEHEWNARIYKQDWLKEIKAGYKQSDLASQCTHRYKIYIEGSAWSVSEKYILACDSMTL  385

Query  1347  LVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEE  1526
             +V+P YYDFY+R LMPM+HYWP+RDD+KC SIK+AVDWGN+H Q+AQ IG   S +IQ+E
Sbjct  386   VVRPKYYDFYSRMLMPMQHYWPVRDDNKCISIKYAVDWGNSHKQKAQRIGKQASNFIQKE  445

Query  1527  LKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAP  1706
             L M+YVYDYMFHL +EYAKLL++KPT PPEAVE+CSE + C A G EK+FM +S+V++  
Sbjct  446   LSMDYVYDYMFHLFTEYAKLLRFKPTKPPEAVEVCSESLACQAVGNEKKFMEDSMVRST-  504

Query  1707  STTAPCTMPPPFDP  1748
             S   PC +PPPF P
Sbjct  505   SDAGPCDLPPPFSP  518



>ref|XP_002446853.1| hypothetical protein SORBIDRAFT_06g023680 [Sorghum bicolor]
 gb|EES11181.1| hypothetical protein SORBIDRAFT_06g023680 [Sorghum bicolor]
Length=555

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/374 (67%), Positives = 303/374 (81%), Gaps = 3/374 (1%)
 Frame = +3

Query  639   YFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWG  815
             YFR+I++DL  WR +G I+R M+  AR TA FRLV++ G AY H  R +FQ+RD FT+WG
Sbjct  160   YFRFIHEDLRPWRAAGGITRAMLDRARLTATFRLVVLGGRAYVHRLRPAFQTRDLFTIWG  219

Query  816   ILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPD  995
             +LQLLRRYPG+VPDLDLMFDTVDWP+++   Y        PP LFRYCGD+ T DIVFPD
Sbjct  220   VLQLLRRYPGRVPDLDLMFDTVDWPIVRAHLYRGKYAEMLPP-LFRYCGDDKTLDIVFPD  278

Query  996   WSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEK  1175
             WSFWGWPEINIKPW+ L ++LK+GN +++W+DREPYAYWKGNP V+ATRK+L+KCNVS  
Sbjct  279   WSFWGWPEINIKPWDALQEDLKDGNNRVRWMDREPYAYWKGNPSVSATRKELVKCNVSST  338

Query  1176  QDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVK  1355
              DW AR+YAQDW +E K GY+ S+L+ QC HRYKIYIEGSAWS+SEKYILACDS+TLLV 
Sbjct  339   HDWNARIYAQDWFKESKAGYKDSDLSSQCAHRYKIYIEGSAWSISEKYILACDSMTLLVT  398

Query  1356  PHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKM  1535
             P YYDF++R LMP +HYWP+RDD+KC SIK+AVDWGN+H Q AQ IG   S +IQEEL M
Sbjct  399   PRYYDFFSRSLMPTQHYWPVRDDNKCASIKYAVDWGNSHKQMAQHIGKQASNFIQEELNM  458

Query  1536  EYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTT  1715
             ++VYDYM HLL+EYAKLLK+KPT PPEAVE+CSE +VC A GLEK+F++ES+VK A    
Sbjct  459   DHVYDYMLHLLTEYAKLLKFKPTKPPEAVEVCSESLVCQAEGLEKKFLVESMVKFA-RDA  517

Query  1716  APCTMPPPFDPATL  1757
              PC +PPPFDP  L
Sbjct  518   GPCDLPPPFDPHEL  531



>ref|XP_010905099.1| PREDICTED: protein O-glucosyltransferase 1-like [Elaeis guineensis]
Length=538

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 307/374 (82%), Gaps = 6/374 (2%)
 Frame = +3

Query  636   DYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWG  815
             DYFRWI++DL  W+ +GI++EMV  AR TA+FRLV+++G  Y   YR+SFQ+RD FTLWG
Sbjct  147   DYFRWIHEDLRPWKSTGITQEMVKRARETAHFRLVVLDGRVYMERYRRSFQTRDVFTLWG  206

Query  816   ILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPD  995
             ILQLLRRYPG++PDL+LMF+T DWPV+  +       T+APP LF YC + +T DIVFPD
Sbjct  207   ILQLLRRYPGRIPDLELMFNTEDWPVVPARR-----NTSAPPPLFHYCANHSTLDIVFPD  261

Query  996   WSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEK  1175
             W+FWGWPEIN+KPWE L +ELK GN +++W+DREPYAYWKGNP V+A RKDLLKCNVS+ 
Sbjct  262   WTFWGWPEINMKPWEPLKRELKAGNERVRWMDREPYAYWKGNPLVSAARKDLLKCNVSKA  321

Query  1176  QDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVK  1355
              DW AR+Y   W +E + G+++S+LA QCIHRYKIYIEG AWSVSEKYILAC+SLTLLVK
Sbjct  322   HDWNARIYNLSWRKETQIGFKESDLASQCIHRYKIYIEGVAWSVSEKYILACNSLTLLVK  381

Query  1356  PHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKM  1535
             P YYDF++R LMP++HYWP+R +DKC+SIK+AVDWGN+H Q+AQ IG   S +IQE+LKM
Sbjct  382   PRYYDFFSRSLMPLQHYWPVRSNDKCRSIKYAVDWGNSHKQKAQAIGKEASNFIQEKLKM  441

Query  1536  EYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTT  1715
             EYVYDYM HLL+EY+KLL+YKPT P +A+ELCSE M C + GL+K+FMMES+VK +P  +
Sbjct  442   EYVYDYMLHLLTEYSKLLRYKPTRPRKAIELCSESMACPSKGLQKKFMMESMVK-SPHDS  500

Query  1716  APCTMPPPFDPATL  1757
             APC +PPP +P  L
Sbjct  501   APCNLPPPLEPVEL  514



>ref|XP_008380708.1| PREDICTED: KDEL motif-containing protein 1-like [Malus domestica]
Length=521

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/423 (62%), Positives = 321/423 (76%), Gaps = 15/423 (4%)
 Frame = +3

Query  498   PLNCSL---RTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLW  668
             PLNCS+        +CPANY      T + T   D            CPDYFR+I+ DL 
Sbjct  80    PLNCSIGNNANQTQTCPANY----PTTFSNTDELDPSPNPL------CPDYFRFIHQDLM  129

Query  669   AWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGK  848
              W+ +GI+R+MV +A++ A+FRLVIV G  Y   Y++S Q+RD FT+WGILQLLRRYPG+
Sbjct  130   PWKRTGITRDMVENAKKXAHFRLVIVKGKVYVEKYKQSIQTRDVFTIWGILQLLRRYPGR  189

Query  849   VPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINI  1028
             +PDL+ MFD  D PVI+ + Y   ++T  PP LFRYCGD  T DIVFPDWSFWGW EINI
Sbjct  190   LPDLEFMFDCDDQPVIRSRDYHGLNSTRVPP-LFRYCGDRWTKDIVFPDWSFWGWNEINI  248

Query  1029  KPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQD  1208
             KPWEG  K++K+GN +IKW+DREPYAYWKGNP V+ TRKDLLKCNVS  QDW AR++ QD
Sbjct  249   KPWEGFLKDVKKGNQRIKWMDREPYAYWKGNPFVSDTRKDLLKCNVSGTQDWNARLFIQD  308

Query  1209  WIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGL  1388
             WI E +QG++QSN+ADQC HRYKIYIEG AWSVSEKYILACDS+TLLVKP YYDF+TRGL
Sbjct  309   WILESQQGFKQSNVADQCTHRYKIYIEGYAWSVSEKYILACDSVTLLVKPKYYDFFTRGL  368

Query  1389  MPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLL  1568
              P+ HYWP+R ++KC+SIK AVDWGNNH Q+AQ IG A S +IQEELKM+YVYDYMFHLL
Sbjct  369   QPVHHYWPVRHENKCRSIKFAVDWGNNHKQKAQAIGKAASNFIQEELKMDYVYDYMFHLL  428

Query  1569  SEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDP  1748
             +EYAKLL+++P +P     LCSE + C A+   K+ M+ESLVK +PS + PCTMPPP++P
Sbjct  429   NEYAKLLRFEPRIPKGTTHLCSESIACPADESPKKSMIESLVK-SPSASDPCTMPPPYEP  487

Query  1749  ATL  1757
               L
Sbjct  488   RAL  490



>ref|XP_002454569.1| hypothetical protein SORBIDRAFT_04g033620 [Sorghum bicolor]
 gb|EES07545.1| hypothetical protein SORBIDRAFT_04g033620 [Sorghum bicolor]
Length=552

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/374 (66%), Positives = 302/374 (81%), Gaps = 3/374 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             CP YFR+I++DL  WR +G I+R MV  AR TANFRLV++ G AY      +FQ+RD FT
Sbjct  149   CPAYFRFIHEDLHPWRAAGGITRAMVDRARATANFRLVVIRGRAYIERIAPAFQTRDLFT  208

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WGILQLLRRYPG+VPDLDLMFD VDWPV+    Y   + T  PP LFRYCG+  T D+V
Sbjct  209   IWGILQLLRRYPGRVPDLDLMFDCVDWPVVHADQYEGENATVLPP-LFRYCGNNETLDVV  267

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGWPEINIKPW+ L KEL  GN ++KW++REPYAYWKGNP+VA  R++L+KCNV
Sbjct  268   FPDWSFWGWPEINIKPWDALQKELNRGNKRVKWLNREPYAYWKGNPDVAVIRQELVKCNV  327

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTL  1346
             S + +W AR+Y QDW++E K GY+QSNLA QC HRYKIYIEGSAWSVSEKYILACDS+TL
Sbjct  328   SSEHEWNARIYKQDWLKEIKAGYKQSNLAGQCTHRYKIYIEGSAWSVSEKYILACDSMTL  387

Query  1347  LVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEE  1526
             +V P YYDFY+R LMPM+HYWPI DD+KC SIK+AVDWGN+H Q+AQ IG  GS +IQ+E
Sbjct  388   VVTPKYYDFYSRVLMPMQHYWPIWDDNKCSSIKYAVDWGNSHKQKAQRIGKQGSNFIQKE  447

Query  1527  LKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAP  1706
             L MEYVYDYMFHLL+EYAKLL++KPT PPEA+E+C E + C A G E++FM +S+V++A 
Sbjct  448   LSMEYVYDYMFHLLTEYAKLLRFKPTKPPEAIEVCPESLACQAIGRERKFMKDSMVRSA-  506

Query  1707  STTAPCTMPPPFDP  1748
             S   PC +PPPF+P
Sbjct  507   SDAGPCDLPPPFNP  520



>ref|XP_004985474.1| PREDICTED: O-glucosyltransferase rumi homolog [Setaria italica]
Length=551

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/374 (66%), Positives = 301/374 (80%), Gaps = 3/374 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             CP YFR+I++DL  WR +G I+  MV  AR TANFRLV++ G AY      +FQ+RD FT
Sbjct  148   CPAYFRFIHEDLHPWRAAGGITHAMVDRARATANFRLVVIRGRAYIERIAPAFQTRDLFT  207

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WGILQLLR YPG+VPDLDLMFD VDWPV+    Y   + T  PP LFRYCGD  T D+V
Sbjct  208   IWGILQLLRLYPGRVPDLDLMFDCVDWPVVHADQYEGENATVLPP-LFRYCGDNETLDVV  266

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGWPEINIKPW+ L KEL  GN ++KW+DREPYAYWKGNP+VAA R++L+KCNV
Sbjct  267   FPDWSFWGWPEINIKPWDALQKELNSGNRRVKWMDREPYAYWKGNPDVAAIRQELVKCNV  326

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTL  1346
             S + +W AR+Y QDW++E K GY+QS+LA QC HRYKIYIEGSAWSVSEKYILACDS+TL
Sbjct  327   SSEHEWNARIYKQDWLKEIKAGYKQSDLASQCTHRYKIYIEGSAWSVSEKYILACDSMTL  386

Query  1347  LVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEE  1526
             +V P YYDFY+R LMPM+HYWP++DD+KC SIK+AVDWGN+H Q+AQ IG   S +IQ+E
Sbjct  387   VVTPKYYDFYSRVLMPMQHYWPVQDDNKCNSIKYAVDWGNSHKQKAQRIGKQASNFIQKE  446

Query  1527  LKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAP  1706
             L M+YVYDYMFHLL+EYAKLL++KPT PPEAVE+CSE + C A G EK+FM +S+V++A 
Sbjct  447   LSMDYVYDYMFHLLTEYAKLLRFKPTKPPEAVEVCSESLACQAIGREKKFMEDSMVRSA-  505

Query  1707  STTAPCTMPPPFDP  1748
             S   PC +PPPF P
Sbjct  506   SDAGPCDLPPPFSP  519



>ref|NP_001047557.2| Os02g0642700 [Oryza sativa Japonica Group]
 dbj|BAF09471.2| Os02g0642700, partial [Oryza sativa Japonica Group]
Length=474

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 303/374 (81%), Gaps = 3/374 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             CP YFR+I++DL  WR +G I+R M+  AR TANFRLV++ G AY      +FQ+RD FT
Sbjct  76    CPAYFRFIHEDLHPWRAAGGITRRMLERARDTANFRLVVLRGRAYVERIAPAFQTRDLFT  135

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WGILQLLRRYPG+VPDLDLMFD VDWPV++   Y   + T  PP LFRYCGD+ T D+V
Sbjct  136   IWGILQLLRRYPGRVPDLDLMFDCVDWPVVQADRYQGENATAMPP-LFRYCGDDETLDVV  194

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGWPEINIKPW+ L K+L  GN ++KWVDREPYAYWKGNP+VA  RK+L+KCNV
Sbjct  195   FPDWSFWGWPEINIKPWDALQKDLDIGNKRVKWVDREPYAYWKGNPDVATKRKELVKCNV  254

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTL  1346
             S K +W AR+Y QDWI+E K GY+QS+LA QC HRYKIYIEGSAWSVSEKYILAC+S+TL
Sbjct  255   SSKHEWNARIYKQDWIKESKAGYKQSDLASQCTHRYKIYIEGSAWSVSEKYILACNSMTL  314

Query  1347  LVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEE  1526
             +V P YYDF++R LMP +HYWP+RDD+KC SIKHAVDWGN++ ++AQ+IG   S +IQ+E
Sbjct  315   VVTPKYYDFFSRVLMPTQHYWPVRDDNKCSSIKHAVDWGNSNKKKAQKIGKQASNFIQQE  374

Query  1527  LKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAP  1706
             L M+Y+YDYMFHLL+EYAKLL++KPT PPEA+E+C E + C A G E++FM +S+VK+A 
Sbjct  375   LSMDYIYDYMFHLLTEYAKLLRFKPTKPPEAIEICPELLACQAIGRERKFMEDSMVKSA-  433

Query  1707  STTAPCTMPPPFDP  1748
             +   PC +PPPF P
Sbjct  434   NDAGPCDLPPPFSP  447



>ref|NP_001136898.1| hypothetical protein [Zea mays]
 gb|ACF82843.1| unknown [Zea mays]
 gb|AFW63188.1| hypothetical protein ZEAMMB73_601289 [Zea mays]
Length=551

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/374 (67%), Positives = 299/374 (80%), Gaps = 3/374 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             CP YFR+I++DL  WR +G I+R MV  AR TANFRLV++ G AY      +FQ+RD FT
Sbjct  148   CPAYFRFIHEDLHPWRAAGGITRAMVDRARATANFRLVVIRGRAYIERIAPAFQTRDLFT  207

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WGILQLLRRYPG+VPDLDLMFD VDWPV+    Y   + T  PP LFRYCGD  T D+V
Sbjct  208   IWGILQLLRRYPGRVPDLDLMFDCVDWPVVHADQYQGENATLLPP-LFRYCGDNETLDVV  266

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGWPEINIKPW+ L KEL  GN ++KW+ REPYAYWKGNP+VA TR++L+KCNV
Sbjct  267   FPDWSFWGWPEINIKPWDALQKELNGGNKRVKWLAREPYAYWKGNPDVAVTRQELVKCNV  326

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTL  1346
             S K +W AR+Y QDW++E K GY+QS+LA QC HRYKIYIEGSAWSVSEKYILACDS+TL
Sbjct  327   SSKHEWNARIYKQDWLKEIKAGYKQSDLASQCTHRYKIYIEGSAWSVSEKYILACDSMTL  386

Query  1347  LVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEE  1526
             +V P YYDFY+R LMPM+HYWPI DD+KC SIK AVDWGN+H Q+AQ IG  GS +IQ+E
Sbjct  387   VVTPKYYDFYSRVLMPMQHYWPIWDDNKCSSIKFAVDWGNSHKQKAQRIGKQGSNFIQKE  446

Query  1527  LKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAP  1706
             L MEYVYDYMFHLL+EYAKLL++KP  PPEA+E+C E + C A G EK+FM +S+V++A 
Sbjct  447   LSMEYVYDYMFHLLTEYAKLLRFKPRKPPEAIEVCPESLACQAIGREKKFMEDSMVRSA-  505

Query  1707  STTAPCTMPPPFDP  1748
             S   PC +PPPF P
Sbjct  506   SDAGPCDLPPPFSP  519



>ref|XP_008232818.1| PREDICTED: O-glucosyltransferase rumi homolog [Prunus mume]
Length=522

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/509 (53%), Positives = 350/509 (69%), Gaps = 22/509 (4%)
 Frame = +3

Query  249   MVRPHILKMRETSEGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLL  428
             M R +   + +  +G  L+RHF  T+WRPL   K    + + +F  ++  V A VS   +
Sbjct  1     MKRNNAKHLCDFLDGTGLHRHFVGTSWRPLK--KRTATTIIFLFLLLIFFVAALVSAGWI  58

Query  429   DSTVTAQHPTRLSHQKIIENEIP-----PLNCSLRTPMA-SCPANYYPSSKLTRTRTRIQ  590
             D+ + +    + S         P     PL C+    +  SCP  Y P++      +R  
Sbjct  59    DAFIFSGAYFKKSITTTTNTSTPKRPEFPLQCTEGINVTQSCPRTY-PTTHNPANPSRPS  117

Query  591   DspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHN  770
             +            CP YFRWI++DL  W+E+GI+R+M+  AR+ A+FRL+IV+G AY   
Sbjct  118   NLT----------CPSYFRWIHEDLRPWKETGITRDMIERARKIAHFRLLIVDGQAYIEK  167

Query  771   YRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALF  950
             Y +SFQ+RD FTLWGILQLLR YPGK+PDL+LMF+  D PVI  + +       +PP LF
Sbjct  168   YSQSFQTRDMFTLWGILQLLRVYPGKLPDLELMFNCGDQPVIPSKDF--RGPNASPPPLF  225

Query  951   RYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEV  1130
             RYC DE + D+VFPDW+FWGW E NIKPW  L   +KEGN + KW DR PYAYWKGNP V
Sbjct  226   RYCADEGSLDVVFPDWTFWGWVETNIKPWRSLLPSIKEGNKRTKWEDRVPYAYWKGNPNV  285

Query  1131  AATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVS  1310
             A TR DLLKCNVS+K DW  R+Y QDW QE KQGY+ SNL +QC HRYKIYIEG AWSVS
Sbjct  286   ARTRMDLLKCNVSDKNDWNTRLYIQDWEQESKQGYKDSNLENQCKHRYKIYIEGWAWSVS  345

Query  1311  EKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQE  1490
             EKYI+ACDS+TL V+P Y+DF+ RG+ P++H+WPIRD++KC S+K AV+WGNNH  +A+ 
Sbjct  346   EKYIMACDSMTLYVRPRYHDFFIRGMEPLQHFWPIRDNNKCTSLKFAVEWGNNHKDKAKV  405

Query  1491  IGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEK  1670
             IG A S +IQE+LKM+YVYDYMFH+L+EYAKLLK+KPT+PP AVELCSEKM C A G  K
Sbjct  406   IGEAASNFIQEDLKMDYVYDYMFHVLNEYAKLLKFKPTIPPNAVELCSEKMACPATGTFK  465

Query  1671  QFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +FM+ES+V+ +PS   PCT+PPP+DP  L
Sbjct  466   KFMVESMVE-SPSDELPCTLPPPYDPLAL  493



>gb|EEC73683.1| hypothetical protein OsI_08244 [Oryza sativa Indica Group]
Length=524

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/374 (65%), Positives = 302/374 (81%), Gaps = 3/374 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             CP YFR+I++DL  WR +G I+R M+  AR TANFRLV++ G AY      +FQ+RD FT
Sbjct  126   CPAYFRFIHEDLHPWRAAGGITRRMLERARDTANFRLVVLRGRAYVERIAPAFQTRDLFT  185

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WGILQLLRRYPG+VPDLDLMFD VDWPV++   Y   + T  PP LFRYCGD+ T D+V
Sbjct  186   IWGILQLLRRYPGRVPDLDLMFDCVDWPVVQADRYQGENATAMPP-LFRYCGDDETLDVV  244

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGWPEINIKPW+ L K+L  GN ++KWVDREPYAYWKGNP+VA  RK+L+KCNV
Sbjct  245   FPDWSFWGWPEINIKPWDALQKDLDIGNKRVKWVDREPYAYWKGNPDVATKRKELVKCNV  304

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTL  1346
             S K +W AR+Y QDWI+E K GY+QS+LA QC HRYKIYIEGSAWSVSEKYILAC+S+TL
Sbjct  305   SSKHEWNARIYKQDWIKESKAGYKQSDLASQCTHRYKIYIEGSAWSVSEKYILACNSMTL  364

Query  1347  LVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEE  1526
             +V P YYDF++R LMP +HYWP+RDD+KC SIKHAVDWGN++ ++AQ+IG   S +IQ+E
Sbjct  365   VVTPKYYDFFSRVLMPTQHYWPVRDDNKCSSIKHAVDWGNSNKKKAQKIGKQASNFIQQE  424

Query  1527  LKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAP  1706
             L M+Y+YDYMFHLL+EYAKLL++KPT PPEA+E+C E + C A G E++FM +S+V +A 
Sbjct  425   LSMDYIYDYMFHLLTEYAKLLRFKPTKPPEAIEICPELLACQAIGRERKFMEDSMVNSA-  483

Query  1707  STTAPCTMPPPFDP  1748
             +   PC +PPPF P
Sbjct  484   NDAGPCDLPPPFSP  497



>ref|XP_004300778.1| PREDICTED: KDEL motif-containing protein 1-like [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/466 (58%), Positives = 333/466 (71%), Gaps = 35/466 (8%)
 Frame = +3

Query  366   SLAVFFFMVLCVGAFVSTRL--LDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCP  539
             S ++FFF +L + A +S+    L S  T Q     ++Q+                  +CP
Sbjct  21    SYSIFFFGLLTIAAILSSFCVHLSSDTTVQIDPFFTNQR-----------------QTCP  63

Query  540   ANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARR  719
              NY  +    R  T            S++ CPDYFR+I++DL  W+ +GI+R MV  A++
Sbjct  64    TNYSTAFSTDRLDT-----------LSNTTCPDYFRFIHEDLKPWKTTGITRTMVEKAKK  112

Query  720   TANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIK  899
             TA+FRLVIV+G AY  NY+KS Q+RD FT+WGILQLLRRYPGKVPDL+LMFD  D PVI+
Sbjct  113   TAHFRLVIVDGKAYVENYKKSIQTRDVFTIWGILQLLRRYPGKVPDLELMFDCNDRPVIR  172

Query  900   KQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKI  1079
                Y  N T   P  LFRYCGD  T DIVFPDWSFWGW EIN+KPWE + K++K+GN + 
Sbjct  173   --DYWWNPTQVPP--LFRYCGDRWTKDIVFPDWSFWGWAEINMKPWESVLKDVKKGNERS  228

Query  1080  KWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQ  1259
             KW++REPYAYWKGNP VA  R+DLLKCNVS  +DW AR++ QDWI E  QG++QS++A Q
Sbjct  229   KWMEREPYAYWKGNPLVAQKRRDLLKCNVSSTKDWNARLFIQDWILESLQGFKQSDVASQ  288

Query  1260  CIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKS  1439
             C HRYKIYIEG+AWSVSEKYILACDS+TLLVKP YYDF+TR L PM HYWPIR+D+KCKS
Sbjct  289   CTHRYKIYIEGTAWSVSEKYILACDSVTLLVKPKYYDFFTRSLQPMHHYWPIRNDNKCKS  348

Query  1440  IKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEA  1619
             IK AVDWGNNH QQAQ IG A S +IQ+ELKM+YVY YMFHLL+EYAKL K++P VP  A
Sbjct  349   IKFAVDWGNNHKQQAQAIGKAASSFIQQELKMDYVYGYMFHLLNEYAKLSKFEPRVPKGA  408

Query  1620  VELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
               +C+E +   A+  EK+FM ESLVK +PS T PCTMPP ++P  L
Sbjct  409   TLMCTETLAFAADESEKKFMTESLVK-SPSMTNPCTMPPSYEPQDL  453



>ref|XP_010110644.1| hypothetical protein L484_001075 [Morus notabilis]
 gb|EXC27339.1| hypothetical protein L484_001075 [Morus notabilis]
Length=476

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/457 (60%), Positives = 338/457 (74%), Gaps = 17/457 (4%)
 Frame = +3

Query  309   HFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPT--RLSHQKII  482
             HF D  W P   +K+   S +      +L VGA VSTR L+  V    PT  ++S     
Sbjct  24    HFRDAIWWPF--LKSSASSPVVFVVLFLLFVGAIVSTRFLN-FVNLAGPTIPKISESPPQ  80

Query  483   ENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDD  662
             + EIP LNC+      + P+NY        T   IQD P      +   CPDYFRWIY+D
Sbjct  81    KVEIP-LNCTAYEATRTRPSNY-------TTAHNIQDDPDRPLPPT---CPDYFRWIYED  129

Query  663   LWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYP  842
             L  W  +GISR+ V  A+ TA+FRLVIVNG AY   YR+SFQ+RD FTLWGILQLL+RYP
Sbjct  130   LRPWAHTGISRDTVERAKPTADFRLVIVNGKAYVETYRRSFQTRDVFTLWGILQLLQRYP  189

Query  843   GKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEI  1022
             G+VPDLDLMF+  D P+I  ++Y       +PP LF YC ++ T DIVFPDWSFWGWPE+
Sbjct  190   GRVPDLDLMFNCGDLPLILSKAY-RKANAKSPPPLFHYCANDNTLDIVFPDWSFWGWPEV  248

Query  1023  NIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYA  1202
             NIKPWE L KEL+EGN K KWVDR+PYAYWKGNP+V+ +R++LLKCNVS+K DW AR+Y 
Sbjct  249   NIKPWEPLLKELEEGNKKSKWVDRQPYAYWKGNPDVSRSRRNLLKCNVSKKHDWNARLYT  308

Query  1203  QDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTR  1382
             QDWI+E ++GY+QSNLA +CIHRYKIYIEG AWSVSEKYILACDS+TLLVK H+YDF+TR
Sbjct  309   QDWIKESQEGYKQSNLASECIHRYKIYIEGVAWSVSEKYILACDSVTLLVKSHFYDFFTR  368

Query  1383  GLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFH  1562
              L+P++HYWPI+D+DKCKSIK AVDWGN+H ++A+ IG AG+++I+EELKMEYVYDYMFH
Sbjct  369   SLVPLQHYWPIKDNDKCKSIKFAVDWGNSHKKKAKSIGKAGNRFIKEELKMEYVYDYMFH  428

Query  1563  LLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQ  1673
             LL+EYAKLL++KPT+P  AVE CSE M   A GL K+
Sbjct  429   LLNEYAKLLQFKPTIPQNAVEFCSESMAFTAWGLGKE  465



>ref|XP_007051850.1| Downstream target of A 2 [Theobroma cacao]
 gb|EOX96007.1| Downstream target of A 2 [Theobroma cacao]
Length=544

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/501 (53%), Positives = 340/501 (68%), Gaps = 38/501 (8%)
 Frame = +3

Query  294   ARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMV---LCVGAFVSTRLLDSTVTAQHPTRL  464
             + L++ FT T WRP+   K    + +AVF F++   +CVG ++   +     + QH    
Sbjct  40    SELHKPFTGTPWRPVKK-KAAASTVIAVFLFVIGVLVCVG-WIDASIFSGVSSCQHLILG  97

Query  465   SHQKIIENEIP-PLNCSLRTPMASCPANY---------YPSSKLTRTRTRIQDspsptpt  614
             S+     N+   PL CS      +CP +Y          PSSK+T               
Sbjct  98    SNSTNARNKPEFPLKCSTGNRTQTCPRDYPTTHNPTNPGPSSKIT---------------  142

Query  615   qsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSR  794
                  CP +FRWI++DL  W+E+GISR+M+  ARRTA+FRLVIV G AY   YRKS Q+R
Sbjct  143   -----CPSFFRWIHEDLRPWKETGISRDMIERARRTAHFRLVIVKGRAYVEKYRKSIQTR  197

Query  795   DTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEAT  974
             D FTLWGILQLLR+YPG++PDL+LMFD  D PV++ + +        PP LFR+C DE +
Sbjct  198   DMFTLWGILQLLRKYPGRLPDLELMFDCDDRPVVRSKDF--QGPNARPPPLFRFCADELS  255

Query  975   WDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLL  1154
              DIVFPDWSFWGW E NI+PW  + +E+K+GN + +W DR PYAYW+GNP VA TRKDL+
Sbjct  256   LDIVFPDWSFWGWAETNIRPWRNVLEEIKKGNRRTEWKDRVPYAYWRGNPTVAPTRKDLM  315

Query  1155  KCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACD  1334
             KCNV++  +W   +Y QDW +E K GY+QSNL DQC HRYKIY EG AWSVSEKYILACD
Sbjct  316   KCNVTDTDNWNTLLYIQDWTKESKHGYKQSNLEDQCTHRYKIYTEGWAWSVSEKYILACD  375

Query  1335  SLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKY  1514
             S+TL ++  +YDF+ RG+MP++HYWPIR++ KC S+K AV+WGN H  +AQ IG A   +
Sbjct  376   SMTLYIRSRFYDFFIRGMMPLQHYWPIRENSKCTSLKFAVEWGNVHPDKAQAIGEAAGNF  435

Query  1515  IQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLV  1694
             IQE+LKM  VYDYMFHLLSEYAKLLK+KP +PP AVELCSE M C A+G  K FM+ES+V
Sbjct  436   IQEDLKMNNVYDYMFHLLSEYAKLLKFKPEIPPGAVELCSETMACPASGTWKDFMVESMV  495

Query  1695  KAAPSTTAPCTMPPPFDPATL  1757
               +PS T PC MPPP++P  L
Sbjct  496   -MSPSDTIPCAMPPPYEPQEL  515



>ref|XP_002509776.1| KDEL motif-containing protein 1 precursor, putative [Ricinus 
communis]
 gb|EEF51163.1| KDEL motif-containing protein 1 precursor, putative [Ricinus 
communis]
Length=534

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/447 (61%), Positives = 328/447 (73%), Gaps = 31/447 (7%)
 Frame = +3

Query  420   RLLDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMA-SCPANYYPSSKLTRTRTRIQDs  596
             R  ++TV       +  ++ IE    PLNC++      +CP NY    KLT +R   QD 
Sbjct  81    RSTNTTVVISEKHNIPQRETIEF---PLNCTINNNQTQTCPTNY---PKLTTSRADDQDP  134

Query  597   psptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYR  776
             P          CP+YFRWI++DL  W  +GISR+MV  A+RTA+F L+IV G AY   YR
Sbjct  135   PRTV-------CPNYFRWIHEDLRPWIAAGISRDMVERAQRTAHFHLIIVGGKAYIKKYR  187

Query  777   KSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRY  956
             +S Q+RDTFT+WGILQLLRRYPGK+PDL+LMFDT D PVI+   Y     TT PP LFRY
Sbjct  188   ESTQTRDTFTIWGILQLLRRYPGKIPDLELMFDTDDRPVIRSSDY-HEQNTTGPPPLFRY  246

Query  957   CGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA  1136
             CGD                P+INIKPW+ LS ++KEGN   KW+DREPYAYWKGNP VA 
Sbjct  247   CGDR---------------PDINIKPWDELSIDIKEGNNGSKWIDREPYAYWKGNPFVAE  291

Query  1137  TRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEK  1316
             TRKDLL CNVS+++DW AR++ QDWIQE +QGY+QS+LA QC HRYKIYIEG AWSVSEK
Sbjct  292   TRKDLLACNVSDQRDWNARLFIQDWIQESQQGYKQSDLARQCAHRYKIYIEGYAWSVSEK  351

Query  1317  YILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIG  1496
             YILAC+SL+LLVKP+Y+DF+TR L P++HYWPIRD DKCKSIK AVDWGN ++Q+AQEIG
Sbjct  352   YILACNSLSLLVKPYYHDFFTRSLQPLQHYWPIRDTDKCKSIKFAVDWGNKNNQKAQEIG  411

Query  1497  MAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQF  1676
              A S +IQEELKM+YVYDYMFHLL+EYAKLLK+ P VP EAVE+CSE M C A+GLEK+F
Sbjct  412   KAASDFIQEELKMDYVYDYMFHLLNEYAKLLKFAPRVPEEAVEMCSEIMACPADGLEKKF  471

Query  1677  MMESLVKAAPSTTAPCTMPPPFDPATL  1757
             M ESLVK +P  T PCT+PP ++P  L
Sbjct  472   MTESLVK-SPRITRPCTLPPAYEPHVL  497



>ref|XP_003611113.1| KTEL motif-containing protein [Medicago truncatula]
 gb|AES94071.1| glycosyltransferase family 90 protein [Medicago truncatula]
Length=502

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/499 (54%), Positives = 340/499 (68%), Gaps = 52/499 (10%)
 Frame = +3

Query  330   RPLPAIKTLPRSSLAVFFFMVLCVGAFVST------------------RLLDSTVTAQHP  455
             +PL   KT      ++ F ++L   AF+S+                   + + T+ A + 
Sbjct  7     QPLLLRKTPATLYTSLLFLLILITAAFISSLWSTLSTTTNIKPTTTTNTVANQTLVAANV  66

Query  456   TRLSHQKIIENEIPP--LNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssK  629
                + +    N+  P  LNC+++    +C ++ YP++K                      
Sbjct  67    PTKNEKIKHSNKFQPTVLNCTIKN--QTCSSSNYPTTKNNMV------------------  106

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYR--KSFQSRDTF  803
             CP+YF+WI++DL  W++ GI+REMV  A++TA+FRLV+ NG  Y   Y+  ++ Q+RD F
Sbjct  107   CPEYFKWIHEDLKPWKKKGITREMVEKAKKTAHFRLVVKNGKGYLEKYKNKEAIQTRDVF  166

Query  804   TLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDI  983
             T+WGILQLLR+YPGK+PDL+LMFD  D PV+             PP +F YC D  T DI
Sbjct  167   TVWGILQLLRKYPGKIPDLELMFDCNDKPVV--------PIGLDPPPVFGYCADRWTQDI  218

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCN  1163
             VFPDWSFWGW EINIKPWE L K++K+GN ++KW DREPYAYWKGNP  AATR D L CN
Sbjct  219   VFPDWSFWGWAEINIKPWEHLLKDIKKGNKRVKWKDREPYAYWKGNPYTAATRLDFLNCN  278

Query  1164  VSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLT  1343
             VS  QDW  R++ QDWI+E +QG+  SNLADQC +RYK+YIEG AWSVSEKYILACDS  
Sbjct  279   VSTAQDWNLRLFTQDWIKESEQGFNHSNLADQCTYRYKVYIEGYAWSVSEKYILACDSPA  338

Query  1344  LLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQE  1523
             LLVKP YYDF+TR L P++HYWPIRD DKCKSIKHAVDWGNNH Q+AQEIG AGSK+IQE
Sbjct  339   LLVKPRYYDFFTRSLQPLQHYWPIRDTDKCKSIKHAVDWGNNHEQKAQEIGKAGSKFIQE  398

Query  1524  ELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGAN-GLEKQFMMESLVKA  1700
             EL M Y+YDYMFHLL+EY+KLLK++P VP EAVELCSE M C  +  +EK+FM ES+V+ 
Sbjct  399   ELNMNYIYDYMFHLLNEYSKLLKFEPRVPEEAVELCSETMACTRSYSMEKEFMGESMVR-  457

Query  1701  APSTTAPCTMPPPFDPATL  1757
              PST  PC++PPPFDP +L
Sbjct  458   EPSTKDPCSLPPPFDPTSL  476



>ref|XP_007220377.1| hypothetical protein PRUPE_ppa019065mg, partial [Prunus persica]
 gb|EMJ21576.1| hypothetical protein PRUPE_ppa019065mg, partial [Prunus persica]
Length=500

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/490 (55%), Positives = 341/490 (70%), Gaps = 18/490 (4%)
 Frame = +3

Query  288   EGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLS  467
             +G  L+RH   T+WRPL   +T   + + +   ++  V A VS   +D+ V+A   T  S
Sbjct  6     DGTGLHRHIAGTSWRPLKK-RTATTTLIFLLLLLIFFVAALVSAGWIDA-VSATTTTNTS  63

Query  468   HQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFR  647
               K  E    PL C+    +       YP+       +R  +            CP YFR
Sbjct  64    TPKRPEF---PLQCTEGINVTQGCPRTYPTRHDPTNPSRPSNLT----------CPSYFR  110

Query  648   WIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQL  827
             WI++DL  W+E+GI+R+M+  ARRTA+FRL+IV+G AY   YR+S Q+RD FTLWGILQL
Sbjct  111   WIHEDLRPWKETGITRDMIERARRTAHFRLLIVDGKAYIEKYRESIQTRDMFTLWGILQL  170

Query  828   LRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFW  1007
             LR YPG++PDL+LMFD  D PV++ + +        PP LFRYC DE + DIVFPDWSFW
Sbjct  171   LRVYPGRLPDLELMFDCDDRPVVRSKDF--RSPNAGPPPLFRYCSDEGSLDIVFPDWSFW  228

Query  1008  GWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWG  1187
             GW E NIKPW  L   +KEGN + KW DR PYAYWKGNP VA TRKDLLKCNVS+K DW 
Sbjct  229   GWAETNIKPWRSLLPSIKEGNKRTKWKDRVPYAYWKGNPNVAPTRKDLLKCNVSDKNDWN  288

Query  1188  ARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYY  1367
              R+Y Q+W QE KQGY+ SNL +QC HRYKIYIEG AWSVSEKYI+ACD++TL V+P YY
Sbjct  289   TRLYIQNWEQESKQGYKDSNLENQCKHRYKIYIEGWAWSVSEKYIMACDAMTLYVRPRYY  348

Query  1368  DFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVY  1547
             DF+ RG+ P++H+WPIRD+ KC S+K AV+WGNNH  +A+ IG A S +IQE+LKM+YVY
Sbjct  349   DFFMRGMEPLQHFWPIRDNSKCTSLKFAVEWGNNHKDKAKAIGEAASNFIQEDLKMDYVY  408

Query  1548  DYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCT  1727
             DYMFH+L+EYAKLLK+KPT+P  AVELCSEKM C A G  K+FM+ES+V+  P+   PCT
Sbjct  409   DYMFHVLNEYAKLLKFKPTIPSNAVELCSEKMACHATGTWKKFMVESMVE-HPTDELPCT  467

Query  1728  MPPPFDPATL  1757
             +PPP+DP  L
Sbjct  468   LPPPYDPPAL  477



>ref|XP_008669095.1| PREDICTED: protein O-glucosyltransferase 1-like isoform X1 [Zea 
mays]
Length=541

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/377 (64%), Positives = 301/377 (80%), Gaps = 5/377 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             CP YFR+I++DL  WR +G I+R M+  AR TA FRLV++ G AY   +R +FQ+RD FT
Sbjct  145   CPSYFRFIHEDLRPWRAAGGITRAMLDRARLTATFRLVVLGGNAYVQRFRPAFQTRDLFT  204

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WG+LQLLRR+PG+VPDLDLMFDTVDWPV++   Y   +    PP LFRYCGD+ T DIV
Sbjct  205   IWGVLQLLRRHPGRVPDLDLMFDTVDWPVVRSHLYRGKNAEMLPP-LFRYCGDDKTLDIV  263

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGWPEINIKPW+ L ++LK GN +++W+DREPYAYWKGNP V+ TRK+L+KCNV
Sbjct  264   FPDWSFWGWPEINIKPWDALKEDLKAGNNRVRWMDREPYAYWKGNPSVSGTRKELVKCNV  323

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTL  1346
             S   DW AR+YAQDW +E K GY+ S+L+ QC HRYKIYIEGSAWS+SEKYILACDS+TL
Sbjct  324   SSTHDWNARIYAQDWFKESKAGYKDSDLSSQCAHRYKIYIEGSAWSISEKYILACDSMTL  383

Query  1347  LVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEE  1526
             LV P YYDF++R LMP++HYWP+R D+KC SIK+AVDWGN+H Q AQ IG   S +IQ+E
Sbjct  384   LVTPRYYDFFSRSLMPIQHYWPVRYDNKCASIKYAVDWGNSHKQLAQRIGKQASNFIQDE  443

Query  1527  LKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAP  1706
             L M++VYDYM HLL+EYAKLLK+KPT PP+AVE+CSE + C A GLEK+F+MES+VK   
Sbjct  444   LSMDHVYDYMLHLLTEYAKLLKFKPTKPPDAVEVCSESLACQAEGLEKKFLMESMVKFPR  503

Query  1707  STTAPCTMPPPFDPATL  1757
                  C +PPPF+P  L
Sbjct  504   DA---CDLPPPFNPHEL  517



>ref|XP_003569968.1| PREDICTED: protein O-glucosyltransferase 1-like [Brachypodium 
distachyon]
Length=543

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 242/374 (65%), Positives = 301/374 (80%), Gaps = 3/374 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             CP YFR+I++DL  WR +G I+R M+  AR TANFRLV++ G AY      +FQ+RD FT
Sbjct  140   CPAYFRFIHEDLHPWRAAGGITRAMLDRARATANFRLVVLRGRAYIELIAPAFQTRDLFT  199

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WGILQLLRRYPG+VPDLDLMFD VDWPV++   Y   + T  PP LFRYCGD  T D+V
Sbjct  200   IWGILQLLRRYPGRVPDLDLMFDCVDWPVVRADQYEGENATAMPP-LFRYCGDNETLDVV  258

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGW EINIKPW+ L K+L  GN +++WVDREPYAYWKGNP+VAA R++L+KCNV
Sbjct  259   FPDWSFWGWAEINIKPWDALRKDLDAGNRRVRWVDREPYAYWKGNPDVAAIRQELVKCNV  318

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTL  1346
             S KQ+W AR+Y QDWI+E K GY++S+LA QC HRYKIYIEGSAWSVSEKYILACDS+TL
Sbjct  319   SSKQEWNARIYKQDWIKESKAGYKKSDLASQCTHRYKIYIEGSAWSVSEKYILACDSMTL  378

Query  1347  LVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEE  1526
             ++ P YYDF++R L+P KHYWP+R D KC SIK+AVDWGN+H ++AQ+IG   S +IQ+E
Sbjct  379   VITPKYYDFFSRVLLPTKHYWPVRADSKCSSIKYAVDWGNSHKKKAQQIGKQASNFIQQE  438

Query  1527  LKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAP  1706
             L M+Y+YDYMFHLL+EYAKLL++KPT PPEAVE+C E + C A G E++FM +S+VK+A 
Sbjct  439   LSMDYIYDYMFHLLTEYAKLLRFKPTKPPEAVEVCPESLACQAIGRERKFMEDSMVKSA-  497

Query  1707  STTAPCTMPPPFDP  1748
             +   PC +PPPF P
Sbjct  498   NVAGPCDLPPPFSP  511



>ref|XP_002273091.2| PREDICTED: O-glucosyltransferase rumi homolog [Vitis vinifera]
Length=519

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/452 (57%), Positives = 329/452 (73%), Gaps = 16/452 (4%)
 Frame = +3

Query  402   GAFVSTRLLDSTVTAQHPTRLSHQKIIENEIP---PLNCSLRTPMASCPANYYPSSKLTR  572
             GA V T  +D+++    P++ S     +  I    PLNCS      +CP NY      T 
Sbjct  49    GALVYTGWIDASIFPGDPSQKSLLSFTKAPIRLEYPLNCSAGNLTKTCPGNYPTKHNPTN  108

Query  573   TRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNG  752
                          + ++  CPDYFRWI+ DL  W+++GI+R+MV  A+RTA+FRLVI++G
Sbjct  109   P----------DHSSTNMTCPDYFRWIHQDLLPWKQTGITRDMVDRAQRTAHFRLVIIDG  158

Query  753   IAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTT  932
              AY   +RKS Q+RD FTLWGILQLLR YPG++PDL+LMFD  D PV++ + +       
Sbjct  159   KAYVEKFRKSIQTRDMFTLWGILQLLRWYPGRLPDLELMFDCDDRPVVRMRDF--RGPNA  216

Query  933   APPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYW  1112
             APP LFRYCGD+ + DIVFPDWSFWGW E NIKPW  + K++KEGN + KW DR P AYW
Sbjct  217   APPPLFRYCGDDWSLDIVFPDWSFWGWAETNIKPWRNVLKDIKEGNRRTKWKDRVPLAYW  276

Query  1113  KGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEG  1292
             +GNP VA TR DLLKCNVS+K DW  R+Y QDW Q+ K GY+QSNL DQC HRYKIYIEG
Sbjct  277   RGNPHVAPTRGDLLKCNVSDKADWNTRLYLQDWGQQSKIGYRQSNLEDQCTHRYKIYIEG  336

Query  1293  SAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNH  1472
              AWSVSEKYILACDS+TLL++P Y+DF+ RGL+P++HYWPIRD++KC+ ++ AV+WGNNH
Sbjct  337   WAWSVSEKYILACDSMTLLIRPRYHDFFIRGLVPLQHYWPIRDNNKCRDLRFAVEWGNNH  396

Query  1473  HQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCG  1652
               +AQ +G   SK+IQE+LKM+YVYDYMFHLL+EYAKLLK+KPT+PP AVE+C+E M C 
Sbjct  397   TDKAQTMGETTSKFIQEDLKMDYVYDYMFHLLNEYAKLLKFKPTIPPGAVEVCAETMACP  456

Query  1653  ANGLEKQFMMESLVKAAPSTTAPCTMPPPFDP  1748
             A G  ++FM ESL K  P+ T PC++PPP+DP
Sbjct  457   AEGAWRKFMEESLEK-NPTDTTPCSLPPPYDP  487



>gb|KCW78050.1| hypothetical protein EUGRSUZ_D02274, partial [Eucalyptus grandis]
Length=496

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/420 (60%), Positives = 319/420 (76%), Gaps = 12/420 (3%)
 Frame = +3

Query  498   PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWR  677
             PL C+      +CP NY  +  LT+               S+S+CP YF+WI++DL  W+
Sbjct  65    PLQCTNDKLAQTCPRNYPITQNLTKQHQN---------HASTSQCPSYFKWIHEDLRPWK  115

Query  678   ESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPD  857
             E+GI+R+MV  ARRTA+FRLV+++G AY   YR + Q+RD FTLWGILQLLRRYPG++PD
Sbjct  116   ETGITRDMVERARRTAHFRLVVLDGRAYVEKYRSAVQTRDVFTLWGILQLLRRYPGRLPD  175

Query  858   LDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPW  1037
             L+LMFD  D P+I+ + Y      + PP LFRYCGD  T DIVFPDWSFWGW E NIKPW
Sbjct  176   LELMFDCDDRPLIQMKDY--RRPKSGPPPLFRYCGDGKTLDIVFPDWSFWGWVETNIKPW  233

Query  1038  EGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQ  1217
               + K++ EGN +IKW DR PYAYWKGNP+VA+TR+DLLKCNV++K DW AR++ QDW +
Sbjct  234   THVLKDIGEGNKRIKWEDRVPYAYWKGNPDVASTRRDLLKCNVTDKYDWNARLFKQDWGK  293

Query  1218  EHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPM  1397
             + K+GY+QSNL DQC HRYKIYI+G AWSVS+KYILACDS+TL V+P YYDF+TRG++P+
Sbjct  294   QSKRGYKQSNLEDQCTHRYKIYIDGWAWSVSKKYILACDSMTLFVRPSYYDFFTRGMVPL  353

Query  1398  KHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEY  1577
             +HYWPIRD+ KC S+K AV+WGNNH  +A+ I   GS +I  ELKMEYVYDYM+H+LSEY
Sbjct  354   QHYWPIRDNSKCTSLKFAVEWGNNHTNEAKTIANGGSHFIFNELKMEYVYDYMYHVLSEY  413

Query  1578  AKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              +LL YKP +PP+AVE+CSE M C +NG  ++FM ES+V  +P   APCT+PPPFDP +L
Sbjct  414   GRLLTYKPRIPPKAVEVCSETMACPSNGTYRRFMEESMV-MSPRGGAPCTLPPPFDPPSL  472



>ref|XP_008393993.1| PREDICTED: protein O-glucosyltransferase 1-like [Malus domestica]
 ref|XP_008353980.1| PREDICTED: protein O-glucosyltransferase 1-like [Malus domestica]
Length=523

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/507 (53%), Positives = 339/507 (67%), Gaps = 17/507 (3%)
 Frame = +3

Query  249   MVRPHILKMRETSEGARLYRHFTDTNWRPL----PAIKTLPRSSLAVFFFMVLCVGAFVS  416
             M R +   + E  +G  L+RHF  T+WRPL         +    L +     L    ++ 
Sbjct  1     MKRNNGKHLYELLDGTGLHRHFIGTSWRPLQKRSATASLIFFLLLLLLCVAALLSAGWID  60

Query  417   TRLLDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDs  596
             TR    + T  + + +  ++  +    PL C+    +       YP++       R  + 
Sbjct  61    TRKFIFSGTYSNESIIPTKETPKRXEFPLQCTKGINVTQTCPRTYPTTHNPTNPNRPSNL  120

Query  597   psptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYR  776
                        CP +FRWI++DL  W+ +GI+R+M+  AR+TA+FRLVIV+G AY   YR
Sbjct  121   T----------CPSHFRWIHEDLRPWKGTGITRDMIERARKTAHFRLVIVDGKAYIEKYR  170

Query  777   KSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRY  956
             +S Q+RD FTLWGILQLLR YPG++PDL+LMFD  D PV++ + +        PP +FRY
Sbjct  171   QSIQTRDMFTLWGILQLLRVYPGRLPDLELMFDCDDRPVVRSKDF--RGPNVGPPPVFRY  228

Query  957   CGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA  1136
             C DE + DIVFPDWSFWGW EINIKPW  L   +KEGN + KW DR PYAYWKGNP VA 
Sbjct  229   CADEESLDIVFPDWSFWGWXEINIKPWRSLLPSIKEGNKRTKWKDRIPYAYWKGNPHVAP  288

Query  1137  TRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEK  1316
             TRKDLLKCNVSEK DW  R+Y QDW +E KQGY+QSNL DQC HRYKIY+EG AWSVSEK
Sbjct  289   TRKDLLKCNVSEKNDWNTRLYIQDWEKESKQGYKQSNLEDQCKHRYKIYVEGWAWSVSEK  348

Query  1317  YILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIG  1496
             YI+AC+S TL VKP YYDF+ R + P++HYWPIRD+ KC S+K AV+WGNNH  + QEIG
Sbjct  349   YIMACNSXTLYVKPRYYDFFMRSMTPLQHYWPIRDNSKCTSLKFAVEWGNNHTDKVQEIG  408

Query  1497  MAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQF  1676
              A SK+IQE+LKM+YVYDYMFH+L+EYAKLL++K T+PP AVELCSE M C ANG  K F
Sbjct  409   EAASKFIQEDLKMDYVYDYMFHVLNEYAKLLQFKATIPPSAVELCSETMACAANGTWKNF  468

Query  1677  MMESLVKAAPSTTAPCTMPPPFDPATL  1757
             M+ES+VK  PS   PCT+PPP+    L
Sbjct  469   MVESMVK-YPSDELPCTLPPPYXSPAL  494



>ref|XP_004510812.1| PREDICTED: protein O-glucosyltransferase 1-like [Cicer arietinum]
Length=511

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/457 (57%), Positives = 325/457 (71%), Gaps = 21/457 (5%)
 Frame = +3

Query  390   VLCVGAFVSTRLLDS-TVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKL  566
               C  A ++T ++   ++  Q+ + +S  K  E E P L C+  T   +CP NY      
Sbjct  46    TFCDFAALNTYIIAGVSIENQNLSSISIDKHQEQEFP-LECTKGT--QTCPRNYPTKHNP  102

Query  567   TRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIV  746
             T     I              CP YF+WI++DL AWRE GI+REM+  ARRTANF++VIV
Sbjct  103   TNHNNHI--------------CPSYFKWIHEDLKAWREKGITREMLEGARRTANFKVVIV  148

Query  747   NGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDT  926
              G  Y   Y+KS Q+RD FTLWGILQLLR YPGK+PDL+LMFD  D PVI    +     
Sbjct  149   EGRLYLEKYKKSIQTRDVFTLWGILQLLRLYPGKLPDLELMFDCEDRPVIHLDKF--QGP  206

Query  927   TTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYA  1106
               +PP LFRYC D+ + DIVFPDWSFWGW E NIKPW+ + K++KEGN + KW DR PYA
Sbjct  207   NASPPPLFRYCSDQWSLDIVFPDWSFWGWAETNIKPWKEVLKDIKEGNKRTKWKDRVPYA  266

Query  1107  YWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYI  1286
             YWKGNP+VAATRK+L+KCNV+ K DW  R+Y QDW +E  QGY++S+L +QC HRYKIYI
Sbjct  267   YWKGNPKVAATRKNLMKCNVTSKNDWNTRLYVQDWDKESNQGYKKSSLGNQCTHRYKIYI  326

Query  1287  EGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGN  1466
             EG AWSVSEKYILACDS+TL V+P Y+DF+ RG+ P++HYWPIRDD KC S+K AV+WGN
Sbjct  327   EGWAWSVSEKYILACDSMTLYVRPKYHDFFIRGMEPLQHYWPIRDDSKCTSLKFAVEWGN  386

Query  1467  NHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMV  1646
             NH  +AQ IG A SK+IQE+L M  VY YMFHLL+EYAKLLK+KPT+P  A+E CSE M 
Sbjct  387   NHVDKAQSIGEAASKFIQEDLDMNNVYSYMFHLLNEYAKLLKFKPTIPQGAIEFCSETMA  446

Query  1647  CGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             CG NG +++FM ES+VK  PS + PCT+PPP+DP TL
Sbjct  447   CGVNGTQRKFMEESMVK-FPSDSNPCTIPPPYDPLTL  482



>ref|XP_010240178.1| PREDICTED: O-glucosyltransferase rumi homolog [Brachypodium distachyon]
Length=547

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 238/377 (63%), Positives = 302/377 (80%), Gaps = 3/377 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             CP YFR+I++DL  WRE+G ++R M+  AR TA+FRLV++ G  +   +R +FQ+RD FT
Sbjct  149   CPSYFRFIHEDLRPWREAGGVTRAMLARARVTASFRLVVLRGRVFVQRFRPAFQTRDLFT  208

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WGILQL+RRYPG+VPDLDLMFD VDWPV++   Y        PP LFRYCGD+ T DIV
Sbjct  209   IWGILQLIRRYPGRVPDLDLMFDCVDWPVVRTHLYRGKHAPFMPP-LFRYCGDDRTLDIV  267

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGWPEINIKPW  L KELK+GN K++W+DREPYAYWKGN  VA +R++L++CNV
Sbjct  268   FPDWSFWGWPEINIKPWGALQKELKDGNNKVRWLDREPYAYWKGNAAVAVSRRELVQCNV  327

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTL  1346
             S  QDW AR+Y QDW +E + GY+ S+L+ QC +RYKIYIEGSAWS+S+KYILACDS+TL
Sbjct  328   SSTQDWNARIYTQDWFKEGRTGYKSSDLSSQCTYRYKIYIEGSAWSISQKYILACDSMTL  387

Query  1347  LVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEE  1526
             LV P YYDF++R LMP++HYWP+R D+KC SIK+AVDWGN+H Q AQ IG   S +IQEE
Sbjct  388   LVTPKYYDFFSRSLMPIQHYWPVRGDNKCASIKYAVDWGNSHKQLAQSIGKGASNFIQEE  447

Query  1527  LKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAP  1706
             +KM++VYDYM HLL+EYAKLL++KPT PPEAVE+CS  +VC A G+E +F+MES+VK+A 
Sbjct  448   VKMDHVYDYMLHLLTEYAKLLRFKPTKPPEAVEVCSHSLVCQAEGIEMKFLMESMVKSA-  506

Query  1707  STTAPCTMPPPFDPATL  1757
               + PC +P PF+P  L
Sbjct  507   HDSGPCDLPSPFNPQEL  523



>ref|XP_004306802.1| PREDICTED: O-glucosyltransferase rumi-like [Fragaria vesca subsp. 
vesca]
Length=525

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/511 (53%), Positives = 348/511 (68%), Gaps = 22/511 (4%)
 Frame = +3

Query  249   MVRPHILKMRETSEGARLYRHFTDTNWRPL----PAIKTLPRSSLAVFFFMVLCVGAFVS  416
             M R +   + +  +G+ L+RH   ++W+PL        T+    L  FF   L  GA  S
Sbjct  1     MKRNNAKHLYDILDGSGLHRHIAGSSWQPLKKRSATFTTIAFLFLLFFFVAALVYGAGWS  60

Query  417   TRL---LDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMA-SCPANYYPSSKLTRTRTR  584
               +   + S  ++          I +    PL C+  T +  +CP  Y   SK   T   
Sbjct  61    VDIDSFIFSGASSNKSILTPTTTIPKTIEFPLQCTTDTNVTQTCPRTY--PSKHNPTNPN  118

Query  585   IQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYY  764
             +  + +         CP YFRWI++DL  WRE+GI+R+MV  ARRTA+FRLVIV+G AY 
Sbjct  119   LPSNVT---------CPAYFRWIHEDLRPWRETGITRDMVERARRTAHFRLVIVDGKAYL  169

Query  765   HNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPA  944
               YR+S Q+RD FTLWGILQLLR YPG++PDL++MFD  D PV++ + +        PP 
Sbjct  170   EKYRQSIQTRDMFTLWGILQLLRVYPGRLPDLEIMFDCDDRPVVRSRDF--QGPNAGPPP  227

Query  945   LFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNP  1124
             +FRYC DE + DIVFPDWSFWGW E NIKPW+ L  ++KEGN + KW DR PYAYWKGNP
Sbjct  228   VFRYCADEGSLDIVFPDWSFWGWAETNIKPWKNLLPKIKEGNKRTKWKDRVPYAYWKGNP  287

Query  1125  EVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWS  1304
              VA TRKDLLKCNVS++ DW   +Y Q+W +E K+GY+QS+L DQC HRYKIYIEG AWS
Sbjct  288   NVAPTRKDLLKCNVSDQNDWNTLLYIQNWEKESKEGYKQSSLEDQCKHRYKIYIEGWAWS  347

Query  1305  VSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQA  1484
             VSEKYI+ACDS+TL V PH+YDFY RG++P++HYWPIRD+ KC S+K AV+WGNNH ++A
Sbjct  348   VSEKYIMACDSMTLYVNPHFYDFYMRGMLPLEHYWPIRDNSKCTSLKFAVEWGNNHTEKA  407

Query  1485  QEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGL  1664
             + IG A S +IQE+LKM+YVYDYMFH+L+EYAKLLK+KPT+PP AVELCSE M C   G 
Sbjct  408   EAIGKAASNFIQEDLKMDYVYDYMFHVLNEYAKLLKFKPTIPPNAVELCSETMACPTTGT  467

Query  1665  EKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
               +FM ES+V  +PS   PC++PPP+DP  L
Sbjct  468   WNKFMEESMV-MSPSDEIPCSLPPPYDPQAL  497



>ref|XP_002320120.2| hypothetical protein POPTR_0014s07740g [Populus trichocarpa]
 gb|EEE98435.2| hypothetical protein POPTR_0014s07740g [Populus trichocarpa]
Length=515

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/490 (53%), Positives = 341/490 (70%), Gaps = 27/490 (6%)
 Frame = +3

Query  306   RHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTV---TAQHPTRLSHQK  476
             R+ T   WR    +K    +++ V FF++L +GA V     D++V    ++ PT      
Sbjct  18    RYLTKQPWR---TVKKRDAATVLVAFFLILFLGALVFVGWFDASVFRGISRKPT------  68

Query  477   IIENEIP---PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFR  647
             +    +P   PL C+      +CP NY      T    R  +  S         CP YF+
Sbjct  69    LTPTGMPSEFPLRCATGNLKQTCPENYPTKHNPTTNPDRPSNLTST--------CPSYFQ  120

Query  648   WIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQL  827
             WI+DDL  W+E+GI+++M+  AR+TA+FRLVIVNG AY   YR+S Q+RD FTLWGILQL
Sbjct  121   WIHDDLRHWKETGITQDMIERARKTAHFRLVIVNGKAYVEKYRQSIQTRDMFTLWGILQL  180

Query  828   LRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFW  1007
             LR YPG++PDL+LMFD  D PVI  + +       APP LFRYC D  + DIVFPDWSFW
Sbjct  181   LRLYPGRLPDLELMFDCDDRPVIPSKHF--RGPNAAPPPLFRYCSDWQSLDIVFPDWSFW  238

Query  1008  GWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWG  1187
             GW E NI+PW+ L KE+KEGN + KW DR PYAYW+GNP V+  R+DLLKCNVSE+ DW 
Sbjct  239   GWAETNIRPWKNLLKEIKEGNSRTKWKDRTPYAYWRGNPWVSPIRQDLLKCNVSEQNDWN  298

Query  1188  ARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYY  1367
              R+Y QDW+++ K+GY++SNL DQC HRYKIYIEG AWSVSEKYILACDS+TL V+P Y+
Sbjct  299   TRLYLQDWVKQSKEGYRESNLQDQCTHRYKIYIEGWAWSVSEKYILACDSVTLYVRPRYH  358

Query  1368  DFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVY  1547
             DF+ RG++P++HYWPIRD+ KC S+K AV+WGNNH ++AQ IG A S +I E++K++YVY
Sbjct  359   DFFIRGMVPLQHYWPIRDNSKCTSLKFAVEWGNNHTKEAQAIGEAASNFIHEDMKIDYVY  418

Query  1548  DYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCT  1727
             DY+FHLL+EYAKLLK+KP +PP A ELC E M C  NG+ ++FM ES+V  +PS   PCT
Sbjct  419   DYIFHLLNEYAKLLKFKPKIPPGADELCPETMACPTNGIHRKFMEESMV-LSPSDAIPCT  477

Query  1728  MPPPFDPATL  1757
             + PP DP+ L
Sbjct  478   L-PPHDPSVL  486



>ref|XP_004143920.1| PREDICTED: O-glucosyltransferase rumi-like [Cucumis sativus]
 gb|KGN50116.1| hypothetical protein Csa_5G154780 [Cucumis sativus]
Length=514

 Score =   531 bits (1368),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 271/476 (57%), Positives = 332/476 (70%), Gaps = 38/476 (8%)
 Frame = +3

Query  375   VFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQ--KIIENEIP--PLNCSL-----RTPM  527
             +FF   + +    STRL     T  H   L +Q  KI +  I   PLNCS      +T  
Sbjct  37    IFFLAAVLIS---STRL---QFTLFHTNFLGNQTEKIPKKSIKYYPLNCSSSSTTNQTQH  90

Query  528   ASC----PANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISR  695
              +C    P  Y P S     R+                CP+YFRWI++DL  W   GI+R
Sbjct  91    FTCRKDYPTLYEPESIGPSGRS---------------VCPEYFRWIHEDLKPWAAGGITR  135

Query  696   EMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFD  875
             EMV   + TA+FRL +V GI Y  +Y+KS Q+RD FT+WGILQLLRRYPG++PDL+LMFD
Sbjct  136   EMVEKGKATAHFRLAVVRGIVYVEHYKKSIQTRDLFTIWGILQLLRRYPGQIPDLELMFD  195

Query  876   TVDWPVIKKQSY--VLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLS  1049
               D PV+K   Y     DT  APP +FRYCGDE T DIVFPDWSFWGW EINI+PWE L 
Sbjct  196   CDDRPVVKSADYRNAGVDTVEAPP-VFRYCGDEETLDIVFPDWSFWGWAEINIRPWENLL  254

Query  1050  KELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQ  1229
             KELK+GN K KW+ RE +AYWKGNP VA TR+DLLKCN+S + DW AR+Y QDWIQE +Q
Sbjct  255   KELKKGNEKRKWMKREAFAYWKGNPYVADTRQDLLKCNLSLQNDWNARLYIQDWIQESQQ  314

Query  1230  GYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYW  1409
             GY+QS LA+QC +RYKIYIEG  WSVSEKYILACDS+TLLVKP++YDF++R L P+ HYW
Sbjct  315   GYKQSKLANQCTYRYKIYIEGYGWSVSEKYILACDSMTLLVKPNFYDFFSRSLEPLHHYW  374

Query  1410  PIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLL  1589
             P+ DD KCKSIK AV WGN+H Q+AQ+IG   S +IQ+EL+ME VYDYMFHLL+ YAKLL
Sbjct  375   PLSDDHKCKSIKFAVHWGNSHKQKAQDIGKTASNFIQQELRMENVYDYMFHLLNHYAKLL  434

Query  1590  KYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +++P +P  A+E+CSE M C  +G EK+FM ES+VK  PS T PC+MPPPFD  +L
Sbjct  435   RFQPEIPTGAMEVCSETMACPRDGPEKKFMKESMVK-TPSLTIPCSMPPPFDTPSL  489



>ref|XP_006491072.1| PREDICTED: O-glucosyltransferase rumi homolog [Citrus sinensis]
Length=531

 Score =   531 bits (1367),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 251/463 (54%), Positives = 334/463 (72%), Gaps = 21/463 (5%)
 Frame = +3

Query  372   AVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANY-  548
             +VFF      G F S+  + S +  Q+    + +  IE +   L C+      SCP NY 
Sbjct  63    SVFF------GWFHSS--IFSGIVHQNSVITTAKSPIEQQEFDLQCTKHNVTQSCPTNYS  114

Query  549   YPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTAN  728
             YP+    +   R  +  +         CP YFRWI++DL  WR+SGI+++M+  AR+TA+
Sbjct  115   YPTPHNPKNPDRPSNLST---------CPSYFRWIHEDLRHWRDSGITKDMIERARKTAH  165

Query  729   FRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQS  908
             FRLVIVNG AY   Y++S Q+RD FTLWGILQLLR YPG++PDL+LMFD  D PV++ + 
Sbjct  166   FRLVIVNGKAYVEKYKQSIQTRDKFTLWGILQLLRLYPGRLPDLELMFDCNDRPVVRARD  225

Query  909   YVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWV  1088
             +      + PP LFRYC D ++ DIVFPDWSFWGW E NI+PW  + K+++EGN + KW 
Sbjct  226   F--GGPNSGPPPLFRYCSDGSSLDIVFPDWSFWGWAETNIRPWSNVLKDIEEGNKRTKWK  283

Query  1089  DREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIH  1268
             +R PYAYW+GNP V+  RK+L+ CN S+K DW AR+Y QDW QE KQ ++QSNL DQC H
Sbjct  284   ERVPYAYWRGNPNVSPIRKELMTCNASDKNDWNARLYVQDWGQESKQNFKQSNLGDQCSH  343

Query  1269  RYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKH  1448
             RYKIYIEG AWSVSEKYILACDS+TL+V+P YYDF++RG++PM+HYWPIRD+ KC S+K 
Sbjct  344   RYKIYIEGWAWSVSEKYILACDSMTLIVRPRYYDFFSRGMVPMQHYWPIRDNSKCTSLKF  403

Query  1449  AVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVEL  1628
             AVDWGN H ++A+ IG A S++I+E+LKM YVYDYMFHLL+EYA+LL++KP++P  A+EL
Sbjct  404   AVDWGNAHTEKAEAIGEAASRFIREDLKMGYVYDYMFHLLNEYARLLRFKPSIPAGALEL  463

Query  1629  CSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             CSE M C A G  ++FM ES+VK +PS + PC++PPP+ P+ L
Sbjct  464   CSETMACSAKGTWRKFMEESMVK-SPSDSIPCSLPPPYHPSAL  505



>ref|XP_006445081.1| hypothetical protein CICLE_v10019760mg [Citrus clementina]
 gb|ESR58321.1| hypothetical protein CICLE_v10019760mg [Citrus clementina]
Length=512

 Score =   530 bits (1365),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 247/444 (56%), Positives = 324/444 (73%), Gaps = 21/444 (5%)
 Frame = +3

Query  453   PTRLSHQKI--------IENEIPPLNCSLRTPMASCPANY-YPSSKLTRTRTRIQDspsp  605
             P R+ HQ          IE +   L C+      SCP NY YP+    +   R  +  + 
Sbjct  55    PLRIVHQNSVITTAKSPIEQQEFDLQCTKHNVTQSCPTNYSYPTPHNPKNPDRPSNLST-  113

Query  606   tptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSF  785
                     CP YFRWI++DL  WR+SGI+++M+  AR+TA+FRLVIVNG AY   Y++S 
Sbjct  114   --------CPSYFRWIHEDLRHWRDSGITKDMIERARKTAHFRLVIVNGKAYVEKYKQSI  165

Query  786   QSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGD  965
             Q+RD FTLWGILQLLR YPG++PDL+LMFD  D PV++ + +      + PP LFRYC D
Sbjct  166   QTRDKFTLWGILQLLRLYPGRLPDLELMFDCNDRPVVRARDF--GGPNSGPPPLFRYCSD  223

Query  966   EATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRK  1145
              ++ DIVFPDWSFWGW E NI+PW  + K+++EGN + KW +R PYAYW+GNP V+  RK
Sbjct  224   GSSLDIVFPDWSFWGWAETNIRPWSNVLKDIEEGNKRTKWKERVPYAYWRGNPNVSPIRK  283

Query  1146  DLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYIL  1325
             +L+ CN S+K DW AR+Y QDW QE KQ ++QSNL DQC HRYKIYIEG AWSVSEKYIL
Sbjct  284   ELMTCNASDKNDWNARLYVQDWGQESKQNFKQSNLGDQCSHRYKIYIEGWAWSVSEKYIL  343

Query  1326  ACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAG  1505
             ACDS+TL+V+P YYDF++RG++PM+HYWPIRD+ KC S+K AVDWGN H ++A+ IG A 
Sbjct  344   ACDSMTLIVRPRYYDFFSRGMVPMQHYWPIRDNSKCTSLKFAVDWGNAHTEKAEAIGEAA  403

Query  1506  SKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMME  1685
             S++I+E+LKM YVYDYMFHLL+EYA+LL++KP++P  A+ELCSE M C A G  ++FM E
Sbjct  404   SRFIREDLKMGYVYDYMFHLLNEYARLLRFKPSIPAGALELCSETMACSAKGTWRKFMEE  463

Query  1686  SLVKAAPSTTAPCTMPPPFDPATL  1757
             S+VK +PS + PC++PPP+ P+ L
Sbjct  464   SMVK-SPSDSIPCSLPPPYHPSAL  486



>gb|EMS55632.1| hypothetical protein TRIUR3_02972 [Triticum urartu]
Length=461

 Score =   528 bits (1360),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 234/350 (67%), Positives = 287/350 (82%), Gaps = 2/350 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             M+  AR TANFRLV++ G AY      +FQ+RD FT+WGILQLLRRYPG+VPDLDLMFD 
Sbjct  1     MIDRARATANFRLVVLRGRAYIERIAPAFQTRDLFTIWGILQLLRRYPGRVPDLDLMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPV+    Y   D  TA P LFRYCGD  T D+VFPDWSFWGW EINIKPW+ L K+L
Sbjct  61    VDWPVVHADEY-QGDNATAMPPLFRYCGDNETLDVVFPDWSFWGWAEINIKPWDALQKDL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
              EGN K++W+DREPYAYWKGNP+VAA R++L+KCNVS +Q+W AR++ QDWI+E K GY+
Sbjct  120   NEGNKKVRWIDREPYAYWKGNPDVAAIRQELVKCNVSSEQEWNARIFKQDWIKESKAGYK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             +SNLA QC HRYKIYIEGSAWSVSEKYILACDS+TL++KP YYDF++R LMP +HYWP+R
Sbjct  180   KSNLASQCTHRYKIYIEGSAWSVSEKYILACDSMTLVIKPKYYDFFSRVLMPTQHYWPVR  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             DD+KC SIK+AVDWGN+H ++AQ+IG   SK+IQ+EL M+Y+YDYMFHLL+EYAKLL++K
Sbjct  240   DDNKCGSIKYAVDWGNSHKKKAQQIGKKASKFIQQELSMDYIYDYMFHLLTEYAKLLRFK  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDP  1748
             PT PPEAVE+C E + C A G EK+FM +S+VK+A +   PC +PPPF P
Sbjct  300   PTKPPEAVEVCPESLACQAIGREKKFMQDSMVKSA-NIAGPCNLPPPFSP  348



>gb|KDO59999.1| hypothetical protein CISIN_1g016930mg [Citrus sinensis]
Length=380

 Score =   525 bits (1351),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 241/353 (68%), Positives = 295/353 (84%), Gaps = 2/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MV  AR+TANFRLVIV G AY   Y K+FQSRDTFTLWGILQLLRRYPG++PDLDLMFD 
Sbjct  1     MVERARKTANFRLVIVKGKAYVETYTKAFQSRDTFTLWGILQLLRRYPGRIPDLDLMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPV+ + +Y   D    P  LFRYC ++ T+DIVFPDWSFWGWPE+NIK WE   K+L
Sbjct  61    VDWPVVLRNAYCAPDAPAPP-PLFRYCANDQTYDIVFPDWSFWGWPEVNIKSWEPQLKDL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             +EGN +IKW DREPYAYWKGNP VA TR+DL+KCNVSE Q+W ARV+AQDWI+E ++GY+
Sbjct  120   EEGNGRIKWSDREPYAYWKGNPTVAPTRQDLMKCNVSEGQEWNARVFAQDWIKEQQEGYK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             QS+LA QC  R+KIYIEGSAWSVSEKYILACDS+TL+V P YYDFYTRGLMP+ HYWPI 
Sbjct  180   QSDLASQCRDRFKIYIEGSAWSVSEKYILACDSVTLIVTPKYYDFYTRGLMPLHHYWPIN  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             D DKC+SIK AVDWGN+H ++A+ +G A SK+IQ+ELK++YVYDYMFHLL++Y+KLL+Y+
Sbjct  240   DHDKCRSIKFAVDWGNSHKKKAKAMGRAASKFIQDELKLDYVYDYMFHLLNQYSKLLRYQ  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             PTVPPEAVE C+E++ C   G  ++FM ESLV+ +P  T+PCT+PP +DP++L
Sbjct  300   PTVPPEAVEYCAERLACAEEGPARKFMEESLVQ-SPKETSPCTLPPSYDPSSL  351



>gb|AFW63189.1| hypothetical protein ZEAMMB73_601289 [Zea mays]
Length=578

 Score =   531 bits (1369),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 250/401 (62%), Positives = 299/401 (75%), Gaps = 30/401 (7%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             CP YFR+I++DL  WR +G I+R MV  AR TANFRLV++ G AY      +FQ+RD FT
Sbjct  148   CPAYFRFIHEDLHPWRAAGGITRAMVDRARATANFRLVVIRGRAYIERIAPAFQTRDLFT  207

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WGILQLLRRYPG+VPDLDLMFD VDWPV+    Y   + T  PP LFRYCGD  T D+V
Sbjct  208   IWGILQLLRRYPGRVPDLDLMFDCVDWPVVHADQYQGENATLLPP-LFRYCGDNETLDVV  266

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGWPEINIKPW+ L KEL  GN ++KW+ REPYAYWKGNP+VA TR++L+KCNV
Sbjct  267   FPDWSFWGWPEINIKPWDALQKELNGGNKRVKWLAREPYAYWKGNPDVAVTRQELVKCNV  326

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHR-------------------------  1271
             S K +W AR+Y QDW++E K GY+QS+LA QC HR                         
Sbjct  327   SSKHEWNARIYKQDWLKEIKAGYKQSDLASQCTHRFLFFLLADKLKYTLSVHNTEILSLG  386

Query  1272  --YKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIK  1445
               YKIYIEGSAWSVSEKYILACDS+TL+V P YYDFY+R LMPM+HYWPI DD+KC SIK
Sbjct  387   DRYKIYIEGSAWSVSEKYILACDSMTLVVTPKYYDFYSRVLMPMQHYWPIWDDNKCSSIK  446

Query  1446  HAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVE  1625
              AVDWGN+H Q+AQ IG  GS +IQ+EL MEYVYDYMFHLL+EYAKLL++KP  PPEA+E
Sbjct  447   FAVDWGNSHKQKAQRIGKQGSNFIQKELSMEYVYDYMFHLLTEYAKLLRFKPRKPPEAIE  506

Query  1626  LCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDP  1748
             +C E + C A G EK+FM +S+V++A S   PC +PPPF P
Sbjct  507   VCPESLACQAIGREKKFMEDSMVRSA-SDAGPCDLPPPFSP  546



>ref|XP_003618993.1| KTEL motif-containing protein [Medicago truncatula]
 gb|KEH18904.1| glycosyltransferase family 90 protein [Medicago truncatula]
Length=515

 Score =   528 bits (1361),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 252/473 (53%), Positives = 328/473 (69%), Gaps = 21/473 (4%)
 Frame = +3

Query  351   TLPRSSLAVFFFMVLCVGAFVSTR---LLDSTVTAQHPTRLSHQKIIENEIPPLNCSL-R  518
             T+  +++   F +V     F +     +  +++  Q+ + +   K  + +  PL C+   
Sbjct  31    TIATTTVVALFCLVATFCDFATWNTYIIAGNSIPNQNLSSIQISKNHKEQEFPLRCTNGE  90

Query  519   TPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISRE  698
                 +CP +Y      T   +                CP +FRWI++DL  W+E GI+RE
Sbjct  91    KETQTCPRDYPTKHNPTNQNSHT--------------CPSFFRWIHEDLKPWKEKGITRE  136

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             M+  A+RTANF++VIV+G  Y   YRKS Q+RD FTLWGILQLLR +PGK+PDL+LMFD 
Sbjct  137   MLEGAKRTANFKVVIVDGKMYVEKYRKSIQTRDVFTLWGILQLLRMFPGKLPDLELMFDC  196

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
              D PVI K ++       +PP LFRYC D+ + DIVFPDWSFWGW E NIKPW+ + KE+
Sbjct  197   EDRPVIHKGNF--QGPNASPPPLFRYCSDQWSLDIVFPDWSFWGWAETNIKPWKNILKEI  254

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             KEGN + KW DR PYAYWKGNP VAATRK+LL+CN + K DW  R+Y QDW +E  QGY+
Sbjct  255   KEGNKETKWKDRVPYAYWKGNPNVAATRKNLLRCNATSKDDWNTRLYIQDWDKESTQGYK  314

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             +S+L +QC HRYKIYIEG AWSVSEKYI+ACDS+TL V+P++YDF+ RG+ P++HYWPIR
Sbjct  315   KSSLGNQCTHRYKIYIEGWAWSVSEKYIMACDSMTLYVRPNFYDFFIRGMDPLQHYWPIR  374

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             D+ KC S+K AVDWGN H  +AQ IG A SK+IQEEL M  VY+YMFH+L+EYAKLLK+K
Sbjct  375   DNSKCTSLKFAVDWGNKHADKAQAIGEAASKFIQEELDMNNVYNYMFHILNEYAKLLKFK  434

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             PT+P  AVE CSE M C  NG +++FM ES+VK  PS + PCT+PPP+DP TL
Sbjct  435   PTIPQGAVEFCSETMACDVNGNQRKFMEESMVK-VPSDSNPCTIPPPYDPLTL  486



>ref|XP_002511835.1| KDEL motif-containing protein 1 precursor, putative [Ricinus 
communis]
 gb|EEF50504.1| KDEL motif-containing protein 1 precursor, putative [Ricinus 
communis]
Length=522

 Score =   528 bits (1359),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 245/422 (58%), Positives = 310/422 (73%), Gaps = 16/422 (4%)
 Frame = +3

Query  498   PLNCSLRTP--MASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWA  671
             PL C+  TP    +CPA+YYP +  +    R  +            CP YF+WI++DL  
Sbjct  87    PLRCTA-TPNITQTCPADYYPKTHNSTNSDRQSNVI----------CPSYFKWIHEDLRP  135

Query  672   WRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKV  851
             WRE+GI+R+M+  ARRTA+FRLVIV+G AY   YR+S Q+RD  TLWGILQLLR YPGKV
Sbjct  136   WRETGITRDMIERARRTAHFRLVIVDGRAYVEKYRQSIQTRDMITLWGILQLLRLYPGKV  195

Query  852   PDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIK  1031
             PDL+LMFD  D PV++ + +     T  PP LFRYC D+ + DIVFPDWSFWGW E+NIK
Sbjct  196   PDLELMFDCDDRPVVRSEDFP--GPTAGPPPLFRYCADDTSLDIVFPDWSFWGWAEVNIK  253

Query  1032  PWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDW  1211
             PW+ + K + +G+ + KW DR PYAYWKGNP V+A R DL+ CNVS+K DW AR+YAQDW
Sbjct  254   PWKSMLKGITKGSKRKKWKDRVPYAYWKGNPYVSANRGDLMTCNVSDKHDWNARLYAQDW  313

Query  1212  IQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLM  1391
              +E +Q Y+ S L DQC HRYKIYIEG AWSVS+KYILACDS+TL+V P YYDF+ R ++
Sbjct  314   GKEIRQKYKHSKLEDQCTHRYKIYIEGRAWSVSDKYILACDSMTLVVNPAYYDFFMRSMV  373

Query  1392  PMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLS  1571
             P++HYWPIR  +KCK I+ AV+WGNNH  +A+ IG  GS++IQE LKMEY+Y YMFHLL 
Sbjct  374   PIQHYWPIRAKNKCKDIEFAVEWGNNHTDKAEAIGKGGSRFIQENLKMEYIYGYMFHLLK  433

Query  1572  EYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPA  1751
             EYAKLLK+KP +P    E+C+E + C  NGL ++FM ES+V  +PS+T PC MPPP+DPA
Sbjct  434   EYAKLLKFKPEIPKGGAEVCAESLACSENGLVRKFMKESMV-MSPSSTLPCAMPPPYDPA  492

Query  1752  TL  1757
              L
Sbjct  493   AL  494



>emb|CAN70600.1| hypothetical protein VITISV_027960 [Vitis vinifera]
Length=521

 Score =   527 bits (1358),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 254/474 (54%), Positives = 323/474 (68%), Gaps = 34/474 (7%)
 Frame = +3

Query  366   SLAVFFFMVLCVGAFVSTRLLDSTVTA------QHPTRLSHQKIIENEIPPLNCSLRTPM  527
             ++++F  +++ +GA VSTR ++ ++          PT+L  QK   +    LNC      
Sbjct  37    TVSLFTIILIFIGALVSTRCINVSILTGDFLKNTSPTKLHSQKFEYS----LNCREGNMS  92

Query  528   ASCPAN----YYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISR  695
              +CP      + P    + T                  CP+YFRWIY+DL  W ++GI+R
Sbjct  93    QTCPVTGPVAFEPGEPPSET------------------CPEYFRWIYEDLRPWMDTGITR  134

Query  696   EMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFD  875
              MV  AR  A+ R+V+V+G  Y   Y++  ++RD FT+WGILQLLR YPGK+PD DLMF+
Sbjct  135   AMVEKARPAASIRIVVVDGKVYVEKYKRVNRNRDEFTIWGILQLLRMYPGKLPDFDLMFE  194

Query  876   TVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKE  1055
               D P+IK   Y   D T  PP LF YCGD+ T+DIVFPDWSFWGWPE NIKPW G  K+
Sbjct  195   CRDRPMIKTHLYQGPDAT-VPPPLFHYCGDDETYDIVFPDWSFWGWPETNIKPWNGFKKD  253

Query  1056  LKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGY  1235
             LKEGN + KW+DREPYAYWKGN ++   RK+L KC  +++QDW AR+Y  DW +E + G+
Sbjct  254   LKEGNYRTKWIDREPYAYWKGNVKMGVVRKELFKCRNTDEQDWNARLYIMDWGREVQSGF  313

Query  1236  QQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPI  1415
             + S+LA QC HRYKIY EG AWSVSEKYILACDS+TLLVKP YY+F+TR L P+ HYWPI
Sbjct  314   KTSDLASQCTHRYKIYTEGIAWSVSEKYILACDSVTLLVKPQYYEFFTRSLQPLVHYWPI  373

Query  1416  RDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKY  1595
             +  D CKSIK A DW NNH ++AQ+IG AGS ++QEE+KM++VYDYMFHLLS YAKLLKY
Sbjct  374   KHKDMCKSIKFATDWCNNHTEKAQKIGKAGSSFVQEEIKMKFVYDYMFHLLSMYAKLLKY  433

Query  1596  KPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             KPTVPP AVE C E M C   GLEK + ++S+VK +PS T PC MPPPF  A L
Sbjct  434   KPTVPPMAVEFCPEMMACAVEGLEKDYKLQSMVK-SPSDTGPCIMPPPFSSAEL  486



>ref|XP_007220070.1| hypothetical protein PRUPE_ppa024728mg [Prunus persica]
 gb|EMJ21269.1| hypothetical protein PRUPE_ppa024728mg [Prunus persica]
Length=519

 Score =   527 bits (1358),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 262/500 (52%), Positives = 342/500 (68%), Gaps = 34/500 (7%)
 Frame = +3

Query  324   NWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIPPL  503
             +WRPL  I     ++  +F  ++  V A V    +D++ T +  T++S  K+   ++  L
Sbjct  3     SWRPLKKIT----AATIIFLLLIFFVAALVPAGWIDASKTNK--TKISLTKV---KLRFL  53

Query  504   NC-SLRTPMASC------------------PANYYPSSKLTRTRTR---IQDspsptptq  617
             N  S+R+ +  C                  P        +T+   R   I   P+     
Sbjct  54    NSTSIRSVVGDCFLLVRRRANTTTPKRPEFPLQCTEGINVTQACPRTYPITHDPTNPSRP  113

Query  618   sssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRD  797
             S+  CP YFRWI++DL  W+E+GI+R+M+    R A+FRL+IV+G AY   YR+SFQ+RD
Sbjct  114   SNLTCPSYFRWIHEDLRPWKETGITRDMIEKGLRAADFRLLIVDGKAYIEKYRQSFQTRD  173

Query  798   TFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATW  977
              FTLWGILQLLR YPG++PDL+LMF+  D PVI  + +        PP LF YC D+ + 
Sbjct  174   MFTLWGILQLLRLYPGRLPDLELMFNCGDLPVIPSKDF--RGPNAGPPPLFHYCADQWSL  231

Query  978   DIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLK  1157
             DIVFPDWSFWGW EINIKPW  L + +KEGN + KW DR PYAYWKGNP VA TRKDLLK
Sbjct  232   DIVFPDWSFWGWAEINIKPWRSLLQSIKEGNKRTKWEDRVPYAYWKGNPNVARTRKDLLK  291

Query  1158  CNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDS  1337
             CNVS+K  W   +Y Q+W+QE KQG++ SNL +QC HRYKIYIEG AWSVSEKYI+ACDS
Sbjct  292   CNVSDKNGWNTHLYIQNWVQESKQGFKDSNLENQCKHRYKIYIEGRAWSVSEKYIMACDS  351

Query  1338  LTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYI  1517
             +TL V+P Y+DF+ RG+ P++H+WPIRD+ KC S+K AV+WGNNH  +A+ IG A S +I
Sbjct  352   MTLYVRPRYHDFFIRGMEPLQHFWPIRDNSKCTSLKFAVEWGNNHKDKAKAIGEAASNFI  411

Query  1518  QEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVK  1697
             QE+LKM+YVYDYMFH+L+EYAKLLK+KPT+PP AVELCSE M C A G  K+FM+ES+V+
Sbjct  412   QEDLKMDYVYDYMFHVLNEYAKLLKFKPTMPPNAVELCSETMACPATGKWKKFMVESMVE  471

Query  1698  AAPSTTAPCTMPPPFDPATL  1757
              +PS   PCT+PPP+DP  L
Sbjct  472   -SPSDELPCTLPPPYDPLAL  490



>ref|XP_003533188.2| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Glycine 
max]
 ref|XP_006587315.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Glycine 
max]
Length=380

 Score =   522 bits (1344),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 241/353 (68%), Positives = 289/353 (82%), Gaps = 2/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MV  A++TANF+LVI+ G AY   Y K++Q+RD F++WGILQLLRRYPGK+PDL+LMFD 
Sbjct  1     MVERAKQTANFKLVILKGKAYLETYEKAYQTRDVFSIWGILQLLRRYPGKIPDLELMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPV+    Y     T  PP LFRYCG++AT DIVFPDWSFWGW E+NIKPWE L  EL
Sbjct  61    VDWPVLLVDRYN-GPNTEQPPPLFRYCGNDATLDIVFPDWSFWGWAEVNIKPWEILLGEL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             KEG  +I W++REPYAYWKGNP VA TR DL+KCNVSE QDW AR+YAQDW +E ++GY+
Sbjct  120   KEGTKRIPWLNREPYAYWKGNPVVAETRLDLMKCNVSENQDWNARLYAQDWGRESQEGYK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             +S+LA QC HRYK+YIEGSAWSVSEKYILACDS TLLVKPHYYDF+TRGL+P  HYWPI+
Sbjct  180   KSDLASQCTHRYKVYIEGSAWSVSEKYILACDSPTLLVKPHYYDFFTRGLIPGHHYWPIK  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             +DDKC+SIK AVDWGN+H Q+A +IG A S +IQEE+KM+YVYDYMFHLL+ YAKL +YK
Sbjct  240   EDDKCRSIKFAVDWGNSHKQRAHQIGKAASDFIQEEVKMDYVYDYMFHLLNSYAKLFRYK  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             P++   A E+C+E MVCGA G  K+FMMESLVK  P+ T PC+MP P+DP TL
Sbjct  300   PSLSANATEICAESMVCGAEGPVKKFMMESLVK-VPANTDPCSMPAPYDPPTL  351



>ref|XP_008439224.1| PREDICTED: protein O-glucosyltransferase 1-like [Cucumis melo]
Length=485

 Score =   526 bits (1354),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 256/474 (54%), Positives = 327/474 (69%), Gaps = 52/474 (11%)
 Frame = +3

Query  357   PRSSLAVFFFMVLCVGAFVSTRL------LDSTVTAQHPTRLSHQKIIENEIPPLNCSLR  518
             PRSS+ +FF  V+ +G F+S RL      L S V  Q P   S Q               
Sbjct  32    PRSSVIIFFAAVVLLGMFLSCRLFSLLLELKSNVMNQQPQGQSKQ---------------  76

Query  519   TPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISRE  698
                       YP   +  T                  CP+YFRWI++DL  W   GI++ 
Sbjct  77    ----------YPDRPMPAT------------------CPEYFRWIHEDLKPWAGRGITKS  108

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             M+  A++ A+FRL++V G AY   Y K++QSRD  T+WG++QLLRRYPGKVPDLDLMF+ 
Sbjct  109   MLEEAQKKAHFRLLVVEGKAYVEAYGKAYQSRDNLTVWGVVQLLRRYPGKVPDLDLMFNC  168

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
              D P I ++ Y       APP LFRY GD+ATWDIVFPDWSFWGWPEINIK WE + K++
Sbjct  169   DDRPEIYQKDYS-GPEKPAPPPLFRYSGDDATWDIVFPDWSFWGWPEINIKAWESILKDI  227

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             KEGN K++W+ R+PYAYWKGNP VA TR+DLLKCNV++KQDW AR+Y Q+W +E K G++
Sbjct  228   KEGNKKMEWMKRQPYAYWKGNPTVAYTRRDLLKCNVTQKQDWSARLYRQNWDKESKAGFK  287

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
              SNLA+QC++RYKIYIEG AWSVSEKYILACDS++L+V+P YYDF+TR L+PMKHYWPI 
Sbjct  288   DSNLANQCVYRYKIYIEGKAWSVSEKYILACDSVSLIVRPRYYDFFTRSLIPMKHYWPIS  347

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
              + KC SIK AV WGN HHQ+A  IG A SK I+EELKMEY+YDYMFHLL++Y+KLL +K
Sbjct  348   SNRKCSSIKFAVHWGNTHHQKAMAIGKAASKLIEEELKMEYIYDYMFHLLNQYSKLLTFK  407

Query  1599  PTVPPEAVELCSEKMVCGANG-LEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             PTVPP A EL S+ +   A G + ++ MMES+V  +P+ ++PC + PP+DP +L
Sbjct  408   PTVPPNATELSSDSLASAAKGSIIRKSMMESVV-TSPAESSPCALQPPYDPQSL  460



>ref|XP_010661761.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Vitis 
vinifera]
Length=514

 Score =   527 bits (1357),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 263/488 (54%), Positives = 331/488 (68%), Gaps = 39/488 (8%)
 Frame = +3

Query  336   LPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLS---------HQKIIEN  488
             LP +     +     FF++L +G F+STR    ++      R +         H K  E 
Sbjct  25    LPGLFKKSYTMNVSVFFIILLIGTFLSTRWSGVSIVTGDSFRTAWNYRSSTKPHYKRFEY  84

Query  489   EIPPLNCSLRTPMASCPAN----YYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIY  656
                 +NCS      +CP      + PS+  T T                  CP+YFRWIY
Sbjct  85    S---MNCSEGNMTKTCPVTLLTTFEPSNLSTGT------------------CPEYFRWIY  123

Query  657   DDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRR  836
             +DL  W E+GI+R+MV  A+  A+ R+V+V+G  Y   Y+  FQ+RD FT+WGILQ+LR 
Sbjct  124   EDLKPWTETGITRDMVERAKTPAHIRVVVVDGKVYTEKYKWVFQTRDVFTIWGILQVLRM  183

Query  837   YPGKVPDLDLMFDTVDWPVIKKQSYV-LNDTTTAPPALFRYCGDEATWDIVFPDWSFWGW  1013
             YPGK+PD DLMF+  D PVIKK  Y  LN   TAPP LF YCGD+ T DIVFPDWSFWGW
Sbjct  184   YPGKLPDFDLMFECGDKPVIKKHDYQGLN--ATAPP-LFHYCGDDETLDIVFPDWSFWGW  240

Query  1014  PEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGAR  1193
             PEI IKPW  L K+L+EGN K KWVDREPYAYWKGN ++  TR +L KC+ + +QDW AR
Sbjct  241   PEIRIKPWSTLRKDLREGNNKTKWVDREPYAYWKGNFKMGVTRHELSKCSKTNEQDWNAR  300

Query  1194  VYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDF  1373
             +Y  DW+QE + G++ ++L+ QC H+YKIY EG+AWSVSEKYILACDS+TLLVKP YYDF
Sbjct  301   IYNMDWLQEMQNGFKSADLSTQCTHKYKIYAEGAAWSVSEKYILACDSVTLLVKPQYYDF  360

Query  1374  YTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDY  1553
             +TR L P+ HYWPI+  D CKSIK A +W NNH Q+AQEI  AGS ++QE+LKM++VYDY
Sbjct  361   FTRSLQPLVHYWPIKLKDMCKSIKFATEWCNNHTQKAQEIAKAGSSFVQEKLKMKFVYDY  420

Query  1554  MFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMP  1733
             MFHLLS YAKLLK+KP+VPP AVE C E MVC   GLEK + ++S+V+ +PS T PCTMP
Sbjct  421   MFHLLSMYAKLLKFKPSVPPGAVEFCPETMVCPVKGLEKDYKIQSMVR-SPSDTGPCTMP  479

Query  1734  PPFDPATL  1757
             PP+DPA L
Sbjct  480   PPYDPAEL  487



>ref|XP_002273194.2| PREDICTED: O-glucosyltransferase rumi-like [Vitis vinifera]
Length=521

 Score =   526 bits (1356),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 253/474 (53%), Positives = 323/474 (68%), Gaps = 34/474 (7%)
 Frame = +3

Query  366   SLAVFFFMVLCVGAFVSTRLLDSTVTA------QHPTRLSHQKIIENEIPPLNCSLRTPM  527
             ++++F  +++ +GA VSTR ++ ++          PT+L  QK   +    LNC      
Sbjct  37    TVSLFTIILIFIGALVSTRCINVSILTGDFLKNTSPTKLHSQKFEYS----LNCREGNMS  92

Query  528   ASCPAN----YYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISR  695
              +CP      + P    + T                  CP+YFRWIY+DL  W ++GI+R
Sbjct  93    QTCPVTGPVAFEPGEPPSET------------------CPEYFRWIYEDLRPWMDTGITR  134

Query  696   EMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFD  875
              MV  AR  A+ R+V+V+G  Y   Y++  ++RD FT+WGILQLLR YPGK+PD DLMF+
Sbjct  135   AMVEKARPAASIRIVVVDGKVYVEKYKRVNRNRDEFTIWGILQLLRMYPGKLPDFDLMFE  194

Query  876   TVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKE  1055
               D P+I+   Y   D T  PP LF YCGD+ T+DIVFPDWSFWGWPE NIKPW G  K+
Sbjct  195   CRDRPMIRTHLYQGPDAT-VPPPLFHYCGDDETYDIVFPDWSFWGWPETNIKPWNGFKKD  253

Query  1056  LKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGY  1235
             LKEGN + KW+DREPYAYWKGN ++   RK+L KC  +++QDW AR+Y  DW +E + G+
Sbjct  254   LKEGNYRTKWIDREPYAYWKGNVKMGVVRKELFKCRNTDEQDWNARLYIMDWGREVQSGF  313

Query  1236  QQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPI  1415
             + S+LA QC HRYKIY EG AWSVSEKYILACDS+TLLVKP YY+F+TR L P+ HYWPI
Sbjct  314   KTSDLASQCTHRYKIYTEGIAWSVSEKYILACDSVTLLVKPQYYEFFTRSLQPLVHYWPI  373

Query  1416  RDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKY  1595
             +  D CKSIK A DW NNH ++AQ+IG AGS ++QEE+KM++VYDYMFHLLS YAKLLKY
Sbjct  374   KHKDMCKSIKFATDWCNNHTEKAQKIGKAGSSFVQEEIKMKFVYDYMFHLLSMYAKLLKY  433

Query  1596  KPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             KPTVPP AVE C E M C   GLEK + ++S+VK +PS T PC MPPPF  A L
Sbjct  434   KPTVPPMAVEFCPEMMACAVEGLEKDYKLQSMVK-SPSDTGPCIMPPPFSSAEL  486



>gb|EMT28728.1| hypothetical protein F775_16149 [Aegilops tauschii]
Length=636

 Score =   531 bits (1367),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 245/403 (61%), Positives = 303/403 (75%), Gaps = 32/403 (8%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             CP YFR+I++DL  WR +G I+  M+  AR TANFRLV+++G AY      +FQ+RD FT
Sbjct  196   CPAYFRFIHEDLHPWRAAGGITHTMLDRARTTANFRLVMLHGRAYIERIAPAFQTRDLFT  255

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WGILQLLRRYPG++PDLDLMFD VDWPV+    Y   + T  PP LFRYCGD  T DIV
Sbjct  256   IWGILQLLRRYPGRIPDLDLMFDCVDWPVVHPDEYQGENATVLPP-LFRYCGDNETLDIV  314

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGW EINIKPW+ L K+L  GN K++W+DREPYAYWKGNPEVAA R++L+KCNV
Sbjct  315   FPDWSFWGWAEINIKPWDALQKDLDAGNRKVRWIDREPYAYWKGNPEVAAIRQELVKCNV  374

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIH--------------------------  1268
             S +Q+W AR+Y QDW++E K GY++S+LA QC H                          
Sbjct  375   SSEQEWNARIYKQDWVKESKAGYKKSDLARQCTHRFRFYLSLIKSLVRLVCSVIGVEIVM  434

Query  1269  ---RYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKS  1439
                RYKIYIEGSAWSVS+KYILACDS+TL++ P YYDF++R LMP +HYWP+RDD KC S
Sbjct  435   LGDRYKIYIEGSAWSVSKKYILACDSMTLVINPKYYDFFSRVLMPTQHYWPVRDDSKCNS  494

Query  1440  IKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEA  1619
             IK+AVDWGN+H ++AQ+IG  GSK+IQ+EL MEYVYDYMFHLL+EYAKLL++KPT PPEA
Sbjct  495   IKYAVDWGNSHKKKAQKIGKEGSKFIQQELSMEYVYDYMFHLLTEYAKLLRFKPTKPPEA  554

Query  1620  VELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDP  1748
             VE+C E + C A G EK+FM +S+VK+A +   PC +PPPF P
Sbjct  555   VEVCPESLACQAIGREKKFMEDSMVKSA-NVAGPCNLPPPFSP  596



>ref|XP_010661760.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Vitis 
vinifera]
Length=515

 Score =   525 bits (1352),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 262/488 (54%), Positives = 330/488 (68%), Gaps = 39/488 (8%)
 Frame = +3

Query  336   LPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLS---------HQKIIEN  488
             LP +     +     FF++L +G F+STR    ++      R +         H K  E 
Sbjct  25    LPGLFKKSYTMNVSVFFIILLIGTFLSTRWSGVSIVTGDSFRTAWNYRSSTKPHYKRFEY  84

Query  489   EIPPLNCSLRTPMASCPAN----YYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIY  656
                 +NCS      +CP      + PS+  T T                  CP+YFRWIY
Sbjct  85    S---MNCSEGNMTKTCPVTLLTTFEPSNLSTGT------------------CPEYFRWIY  123

Query  657   DDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRR  836
             +DL  W E+GI+R+MV  A+  A+ R+V+V+G  Y   Y+  FQ+RD FT+WGILQ+LR 
Sbjct  124   EDLKPWTETGITRDMVERAKTPAHIRVVVVDGKVYTEKYKWVFQTRDVFTIWGILQVLRM  183

Query  837   YPGKVPDLDLMFDTVDWPVIKKQSYV-LNDTTTAPPALFRYCGDEATWDIVFPDWSFWGW  1013
             YPGK+PD DLMF+  D PVIKK  Y  LN   TAPP LF YCGD+ T DIVFPDWSFWGW
Sbjct  184   YPGKLPDFDLMFECGDKPVIKKHDYQGLN--ATAPP-LFHYCGDDETLDIVFPDWSFWGW  240

Query  1014  PEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGAR  1193
             PEI IKPW  L K+L+EGN K KWVDREPYAYWKGN ++  TR +L KC+ + +QDW AR
Sbjct  241   PEIRIKPWSTLRKDLREGNNKTKWVDREPYAYWKGNFKMGVTRHELSKCSKTNEQDWNAR  300

Query  1194  VYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDF  1373
             +Y  DW+QE + G++ ++L+ QC H+YKIY EG+AWSVSEKYILACDS+TLLVKP YYDF
Sbjct  301   IYNMDWLQEMQNGFKSADLSTQCTHKYKIYAEGAAWSVSEKYILACDSVTLLVKPQYYDF  360

Query  1374  YTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDY  1553
             +TR L P+ HYWPI+  D CKSIK A +W NNH Q+A EI  AGS ++QEEL+M++VYDY
Sbjct  361   FTRSLQPLVHYWPIKLKDMCKSIKFATEWCNNHTQKAHEIRNAGSSFVQEELRMKFVYDY  420

Query  1554  MFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMP  1733
             MFHLLS YAKL KYKPTVPP AVE+C E MVC   GL+K++ ++S+VK +PS T PC MP
Sbjct  421   MFHLLSAYAKLFKYKPTVPPGAVEVCPETMVCPVKGLQKKYKIQSMVK-SPSDTGPCVMP  479

Query  1734  PPFDPATL  1757
             PP+DPA L
Sbjct  480   PPYDPAEL  487



>gb|KHN04653.1| Protein O-glucosyltransferase 1 [Glycine soja]
Length=510

 Score =   524 bits (1349),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 240/378 (63%), Positives = 300/378 (79%), Gaps = 5/378 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRES--GISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTF  803
             CP YFRWI++DLW WRE   GI+REM+  ARRTA+FRLVIV+G  Y   Y+K+ Q+RD F
Sbjct  107   CPSYFRWIHEDLWPWRERDRGITREMLEGARRTAHFRLVIVDGKLYVEKYKKAIQTRDVF  166

Query  804   TLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDI  983
             TLWGILQLLR YPGKVPDL+L+FD  D PV+ K+ +   +  T P  LFRYC D+ + DI
Sbjct  167   TLWGILQLLRMYPGKVPDLELLFDCDDRPVVSKERFKGPNAPTPP--LFRYCSDQWSLDI  224

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCN  1163
             VFPDWSFWGW EINIKPW+ + KE+KEGN K KW DR PYAYWKGNP V+ TRKDL+KCN
Sbjct  225   VFPDWSFWGWAEINIKPWKHVLKEIKEGNEKTKWKDRVPYAYWKGNPLVSPTRKDLMKCN  284

Query  1164  VSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLT  1343
             V+EK DW   +Y QDW QE  QGY++SNL DQC HRYKIY+EG AWSVSEKYILACDS T
Sbjct  285   VTEKDDWNTHLYIQDWDQESSQGYKKSNLGDQCTHRYKIYVEGWAWSVSEKYILACDSTT  344

Query  1344  LLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQE  1523
             L V+  ++DF+ RG++P++HYWPIRD+ KCKS+K AV+WGNN+  +AQ IG AGSK+I E
Sbjct  345   LYVRSRFHDFFVRGMVPLEHYWPIRDNSKCKSLKFAVEWGNNNTDKAQAIGEAGSKFIHE  404

Query  1524  ELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAA  1703
             ++ M+YVYDYMFHLL+EYAKL ++KPT+P  AVE C E M CG +G++++FM +S+VK +
Sbjct  405   DMDMDYVYDYMFHLLNEYAKLQRFKPTIPQNAVEYCPETMACGVDGIQRRFMEDSMVK-S  463

Query  1704  PSTTAPCTMPPPFDPATL  1757
             PS + PCT+PPP++P  L
Sbjct  464   PSDSNPCTLPPPYEPINL  481



>emb|CAN66409.1| hypothetical protein VITISV_020976 [Vitis vinifera]
Length=439

 Score =   521 bits (1341),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 243/376 (65%), Positives = 298/376 (79%), Gaps = 12/376 (3%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYFRWI++DL  W+ +GISR+MV  A+R+A+FRLVIV G  Y   Y+KS Q+RD FT+
Sbjct  47    CPDYFRWIHEDLKPWKTTGISRDMVERAKRSAHFRLVIVKGKVYIEKYKKSIQTRDVFTI  106

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGILQLLRRYPGK+ DL+L FD  D PVI+   +     +T+PP LFRYCGD  T D+VF
Sbjct  107   WGILQLLRRYPGKLLDLELTFDCNDRPVIRSGDH-RGPNSTSPPPLFRYCGDRWTLDVVF  165

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGWPEIN+KPW  L K+LKEGN + KW++REPYAYWKGNP VA TR+DLL CNVS
Sbjct  166   PDWSFWGWPEINMKPWGNLLKDLKEGNNRTKWMEREPYAYWKGNPLVAETRRDLLTCNVS  225

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             + QDW AR++ QDW+ E +QGY+QS++++QC HRYKIYIEG AWSVSEKYILACDS+TL+
Sbjct  226   DVQDWNARLFVQDWMLESQQGYKQSDVSNQCTHRYKIYIEGWAWSVSEKYILACDSVTLM  285

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VKP YYDF+ R L P+ HYWPI+D+DKC+SIK A          AQ IG   S +IQEEL
Sbjct  286   VKPRYYDFFMRSLQPVHHYWPIKDNDKCRSIKFA----------AQAIGKXASDFIQEEL  335

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KM+YVYDYMFHLL+EYAKLL++KPT+P  AVE+CSE + C A G+EK+FMMESLV  +PS
Sbjct  336   KMDYVYDYMFHLLNEYAKLLRFKPTIPEGAVEVCSETVACSAEGVEKKFMMESLVN-SPS  394

Query  1710  TTAPCTMPPPFDPATL  1757
              T+PC +PPP+DP  L
Sbjct  395   VTSPCALPPPYDPPVL  410



>gb|KDP28649.1| hypothetical protein JCGZ_14420 [Jatropha curcas]
Length=503

 Score =   523 bits (1347),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 240/376 (64%), Positives = 293/376 (78%), Gaps = 3/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP+Y+RWI++DL  WRE GI+++++  A+RTA+FRLVIV G AY   YRKS QSRD F+L
Sbjct  105   CPEYYRWIHEDLRPWREKGITKDIIERAKRTAHFRLVIVEGKAYVEKYRKSIQSRDEFSL  164

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGI+QLLR YPG++PDL+LMFD  D PV+  + +       +PP LFRYC D+ + DIVF
Sbjct  165   WGIMQLLRLYPGRLPDLELMFDCDDRPVVPSEKF--QGPNASPPPLFRYCSDDRSLDIVF  222

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGW EINI+PW+ + K++++GN + KW DR PYA+WKGNP V   R+DLLKCNVS
Sbjct  223   PDWSFWGWAEINIRPWDHVLKDIRKGNNRTKWKDRVPYAFWKGNPYVDPGRRDLLKCNVS  282

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             ++ DW  R+Y QDW+Q+ KQGY +SNL DQC HRYKIYIEG AWSVSEKYI+ACDS+ L 
Sbjct  283   DQNDWNTRLYIQDWVQQSKQGYNESNLQDQCTHRYKIYIEGWAWSVSEKYIIACDSMNLY  342

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VKP YYDFY R ++P+KHYWPIRDD KC S+K AVDWGNNH QQA+ IG AGS +I EEL
Sbjct  343   VKPRYYDFYIREMVPLKHYWPIRDDAKCNSLKFAVDWGNNHTQQAEAIGKAGSSFIHEEL  402

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KM+YVYDYMFHLL+EYAKLLK+K  +P  A EL  EKM C ANG  K+FM+ES V A PS
Sbjct  403   KMDYVYDYMFHLLNEYAKLLKFKARIPKGATELRPEKMECLANGTHKKFMVESTV-ACPS  461

Query  1710  TTAPCTMPPPFDPATL  1757
                PC MPPP+DP  L
Sbjct  462   HKNPCKMPPPYDPKAL  477



>emb|CAH67462.1| OSIGBa0159I10.7 [Oryza sativa Indica Group]
 gb|EEC77702.1| hypothetical protein OsI_16775 [Oryza sativa Indica Group]
Length=537

 Score =   523 bits (1347),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 232/374 (62%), Positives = 296/374 (79%), Gaps = 3/374 (1%)
 Frame = +3

Query  639   YFRWIYDDLWAWRESG-ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWG  815
             YFR+I++DL  WR++G I+R M+  AR TA+FRL+++ G A+ H +R +FQ+RD FT+WG
Sbjct  142   YFRFIHEDLRPWRDAGGITRAMLARARVTASFRLLVLGGRAFVHRFRPAFQTRDLFTIWG  201

Query  816   ILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPD  995
             +LQLLRRYPG+VPDLDLMFD  DWPV++   Y        PP LF YCGD+ T DIVFPD
Sbjct  202   VLQLLRRYPGRVPDLDLMFDCADWPVVRTHLYRGKHAAFMPP-LFSYCGDDRTLDIVFPD  260

Query  996   WSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEK  1175
             WSFWGWPEINIKPW+ L ++LK+GN ++KW+DR PYAYWKGNP VA TR++L+ CNVS  
Sbjct  261   WSFWGWPEINIKPWDALRQDLKDGNNRVKWLDRVPYAYWKGNPAVAVTRQELVNCNVSTT  320

Query  1176  QDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVK  1355
             +DW AR+Y QDW +E K GY+ SNL  QC HRYKIYIEGSAWSVS+KYILACDS+TLLV 
Sbjct  321   KDWNARIYKQDWFRESKAGYKDSNLGSQCTHRYKIYIEGSAWSVSQKYILACDSMTLLVT  380

Query  1356  PHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKM  1535
             P YYDF++R LMP++HYWP+ +D+KC SIK+AVDWGN+H Q AQ IG   S +I+E++ M
Sbjct  381   PRYYDFFSRSLMPIQHYWPVHNDNKCDSIKYAVDWGNSHKQLAQRIGKQASDFIEEDVNM  440

Query  1536  EYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTT  1715
             + VYDYM HLL+EYAKLL+++P  PPEAVE+C + + C A GLEK+F+MES+VK+A    
Sbjct  441   DRVYDYMLHLLTEYAKLLRFRPIKPPEAVEICPDSLACQAEGLEKKFLMESMVKSA-RDA  499

Query  1716  APCTMPPPFDPATL  1757
              PC +PPPF+P  L
Sbjct  500   GPCDLPPPFNPQEL  513



>ref|XP_003529952.1| PREDICTED: O-glucosyltransferase rumi homolog [Glycine max]
Length=510

 Score =   522 bits (1344),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 239/378 (63%), Positives = 300/378 (79%), Gaps = 5/378 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRES--GISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTF  803
             CP YFRWI++DLW WRE   GI+REM+  ARRTA+FRLVIV+G  Y   Y+K+ Q+RD F
Sbjct  107   CPSYFRWIHEDLWPWRERDRGITREMLEGARRTAHFRLVIVDGKLYVEKYKKAIQTRDVF  166

Query  804   TLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDI  983
             TLWGILQLLR YPGKVPDL+L+FD  D PV+ K+ +   +  T P  LFRYC D+ + DI
Sbjct  167   TLWGILQLLRMYPGKVPDLELLFDCDDRPVVSKERFKGPNAPTPP--LFRYCSDQWSLDI  224

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCN  1163
             VFPDWSFWGW EINIKPW+ + KE+KEGN K KW DR PYAYWKGNP V+ TRKDL+KCN
Sbjct  225   VFPDWSFWGWAEINIKPWKHVLKEIKEGNEKTKWKDRVPYAYWKGNPLVSPTRKDLMKCN  284

Query  1164  VSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLT  1343
             V+EK DW   +Y QDW QE  +GY++SNL DQC HRYKIY+EG AWSVSEKYILACDS T
Sbjct  285   VTEKDDWNTHLYIQDWDQESSKGYKKSNLGDQCTHRYKIYVEGWAWSVSEKYILACDSTT  344

Query  1344  LLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQE  1523
             L V+  ++DF+ RG++P++HYWPIRD+ KCKS+K AV+WGNN+  +AQ IG AGSK+I E
Sbjct  345   LYVRSRFHDFFVRGMVPLEHYWPIRDNSKCKSLKFAVEWGNNNTDKAQAIGEAGSKFIHE  404

Query  1524  ELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAA  1703
             ++ M+YVYDYMFHLL+EYAKL ++KPT+P  AVE C E M CG +G++++FM +S+VK +
Sbjct  405   DMDMDYVYDYMFHLLNEYAKLQRFKPTIPQNAVEYCPETMACGVDGIQRRFMEDSMVK-S  463

Query  1704  PSTTAPCTMPPPFDPATL  1757
             PS + PCT+PPP++P  L
Sbjct  464   PSDSNPCTLPPPYEPINL  481



>gb|KDO86109.1| hypothetical protein CISIN_1g044043mg [Citrus sinensis]
Length=428

 Score =   518 bits (1335),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 229/377 (61%), Positives = 300/377 (80%), Gaps = 2/377 (1%)
 Frame = +3

Query  627   KCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             +CP+YFRWI+ DL  W+ +GISREM+  A+  A FRLVI+NG AY   Y+ ++Q+RD FT
Sbjct  26    ECPEYFRWIHKDLEPWKHTGISREMLERAKAHAQFRLVIINGDAYVEKYKNAYQTRDVFT  85

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WGILQLLR YPGKVPDL+LMF   D PV+KK+ Y     +T+PP +F YCGD+ + DIV
Sbjct  86    VWGILQLLRLYPGKVPDLELMFSCGDRPVVKKRDYE-GANSTSPPPVFHYCGDQESLDIV  144

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGW E NI+PW  + +++KEGN + KW++R PYAYWKGNP V+  R+DL+KCNV
Sbjct  145   FPDWSFWGWAETNIRPWNSILEDIKEGNKRTKWINRAPYAYWKGNPYVSIAREDLMKCNV  204

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTL  1346
             ++K  W  R+Y QDW +E KQG+++S LADQC HRYKIY+EG AWSVSEKYILACDS+TL
Sbjct  205   TDKYQWKTRLYVQDWHKEKKQGFEKSKLADQCTHRYKIYVEGQAWSVSEKYILACDSMTL  264

Query  1347  LVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEE  1526
             L++P YYDFY+R L+P++HYWP+R   KC+ IK AV+WGN H +QA+ IG AGS+Y+QE+
Sbjct  265   LIEPKYYDFYSRSLVPLQHYWPVRTARKCRDIKFAVEWGNTHTRQARAIGRAGSRYMQEK  324

Query  1527  LKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAP  1706
             LKM+YVYDYMFHLL EYAKLLK++P +P E  ++C++K+    NGL K+FM+ES+V ++ 
Sbjct  325   LKMKYVYDYMFHLLIEYAKLLKFEPRIPNEGKKVCAQKLASSQNGLGKRFMVESMVNSS-  383

Query  1707  STTAPCTMPPPFDPATL  1757
             S T PCTMPPPF+P +L
Sbjct  384   SETLPCTMPPPFEPLSL  400



>dbj|BAD25236.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG98449.1| unnamed protein product [Oryza sativa Japonica Group]
Length=375

 Score =   516 bits (1328),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 231/350 (66%), Positives = 285/350 (81%), Gaps = 2/350 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             M+  AR TANFRLV++ G AY      +FQ+RD FT+WGILQLLRRYPG+VPDLDLMFD 
Sbjct  1     MLERARDTANFRLVVLRGRAYVERIAPAFQTRDLFTIWGILQLLRRYPGRVPDLDLMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPV++   Y   + T  PP LFRYCGD+ T D+VFPDWSFWGWPEINIKPW+ L K+L
Sbjct  61    VDWPVVQADRYQGENATAMPP-LFRYCGDDETLDVVFPDWSFWGWPEINIKPWDALQKDL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
               GN ++KWVDREPYAYWKGNP+VA  RK+L+KCNVS K +W AR+Y QDWI+E K GY+
Sbjct  120   DIGNKRVKWVDREPYAYWKGNPDVATKRKELVKCNVSSKHEWNARIYKQDWIKESKAGYK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             QS+LA QC HRYKIYIEGSAWSVSEKYILAC+S+TL+V P YYDF++R LMP +HYWP+R
Sbjct  180   QSDLASQCTHRYKIYIEGSAWSVSEKYILACNSMTLVVTPKYYDFFSRVLMPTQHYWPVR  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             DD+KC SIKHAVDWGN++ ++AQ+IG   S +IQ+EL M+Y+YDYMFHLL+EYAKLL++K
Sbjct  240   DDNKCSSIKHAVDWGNSNKKKAQKIGKQASNFIQQELSMDYIYDYMFHLLTEYAKLLRFK  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDP  1748
             PT PPEA+E+C E + C A G E++FM +S+VK+A +   PC +PPPF P
Sbjct  300   PTKPPEAIEICPELLACQAIGRERKFMEDSMVKSA-NDAGPCDLPPPFSP  348



>ref|XP_010058149.1| PREDICTED: O-glucosyltransferase rumi homolog, partial [Eucalyptus 
grandis]
Length=437

 Score =   518 bits (1333),  Expect = 5e-176, Method: Compositional matrix adjust.
 Identities = 243/421 (58%), Positives = 309/421 (73%), Gaps = 17/421 (4%)
 Frame = +3

Query  498   PLNCSLRTPM-ASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAW  674
             PLNCS    M  +CP NY P+   T                 +  CP+YFRWI++DL  W
Sbjct  2     PLNCSATASMPQTCPGNY-PTKHQTEN-------------SYAEACPEYFRWIHEDLRPW  47

Query  675   RESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVP  854
             + +GI+RE++ S++  A+FRLVI+NG AY   YR SFQ+RD FT+WGILQLLR YPGKVP
Sbjct  48    KGAGITREILESSKEHAHFRLVILNGKAYVEKYRNSFQTRDVFTIWGILQLLRLYPGKVP  107

Query  855   DLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKP  1034
             DL+LMF+  D+PVI K+ Y  +   T PP LF YCG   T DI+FPDWSFWGWPE+NI+P
Sbjct  108   DLELMFNCADYPVILKRDYEGSKAATVPP-LFHYCGLNTTMDIIFPDWSFWGWPEVNIRP  166

Query  1035  WEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWI  1214
             WEG    ++E   K +W D+ P+AYWKGNP VA TR DL+KCN + + DW AR+Y QDW 
Sbjct  167   WEGTLGAIEEKAGKTRWKDKVPFAYWKGNPVVAQTRLDLMKCNGTTEIDWKARLYTQDWR  226

Query  1215  QEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMP  1394
             Q   +G++ SNL DQC HRYKIY+EGSAWSVSEKYILACD++TL++ P YYD +TRG++P
Sbjct  227   QATAEGFKDSNLEDQCTHRYKIYVEGSAWSVSEKYILACDAVTLMITPEYYDHFTRGMVP  286

Query  1395  MKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSE  1574
             M+HYWPIR D KC+ IK AV+WGNNH ++AQ IG +GS++I E LKM+YVYD+MFHLL+E
Sbjct  287   MEHYWPIRPDQKCRDIKFAVEWGNNHTEEAQRIGESGSRFISESLKMKYVYDFMFHLLNE  346

Query  1575  YAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPAT  1754
             YAKLLK+   VPP AVELCSE M C A GL ++FM ES+V+ +PS T PC++PPP++   
Sbjct  347   YAKLLKFDVEVPPGAVELCSELMACPAGGLIRKFMTESVVE-SPSNTLPCSLPPPYEALE  405

Query  1755  L  1757
             L
Sbjct  406   L  406



>ref|XP_002273411.2| PREDICTED: O-glucosyltransferase rumi-like isoform X1 [Vitis 
vinifera]
Length=525

 Score =   521 bits (1341),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 254/478 (53%), Positives = 320/478 (67%), Gaps = 38/478 (8%)
 Frame = +3

Query  366   SLAVFFFMVLCVGAFVSTR----------LLDSTVTAQHPTRLSHQKIIENEIPPLNCSL  515
             ++++F  +++ +GA VSTR           L  T+    PT+   QK   +    LNC  
Sbjct  37    TVSLFTIILIFIGALVSTRWINVSILTGDFLKKTLNYTSPTKPHSQKFEYS----LNCRE  92

Query  516   RTPMASCPAN----YYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRES  683
                  +CP      + PS   + T                  CP+YFRWIY+DL  W ++
Sbjct  93    GNVSQTCPVTGPVAFEPSEPPSET------------------CPEYFRWIYEDLRPWMDT  134

Query  684   GISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLD  863
             GI+R MV  AR  A+ R+V+V+G  Y   Y++   +RD FT+WGILQLLR YP K+PD D
Sbjct  135   GITRAMVEKARPAASIRIVVVDGKVYMEKYKRVNHNRDEFTIWGILQLLRMYPEKLPDFD  194

Query  864   LMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEG  1043
             LMF+  D P+IK   Y   D T  PP LF YCGD+ T+DIVFPDWSFWGWPE NIKPW G
Sbjct  195   LMFECRDRPMIKTHLYQGPDAT-VPPPLFHYCGDDETYDIVFPDWSFWGWPETNIKPWNG  253

Query  1044  LSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEH  1223
               K+LKEGN + KW+DREPYAYWKGN ++   RK+L KC  +++QDW AR+Y  DW +E 
Sbjct  254   FKKDLKEGNYRTKWIDREPYAYWKGNVKMGVVRKELFKCRNTDEQDWNARLYIMDWGREV  313

Query  1224  KQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKH  1403
             + G++ S+LA QC HRYKIY EG  WSVSEKYILACDS+TLLVKP YY+F+TR L P+ H
Sbjct  314   QSGFKTSDLASQCTHRYKIYTEGIGWSVSEKYILACDSVTLLVKPQYYEFFTRSLQPLVH  373

Query  1404  YWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAK  1583
             YWPI+  D CKSIK A DW NNH ++AQ+IG AGS ++QEE+KM++VYDYMFHLLS YAK
Sbjct  374   YWPIKHKDMCKSIKFATDWCNNHTEKAQKIGKAGSGFVQEEIKMKFVYDYMFHLLSMYAK  433

Query  1584  LLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             LLKYKPTVPP AVE C E M C   GLEK + ++S+VK +PS T PC MPPPF+ A L
Sbjct  434   LLKYKPTVPPMAVEFCPEMMACAVEGLEKDYKLQSMVK-SPSDTGPCIMPPPFNSAEL  490



>ref|XP_006445080.1| hypothetical protein CICLE_v10023948mg [Citrus clementina]
 ref|XP_006491073.1| PREDICTED: O-glucosyltransferase rumi-like [Citrus sinensis]
 gb|ESR58320.1| hypothetical protein CICLE_v10023948mg [Citrus clementina]
Length=482

 Score =   519 bits (1337),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 229/377 (61%), Positives = 300/377 (80%), Gaps = 2/377 (1%)
 Frame = +3

Query  627   KCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFT  806
             +CP+YFRWI+ DL  W+ +GISREM+  A+  A FRLVI+NG AY   Y+ ++Q+RD FT
Sbjct  80    ECPEYFRWIHKDLEPWKHTGISREMLERAKAHAQFRLVIINGDAYVEKYKNAYQTRDVFT  139

Query  807   LWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIV  986
             +WGILQLLR YPGKVPDL+LMF   D PV+KK+ Y     +T+PP +F YCGD+ + DIV
Sbjct  140   VWGILQLLRLYPGKVPDLELMFSCGDRPVVKKRDYE-GANSTSPPPVFHYCGDQESLDIV  198

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGW E NI+PW  + +++KEGN + KW++R PYAYWKGNP V+  R+DL+KCNV
Sbjct  199   FPDWSFWGWAETNIRPWNSILEDIKEGNKRTKWINRAPYAYWKGNPYVSIAREDLMKCNV  258

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTL  1346
             ++K  W  R+Y QDW +E KQG+++S LADQC HRYKIY+EG AWSVSEKYILACDS+TL
Sbjct  259   TDKYQWKTRLYVQDWHKEKKQGFEKSKLADQCTHRYKIYVEGQAWSVSEKYILACDSMTL  318

Query  1347  LVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEE  1526
             L++P YYDFY+R L+P++HYWP+R   KC+ IK AV+WGN H +QA+ IG AGS+Y+QE+
Sbjct  319   LIEPKYYDFYSRSLVPLQHYWPVRTARKCRDIKFAVEWGNTHTRQARAIGRAGSRYMQEK  378

Query  1527  LKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAP  1706
             LKM+YVYDYMFHLL EYAKLLK++P +P E  ++C++K+    NGL K+FM+ES+V ++ 
Sbjct  379   LKMKYVYDYMFHLLIEYAKLLKFEPRIPNEGKKVCAQKLASSQNGLGKRFMVESMVNSS-  437

Query  1707  STTAPCTMPPPFDPATL  1757
             S T PCTMPPPF+P +L
Sbjct  438   SETLPCTMPPPFEPLSL  454



>ref|XP_004976349.1| PREDICTED: O-glucosyltransferase rumi-like [Setaria italica]
Length=375

 Score =   514 bits (1324),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 230/353 (65%), Positives = 285/353 (81%), Gaps = 2/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             M+  AR TA FRLV++ G AY   +R +FQ+RD FT+WG+LQLLRRYPG+VPDL+LMFDT
Sbjct  1     MLRRARLTATFRLVVLGGRAYVQRFRPAFQTRDLFTVWGVLQLLRRYPGRVPDLELMFDT  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPV+    Y        PP LFRYCGD+ T DIVFPDWSFWGWPEINIKPW+ L ++L
Sbjct  61    VDWPVVHTHLYRGKYAEVMPP-LFRYCGDDRTLDIVFPDWSFWGWPEINIKPWDALQEDL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             K+GN ++KW+DREPYAYWKGNP V+ATR++L+KCNVS  +DW AR+YAQDW +E K GY+
Sbjct  120   KDGNNRVKWMDREPYAYWKGNPSVSATRQELVKCNVSSTKDWNARIYAQDWFKESKAGYK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
              S+L  QC HRYKIYIEGSAWS+S+KYILACDS+ LLV P YYDF++R LMP++HYWP+R
Sbjct  180   DSDLGSQCSHRYKIYIEGSAWSISQKYILACDSMALLVTPKYYDFFSRSLMPIQHYWPVR  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             DD+KC SIK+AVDWGN+H Q AQ IG   S +IQEEL M++VYDYM HLL+EYAKLLK+K
Sbjct  240   DDNKCASIKYAVDWGNSHKQLAQRIGKQASNFIQEELSMDHVYDYMLHLLTEYAKLLKFK  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             PT PPEAVE+CSE + C A+GLEK+F+++S+VK++     PC +PPPF    L
Sbjct  300   PTKPPEAVEVCSESLACQADGLEKKFLVDSMVKSS-HDAGPCNLPPPFSSHEL  351



>ref|XP_009771652.1| PREDICTED: protein O-glucosyltransferase 1-like isoform X1 [Nicotiana 
sylvestris]
Length=480

 Score =   518 bits (1333),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 246/462 (53%), Positives = 325/462 (70%), Gaps = 25/462 (5%)
 Frame = +3

Query  372   AVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYY  551
              + FF++L     V+  +  + ++  H   L   K+  +  P ++CS++ P  S P    
Sbjct  21    TIGFFLILISITIVALTIEWNDISV-HTDSLQKNKV--DLFPEVSCSIKCPRTS-PNKPI  76

Query  552   PSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANF  731
              SS+                      CP+YF WI++DL  W+++GI+R+MV  AR  A+F
Sbjct  77    FSSQFE-------------------SCPEYFGWIHEDLRPWKDTGITRKMVERAREEAHF  117

Query  732   RLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSY  911
             R+VIVNG  Y+  Y+ +FQ RD  TLWGILQLL  YPG +PDLD +F+  D PV +K  Y
Sbjct  118   RIVIVNGRVYFEKYKPTFQKRDMVTLWGILQLLSFYPGMLPDLDFVFECGDQPVTQKSDY  177

Query  912   VLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVD  1091
                   + PP LF YCG+++T+DIVFPDWSFWGWPE+NIKPW+ L K+L++ N  IKW +
Sbjct  178   G-KSKDSIPPPLFHYCGNDSTFDIVFPDWSFWGWPELNIKPWDILKKDLQQSNEMIKWTE  236

Query  1092  REPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHR  1271
             REPYAYWKGN  ++ +R+DLLKCNVS  QDW AR+Y   W +E +QGY+ SNLA QC HR
Sbjct  237   REPYAYWKGNALLSQSRRDLLKCNVSMNQDWNARIYDMQWARERRQGYKTSNLATQCTHR  296

Query  1272  YKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHA  1451
             YKIY+EG AWSVS+KYILACDS+ LL+ PHYYDF+TR L+P  HYWPI ++DKCKSIK A
Sbjct  297   YKIYVEGLAWSVSQKYILACDSVALLINPHYYDFFTRSLLPTIHYWPINENDKCKSIKFA  356

Query  1452  VDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELC  1631
             VDWGN + ++AQEIG +GSK++ EEL+M+Y+YDYMFHLLSEYAKLLKY+PTVP EAVE+C
Sbjct  357   VDWGNKNAEKAQEIGKSGSKFVHEELQMKYIYDYMFHLLSEYAKLLKYRPTVPREAVEVC  416

Query  1632  SEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             S+ ++C   G+ K+F + S V  A S++ PCTMPPP+ PA L
Sbjct  417   SDTLICSTKGIRKKFRVHSRVNNA-SSSKPCTMPPPWSPADL  457



>ref|XP_011035982.1| PREDICTED: O-glucosyltransferase rumi homolog [Populus euphratica]
Length=515

 Score =   519 bits (1336),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 244/420 (58%), Positives = 309/420 (74%), Gaps = 12/420 (3%)
 Frame = +3

Query  498   PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWR  677
             PL C+      +CP NY      T    R  +  S         CP YF+WI+DDL  W+
Sbjct  79    PLRCATGNLKQTCPENYPTKHNPTTNPDRPSNLNST--------CPSYFQWIHDDLRHWK  130

Query  678   ESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPD  857
             E+GI+++M+  AR+TA+FRLVIVNG AY   YR+S Q+RD FTLWGILQLLR YPG++PD
Sbjct  131   ETGITQDMIERARKTAHFRLVIVNGKAYVERYRQSLQTRDMFTLWGILQLLRWYPGRLPD  190

Query  858   LDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPW  1037
             L+LMFD  D PVI  + +       APP LFRYC D  + DIVFPDWSFWGW E NI+PW
Sbjct  191   LELMFDCDDRPVIPSKHF--RGPNAAPPPLFRYCSDWQSLDIVFPDWSFWGWAETNIRPW  248

Query  1038  EGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQ  1217
             + + KE+KEGN + KW DR PYAYW+GNP V+  R+DLLKCNVSE+ DW  R+Y QDW++
Sbjct  249   KNMLKEIKEGNSRTKWKDRTPYAYWRGNPWVSPIRQDLLKCNVSEQNDWNTRLYLQDWVK  308

Query  1218  EHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPM  1397
             + K+GY++SNL DQC HRYKIYIEG AWSVSEKYILACDS+TL V+P Y+DF+ RG++P+
Sbjct  309   QSKEGYRESNLQDQCTHRYKIYIEGWAWSVSEKYILACDSMTLYVRPRYHDFFIRGMVPL  368

Query  1398  KHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEY  1577
             +HYWPIRD+ KC S+K AV+WGNNH ++AQ IG A S +I E++K++YVYDY+FHLL+EY
Sbjct  369   QHYWPIRDNSKCTSLKFAVEWGNNHTEEAQAIGEAASNFIHEDMKIDYVYDYIFHLLNEY  428

Query  1578  AKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             AKLLK+KP +PP A ELC E M C  NG  ++FM ES+V  +PS   PCT+ PP DP+ L
Sbjct  429   AKLLKFKPKIPPGADELCPETMACPTNGTHRKFMEESMV-LSPSDAIPCTL-PPHDPSVL  486



>ref|XP_009386726.1| PREDICTED: O-glucosyltransferase rumi homolog [Musa acuminata 
subsp. malaccensis]
Length=508

 Score =   518 bits (1335),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 230/376 (61%), Positives = 295/376 (78%), Gaps = 5/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYFRW+++DL  W+ +GI+ EMV  AR+ A FRLV++ G  Y   YR++FQ+RD FTL
Sbjct  112   CPDYFRWVHEDLRPWKSTGITEEMVGRARKFATFRLVVLAGRVYVERYRRAFQTRDVFTL  171

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGILQL+ RYPG+VPD+DLMF+  D PV+K    + +  ++ PP LFRYC D+ T DIVF
Sbjct  172   WGILQLVSRYPGRVPDIDLMFNCDDTPVVK----LADHRSSPPPPLFRYCKDDRTLDIVF  227

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGW E+NIKPWE L+ +LK+GN ++KW DR+PYAYWKGNP V+ +R+DL+KCN+S
Sbjct  228   PDWSFWGWAELNIKPWETLANDLKQGNQRVKWRDRKPYAYWKGNPWVSDSRRDLIKCNLS  287

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             +  DW AR+Y Q+W +E  QG++ SNLA+QC HRYKIYIEG AWSVS+KYILACDS    
Sbjct  288   KHHDWKARLYDQNWDREINQGFKNSNLANQCDHRYKIYIEGRAWSVSQKYILACDSPAFF  347

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VK H++DF++R LMP  H+WPI++DDKC+SI+ AVDWGN H ++AQ +G AGS ++QEEL
Sbjct  348   VKTHFHDFFSRALMPGLHFWPIKEDDKCRSIEFAVDWGNEHQEEAQAMGRAGSNFVQEEL  407

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KM+YVYDYM HLL+EYAKLL+Y+P VP +A ELCSE M C A GL K+F+M S+ K+   
Sbjct  408   KMDYVYDYMLHLLTEYAKLLRYEPAVPEKATELCSESMACPATGLVKEFLMASMAKST-H  466

Query  1710  TTAPCTMPPPFDPATL  1757
              T PC MPPPFDP  L
Sbjct  467   DTEPCAMPPPFDPEAL  482



>ref|XP_010418359.1| PREDICTED: protein O-glucosyltransferase 1-like isoform X2 [Camelina 
sativa]
Length=514

 Score =   518 bits (1334),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 260/481 (54%), Positives = 330/481 (69%), Gaps = 25/481 (5%)
 Frame = +3

Query  339   PAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQK--IIENEIPPLNCS  512
             P I  L  ++L +  F++    A  S+  L+ T     P +   +K  I+ N    LN  
Sbjct  23    PVIGKLHVATLTLLIFLIAAGIAVTSSLWLNKTKPYNRPEKKPPEKTGILLNCTSFLN--  80

Query  513   LRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGIS  692
              +    SC     P  K  +T                  CPDYF+WI++DL  WRE+GI+
Sbjct  81    -QNRSGSCSKTTQPGYKQNQTEAN-------------RPCPDYFKWIHEDLKPWRETGIT  126

Query  693   REMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMF  872
             REMV   + TA+FRLVIVNG     NY KS Q+RD FTLWGILQLLR+YPGK+PD+DLMF
Sbjct  127   REMVERGKTTAHFRLVIVNGRVLVENYEKSIQTRDAFTLWGILQLLRKYPGKLPDVDLMF  186

Query  873   DTVDWPVIKKQSYVLNDTTT--APPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGL  1046
             D  D PVIK   Y   + T   +PP LFRYCGD  T DIVFPDWSFWGW EINIK W  +
Sbjct  187   DCDDRPVIKSDGYNRFNRTAKDSPPPLFRYCGDRWTVDIVFPDWSFWGWQEINIKEWSKV  246

Query  1047  SKELKEGNVKIKWVDREPYAYWKGNPEVAA-TRKDLLKCNVSEKQDWGARVYAQDWIQEH  1223
              K+++EG  K K+++RE YAYWKGNP VA+ +R+DLL CN+S   DW AR++ QDWI E 
Sbjct  247   LKDMEEGKKKKKFMEREAYAYWKGNPFVASPSREDLLTCNLSSLHDWNARIFIQDWISEG  306

Query  1224  KQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKH  1403
             ++G++ SN+A+QC +RYKIYIEG AWSVSEKYILACDS+TL+VKP+YYDF++R L P++H
Sbjct  307   QRGFENSNVANQCTYRYKIYIEGYAWSVSEKYILACDSVTLMVKPYYYDFFSRTLQPLQH  366

Query  1404  YWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAK  1583
             YWPIRD DKC+SIK AVDW NNH Q+AQEIG   S++++ +L +E VYDYMFHLL+EY+K
Sbjct  367   YWPIRDKDKCRSIKFAVDWLNNHTQKAQEIGREASEFMKRDLSIENVYDYMFHLLNEYSK  426

Query  1584  LLKYKPTVPPEAVELCSEKMVC---GANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPAT  1754
             LLKYKP VP  +VELC+E MVC     NG+ K+FMM SLV + P  + PC++PPPF P  
Sbjct  427   LLKYKPQVPKNSVELCTEAMVCPSGDVNGVNKRFMMGSLV-SRPHVSGPCSLPPPFSPNG  485

Query  1755  L  1757
             L
Sbjct  486   L  486



>ref|XP_010430436.1| PREDICTED: protein O-glucosyltransferase 1-like isoform X2 [Camelina 
sativa]
Length=514

 Score =   518 bits (1334),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 256/481 (53%), Positives = 332/481 (69%), Gaps = 25/481 (5%)
 Frame = +3

Query  339   PAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQK--IIENEIPPLNCS  512
             P I  L  ++L +  F++    A  S+  L+ T     P +   +K  I+ N    LN  
Sbjct  23    PVIGKLHVATLTLLIFLIAVGIAVTSSLWLNKTKPYNRPEKKPQEKTGILLNCTSFLN--  80

Query  513   LRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGIS  692
              +    SC     P     +T +                CPDYF+WI++DL  WRE+GI+
Sbjct  81    -QNRSGSCSKTTQPGYNQNQTESN-------------RSCPDYFKWIHEDLKPWRETGIT  126

Query  693   REMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMF  872
             +EMV   + TA+FRLVIVNG  +  NY+KS Q+RD FTLWGILQLLR+YPGK+PD+D+MF
Sbjct  127   KEMVERGKTTAHFRLVIVNGKVFVENYKKSIQTRDAFTLWGILQLLRKYPGKLPDVDIMF  186

Query  873   DTVDWPVIKKQSYVLNDTTT--APPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGL  1046
             D  D PVI+   Y   + T   +PP LFRYCGD  T DIVFPDWSFWGW EINIK W  +
Sbjct  187   DCDDRPVIRLDGYNRFNRTVEDSPPPLFRYCGDRWTVDIVFPDWSFWGWQEINIKEWSKV  246

Query  1047  SKELKEGNVKIKWVDREPYAYWKGNPEVAA-TRKDLLKCNVSEKQDWGARVYAQDWIQEH  1223
              K+++EG  K K+++RE YAYWKGNP VA+ +R+DLL CN+S   DW AR++ QDWI E 
Sbjct  247   LKDMEEGKKKKKFMEREAYAYWKGNPFVASPSREDLLTCNLSSLHDWNARIFIQDWISEG  306

Query  1224  KQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKH  1403
             ++G++ SN+A+QC +RYKIYIEG AWSVSEKYILACDS+TL+VKP+YYDF++R L P++H
Sbjct  307   QRGFENSNVANQCTYRYKIYIEGYAWSVSEKYILACDSVTLMVKPYYYDFFSRTLQPLQH  366

Query  1404  YWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAK  1583
             YWPIRD DKC+SIK AVDW NNH Q+AQEIG   S++++ +L +E VYDYMFHLL+EY+K
Sbjct  367   YWPIRDKDKCRSIKFAVDWLNNHTQKAQEIGREASEFMKRDLSIENVYDYMFHLLNEYSK  426

Query  1584  LLKYKPTVPPEAVELCSEKMVC---GANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPAT  1754
             LLKYKP VP  +VELC+E MVC     NG+ K+FMM SLV + P  + PC++PPPF P  
Sbjct  427   LLKYKPQVPKNSVELCTEAMVCPSGDVNGVNKRFMMGSLV-SRPHVSGPCSLPPPFSPNG  485

Query  1755  L  1757
             L
Sbjct  486   L  486



>ref|XP_009771653.1| PREDICTED: protein O-glucosyltransferase 1-like isoform X2 [Nicotiana 
sylvestris]
Length=455

 Score =   515 bits (1327),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 243/441 (55%), Positives = 316/441 (72%), Gaps = 24/441 (5%)
 Frame = +3

Query  435   TVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptpt  614
             T+ + H   L   K+  +  P ++CS++ P  S P     SS+                 
Sbjct  16    TLESVHTDSLQKNKV--DLFPEVSCSIKCPRTS-PNKPIFSSQFE---------------  57

Query  615   qsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSR  794
                  CP+YF WI++DL  W+++GI+R+MV  AR  A+FR+VIVNG  Y+  Y+ +FQ R
Sbjct  58    ----SCPEYFGWIHEDLRPWKDTGITRKMVERAREEAHFRIVIVNGRVYFEKYKPTFQKR  113

Query  795   DTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEAT  974
             D  TLWGILQLL  YPG +PDLD +F+  D PV +K  Y      + PP LF YCG+++T
Sbjct  114   DMVTLWGILQLLSFYPGMLPDLDFVFECGDQPVTQKSDYG-KSKDSIPPPLFHYCGNDST  172

Query  975   WDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLL  1154
             +DIVFPDWSFWGWPE+NIKPW+ L K+L++ N  IKW +REPYAYWKGN  ++ +R+DLL
Sbjct  173   FDIVFPDWSFWGWPELNIKPWDILKKDLQQSNEMIKWTEREPYAYWKGNALLSQSRRDLL  232

Query  1155  KCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACD  1334
             KCNVS  QDW AR+Y   W +E +QGY+ SNLA QC HRYKIY+EG AWSVS+KYILACD
Sbjct  233   KCNVSMNQDWNARIYDMQWARERRQGYKTSNLATQCTHRYKIYVEGLAWSVSQKYILACD  292

Query  1335  SLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKY  1514
             S+ LL+ PHYYDF+TR L+P  HYWPI ++DKCKSIK AVDWGN + ++AQEIG +GSK+
Sbjct  293   SVALLINPHYYDFFTRSLLPTIHYWPINENDKCKSIKFAVDWGNKNAEKAQEIGKSGSKF  352

Query  1515  IQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLV  1694
             + EEL+M+Y+YDYMFHLLSEYAKLLKY+PTVP EAVE+CS+ ++C   G+ K+F + S V
Sbjct  353   VHEELQMKYIYDYMFHLLSEYAKLLKYRPTVPREAVEVCSDTLICSTKGIRKKFRVHSRV  412

Query  1695  KAAPSTTAPCTMPPPFDPATL  1757
               A S++ PCTMPPP+ PA L
Sbjct  413   NNA-SSSKPCTMPPPWSPADL  432



>ref|XP_006647597.1| PREDICTED: KDEL motif-containing protein 2-like [Oryza brachyantha]
Length=375

 Score =   511 bits (1316),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 228/350 (65%), Positives = 284/350 (81%), Gaps = 2/350 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             M+  AR TANFRLV++ G AY      +FQ+RD FT+WGILQLLRRYPG+VPDL+LMFD 
Sbjct  1     MLDRARATANFRLVVLRGRAYVERIAPAFQTRDLFTIWGILQLLRRYPGRVPDLELMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPV++   Y   + T  PP LFRYCGD  T D+VFPDWSFWGWPEINIKPW  L K+L
Sbjct  61    VDWPVVRADQYQGENATVMPP-LFRYCGDNETLDVVFPDWSFWGWPEINIKPWNALQKKL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
               GN ++KWVDREPYAYWKGNP+VAA R++L+KCNVS K +W AR+Y QDWI+E K GY+
Sbjct  120   NTGNKRVKWVDREPYAYWKGNPDVAAKRQELVKCNVSSKHEWNARIYKQDWIKESKAGYK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             QS+LA QC HRYKIYIEGSAWSVSEKYILAC+S+TL+V P+YYDF++R L+P +HYWP+R
Sbjct  180   QSDLASQCTHRYKIYIEGSAWSVSEKYILACNSMTLVVTPNYYDFFSRVLIPTQHYWPVR  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             +++KC SIKHAVDWGN++ ++AQ+IG   S +IQ+EL M+Y+YDYMFHLL+EYAKLL++K
Sbjct  240   ENNKCSSIKHAVDWGNSNKKKAQQIGKKASNFIQQELSMDYIYDYMFHLLTEYAKLLRFK  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDP  1748
             PT PPEAVE+C E + C A G EK+FM +S+V++A     PC +PPPF P
Sbjct  300   PTKPPEAVEICPESLACQAIGREKKFMEDSMVRSA-KDAGPCDLPPPFSP  348



>ref|XP_010473579.1| PREDICTED: protein O-glucosyltransferase 1-like [Camelina sativa]
Length=566

 Score =   518 bits (1334),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 239/382 (63%), Positives = 303/382 (79%), Gaps = 7/382 (2%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYF+WI++DL  WRE+GI++EMV   + TA+FRLVIVNG  +  NY+KS Q+RD FTL
Sbjct  158   CPDYFKWIHEDLKPWRETGITKEMVERGKTTAHFRLVIVNGKVFVENYKKSIQTRDAFTL  217

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTT--APPALFRYCGDEATWDI  983
             WGILQLLR+YPGK+PD+DLMFD  D PVI+   Y   + T   +PP LFRYCGD  T DI
Sbjct  218   WGILQLLRKYPGKLPDVDLMFDCDDRPVIRSDGYNRFNRTAEDSPPPLFRYCGDRWTVDI  277

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA-TRKDLLKC  1160
             VFPDWSFWGW EINIK W  + K+++EG  K K+++RE YAYWKGNP VA+ +R+DLL C
Sbjct  278   VFPDWSFWGWQEINIKEWSKVLKDMEEGKKKKKFMEREAYAYWKGNPFVASPSREDLLTC  337

Query  1161  NVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSL  1340
             N+S   DW AR++ QDWI E ++G++ SN+A+QC +RYKIYIEG AWSVSEKYILACDS+
Sbjct  338   NLSSLHDWNARIFIQDWISEGQRGFENSNVANQCTYRYKIYIEGYAWSVSEKYILACDSV  397

Query  1341  TLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQ  1520
             TL+VKP+YYDF++R L P++HYWPIRD DKC+SIK AVDW NNH Q+AQEIG   S++++
Sbjct  398   TLMVKPYYYDFFSRTLQPLQHYWPIRDKDKCRSIKFAVDWLNNHTQKAQEIGREASEFMK  457

Query  1521  EELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVC---GANGLEKQFMMESL  1691
              +L ME VYDYMFHLL+EY+KLLKYKP VP ++VELC+E MVC     NG+ K+FMM SL
Sbjct  458   RDLSMENVYDYMFHLLNEYSKLLKYKPQVPKDSVELCTETMVCPSGDVNGVNKRFMMGSL  517

Query  1692  VKAAPSTTAPCTMPPPFDPATL  1757
             V + P  + PC++PPPF+P+ L
Sbjct  518   V-SRPHVSGPCSLPPPFNPSGL  538



>ref|XP_010105961.1| hypothetical protein L484_017309 [Morus notabilis]
 gb|EXC06843.1| hypothetical protein L484_017309 [Morus notabilis]
Length=522

 Score =   516 bits (1330),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 248/420 (59%), Positives = 312/420 (74%), Gaps = 11/420 (3%)
 Frame = +3

Query  498   PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWR  677
             PL C+ +    +CP NY P+S    T       PS   T  +  CP YFRWI++DL  W+
Sbjct  85    PLTCT-KGNATTCPRNY-PTSLYNHTLN-----PSSPITSKNVTCPSYFRWIHEDLRPWK  137

Query  678   ESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPD  857
             E+GI+++MV  ARR+A+FRLVIV+G AY   YR+S Q+RD F++WGILQL+R YPG++PD
Sbjct  138   ETGITKDMVERARRSAHFRLVIVDGKAYVEKYRQSLQTRDMFSIWGILQLMRYYPGRLPD  197

Query  858   LDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPW  1037
             LDLMFD  D PV++ + +        P  +FRYC D+ + DIVFPDWSFWGW E NIKPW
Sbjct  198   LDLMFDCDDRPVVRAKDF--RGPNARPLPVFRYCSDQWSLDIVFPDWSFWGWAECNIKPW  255

Query  1038  EGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQ  1217
             E +  +++EGN + KW DR PYAYW+GNP VA TR+DLLKCNVS K DW  R+Y Q W +
Sbjct  256   EDVLADIREGNKRTKWKDRVPYAYWRGNPNVAPTRRDLLKCNVSPKNDWNTRLYIQSWEE  315

Query  1218  EHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPM  1397
             E KQGY++SNL DQC HRYKIY EG AWSVSEKYILACDS+TL ++  Y+DFY RG+ P+
Sbjct  316   EKKQGYKESNLQDQCTHRYKIYTEGWAWSVSEKYILACDSMTLYIRSRYHDFYIRGMEPL  375

Query  1398  KHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEY  1577
             +HYWPIR++ KC S+K AVDWGNNH  +AQ IG A SK+IQE++KM+YVYDYMFH+L+EY
Sbjct  376   QHYWPIRENSKCTSLKFAVDWGNNHTDKAQAIGKASSKFIQEDMKMDYVYDYMFHILNEY  435

Query  1578  AKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             AKLLKYKPTVP  AVELC+E M C ANG  + FM +SLVK +PS T PC + PP+DP  +
Sbjct  436   AKLLKYKPTVPAGAVELCAETMACPANGTWRSFMEKSLVK-SPSETIPCNL-PPYDPQAV  493



>ref|XP_007135034.1| hypothetical protein PHAVU_010G096100g [Phaseolus vulgaris]
 gb|ESW07028.1| hypothetical protein PHAVU_010G096100g [Phaseolus vulgaris]
Length=509

 Score =   515 bits (1327),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 251/467 (54%), Positives = 326/467 (70%), Gaps = 29/467 (6%)
 Frame = +3

Query  387   MVLCVGAFVSTRLLDS--TVTAQHPTRLSHQKIIENEIPP-------LNCSLRTPMASCP  539
             MV+ +  F +T L+ +   +T+     +    + + ++PP       L C+L     SCP
Sbjct  33    MVIVMVCFAATFLVFTVCNITSTFSPGIGISILTKKKLPPMAKQEFPLRCTLPHVPQSCP  92

Query  540   ANYYPSSKLTR-TRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSAR  716
              +Y  S K T   RT                CP YF+WI++DL AWR  GI+REMV  AR
Sbjct  93    RDYPTSQKPTGPART----------------CPSYFQWIHEDLKAWRGKGITREMVEGAR  136

Query  717   RTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVI  896
             RTA+FR+VIV+G  Y  NY+KS Q+RD FTLWG++QLLR YPGKVPDL+L+FD  D PVI
Sbjct  137   RTAHFRVVIVDGKMYVENYKKSIQTRDAFTLWGLMQLLRVYPGKVPDLELLFDCDDRPVI  196

Query  897   KKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVK  1076
              K  +   D  T P  LFRYC D+ ++DIVFPDWSFWGW EINIKPW+ + +++K GN K
Sbjct  197   PKGRFEGPDAATPP--LFRYCSDQWSYDIVFPDWSFWGWAEINIKPWKYVLEDIKNGNQK  254

Query  1077  IKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLAD  1256
              KW DR PYAYWKGNP V  TRKDL++CNV+EK DW   +Y QDW QE  +G+++SNL D
Sbjct  255   TKWEDRVPYAYWKGNPLVTPTRKDLMRCNVTEKDDWNTHLYIQDWKQESHEGFKKSNLGD  314

Query  1257  QCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCK  1436
             QC HRYKIY+EG AWSVSEKYILACDS  L V+  ++DF+ RG++P++HYWPIRD+ KC 
Sbjct  315   QCTHRYKIYVEGWAWSVSEKYILACDSTNLYVRSRFHDFFIRGMVPLEHYWPIRDNSKCT  374

Query  1437  SIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPE  1616
             S+K AV+WGNNH  +A+ IG A  K+I E + M+YVYDYMFHLL+EYAKLL++KP +PP+
Sbjct  375   SLKFAVEWGNNHTDKAKAIGEAARKFIHEGMDMDYVYDYMFHLLNEYAKLLRFKPVIPPK  434

Query  1617  AVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             AVE C E M C  +G E++FM +S+VK  PS + PCT+PPP+D  +L
Sbjct  435   AVEYCPETMACALSGTERRFMEDSMVK-VPSDSNPCTIPPPYDATSL  480



>gb|KHN25713.1| KDEL motif-containing protein 1 [Glycine soja]
Length=379

 Score =   509 bits (1311),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 236/352 (67%), Positives = 281/352 (80%), Gaps = 7/352 (2%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MV  A+++A+FRLV+  G  Y   Y+KS Q+R+ FT+WGI+QLLR+YPGKV DL+LMFD 
Sbjct  1     MVERAKKSAHFRLVVKRGRVYVERYKKSIQTREVFTMWGIVQLLRKYPGKVADLELMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
              D PVI+  S         PP LFRYCGD  T DIVFPDWSFWGW EINI+PWE + KE+
Sbjct  61    DDLPVIRGSS------LAGPPPLFRYCGDRWTDDIVFPDWSFWGWAEINIRPWEHVLKEM  114

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             ++GN +IKW DREPYAYWKGNP VA TR+DLLKCNVS  QDW AR+Y QDWIQE +QG+ 
Sbjct  115   EKGNRRIKWNDREPYAYWKGNPFVAETRQDLLKCNVSTTQDWNARLYVQDWIQESQQGFN  174

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
              SNLA QC HRYKIYIEG AWSVSEKYILACDS+TL+VKP +YDF+ R L PM+HYWPIR
Sbjct  175   NSNLASQCTHRYKIYIEGYAWSVSEKYILACDSVTLMVKPRFYDFFIRSLQPMQHYWPIR  234

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             D  KCKSIKHAVDWGNNH ++AQ+IG A SK+IQEELKM+YVYDYMFHLL+EYAKLLK++
Sbjct  235   DKGKCKSIKHAVDWGNNHKEEAQKIGKAASKFIQEELKMDYVYDYMFHLLNEYAKLLKFE  294

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPAT  1754
             P VP  A ELC E M C  +GLE++FM ES+V+  PST APC++PPP +P +
Sbjct  295   PRVPEGAEELCVEAMACTRSGLERKFMTESMVR-EPSTKAPCSLPPPLEPTS  345



>ref|XP_004170219.1| PREDICTED: protein O-glucosyltransferase 1-like [Cucumis sativus]
Length=426

 Score =   511 bits (1316),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 232/376 (62%), Positives = 292/376 (78%), Gaps = 2/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP+YFRWI++DL  W   GI++ M+  A++ A+FR+V+V G AY   Y K++QSRD  T+
Sbjct  5     CPEYFRWIHEDLKPWAGRGITKSMLEEAQKKAHFRVVVVEGKAYVEAYGKAYQSRDNLTV  64

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WG++QLLRRYPGK+PDLDLMF   D P I ++ Y       +PP LFRY GD+ATWDIVF
Sbjct  65    WGVVQLLRRYPGKLPDLDLMFSCDDRPEIYQKDYS-GAEKPSPPPLFRYSGDDATWDIVF  123

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGWPEINIK WE + K++KEGN K+ W+ R+PYAYWKGNP VA TR+DLLKCNV+
Sbjct  124   PDWSFWGWPEINIKAWESMLKDIKEGNKKMGWMKRQPYAYWKGNPAVAYTRRDLLKCNVT  183

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             +KQDW AR+Y Q+W +E K G++ SNLA+QC +RYKIYIEG AWSVSEKYILACDS++L+
Sbjct  184   QKQDWSARLYRQNWDKESKAGFKDSNLANQCDYRYKIYIEGKAWSVSEKYILACDSVSLI  243

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             V+P YYDF+TR L+PMKHYWPI  + KC SIK AV WGN H QQA  IG A SK I+EEL
Sbjct  244   VRPRYYDFFTRSLIPMKHYWPISSNRKCSSIKFAVHWGNTHRQQAMAIGKAASKLIEEEL  303

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KMEY+YDYMFHLL++Y+KLL +KPTVPP A EL SE +     G  ++ MMES+V  +P+
Sbjct  304   KMEYIYDYMFHLLNQYSKLLTFKPTVPPNATELLSESLASAGKGSIRKSMMESVV-TSPA  362

Query  1710  TTAPCTMPPPFDPATL  1757
              + PC + PP+DP +L
Sbjct  363   ESGPCALQPPYDPQSL  378



>ref|XP_010672073.1| PREDICTED: protein O-glucosyltransferase 1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=551

 Score =   514 bits (1325),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 235/423 (56%), Positives = 309/423 (73%), Gaps = 22/423 (5%)
 Frame = +3

Query  498   PLNCSLRTPMASCPANY---YPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLW  668
             PL C+ ++   +CP NY   Y S   + + T                CPDYFRWI++DL 
Sbjct  113   PLQCTSKSTTQTCPHNYPTNYSSMNPSHSST----------------CPDYFRWIHEDLR  156

Query  669   AWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGK  848
              W+ +G++R+MV +A++TA+FRLVI++G  Y   +R+S Q+RD FTLWG LQLLR YPG+
Sbjct  157   PWKGTGVTRKMVDAAQKTAHFRLVILDGRMYVEKFRESLQTRDEFTLWGFLQLLRWYPGR  216

Query  849   VPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINI  1028
             +PDL+LMFD  D P++  + +      + PP LF+YC D    DIVFPDWSFWGWPE NI
Sbjct  217   LPDLELMFDCDDRPMVPAKKF--RRPNSGPPPLFKYCSDPWGLDIVFPDWSFWGWPECNI  274

Query  1029  KPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQD  1208
             KPW   S++++EGN  +KW DR PYAYW+GNP V+  R + +KCN ++  DW  R+Y Q+
Sbjct  275   KPWRNASRDIQEGNKMVKWKDRVPYAYWRGNPHVSPWRANFVKCNATDTTDWNIRIYTQN  334

Query  1209  WIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGL  1388
             W ++ K GY++SNL DQC HRYK+YIEG AWSVSEKYIL CDS+TL+VKP YYDF+ RG+
Sbjct  335   WDKQAKVGYKESNLKDQCTHRYKVYIEGWAWSVSEKYILGCDSMTLVVKPKYYDFFNRGM  394

Query  1389  MPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLL  1568
             +P+ HYWPIRD+DKCKSIK AV+WGNNH  +AQEIG A ++YI EE+KMEYVYDYM HLL
Sbjct  395   LPLVHYWPIRDNDKCKSIKFAVEWGNNHTDKAQEIGQAATRYIHEEMKMEYVYDYMLHLL  454

Query  1569  SEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDP  1748
             +EY+KLL++KP +PP AVELC+E M C   G  ++FM ESL K +PS   PCT+PPP+DP
Sbjct  455   TEYSKLLRFKPAIPPNAVELCAEAMACETEGSWRKFMEESLEK-SPSNGVPCTLPPPYDP  513

Query  1749  ATL  1757
             ++L
Sbjct  514   SSL  516



>ref|XP_006302095.1| hypothetical protein CARUB_v10020086mg [Capsella rubella]
 gb|EOA34993.1| hypothetical protein CARUB_v10020086mg [Capsella rubella]
Length=555

 Score =   514 bits (1324),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 239/383 (62%), Positives = 300/383 (78%), Gaps = 8/383 (2%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYF+WI++DL  WRE+GI+REMV   + TA+FRLVIVNG  +  NY+KS Q+RD FTL
Sbjct  149   CPDYFKWIHEDLKPWRETGITREMVERGKTTAHFRLVIVNGKVFVENYKKSIQTRDAFTL  208

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTT--APPALFRYCGDEATWDI  983
             WGILQLLR+YPGK+PD+DLMFD  D PVI+   Y   + T   +PP LFRYCGD  T DI
Sbjct  209   WGILQLLRKYPGKLPDVDLMFDCDDRPVIRSDGYNRFNRTAEDSPPPLFRYCGDRWTVDI  268

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA-TRKDLLKC  1160
             VFPDWSFWGW EINIK W  + KE+++G  K K+++RE YAYWKGNP VA+ +R+DLL C
Sbjct  269   VFPDWSFWGWQEINIKEWSKVLKEMEQGKKKKKFMEREAYAYWKGNPFVASPSREDLLTC  328

Query  1161  NVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSL  1340
             N+S   DW AR++ QDW+ E ++G++ SN+A+QC +RYKIYIEG AWSVSEKYILACDS+
Sbjct  329   NLSLLHDWNARIFIQDWLSEGQRGFENSNVANQCTYRYKIYIEGYAWSVSEKYILACDSV  388

Query  1341  TLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQ  1520
             TL+VKP+YYDF++R L P++HYWPIRD DKC+SIK AVDW NNH Q+AQEIG   S++++
Sbjct  389   TLMVKPYYYDFFSRTLQPLQHYWPIRDKDKCRSIKFAVDWLNNHTQKAQEIGREASEFMR  448

Query  1521  EELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVC----GANGLEKQFMMES  1688
              +L ME VYDYMFHLL+EY+KLLKYKP VP   VELC+E MVC      NG+ K+FMM S
Sbjct  449   RDLSMENVYDYMFHLLNEYSKLLKYKPQVPENGVELCTEAMVCPSDDANNGVNKRFMMGS  508

Query  1689  LVKAAPSTTAPCTMPPPFDPATL  1757
             LV + P  + PC++PPP+DP  L
Sbjct  509   LV-SRPHVSGPCSLPPPYDPNGL  530



>gb|KHG06444.1| Protein O-glucosyltransferase 1 [Gossypium arboreum]
Length=540

 Score =   513 bits (1322),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 251/476 (53%), Positives = 323/476 (68%), Gaps = 22/476 (5%)
 Frame = +3

Query  339   PAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTR-LSHQKIIENEIP--PLNC  509
             P  K    + +AVF   VL     VS   LD + +A +    +  +       P  PL C
Sbjct  58    PVKKAAASTIIAVFLITVL----MVSVGWLDISFSASYQNMGVGSKSTTARHKPEFPLEC  113

Query  510   SLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGI  689
             S      +C  +Y  ++ +    T            S  +CP +FRWI++DL  W+++GI
Sbjct  114   STENQTQTCRRDYPTTTGIPPMNT------------SKVECPSFFRWIHEDLRHWKQTGI  161

Query  690   SREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLM  869
             SR+M+  AR+TA+FRLVIV G AY   YR S Q+RD FTLWGILQLLR YPG++PDL+LM
Sbjct  162   SRDMIEGARKTAHFRLVIVKGKAYVEKYRNSIQTRDKFTLWGILQLLRMYPGRLPDLELM  221

Query  870   FDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLS  1049
             FD  D PV++ + +        PP LFRYC DE + DIVFPDWSFWGW E NI+PW  + 
Sbjct  222   FDCDDRPVVRSRDF--QGPNARPPPLFRYCADEWSLDIVFPDWSFWGWAETNIRPWRNVL  279

Query  1050  KELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQ  1229
             KE+K+GN + KW +R PYAYW+GNP VA TRKDL+KCN ++K +W   +Y QDW +E KQ
Sbjct  280   KEIKKGNERRKWKERVPYAYWRGNPSVAPTRKDLMKCNATDKNNWNTLLYVQDWDRESKQ  339

Query  1230  GYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYW  1409
             G++QSNL DQC HRYKIY EG AWSVSEKYILACDS+TL V+  +YDF+ RG+ P++HYW
Sbjct  340   GFKQSNLEDQCTHRYKIYTEGWAWSVSEKYILACDSMTLYVRSRFYDFFIRGMQPLQHYW  399

Query  1410  PIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLL  1589
             PI ++ KCKS+K AV+WGN H ++AQ IG A  K+I E+LKM+ VYDYMFHLL+EYAKLL
Sbjct  400   PISENTKCKSLKFAVEWGNIHPKKAQAIGEAAGKFIHEDLKMDNVYDYMFHLLNEYAKLL  459

Query  1590  KYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             K++PTVPP +VELCSE M C   G  K+ M+ESLV  +PS   PC MPPP++P  L
Sbjct  460   KFEPTVPPGSVELCSETMACPRTGTWKKLMVESLV-MSPSDVTPCGMPPPYEPQEL  514



>gb|KGN57370.1| hypothetical protein Csa_3G182060 [Cucumis sativus]
Length=521

 Score =   513 bits (1321),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 232/376 (62%), Positives = 294/376 (78%), Gaps = 2/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP+YFRWI++DL  W   GI++ M+  A++ A+FR+V+V G AY   Y K++QSRD  T+
Sbjct  118   CPEYFRWIHEDLKPWAGRGITKSMLEEAQKKAHFRVVVVEGKAYVEAYGKAYQSRDNLTV  177

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WG++QLLRRYPGK+PDLDLMF   D P I ++ Y   +  + PP LFRY GD+ATWDIVF
Sbjct  178   WGVVQLLRRYPGKLPDLDLMFSCDDRPEIYQKDYSGAEKPSPPP-LFRYSGDDATWDIVF  236

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGWPEINIK WE + K++KEGN K+ W+ R+PYAYWKGNP VA TR+DLLKCNV+
Sbjct  237   PDWSFWGWPEINIKAWESMLKDIKEGNKKMGWMKRQPYAYWKGNPAVAYTRRDLLKCNVT  296

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             +KQDW AR+Y Q+W +E K G++ SNLA+QC +RYKIYIEG AWSVSEKYILACDS++L+
Sbjct  297   QKQDWSARLYRQNWDKESKAGFKDSNLANQCDYRYKIYIEGKAWSVSEKYILACDSVSLI  356

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             V+P YYDF+TR L+PMKHYWPI  + KC SIK AV WGN H Q+A  IG A SK I+EEL
Sbjct  357   VRPRYYDFFTRSLIPMKHYWPISSNRKCSSIKFAVHWGNTHSQEAMAIGKAASKLIEEEL  416

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KMEY+YDYMFHLL++Y+KLL +KPTVPP A EL SE +   A G  ++ MMES+V  +P+
Sbjct  417   KMEYIYDYMFHLLNQYSKLLTFKPTVPPNATELLSESLASAAKGSIRKSMMESVV-TSPA  475

Query  1710  TTAPCTMPPPFDPATL  1757
              + PC + PP+DP +L
Sbjct  476   ESGPCALQPPYDPQSL  491



>ref|XP_010413436.1| PREDICTED: O-glucosyltransferase rumi homolog [Camelina sativa]
Length=507

 Score =   512 bits (1318),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 233/376 (62%), Positives = 286/376 (76%), Gaps = 1/376 (0%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP YFRWI++DL  W+E+GI+R MV  A RTA+FRLVI NG AY   YRKS Q+RD FTL
Sbjct  104   CPSYFRWIHEDLKPWKETGITRRMVEEASRTAHFRLVIRNGKAYVKRYRKSIQTRDDFTL  163

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGILQLLRRYPG++PDLDLMFD  D PV++   +++      PP +FRYC D+A+ DIVF
Sbjct  164   WGILQLLRRYPGRLPDLDLMFDADDRPVVRSDDFIIGQPDKEPPPVFRYCSDDASLDIVF  223

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGW E+N+KPWE   + +KEGN   +W DR  YAYW+GNP V  TR DLLKCNVS
Sbjct  224   PDWSFWGWAEVNVKPWEKSLEAIKEGNNMTQWEDRVAYAYWRGNPYVDPTRGDLLKCNVS  283

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             E ++W  R+Y QDW +E K+GY+ SNL +QC HRYKIYIEG AWSVSEKYI+ACDS+TL 
Sbjct  284   EHEEWNTRLYIQDWDKESKEGYKNSNLENQCTHRYKIYIEGWAWSVSEKYIMACDSMTLY  343

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VKP +YDFY RG+MP++HYWPIRDD KC S+K AV WGN H  +A+EIG  GS++I+EE+
Sbjct  344   VKPRFYDFYIRGMMPLQHYWPIRDDSKCTSLKFAVHWGNTHVDKAREIGEMGSRFIREEV  403

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
              M+YVYDYMFHLL EYAKLLK+KP VP +A E+  + M C A    + FM ES+V  +PS
Sbjct  404   NMKYVYDYMFHLLKEYAKLLKFKPEVPLDAEEITPDSMGCAATERWRDFMAESMV-TSPS  462

Query  1710  TTAPCTMPPPFDPATL  1757
               +PC M PP+DP  L
Sbjct  463   EESPCEMLPPYDPQDL  478



>ref|XP_004140843.1| PREDICTED: protein O-glucosyltransferase 1-like [Cucumis sativus]
Length=442

 Score =   509 bits (1311),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 232/376 (62%), Positives = 294/376 (78%), Gaps = 2/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP+YFRWI++DL  W   GI++ M+  A++ A+FR+V+V G AY   Y K++QSRD  T+
Sbjct  21    CPEYFRWIHEDLKPWAGRGITKSMLEEAQKKAHFRVVVVEGKAYVEAYGKAYQSRDNLTV  80

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WG++QLLRRYPGK+PDLDLMF   D P I ++ Y   +  + PP LFRY GD+ATWDIVF
Sbjct  81    WGVVQLLRRYPGKLPDLDLMFSCDDRPEIYQKDYSGAEKPSPPP-LFRYSGDDATWDIVF  139

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGWPEINIK WE + K++KEGN K+ W+ R+PYAYWKGNP VA TR+DLLKCNV+
Sbjct  140   PDWSFWGWPEINIKAWESMLKDIKEGNKKMGWMKRQPYAYWKGNPAVAYTRRDLLKCNVT  199

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             +KQDW AR+Y Q+W +E K G++ SNLA+QC +RYKIYIEG AWSVSEKYILACDS++L+
Sbjct  200   QKQDWSARLYRQNWDKESKAGFKDSNLANQCDYRYKIYIEGKAWSVSEKYILACDSVSLI  259

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             V+P YYDF+TR L+PMKHYWPI  + KC SIK AV WGN H Q+A  IG A SK I+EEL
Sbjct  260   VRPRYYDFFTRSLIPMKHYWPISSNRKCSSIKFAVHWGNTHSQEAMAIGKAASKLIEEEL  319

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KMEY+YDYMFHLL++Y+KLL +KPTVPP A EL SE +   A G  ++ MMES+V  +P+
Sbjct  320   KMEYIYDYMFHLLNQYSKLLTFKPTVPPNATELLSESLASAAKGSIRKSMMESVV-TSPA  378

Query  1710  TTAPCTMPPPFDPATL  1757
              + PC + PP+DP +L
Sbjct  379   ESGPCALQPPYDPQSL  394



>ref|XP_007219799.1| hypothetical protein PRUPE_ppa026562mg [Prunus persica]
 gb|EMJ20998.1| hypothetical protein PRUPE_ppa026562mg [Prunus persica]
Length=494

 Score =   510 bits (1314),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 255/504 (51%), Positives = 330/504 (65%), Gaps = 40/504 (8%)
 Frame = +3

Query  249   MVRPHILKMRETSEGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGA-FVSTRL  425
             M R +   + +  +G  L+RHF  T+WRPL  I       L + FF+   V A ++  + 
Sbjct  1     MKRNNAKHLCDFLDGTGLHRHFVGTSWRPLKKITAATIIFLLLIFFVAALVPAGWIDAKS  60

Query  426   LDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsp  605
             + +T     P R            PL C+    +       YP++      +R  +    
Sbjct  61    ITTTTNTSTPKRPEF---------PLQCTEGINVTQACPRTYPTTHDPTNPSRPSNLT--  109

Query  606   tptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSF  785
                     CP YFRWI++DL  W+E+GI+R+M+  ARRTA+FRL+IV+G AY   YR+SF
Sbjct  110   --------CPSYFRWIHEDLRPWKETGITRDMIEKARRTAHFRLLIVDGKAYIEKYRQSF  161

Query  786   QSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGD  965
             Q+RD FTLWGILQLLR Y G++PDL+LMF+  D PVI  + +        PP LFRYC D
Sbjct  162   QTRDMFTLWGILQLLRVYSGRLPDLELMFNCGDRPVIPSKDF--QGPNAGPPPLFRYCSD  219

Query  966   EATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRK  1145
             E + DIVFPDWSFWGWPE+NIKPW  L + +KEGN + KW DR PYAYWKGNP VA TR 
Sbjct  220   EGSLDIVFPDWSFWGWPEVNIKPWRSLLQSIKEGNKRTKWEDRVPYAYWKGNPNVAPTRM  279

Query  1146  DLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYIL  1325
              LLKCN S+K DW  R+Y Q W                  +RYKIYIEG AWSVSEKYI+
Sbjct  280   GLLKCNDSDKNDWNTRLYIQIWF-----------------YRYKIYIEGLAWSVSEKYIM  322

Query  1326  ACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAG  1505
             ACDS+TL V+P Y+DF+ RG+ P++H+WPIRD+ KC S+K AV+WGNNH  +A+ IG A 
Sbjct  323   ACDSMTLYVRPRYHDFFIRGMEPLQHFWPIRDNSKCTSLKFAVEWGNNHEDKAKAIGEAA  382

Query  1506  SKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMME  1685
             S +IQE+L+M+YVYDYMFH+L++YAKLLK+KPT+PP AVELCSEKM C A G  K+FM+E
Sbjct  383   SNFIQEDLEMDYVYDYMFHVLNKYAKLLKFKPTIPPNAVELCSEKMACHATGTCKKFMVE  442

Query  1686  SLVKAAPSTTAPCTMPPPFDPATL  1757
             S+V+ +PS   PCT+PPP+DP  L
Sbjct  443   SMVE-SPSDELPCTLPPPYDPLAL  465



>ref|XP_011091974.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Sesamum 
indicum]
Length=485

 Score =   510 bits (1313),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 239/420 (57%), Positives = 309/420 (74%), Gaps = 15/420 (4%)
 Frame = +3

Query  498   PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWR  677
             PL+C+      +CP NY P+S +       + +           CP+YFRWI++DL  W+
Sbjct  52    PLDCTTWNHTNTCPKNY-PTSYIPGANPSPKST-----------CPEYFRWIHEDLKHWK  99

Query  678   ESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPD  857
             ++GI++EMV  ARRTA+FRL I++G  Y   +R S Q+R  FT+WGI QL+R YPGK+PD
Sbjct  100   QTGITKEMVEKARRTAHFRLTILDGKVYVEKFRDSIQTRALFTMWGISQLMRWYPGKLPD  159

Query  858   LDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPW  1037
             L+LMFD  D PV++++ +      + PP LFRYC D  + DIVFPDWSFWGW E NI+PW
Sbjct  160   LELMFDCDDRPVVQEKDF--RQPGSGPPPLFRYCSDWRSLDIVFPDWSFWGWAETNIRPW  217

Query  1038  EGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQ  1217
               + K++KEGN  +KW DR PYAYWKGNP V   R DL+KCNV+++ DW  R+Y QDW+ 
Sbjct  218   RSVLKDIKEGNKMVKWEDRVPYAYWKGNPHVCPWRADLMKCNVTDQNDWNTRLYVQDWVA  277

Query  1218  EHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPM  1397
             E K+GY+QSNL DQC HRYKIYIEG AWSVSEKYILAC+S TLL+   +YDF+ RG++P 
Sbjct  278   ESKKGYKQSNLGDQCTHRYKIYIEGWAWSVSEKYILACNSPTLLMTLRWYDFFVRGMIPQ  337

Query  1398  KHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEY  1577
              HYWP+R++ KC+S+K AV+WGNNH ++A+ IG AGS++I E+LKMEYVYDY+FHLL+EY
Sbjct  338   HHYWPVRENAKCRSLKFAVEWGNNHTEKAKAIGEAGSRFIHEDLKMEYVYDYIFHLLNEY  397

Query  1578  AKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             AKLLKYKPT+PP AVELCSE M C A+G  ++FM ESL K  P  +APCTMPPP+ P  L
Sbjct  398   AKLLKYKPTIPPNAVELCSESMACPADGNWRKFMEESLEK-FPKDSAPCTMPPPYQPQEL  456



>ref|XP_010418358.1| PREDICTED: protein O-glucosyltransferase 1-like isoform X1 [Camelina 
sativa]
Length=569

 Score =   513 bits (1320),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 240/382 (63%), Positives = 298/382 (78%), Gaps = 7/382 (2%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYF+WI++DL  WRE+GI+REMV   + TA+FRLVIVNG     NY KS Q+RD FTL
Sbjct  161   CPDYFKWIHEDLKPWRETGITREMVERGKTTAHFRLVIVNGRVLVENYEKSIQTRDAFTL  220

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTT--APPALFRYCGDEATWDI  983
             WGILQLLR+YPGK+PD+DLMFD  D PVIK   Y   + T   +PP LFRYCGD  T DI
Sbjct  221   WGILQLLRKYPGKLPDVDLMFDCDDRPVIKSDGYNRFNRTAKDSPPPLFRYCGDRWTVDI  280

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA-TRKDLLKC  1160
             VFPDWSFWGW EINIK W  + K+++EG  K K+++RE YAYWKGNP VA+ +R+DLL C
Sbjct  281   VFPDWSFWGWQEINIKEWSKVLKDMEEGKKKKKFMEREAYAYWKGNPFVASPSREDLLTC  340

Query  1161  NVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSL  1340
             N+S   DW AR++ QDWI E ++G++ SN+A+QC +RYKIYIEG AWSVSEKYILACDS+
Sbjct  341   NLSSLHDWNARIFIQDWISEGQRGFENSNVANQCTYRYKIYIEGYAWSVSEKYILACDSV  400

Query  1341  TLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQ  1520
             TL+VKP+YYDF++R L P++HYWPIRD DKC+SIK AVDW NNH Q+AQEIG   S++++
Sbjct  401   TLMVKPYYYDFFSRTLQPLQHYWPIRDKDKCRSIKFAVDWLNNHTQKAQEIGREASEFMK  460

Query  1521  EELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVC---GANGLEKQFMMESL  1691
              +L +E VYDYMFHLL+EY+KLLKYKP VP  +VELC+E MVC     NG+ K+FMM SL
Sbjct  461   RDLSIENVYDYMFHLLNEYSKLLKYKPQVPKNSVELCTEAMVCPSGDVNGVNKRFMMGSL  520

Query  1692  VKAAPSTTAPCTMPPPFDPATL  1757
             V + P  + PC++PPPF P  L
Sbjct  521   V-SRPHVSGPCSLPPPFSPNGL  541



>gb|KDP28650.1| hypothetical protein JCGZ_14421 [Jatropha curcas]
Length=498

 Score =   510 bits (1313),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 247/474 (52%), Positives = 326/474 (69%), Gaps = 28/474 (6%)
 Frame = +3

Query  342   AIKTLPR--SSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIPPLNCSL  515
             A + L R  S+    FF++L VG F+  R+  S +T +  + +  Q         L C  
Sbjct  23    ACRALKRLASATVFLFFILLVVGVFI-LRIDVSVITKKQKSSIEFQ---------LKCPK  72

Query  516   RTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISR  695
             +    +C +NY                P  TP  S +KCP+YFRWI++DL  W+ SGISR
Sbjct  73    KGIAKTCDSNY--------------TVPFETPAFSDAKCPEYFRWIHEDLRPWKSSGISR  118

Query  696   EMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFD  875
             + + +AR+  +FRLVIV G  Y   Y+KSFQ+RD FT+WG LQLLR YPG+VPDL+LMF 
Sbjct  119   DTLETARKFTDFRLVIVQGKLYVEQYQKSFQTRDLFTIWGFLQLLRLYPGRVPDLELMFG  178

Query  876   TVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKE  1055
               D P+I+K+++      T PP LF+YCG     DIVFPDWSFWGW E NIKPWE   + 
Sbjct  179   CGDTPIIQKRNHQ-GPNATLPPPLFQYCGHRDALDIVFPDWSFWGWAETNIKPWENTLEG  237

Query  1056  LKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGY  1235
             + +G+ KIKW +R PYAYW+GNP V++ R DL++C VS+K DW AR+Y QDW +E K+GY
Sbjct  238   IIKGSKKIKWKNRVPYAYWRGNPYVSSNRGDLMRCKVSDKHDWNARLYRQDWAKEIKEGY  297

Query  1236  QQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPI  1415
             + S L DQC HRYKIYIEG  WSVS KYILACDS+TLL+KP +YDF+ RG++PM+HYWP+
Sbjct  298   KHSKLEDQCTHRYKIYIEGIGWSVSHKYILACDSMTLLIKPEFYDFFMRGMVPMQHYWPV  357

Query  1416  RDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKY  1595
             R+ +KC+ IK AV+WGNNH +QA+ IG  GSK+I+E LKME VY+YMFH L+EYAKLLK+
Sbjct  358   RNTNKCRDIKFAVEWGNNHPRQARAIGKGGSKFIKENLKMENVYEYMFHTLTEYAKLLKF  417

Query  1596  KPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             KP +P   VE+C E   C  NG+ ++FM ES++K +PS T PC+MPPP+D  +L
Sbjct  418   KPKIPKGGVEMCLESTACSKNGVWRKFMAESMIK-SPSDTLPCSMPPPYDQHSL  470



>ref|XP_010430435.1| PREDICTED: protein O-glucosyltransferase 1-like isoform X1 [Camelina 
sativa]
Length=568

 Score =   513 bits (1320),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 237/382 (62%), Positives = 300/382 (79%), Gaps = 7/382 (2%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYF+WI++DL  WRE+GI++EMV   + TA+FRLVIVNG  +  NY+KS Q+RD FTL
Sbjct  160   CPDYFKWIHEDLKPWRETGITKEMVERGKTTAHFRLVIVNGKVFVENYKKSIQTRDAFTL  219

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTT--APPALFRYCGDEATWDI  983
             WGILQLLR+YPGK+PD+D+MFD  D PVI+   Y   + T   +PP LFRYCGD  T DI
Sbjct  220   WGILQLLRKYPGKLPDVDIMFDCDDRPVIRLDGYNRFNRTVEDSPPPLFRYCGDRWTVDI  279

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA-TRKDLLKC  1160
             VFPDWSFWGW EINIK W  + K+++EG  K K+++RE YAYWKGNP VA+ +R+DLL C
Sbjct  280   VFPDWSFWGWQEINIKEWSKVLKDMEEGKKKKKFMEREAYAYWKGNPFVASPSREDLLTC  339

Query  1161  NVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSL  1340
             N+S   DW AR++ QDWI E ++G++ SN+A+QC +RYKIYIEG AWSVSEKYILACDS+
Sbjct  340   NLSSLHDWNARIFIQDWISEGQRGFENSNVANQCTYRYKIYIEGYAWSVSEKYILACDSV  399

Query  1341  TLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQ  1520
             TL+VKP+YYDF++R L P++HYWPIRD DKC+SIK AVDW NNH Q+AQEIG   S++++
Sbjct  400   TLMVKPYYYDFFSRTLQPLQHYWPIRDKDKCRSIKFAVDWLNNHTQKAQEIGREASEFMK  459

Query  1521  EELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVC---GANGLEKQFMMESL  1691
              +L +E VYDYMFHLL+EY+KLLKYKP VP  +VELC+E MVC     NG+ K+FMM SL
Sbjct  460   RDLSIENVYDYMFHLLNEYSKLLKYKPQVPKNSVELCTEAMVCPSGDVNGVNKRFMMGSL  519

Query  1692  VKAAPSTTAPCTMPPPFDPATL  1757
             V + P  + PC++PPPF P  L
Sbjct  520   V-SRPHVSGPCSLPPPFSPNGL  540



>ref|XP_008806857.1| PREDICTED: protein O-glucosyltransferase 1 [Phoenix dactylifera]
Length=538

 Score =   511 bits (1316),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 227/376 (60%), Positives = 296/376 (79%), Gaps = 4/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYFRWI++DL  W  +GI+R+MV +A+++A+FRLV+++G AY   Y K+F++RD FTL
Sbjct  135   CPDYFRWIHEDLRPWNRTGITRDMVAAAQKSADFRLVVLDGRAYMERYHKAFETRDVFTL  194

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGILQLL RYPG++PDL+LMF+  D PVI    Y  +  +  PP LFRYC D++T DI+F
Sbjct  195   WGILQLLNRYPGRIPDLELMFNCGDMPVI---PYADHRDSAPPPPLFRYCKDDSTADILF  251

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGWPE+N+KPW+ LS+EL+E N ++ W++REPYAYWKGN  V ATR+++++CNVS
Sbjct  252   PDWSFWGWPEVNVKPWKTLSEELREANERMSWMEREPYAYWKGNTGVCATRREVMQCNVS  311

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
               ++W AR+Y QDW    +QG++ S+LA QC HRYKIYIEG AWSVSEKYILACDS TL 
Sbjct  312   NGKEWNARIYQQDWGITRRQGFKGSDLASQCKHRYKIYIEGRAWSVSEKYILACDSPTLY  371

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VK  ++DF++RGL+P +HYWP+ D DKC+SIK AVDWGN+H ++AQ IG  GS++I+E+L
Sbjct  372   VKTQFHDFFSRGLLPGRHYWPLPDRDKCRSIKFAVDWGNSHKKEAQAIGKEGSRFIEEQL  431

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KM++VYDYMFHLLSEYAKLL YKP+ P  A+ELC E M C A GL K FM ES+     S
Sbjct  432   KMDHVYDYMFHLLSEYAKLLTYKPSRPKNAIELCLESMACSAEGLVKTFMRESMPDLT-S  490

Query  1710  TTAPCTMPPPFDPATL  1757
              + PCTMPPPF+P  +
Sbjct  491   GSNPCTMPPPFNPQEI  506



>ref|XP_006391747.1| hypothetical protein EUTSA_v10023375mg [Eutrema salsugineum]
 gb|ESQ29033.1| hypothetical protein EUTSA_v10023375mg [Eutrema salsugineum]
Length=579

 Score =   512 bits (1319),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 251/444 (57%), Positives = 316/444 (71%), Gaps = 23/444 (5%)
 Frame = +3

Query  453   PTRLSHQKIIENEIPPLNC-SLRTPM--ASCPANYYPSSKLTRTRTRIQDspsptptqss  623
             P R+  +K  +     +NC S   P   ASC     P S   +T +              
Sbjct  124   PVRVPEKKSTQKTGISVNCTSFWNPNRPASCSRTPQPGSHHNQTESN-------------  170

Query  624   sKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTF  803
               CPDYF+WI++DL  WRE+GI+REMV + + TA+FRLVI NG  +  NY+KS  +RD F
Sbjct  171   RSCPDYFKWIHEDLKPWRETGITREMVENGKTTAHFRLVITNGKVFVENYKKSILTRDAF  230

Query  804   TLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYV-LNDTTT-APPALFRYCGDEATW  977
             TLWGILQLLR+YPGK+PD+DLMFD  D PVIK   +  LN T    PPALFRYCGD  T 
Sbjct  231   TLWGILQLLRKYPGKLPDVDLMFDCDDRPVIKSDGFSKLNPTAEDGPPALFRYCGDRWTV  290

Query  978   DIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA-TRKDLL  1154
             DIVFPDWSFWGW EINIKPW  + KE+++G  K  +++RE YAYWKGNP VA+ +R+DLL
Sbjct  291   DIVFPDWSFWGWQEINIKPWSKVLKEMEQGKKKKTFMEREAYAYWKGNPFVASPSREDLL  350

Query  1155  KCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACD  1334
              CN+S + DW AR++ QDWI E ++G++ SN+A+QC HRYKIYIEG  WSVSEKYILACD
Sbjct  351   TCNLSSQHDWNARIFIQDWISEGQRGFENSNVANQCTHRYKIYIEGYGWSVSEKYILACD  410

Query  1335  SLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKY  1514
             S+TL+VKP+YYDF++R L P++HYWPI+D DKC+SIK AVDW NNH Q+AQEIG   S++
Sbjct  411   SVTLMVKPYYYDFFSRTLQPLQHYWPIKDKDKCRSIKFAVDWLNNHTQKAQEIGRGASEF  470

Query  1515  IQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVC---GANGLEKQFMME  1685
             +Q +L ME VYDYMFHLL+EY+KLLKYKP     +VE+C+E MVC     NG  K+F+M 
Sbjct  471   MQRDLSMENVYDYMFHLLNEYSKLLKYKPQASKNSVEICTEAMVCPSGDVNGPNKRFLMG  530

Query  1686  SLVKAAPSTTAPCTMPPPFDPATL  1757
             SLV   P  + PC++PPPFDP  L
Sbjct  531   SLV-YEPPISDPCSLPPPFDPNGL  553



>ref|XP_010055153.1| PREDICTED: O-glucosyltransferase rumi homolog [Eucalyptus grandis]
Length=507

 Score =   509 bits (1312),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 245/478 (51%), Positives = 322/478 (67%), Gaps = 19/478 (4%)
 Frame = +3

Query  321   TNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVS---TRLLDSTVTAQHPTRLSHQKIIENE  491
             T  RP P  +    +++ +   + +  G FVS      L      +  T  S +    N 
Sbjct  13    TKTRPPPVKRAWASATVLMLSIVFILSGFFVSWIDISTLTGPFIFKTRTAESPRNSTRNV  72

Query  492   IPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWA  671
               PL C+  T + +CP NY  + ++    T +              CP+YFRWI++DL  
Sbjct  73    AYPLVCTNDTELLTCPTNYPATHRIENIYTEV--------------CPEYFRWIHEDLRP  118

Query  672   WRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKV  851
             W+ +GI+REM+ +++  A FRLVI+ G AY   Y+ +FQ+RD FT+WGILQLLR YPGKV
Sbjct  119   WKAAGITREMLENSKEHAQFRLVILKGKAYVEKYKPAFQTRDVFTIWGILQLLRLYPGKV  178

Query  852   PDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIK  1031
             PDL+LMF+  D P+I KQ Y  +     PP LF YCG   T+D+ FPDWSFWGWPE+NIK
Sbjct  179   PDLELMFNCDDKPLILKQEYQGSKEEQIPP-LFHYCGHNTTFDVPFPDWSFWGWPEVNIK  237

Query  1032  PWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDW  1211
             PWE +   +K     IKW DREPYA+WKGN  +A TR+DL +CN   + DW ARVYAQDW
Sbjct  238   PWEDILSAIKGKAEPIKWKDREPYAFWKGNYGLAETRRDLFRCNDRSRTDWKARVYAQDW  297

Query  1212  IQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLM  1391
              +E   G++ S L DQC HRYKIYIEG  WSVSEKYILACDS TLL+KP +YD++ RG+M
Sbjct  298   RREVADGFKHSKLEDQCTHRYKIYIEGIGWSVSEKYILACDSTTLLIKPEFYDYFIRGMM  357

Query  1392  PMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLS  1571
             PM+HYWPIR ++KC+ IK AV+WGNNH ++AQ IG  G+K+++E LK+++VYDYMFHLLS
Sbjct  358   PMEHYWPIRPNNKCRDIKFAVEWGNNHTEEAQRIGDRGTKFVEESLKLKFVYDYMFHLLS  417

Query  1572  EYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFD  1745
             EYAKLLK++  VPP   ELCSE M C A+GL + FM+ES+VK +PS   PC++PPP+D
Sbjct  418   EYAKLLKFEVKVPPGVPELCSELMACPADGLVRTFMVESMVK-SPSDALPCSLPPPYD  474



>ref|XP_010315451.1| PREDICTED: O-glucosyltransferase rumi-like [Solanum lycopersicum]
Length=472

 Score =   508 bits (1308),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 232/424 (55%), Positives = 303/424 (71%), Gaps = 22/424 (5%)
 Frame = +3

Query  486   NEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDL  665
             N  P ++CS++ P  S     + SS  +                    CP+YFRWI++DL
Sbjct  48    NIFPEVSCSIKCPRVSPRKPKFMSSSES--------------------CPEYFRWIHEDL  87

Query  666   WAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPG  845
               W+E+GI+R+MV  AR  A+FR+V+VNG  Y+  Y+ +FQ RD  TLWGILQLL  YPG
Sbjct  88    RPWKETGITRKMVEKAREVAHFRVVVVNGRVYFEKYKATFQKRDIVTLWGILQLLSFYPG  147

Query  846   KVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEIN  1025
              +PDLDL+F+  D PV ++  Y      + PP LF YCG+ +++DIVFPDWSFWGWPE++
Sbjct  148   MLPDLDLVFECGDQPVTQRSDYG-KSKESVPPPLFHYCGNRSSFDIVFPDWSFWGWPELS  206

Query  1026  IKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQ  1205
             I+PW+ L K+L+  N  IKW +REPYAYWKGN  +   R+DL+KCNVS KQDW AR+Y  
Sbjct  207   IRPWDKLEKDLQHSNEMIKWTEREPYAYWKGNAVLGEARRDLMKCNVSGKQDWNARIYGL  266

Query  1206  DWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRG  1385
              W  E KQGY+ S+LA QC HRYKIY+EG AWSVS+KYILACDS+ LL+ PHYYDFYTR 
Sbjct  267   QWALERKQGYKTSDLAAQCTHRYKIYVEGLAWSVSQKYILACDSVALLINPHYYDFYTRS  326

Query  1386  LMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHL  1565
             L+P  HYWPI + DKCKSIK AVDWGN + ++AQEIG  GSK++ EEL+M+Y+YDYMFHL
Sbjct  327   LLPTVHYWPINEKDKCKSIKFAVDWGNKNAKKAQEIGKTGSKFVHEELQMKYIYDYMFHL  386

Query  1566  LSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFD  1745
             L+EY+KLLKYKPT+P +AVE+CS+ ++C   G+ K+F + S +    S++ PCTMPP + 
Sbjct  387   LTEYSKLLKYKPTIPKDAVEVCSDTLICSTKGIRKKFRVHSRINNV-SSSEPCTMPPSWS  445

Query  1746  PATL  1757
             PA L
Sbjct  446   PADL  449



>ref|XP_004234449.1| PREDICTED: O-glucosyltransferase rumi homolog [Solanum lycopersicum]
Length=384

 Score =   504 bits (1299),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 233/353 (66%), Positives = 275/353 (78%), Gaps = 2/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MV  A RTANFRLVI+NG AY   Y K FQ+RD FTLWGILQLLRRYPGK+PDLD+MFD 
Sbjct  1     MVERANRTANFRLVILNGRAYVETYEKGFQTRDVFTLWGILQLLRRYPGKIPDLDMMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPV++   +   +   APP LFRYCGD  T DIVFPDWSFWGW EINIKPW+ L K+L
Sbjct  61    VDWPVVRSSDFA-GENAVAPPPLFRYCGDNETLDIVFPDWSFWGWAEINIKPWQDLLKDL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
              +GN   +W +R PYAYWKGNPEVA  R +L+KCNV+E Q+W AR+Y QDW +E KQG++
Sbjct  120   DKGNRMQRWQNRAPYAYWKGNPEVAEKRMELVKCNVTENQEWNARIYVQDWKEEIKQGFK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
              S+L +QC HRYKIYIEGSAWSVSEKYILACDS++LLV PHYYDF++R L+P+ HYWPI 
Sbjct  180   HSDLGNQCHHRYKIYIEGSAWSVSEKYILACDSVSLLVTPHYYDFFSRSLLPLVHYWPIN  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             +DDKC SIK AVDWGN + ++ Q IG   S +IQE+LKM+YVYDYMFHLL+EYAKLL+YK
Sbjct  240   EDDKCASIKFAVDWGNKYKKKVQRIGREASDFIQEDLKMDYVYDYMFHLLNEYAKLLRYK  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             P VP  A ELCSE M C A G EK+ MMES+V   P   +PC MP PFD  +L
Sbjct  300   PKVPKSASELCSEIMACPAEGTEKKLMMESMVN-WPIDDSPCKMPIPFDKLSL  351



>gb|KCW77553.1| hypothetical protein EUGRSUZ_D01868 [Eucalyptus grandis]
Length=381

 Score =   504 bits (1298),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 231/353 (65%), Positives = 284/353 (80%), Gaps = 2/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MV  A+RTA+FRLVI+ G AY   YRKS Q+RD FT+WGILQLLRRYPG++PDL+LMFD 
Sbjct  1     MVERAKRTAHFRLVIIKGKAYVEKYRKSIQTRDKFTIWGILQLLRRYPGRIPDLELMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
              D PVI+ + Y      T+PP LFRYCGD  T DIVFPDWSFWGW EINI PWE +  EL
Sbjct  61    NDRPVIQSRHY-RGQNGTSPPPLFRYCGDRWTMDIVFPDWSFWGWAEINIMPWERVQMEL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             K+GN + KW++REP+AYWKGNP VA TR+DLLKCNVSE QDW AR++ QDWI E +QG++
Sbjct  120   KQGNERKKWIEREPHAYWKGNPFVAETRRDLLKCNVSETQDWNARLFIQDWILESQQGFK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
              S+LA QC HR+KIYIEG AWSVSEKYIL+CDS TLLVKP +YDF+TR L P++HYWPIR
Sbjct  180   NSDLASQCTHRFKIYIEGHAWSVSEKYILSCDSTTLLVKPWFYDFFTRSLNPLQHYWPIR  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
              +DKC+S+K AVDWGN+H Q+AQEIG A S +IQE++KM  VYDYM HL++EYAKLL+++
Sbjct  240   TEDKCRSLKFAVDWGNSHKQKAQEIGKASSDFIQEQVKMSNVYDYMLHLMNEYAKLLRFE  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             P VP  AVE+CSE + C A G E++FM+ESL   +PS T PCTMPPP++P ++
Sbjct  300   PEVPEGAVEVCSELVACPAGGTEREFMVESLT-MSPSATGPCTMPPPYEPKSV  351



>ref|XP_006339788.1| PREDICTED: O-glucosyltransferase rumi-like [Solanum tuberosum]
Length=441

 Score =   506 bits (1304),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 225/376 (60%), Positives = 291/376 (77%), Gaps = 2/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP+YFRWI++DL  W+E+GI+R+MV  AR  A+FR+V+VNG  Y+  Y+ +FQ RD  TL
Sbjct  45    CPEYFRWIHEDLRPWKETGITRKMVEKAREVAHFRVVVVNGRVYFDKYKATFQKRDIVTL  104

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGILQLL  YPG +PDLDL+F+  D PV ++  Y      + PP LF YCG+ +++DIVF
Sbjct  105   WGILQLLSFYPGMLPDLDLVFECGDQPVTQRSDYG-KSKDSIPPPLFHYCGNRSSFDIVF  163

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGWPE++I+PW+ L K+L++ N  IKW +REPYAYWKGN  +   R+DL+KCNVS
Sbjct  164   PDWSFWGWPELSIRPWDKLEKDLQQSNEMIKWTEREPYAYWKGNAVLGEARRDLIKCNVS  223

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
              KQDW AR+Y   W  E +QGY+ S+LA QC HRYKIY+EG AWSVS+KYILACDS+ LL
Sbjct  224   GKQDWNARIYGLQWALERRQGYKTSDLATQCTHRYKIYVEGLAWSVSQKYILACDSVALL  283

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             + PHYYDFYTR L+P  HYWPI + DKCKSIK AVDWGN + ++AQEIG AGSK++ EEL
Sbjct  284   INPHYYDFYTRSLLPTVHYWPINEKDKCKSIKFAVDWGNKNAKKAQEIGKAGSKFVHEEL  343

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             +M+Y+YDYMFHLL+EYAKLLKYKPT+P +AVE+CS+ ++C   G+ K+F + S +    S
Sbjct  344   QMKYIYDYMFHLLTEYAKLLKYKPTIPRDAVEVCSDTLICSTKGIRKKFRVHSRINNV-S  402

Query  1710  TTAPCTMPPPFDPATL  1757
             ++ PCTMPP + PA L
Sbjct  403   SSEPCTMPPSWSPADL  418



>gb|EMT28780.1| hypothetical protein F775_08370 [Aegilops tauschii]
Length=513

 Score =   509 bits (1311),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 235/384 (61%), Positives = 287/384 (75%), Gaps = 36/384 (9%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             M+  AR TANFRLV++ G AY      +FQ+RD FT+WGILQLLRRYPG+VPDLDLMFD 
Sbjct  1     MLDRARATANFRLVVLRGRAYIERIAPAFQTRDLFTIWGILQLLRRYPGRVPDLDLMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPV+    Y   D  TA P LFRYCGD  T D+VFPDWSFWGW EINIKPW+ L K+L
Sbjct  61    VDWPVVHADEY-QGDNATAMPPLFRYCGDNETLDVVFPDWSFWGWAEINIKPWDALQKDL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
              EGN +++W+DREPYAYWKGNP+VAA R++L+KCNVS KQ+W AR++ QDWI+E K GY+
Sbjct  120   NEGNKRVRWIDREPYAYWKGNPDVAAIRQELVKCNVSSKQEWNARIFKQDWIKESKAGYK  179

Query  1239  QSNLADQCIH---------RYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLM  1391
             +SNLA QC H         RYKIYIEGSAWSVSEKYILACDS+TL++KP YYDF++R LM
Sbjct  180   KSNLASQCTHSIEVVMMGDRYKIYIEGSAWSVSEKYILACDSMTLVIKPKYYDFFSRVLM  239

Query  1392  PMKHYWPIRDDDKCKSIKHAVDWGNNHHQ-------------------------QAQEIG  1496
             P +HYWP+RDD+KC SIK+AVDWGN+H +                         QAQ+IG
Sbjct  240   PTQHYWPVRDDNKCGSIKYAVDWGNSHKKKKISCHSTFCMLITCFSHLPFKNCSQAQQIG  299

Query  1497  MAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQF  1676
                SK+IQ+EL M+Y+YDYMFHLL+EYAKLL++KPT PPEAVE+C E + C A G EK+F
Sbjct  300   KKASKFIQQELSMDYIYDYMFHLLTEYAKLLRFKPTKPPEAVEVCPESLACQAIGREKKF  359

Query  1677  MMESLVKAAPSTTAPCTMPPPFDP  1748
             M +S+VK+A +   PC +PPPF P
Sbjct  360   MQDSMVKSA-NVAGPCNLPPPFSP  382



>ref|XP_010672083.1| PREDICTED: protein O-glucosyltransferase 1-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=416

 Score =   505 bits (1301),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 225/376 (60%), Positives = 293/376 (78%), Gaps = 3/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYFRWI++DL  W+ +G++R+MV +A++TA+FRLVI++G  Y   +R+S Q+RD FTL
Sbjct  9     CPDYFRWIHEDLRPWKGTGVTRKMVDAAQKTAHFRLVILDGRMYVEKFRESLQTRDEFTL  68

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WG LQLLR YPG++PDL+LMFD  D P++  + +      + PP LF+YC D    DIVF
Sbjct  69    WGFLQLLRWYPGRLPDLELMFDCDDRPMVPAKKF--RRPNSGPPPLFKYCSDPWGLDIVF  126

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGWPE NIKPW   S++++EGN  +KW DR PYAYW+GNP V+  R + +KCN +
Sbjct  127   PDWSFWGWPECNIKPWRNASRDIQEGNKMVKWKDRVPYAYWRGNPHVSPWRANFVKCNAT  186

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             +  DW  R+Y Q+W ++ K GY++SNL DQC HRYK+YIEG AWSVSEKYIL CDS+TL+
Sbjct  187   DTTDWNIRIYTQNWDKQAKVGYKESNLKDQCTHRYKVYIEGWAWSVSEKYILGCDSMTLV  246

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VKP YYDF+ RG++P+ HYWPIRD+DKCKSIK AV+WGNNH  +AQEIG A ++YI EE+
Sbjct  247   VKPKYYDFFNRGMLPLVHYWPIRDNDKCKSIKFAVEWGNNHTDKAQEIGQAATRYIHEEM  306

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KMEYVYDYM HLL+EY+KLL++KP +PP AVELC+E M C   G  ++FM ESL K +PS
Sbjct  307   KMEYVYDYMLHLLTEYSKLLRFKPAIPPNAVELCAEAMACETEGSWRKFMEESLEK-SPS  365

Query  1710  TTAPCTMPPPFDPATL  1757
                PCT+PPP+DP++L
Sbjct  366   NGVPCTLPPPYDPSSL  381



>ref|XP_009630107.1| PREDICTED: protein O-glucosyltransferase 1-like [Nicotiana tomentosiformis]
Length=480

 Score =   508 bits (1307),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 238/462 (52%), Positives = 323/462 (70%), Gaps = 25/462 (5%)
 Frame = +3

Query  372   AVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPANYY  551
              + FF++L     V+  +  + ++  H   L   K+  +  P ++CS++ P  S     +
Sbjct  21    TIGFFLILISITIVALTIEWNDISL-HTDSLQKNKV--DLFPEVSCSIKCPRTSPNKPKF  77

Query  552   PSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANF  731
              SS  +                    CP+YFRWI++DL  W+++GI+R+MV  AR  A+F
Sbjct  78    SSSSES--------------------CPEYFRWIHEDLRPWKDTGITRKMVERAREVAHF  117

Query  732   RLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSY  911
             R+VIVNG  Y+  Y+ +FQ RD  TLWG+LQLL  YPG +PDLD +F+  D PV +K  Y
Sbjct  118   RIVIVNGRVYFEKYKPTFQKRDMVTLWGVLQLLSFYPGMLPDLDFVFECGDQPVTQKSDY  177

Query  912   VLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVD  1091
                   + PP LF YCG+++++DIVFPDWSFWGWPEINIK W+ L K+L++ N  IKW +
Sbjct  178   G-KSKDSIPPPLFHYCGNDSSFDIVFPDWSFWGWPEINIKHWDILKKDLQQSNEMIKWTE  236

Query  1092  REPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHR  1271
             REPYAYWKGN  ++ +R+DLLKCN S+ QDW AR+Y   W +E +QGY+ S+LA QC HR
Sbjct  237   REPYAYWKGNVLLSQSRRDLLKCNASKNQDWNARIYDMQWARERRQGYKTSDLATQCTHR  296

Query  1272  YKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHA  1451
             YKIY+EG AWSVS+KYILACDS+ LL+ PHYYDF+TR L+P  HYWPI ++DKCKSIK A
Sbjct  297   YKIYVEGLAWSVSQKYILACDSVALLINPHYYDFFTRSLLPTIHYWPINENDKCKSIKFA  356

Query  1452  VDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELC  1631
             VDWGN + ++AQEIG +GSK++ EEL+M+Y+YDYMFHLLSEYAKLL+Y+PTVP EAVE+C
Sbjct  357   VDWGNKNAEKAQEIGKSGSKFVHEELQMKYIYDYMFHLLSEYAKLLQYRPTVPREAVEVC  416

Query  1632  SEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             S+ ++C   G+ K+  + S V  A S++ PC+MPPP+ P  L
Sbjct  417   SDTLICSTKGIRKKSRVHSRVNYA-SSSKPCSMPPPWSPVDL  457



>gb|EYU32096.1| hypothetical protein MIMGU_mgv1a004518mg [Erythranthe guttata]
Length=523

 Score =   508 bits (1309),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 237/420 (56%), Positives = 308/420 (73%), Gaps = 14/420 (3%)
 Frame = +3

Query  498   PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWR  677
             PL+C+      +CP NY  S+K +   T  + +           CP+YFRWI++DL  W+
Sbjct  89    PLDCNAWNLTNTCPKNYPNSTKPSSANTSPEST-----------CPEYFRWIHEDLRHWK  137

Query  678   ESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPD  857
             ++G++REMV  AR TA+FRL IV+G  Y   +++S Q+R  FT+WGI QL+R YPGK+PD
Sbjct  138   KTGVTREMVEKARATAHFRLTIVDGKMYVEKFKESIQTRALFTMWGIAQLMRWYPGKLPD  197

Query  858   LDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPW  1037
             L+LMFD  D PV+    + L    + PP LFRYC D  + DIVFPDWSFWGW E NI+PW
Sbjct  198   LELMFDADDRPVVPANDFRL--PGSEPPPLFRYCSDWNSLDIVFPDWSFWGWAETNIRPW  255

Query  1038  EGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQ  1217
               + K++KEGN + KW DR PYAYWKGNP V   R DL+KCN +++ DW  R+Y QDWI 
Sbjct  256   RYVLKDIKEGNKRTKWEDRVPYAYWKGNPHVCPWRADLMKCNATDQNDWNTRLYVQDWIA  315

Query  1218  EHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPM  1397
             E ++GY+QSNL DQC HRYKIYIEG AWSVSEKYILAC+S TLL+   +YDF+ RG++P 
Sbjct  316   ESQKGYKQSNLGDQCTHRYKIYIEGWAWSVSEKYILACNSPTLLMTQRWYDFFIRGMIPQ  375

Query  1398  KHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEY  1577
             +HYWP+RD DKC+S+K+AV+WGNNH ++A+ IG AGS++I E++KMEYVYDY+FH+L+EY
Sbjct  376   QHYWPVRDSDKCRSLKYAVEWGNNHTEKAKAIGEAGSRFIHEDMKMEYVYDYIFHVLNEY  435

Query  1578  AKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             AKLLKYKPTVP  A+ELCSE M C A+G+ ++FM ESL K  PS + PC MPPP+ P  L
Sbjct  436   AKLLKYKPTVPINAIELCSESMACPADGIWRKFMEESLEK-TPSDSPPCKMPPPYQPHEL  494



>emb|CBI40335.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   509 bits (1312),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 258/509 (51%), Positives = 319/509 (63%), Gaps = 29/509 (6%)
 Frame = +3

Query  258   PHILKMRETSEGARLYRHFTDTNWRPLPAIKTLPRSSLAVFFFMVLCVGAFVSTRLLDST  437
             P +  + E     R  RH T  +  PL          +     +    G F       S 
Sbjct  63    PDLDLIFECGAKNRCSRHMTTKDLMPLLHQHCFITVEMMKHLILSSGTGHFGVVLFFQSV  122

Query  438   VTAQHPTRL-SHQKIIE---NEIP-PLNCSLRTPMASCP----ANYYPSSKLTRTRTRIQ  590
              T     ++ SH   I+    +I   LNCS      +CP    A + PS   T T     
Sbjct  123   FTGDSFRKVWSHSSSIKPCNKKIEYSLNCSEGNMAQTCPVTPLATFEPSEPSTET-----  177

Query  591   DspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHN  770
                          CP+YFRWIY+DL  WRE+GI+R+MV  A+  A  R+V+V+G  Y   
Sbjct  178   -------------CPEYFRWIYEDLRPWRETGITRDMVERAKPAAYIRVVVVDGKVYMEK  224

Query  771   YRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALF  950
             Y+  +Q+RD FT+WGILQLLR YPGK+PD DLMF   D  +  K  Y      T PP LF
Sbjct  225   YKGVYQTRDVFTIWGILQLLRMYPGKLPDFDLMFSCGD-KLAMKTRYFQGPNATTPPPLF  283

Query  951   RYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEV  1130
              YCGD+ T+DIVFPDWSFWGWPEI+IK W  L K+LKEGN + +W+DREPYAYWKGN  +
Sbjct  284   HYCGDDETYDIVFPDWSFWGWPEIHIKQWNTLKKDLKEGNNRTEWIDREPYAYWKGNINL  343

Query  1131  AATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVS  1310
                R +L KCN + +QDW AR+Y  DW QE   G+  S+LA QC HRYKIY EG  WSVS
Sbjct  344   GLARHELSKCNKTSEQDWNARIYDIDWRQEIHSGFNSSDLASQCTHRYKIYTEGVTWSVS  403

Query  1311  EKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQE  1490
             EKYILACDS+TLL  PHYYDF+TR L PM HYWP++  D CKSIK A +W NNH ++AQE
Sbjct  404   EKYILACDSVTLLANPHYYDFFTRSLQPMVHYWPLKLKDMCKSIKFATEWCNNHTEKAQE  463

Query  1491  IGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEK  1670
             I  AGS ++QE+LKM++VYDYMFHLLS YAKLLK+KP+VPP AVE C E MVC   GLEK
Sbjct  464   IAKAGSSFVQEKLKMKFVYDYMFHLLSMYAKLLKFKPSVPPGAVEFCPETMVCPVKGLEK  523

Query  1671  QFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              + ++S+V+ +PS T PCTMPPP+DPA L
Sbjct  524   DYKIQSMVR-SPSDTGPCTMPPPYDPAEL  551


 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +3

Query  723  ANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFD  875
            A+ R+V+V+G  +   Y   FQ+R   T+W ILQLLR YPGK+PDLDL+F+
Sbjct  20   AHIRVVVVDGKVFMEKYEWVFQTRHVLTIWCILQLLRMYPGKLPDLDLIFE  70



>ref|XP_006353391.1| PREDICTED: KDEL motif-containing protein 1-like [Solanum tuberosum]
Length=392

 Score =   503 bits (1294),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 232/353 (66%), Positives = 275/353 (78%), Gaps = 2/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MV    RTANFRLV++NG AY   Y K FQ+RD FTLWGILQLLRRYPGK+PDLD+MFD 
Sbjct  1     MVERGNRTANFRLVVLNGRAYVETYEKGFQTRDVFTLWGILQLLRRYPGKIPDLDMMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
             VDWPV++   +   +   APP LFRYCGD  T DIVFPDWSFWGW EINIKPW+ L K+L
Sbjct  61    VDWPVVRSSDFA-GENAVAPPPLFRYCGDNETLDIVFPDWSFWGWAEINIKPWQDLLKDL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
              +GN   +W++REPYAYWKGNPEVA  R +L+KCNV+E Q+  AR+Y QDW +E KQG++
Sbjct  120   DKGNKMQRWLNREPYAYWKGNPEVAEKRMELVKCNVTENQESNARIYVQDWKEEIKQGFK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
              S+L +QC HRYKIYIEGSAWSVSEKYILACDS++LLV PHYYDF++R L+P+ HYWPI 
Sbjct  180   HSDLGNQCHHRYKIYIEGSAWSVSEKYILACDSVSLLVTPHYYDFFSRSLLPLVHYWPIN  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             +DDKC SIK AVDWGN + ++ Q IG   S +IQE+L+MEYVYDYMFHLL+EYAKLLKYK
Sbjct  240   EDDKCGSIKFAVDWGNKYKKKVQRIGRKASDFIQEDLRMEYVYDYMFHLLNEYAKLLKYK  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             P VP  A ELCSE M C A G EK+ MMES+V   P   +PC MP PF+  TL
Sbjct  300   PRVPKNASELCSEIMACPAEGTEKKLMMESMVN-WPIDESPCKMPIPFNKLTL  351



>ref|XP_010544721.1| PREDICTED: O-glucosyltransferase rumi homolog [Tarenaya hassleriana]
Length=502

 Score =   506 bits (1303),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 241/470 (51%), Positives = 323/470 (69%), Gaps = 21/470 (4%)
 Frame = +3

Query  348   KTLPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPM  527
             K++ ++++ V   + +  G F     LD T       R +     ++E P     +    
Sbjct  25    KSIAKTTVIVVSLLFILAGLFDFLGFLDLTTFTGFTLRATAN--TKHEFPDKCDVVEKQT  82

Query  528   ASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVM  707
                P     S +  R+R            +S+  CP YFRWI++DL  W+E+GI+R+M+ 
Sbjct  83    VRVPK----SGETNRSR------------RSNVTCPSYFRWIHEDLRPWKEAGITRDMIE  126

Query  708   SARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDW  887
              ++ TANFRLVI++G  Y   YR++ Q+RD FTLWGILQLLR YPG++PDL+LMFD  D 
Sbjct  127   RSKETANFRLVILDGRVYVEKYREAIQTRDVFTLWGILQLLRWYPGRLPDLELMFDCGDR  186

Query  888   PVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEG  1067
             P ++   ++       PP LFRYC D+A+ DIVFPDWSFWGW E+NIKPWE   + ++EG
Sbjct  187   PTVRSDDFL--GQRAGPPPLFRYCSDDASLDIVFPDWSFWGWAEVNIKPWEKSLEAIEEG  244

Query  1068  NVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSN  1247
             N K +W DR PYAYWKGNP V  TR DLL+CNVS+++ W  R+Y QDW +E+K+G++ SN
Sbjct  245   NKKSQWEDRIPYAYWKGNPNVDPTRIDLLRCNVSDREGWNTRLYIQDWERENKEGFKNSN  304

Query  1248  LADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDD  1427
             L +QC HRYKIYIEG AWSVSEKYI+ACDS+TL VKP +YDFY RG++P++HYWPIRDD 
Sbjct  305   LENQCNHRYKIYIEGWAWSVSEKYIMACDSMTLYVKPRFYDFYVRGMVPLRHYWPIRDDS  364

Query  1428  KCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTV  1607
             KC S+K AV WGNNH ++A+EI  AGS++I+EE+KME+VYDYMFHLL+EYAKLLK++P +
Sbjct  365   KCISLKFAVHWGNNHFEKAREIAEAGSRFIREEVKMEFVYDYMFHLLNEYAKLLKFRPEI  424

Query  1608  PPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             P    E+  E M C A G  ++FM ES+V  +PS  +PC MPPP+DP  L
Sbjct  425   PRGGKEITPENMGCPATGRWREFMSESMV-MSPSERSPCVMPPPYDPLAL  473



>gb|KEH18906.1| glycosyltransferase family 90 protein [Medicago truncatula]
Length=498

 Score =   505 bits (1300),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 236/378 (62%), Positives = 292/378 (77%), Gaps = 5/378 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP YFRWI++DL  WRE GI+R M+  A++TA+F+LVIV+G  Y   YRKS Q+RD FTL
Sbjct  95    CPSYFRWIHEDLKPWREKGITRNMLKKAKKTAHFKLVIVDGKMYVEKYRKSIQTRDVFTL  154

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGILQLLR YPGK+PDL+LMFD  D PV+    +       +PP LFRYC D+ + DIVF
Sbjct  155   WGILQLLRLYPGKLPDLELMFDCEDKPVVPLDKF--QGPNASPPPLFRYCSDQWSLDIVF  212

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGW E NIKPW  + K++KEGN K KW DR PYAYWKGNP VA TR++LL+CNV+
Sbjct  213   PDWSFWGWAETNIKPWNNILKDIKEGNKKTKWKDRVPYAYWKGNPYVAPTRQNLLQCNVT  272

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
              + DW   +Y QDWIQE  QG+ +SNL DQC HRYKIYIEG AWSVSEKYI+ACDS+TL 
Sbjct  273   LENDWNTLIYIQDWIQESNQGFNKSNLGDQCTHRYKIYIEGWAWSVSEKYIMACDSMTLY  332

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VK +Y+DF+ RG++P++HYWPIR++ KC S+K AV+WGNNH  +AQ IG AGSK+IQE+L
Sbjct  333   VKSNYHDFFIRGMVPLQHYWPIRNNSKCTSLKFAVEWGNNHTHKAQSIGEAGSKFIQEDL  392

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEK-MVCGANGLEK-QFMMESLVKAA  1703
              M+ VY+YMFHLL+EYAKLLK+KPT+P  AVE+C EK M C   G  K +FM ES+VK  
Sbjct  393   DMKNVYNYMFHLLNEYAKLLKFKPTIPRGAVEICPEKLMACDVIGGNKMRFMEESMVK-V  451

Query  1704  PSTTAPCTMPPPFDPATL  1757
             PS + PCT+PPP++P  L
Sbjct  452   PSDSNPCTIPPPYEPLAL  469



>emb|CAD41531.1| OSJNBb0020O11.18 [Oryza sativa Japonica Group]
 emb|CAE04583.2| OSJNBb0039L24.22 [Oryza sativa Japonica Group]
Length=375

 Score =   500 bits (1287),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 221/353 (63%), Positives = 279/353 (79%), Gaps = 2/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             M+  AR TA+FRL+++ G A+ H +R +FQ+RD FT+WG+LQLLRRYPG+VPDLDLMFD 
Sbjct  1     MLARARVTASFRLLVLGGRAFVHRFRPAFQTRDLFTIWGVLQLLRRYPGRVPDLDLMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
              DWPV++   Y        PP LF YCGD+ T DIVFPDWSFWGWPEINIKPW+ L ++L
Sbjct  61    ADWPVVRTHLYRGKHAAFMPP-LFSYCGDDRTLDIVFPDWSFWGWPEINIKPWDALRQDL  119

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             K+GN ++KW+DR PYAYWKGNP VA TR++L+ CNVS  +DW AR+Y QDW +E K GY+
Sbjct  120   KDGNNRVKWLDRVPYAYWKGNPAVAVTRQELVNCNVSTTKDWNARIYKQDWFRESKAGYK  179

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
              SNL  QC HRYKIYIEGSAWSVS+KYILACDS+TLLV P YYDF++R LMP++HYWP+ 
Sbjct  180   DSNLGSQCTHRYKIYIEGSAWSVSQKYILACDSMTLLVTPRYYDFFSRSLMPIQHYWPVH  239

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             +D+KC SIK+AVDWGN+H Q AQ IG   S +I+E++ M+ VYDYM HLL+EYAKLL+++
Sbjct  240   NDNKCDSIKYAVDWGNSHKQLAQRIGKQASDFIEEDVNMDRVYDYMLHLLTEYAKLLRFR  299

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             P  PPEAVE+C + + C A GLEK+F+MES+VK+A     PC +PPPF+P  L
Sbjct  300   PIKPPEAVEICPDSLACQAEGLEKKFLMESMVKSA-RDAGPCDLPPPFNPQEL  351



>gb|KCW71637.1| hypothetical protein EUGRSUZ_E00165, partial [Eucalyptus grandis]
Length=447

 Score =   503 bits (1294),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 233/416 (56%), Positives = 301/416 (72%), Gaps = 16/416 (4%)
 Frame = +3

Query  498   PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWR  677
             PL C+  T + +CP NY  + ++    T +              CP+YFRWI++DL  W+
Sbjct  15    PLVCTNDTELLTCPTNYPATHRIENIYTEV--------------CPEYFRWIHEDLRPWK  60

Query  678   ESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPD  857
              +GI+REM+ +++  A FRLVI+ G AY   Y+ +FQ+RD FT+WGILQLLR YPGKVPD
Sbjct  61    AAGITREMLENSKEHAQFRLVILKGKAYVEKYKPAFQTRDVFTIWGILQLLRLYPGKVPD  120

Query  858   LDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPW  1037
             L+LMF+  D P+I KQ Y  +     PP LF YCG   T+D+ FPDWSFWGWPE+NIKPW
Sbjct  121   LELMFNCDDKPLILKQEYQGSKEEQIPP-LFHYCGHNTTFDVPFPDWSFWGWPEVNIKPW  179

Query  1038  EGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQ  1217
             E +   +K     IKW DREPYA+WKGN  +A TR+DL +CN   + DW ARVYAQDW +
Sbjct  180   EDILSAIKGKAEPIKWKDREPYAFWKGNYGLAETRRDLFRCNDRSRTDWKARVYAQDWRR  239

Query  1218  EHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPM  1397
             E   G++ S L DQC HRYKIYIEG  WSVSEKYILACDS TLL+KP +YD++ RG+MPM
Sbjct  240   EVADGFKHSKLEDQCTHRYKIYIEGIGWSVSEKYILACDSTTLLIKPEFYDYFIRGMMPM  299

Query  1398  KHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEY  1577
             +HYWPIR ++KC+ IK AV+WGNNH ++AQ IG  G+K+++E LK+++VYDYMFHLLSEY
Sbjct  300   EHYWPIRPNNKCRDIKFAVEWGNNHTEEAQRIGDRGTKFVEESLKLKFVYDYMFHLLSEY  359

Query  1578  AKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFD  1745
             AKLLK++  VPP   ELCSE M C A+GL + FM+ES+VK +PS   PC++PPP+D
Sbjct  360   AKLLKFEVKVPPGVPELCSELMACPADGLVRTFMVESMVK-SPSDALPCSLPPPYD  414



>ref|XP_008244917.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Prunus 
mume]
Length=379

 Score =   499 bits (1285),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 230/353 (65%), Positives = 277/353 (78%), Gaps = 3/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             M+  A RTA+FRL+I+NG AY   YR+S Q+RD FTLWGILQLLR YPG++PDL+LMFD 
Sbjct  1     MIERAHRTAHFRLLIINGKAYIEKYRQSIQTRDMFTLWGILQLLRVYPGRLPDLELMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
              D P+I+ + +        PP LFRYC DE + DIVFPDWSFWGW E NIKPW  L   +
Sbjct  61    DDRPIIRSKDF--RGPNAGPPPLFRYCADEGSLDIVFPDWSFWGWAETNIKPWRSLLPSI  118

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             KEGN + KW DR PYAYWKGNP VA TRKDLLKCNVS+K DW AR+Y Q+W QE KQGY+
Sbjct  119   KEGNKRTKWKDRLPYAYWKGNPSVAPTRKDLLKCNVSDKNDWNARLYIQNWEQESKQGYK  178

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
              SNL  QC HRYKIYIEG AWSVSEKYI+ACDS+TL V+P YYDF+ RG+ P++H+WPIR
Sbjct  179   DSNLESQCKHRYKIYIEGWAWSVSEKYIMACDSMTLYVRPRYYDFFMRGMEPLQHFWPIR  238

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             D+ KC S+K AV+WGNNH  +A+ IG A S +IQE+LKM+YVYDYMFH+L+EYAKLLK+K
Sbjct  239   DNSKCTSLKFAVEWGNNHKDKAKAIGEAASNFIQEDLKMDYVYDYMFHVLNEYAKLLKFK  298

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             PT+PP AVELCSE M C A G  K+FM+ES+V+ +PS   PCT+PPP+DP  L
Sbjct  299   PTIPPNAVELCSETMACPATGTWKKFMVESMVE-SPSDELPCTLPPPYDPLAL  350



>ref|XP_010055151.1| PREDICTED: protein O-glucosyltransferase 1-like [Eucalyptus grandis]
Length=508

 Score =   503 bits (1295),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 247/490 (50%), Positives = 331/490 (68%), Gaps = 34/490 (7%)
 Frame = +3

Query  336   LPAIKTLPRS-----SLAVF--FFMVLCVGAFVSTRLLDSTVTAQHPTR--LSHQKIIEN  488
             LP+ K  PRS     S AVF  F +++  G  +S   LD  +      R   +  KI E+
Sbjct  9     LPSSKRTPRSLKVPASAAVFVLFLIIVLSGCIISG--LDIFIFPGGSLREVFNVNKIPED  66

Query  489   EIPP-------LNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFR  647
              +         LNC+  T   +CP +Y    + T    R              +CP+YFR
Sbjct  67    SLRSSQKIEYLLNCTNATKPQTCPIDYLTMFQPTDLPAR--------------ECPEYFR  112

Query  648   WIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQL  827
             WI++DL AW+ +GI++EMV   R  A++RLVI+ G  Y  ++RK +Q+RD  T+WGI+QL
Sbjct  113   WIHEDLRAWKSTGITKEMVERTRDFAHYRLVILKGRVYVEHFRKPYQTRDVGTIWGIVQL  172

Query  828   LRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFW  1007
             LR YPGK+PDL+LMF   D PVI K  Y      T PP LFR+CG+++ +DI FPDWSFW
Sbjct  173   LRLYPGKIPDLELMFYCNDQPVIMKNDY-QGPNATLPPPLFRFCGNQSAFDITFPDWSFW  231

Query  1008  GWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWG  1187
             GW EINI PWE   + +++ + KI+W D+ PYAYWKGN  VAATR+DL+KCN +  QDW 
Sbjct  232   GWAEINIGPWESTVRAIRQNSEKIEWNDKVPYAYWKGNTGVAATRRDLMKCNATSGQDWK  291

Query  1188  ARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYY  1367
               +Y Q+W +E  QG++QS L DQC HRYKIY+EG AWSVSEKYI+AC+S+TL+VKP + 
Sbjct  292   THLYHQEWSREVSQGFKQSKLEDQCTHRYKIYVEGEAWSVSEKYIMACNSMTLMVKPEFL  351

Query  1368  DFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVY  1547
             DF+TRG++P++HYWPIR D+KC+ IK AV+WGNNH Q+AQ IG +GSK+++E LKM+ VY
Sbjct  352   DFFTRGMIPLEHYWPIRPDNKCRDIKFAVEWGNNHPQEAQVIGESGSKFMEEGLKMKNVY  411

Query  1548  DYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCT  1727
             DYMFHLLS Y KL+ YKP +PP A+E CSE M C A GL ++ M+ES+VK +PS + PCT
Sbjct  412   DYMFHLLSGYGKLITYKPEIPPGAIEYCSETMACPAQGLFRKNMLESMVK-SPSDSPPCT  470

Query  1728  MPPPFDPATL  1757
             +PPP++P   
Sbjct  471   LPPPYEPGEF  480



>ref|XP_008244916.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X1 [Prunus 
mume]
Length=379

 Score =   496 bits (1278),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 229/353 (65%), Positives = 277/353 (78%), Gaps = 3/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             M+  A RTA+FRL+I+NG AY   YR+S Q+RD FTLWGILQLLR YPG++PDL+LMFD 
Sbjct  1     MIERAHRTAHFRLLIINGKAYIEKYRQSIQTRDMFTLWGILQLLRVYPGRLPDLELMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
              D P+I+ + +        PP LFRYC DE + DIVFPDWSFWGW E NIKPW  L   +
Sbjct  61    DDRPIIRSKDF--RGPNAGPPPLFRYCADEGSLDIVFPDWSFWGWAETNIKPWRSLLPSI  118

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             KEGN + KW DR PYAYWKGNP VA TRKDLLKCNVS+K DW AR+Y Q+W QE KQGY+
Sbjct  119   KEGNKRTKWKDRLPYAYWKGNPSVAPTRKDLLKCNVSDKNDWNARLYIQNWEQESKQGYK  178

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
              SNL  QC HRYKIYIEG AWSVSEKYI+ACDS+TL V+P YYDF+ RG+ P++H+WPIR
Sbjct  179   DSNLESQCKHRYKIYIEGWAWSVSEKYIMACDSMTLYVRPRYYDFFMRGMEPLQHFWPIR  238

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             D+ KC S+K AV+WGNNH  +A+ IG A + +IQE+LKM+YVYDYMFH+L+EYAKLLK+K
Sbjct  239   DNSKCTSLKFAVEWGNNHKDKAKAIGEAANNFIQEDLKMDYVYDYMFHVLNEYAKLLKFK  298

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             PT+PP AVELCSEKM C A G  K+FM+ES+V+ +PS   PCT+ PP+DP  L
Sbjct  299   PTIPPNAVELCSEKMACPATGTWKKFMVESMVE-SPSDELPCTLLPPYDPLAL  350



>ref|XP_008244914.1| PREDICTED: O-glucosyltransferase rumi homolog [Prunus mume]
Length=382

 Score =   496 bits (1278),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 227/355 (64%), Positives = 279/355 (79%), Gaps = 3/355 (1%)
 Frame = +3

Query  693   REMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMF  872
             R+M+  ARRTA+FRL IV+G AY   Y +SFQ+RD FTLWGILQLLR YPG++PDL+LMF
Sbjct  2     RDMIEKARRTAHFRLFIVDGKAYIEKYTQSFQTRDMFTLWGILQLLRVYPGRLPDLELMF  61

Query  873   DTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSK  1052
             +  D PVI  + +        PP LFRYCGDE + DI+FPDWSFWGW E NIKPW  L  
Sbjct  62    NCGDLPVIPSKDF--RGPNAGPPPLFRYCGDEGSLDIMFPDWSFWGWVETNIKPWRSLLP  119

Query  1053  ELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQG  1232
              +KEGN + KW DR PYAYWKGNP VA TR DLLKCNVS+K DW  R+Y Q+W+QE K+G
Sbjct  120   SIKEGNKRTKWEDRVPYAYWKGNPNVARTRMDLLKCNVSDKNDWNTRLYIQNWVQESKRG  179

Query  1233  YQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWP  1412
             Y+ SNL +QC HRYKIYIEG AWSVSEKYI+ACDS+TL V+  Y+DF+ RG+ P++H+WP
Sbjct  180   YKDSNLENQCKHRYKIYIEGRAWSVSEKYIMACDSMTLYVRSRYHDFFIRGMEPLQHFWP  239

Query  1413  IRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLK  1592
             IRD+ KC S+K AV+WGNNH  +A+ IG A + +IQE+LKM+YVYDYMFH+L+EYAKLLK
Sbjct  240   IRDNSKCTSLKFAVEWGNNHKDKAKAIGEAANNFIQEDLKMDYVYDYMFHVLNEYAKLLK  299

Query  1593  YKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +KPT+PP AVELCSEKM C A G  K+FM+ES+V+ +PS   PCT+PPP+DP  L
Sbjct  300   FKPTIPPNAVELCSEKMACPATGTCKKFMVESMVE-SPSDELPCTLPPPYDPLAL  353



>gb|KCW71638.1| hypothetical protein EUGRSUZ_E00166 [Eucalyptus grandis]
Length=456

 Score =   499 bits (1284),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 239/438 (55%), Positives = 303/438 (69%), Gaps = 45/438 (10%)
 Frame = +3

Query  531   SCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMS  710
             +CP NY P+   T                 +  CP+YFRWI++DL  W+ +GI+RE++ S
Sbjct  4     TCPGNY-PTKHQTEN-------------SYAEACPEYFRWIHEDLRPWKGAGITREILES  49

Query  711   ARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWP  890
             ++  A+FRLVI+NG AY   YR SFQ+RD FT+WGILQLLR YPGKVPDL+LMF+  D+P
Sbjct  50    SKEHAHFRLVILNGKAYVEKYRNSFQTRDVFTIWGILQLLRLYPGKVPDLELMFNCADYP  109

Query  891   VIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGN  1070
             VI K+ Y  +   T PP LF YCG   T DI+FPDWSFWGWPE+NI+PWEG    ++E  
Sbjct  110   VILKRDYEGSKAATVPP-LFHYCGLNTTMDIIFPDWSFWGWPEVNIRPWEGTLGAIEEKA  168

Query  1071  VKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNL  1250
              K +W D+ P+AYWKGNP VA TR DL+KCN + + DW AR+Y QDW Q   +G++ SNL
Sbjct  169   GKTRWKDKVPFAYWKGNPVVAQTRLDLMKCNGTTEIDWKARLYTQDWRQATAEGFKDSNL  228

Query  1251  ADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDK  1430
              DQC HRYKIY+EGSAWSVSEKYILACD++TL++ P YYD +TRG++PM+HYWPIR D K
Sbjct  229   EDQCTHRYKIYVEGSAWSVSEKYILACDAVTLMITPEYYDHFTRGMVPMEHYWPIRPDQK  288

Query  1431  CKSIKHAVDWGNNH-----------------------------HQQAQEIGMAGSKYIQE  1523
             C+ IK AV+WGNNH                             H QAQ IG +GS++I E
Sbjct  289   CRDIKFAVEWGNNHTEEVGLDRISPHPISFDPLSLSSVLQSCKHMQAQRIGESGSRFISE  348

Query  1524  ELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAA  1703
              LKM+YVYD+MFHLL+EYAKLLK+   VPP AVELCSE M C A GL ++FM ES+V+ +
Sbjct  349   SLKMKYVYDFMFHLLNEYAKLLKFDVEVPPGAVELCSELMACPAGGLIRKFMTESVVE-S  407

Query  1704  PSTTAPCTMPPPFDPATL  1757
             PS T PC++PPP++   L
Sbjct  408   PSNTLPCSLPPPYEALEL  425



>gb|KFK40510.1| hypothetical protein AALP_AA2G005200 [Arabis alpina]
Length=577

 Score =   503 bits (1295),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 241/382 (63%), Positives = 303/382 (79%), Gaps = 7/382 (2%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYF+WI++DL  WRE+GI++E V  A+ TA+FRLVIVNG  +  NY+KS QSRD FTL
Sbjct  169   CPDYFKWIHEDLKPWRETGITKETVEKAKTTAHFRLVIVNGKVFIENYKKSIQSRDAFTL  228

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTA--PPALFRYCGDEATWDI  983
             WGILQLLR+YPGK+PD+DLMFD  D PVI+   Y  ++ T    PP LFRYCGD  T DI
Sbjct  229   WGILQLLRKYPGKLPDVDLMFDCDDRPVIRSDGYNQSNHTVGNEPPVLFRYCGDRWTVDI  288

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA-TRKDLLKC  1160
             VFPDWSFWGW EINIKPW  + KE++EG  K K+++RE YAYWKGNP VA+ +R+DLL C
Sbjct  289   VFPDWSFWGWQEINIKPWSKVLKEMEEGKKKKKFMEREAYAYWKGNPFVASPSREDLLTC  348

Query  1161  NVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSL  1340
             NVS + DW AR++ QDW+ E ++G++ SN+A+QC +RYKIYIEG AWSVSEKYILACDS+
Sbjct  349   NVSLQHDWNARIFIQDWMSEGQKGFENSNVANQCTYRYKIYIEGYAWSVSEKYILACDSV  408

Query  1341  TLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQ  1520
              L+V+P+YYDF++R L P++HYWPI+D DKC+SIK AVDW NNH Q+AQEIG   S+++Q
Sbjct  409   ALMVRPYYYDFFSRTLQPLQHYWPIKDKDKCRSIKFAVDWLNNHTQKAQEIGRGASEFMQ  468

Query  1521  EELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGA---NGLEKQFMMESL  1691
              +L ME VYDYMFHLL+EY+KLLKYKP VP  +VE+C+E MVC +   NG  K+F+M SL
Sbjct  469   RDLSMENVYDYMFHLLNEYSKLLKYKPQVPKNSVEICTEAMVCPSGDINGPNKRFLMGSL  528

Query  1692  VKAAPSTTAPCTMPPPFDPATL  1757
             V   P T+APC++PPPFDP  L
Sbjct  529   VN-EPHTSAPCSLPPPFDPNGL  549



>emb|CBI40334.3| unnamed protein product [Vitis vinifera]
Length=819

 Score =   511 bits (1315),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 239/377 (63%), Positives = 294/377 (78%), Gaps = 5/377 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP+YFRWIY+DL  W E+GI+R+MV  A+  A+ R+V+V+G  Y   Y+  FQ+RD FT+
Sbjct  29    CPEYFRWIYEDLKPWTETGITRDMVERAKTPAHIRVVVVDGKVYTEKYKWVFQTRDVFTI  88

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYV-LNDTTTAPPALFRYCGDEATWDIV  986
             WGILQ+LR YPGK+PD DLMF+  D PVIKK  Y  LN   TAPP LF YCGD+ T DIV
Sbjct  89    WGILQVLRMYPGKLPDFDLMFECGDKPVIKKHDYQGLN--ATAPP-LFHYCGDDETLDIV  145

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNV  1166
             FPDWSFWGWPEI IKPW  L K+L+EGN K KWVDREPYAYWKGN ++  TR +L KC+ 
Sbjct  146   FPDWSFWGWPEIRIKPWSTLRKDLREGNNKTKWVDREPYAYWKGNFKMGVTRHELSKCSK  205

Query  1167  SEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTL  1346
             + +QDW AR+Y  DW+QE + G++ ++L+ QC H+YKIY EG+AWSVSEKYILACDS+TL
Sbjct  206   TNEQDWNARIYNMDWLQEMQNGFKSADLSTQCTHKYKIYAEGAAWSVSEKYILACDSVTL  265

Query  1347  LVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEE  1526
             LVKP YYDF+TR L P+ HYWPI+  D CKSIK A +W NNH Q+A EI  AGS ++QEE
Sbjct  266   LVKPQYYDFFTRSLQPLVHYWPIKLKDMCKSIKFATEWCNNHTQKAHEIRNAGSSFVQEE  325

Query  1527  LKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAP  1706
             L+M++VYDYMFHLLS YAKL KYKPTVPP AVE+C E MVC   GL+K++ ++S+VK +P
Sbjct  326   LRMKFVYDYMFHLLSAYAKLFKYKPTVPPGAVEVCPETMVCPVKGLQKKYKIQSMVK-SP  384

Query  1707  STTAPCTMPPPFDPATL  1757
             S T PC MPPP+DPA L
Sbjct  385   SDTGPCVMPPPYDPAEL  401


 Score =   487 bits (1253),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 225/367 (61%), Positives = 276/367 (75%), Gaps = 2/367 (1%)
 Frame = +3

Query  657   DDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRR  836
             +DL  W ++GI+R MV  AR  A+ R+V+V+G  Y   Y++   +RD FT+WGILQLLR 
Sbjct  420   EDLRPWMDTGITRAMVEKARPAASIRIVVVDGKVYMEKYKRVNHNRDEFTIWGILQLLRM  479

Query  837   YPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWP  1016
             YP K+PD DLMF+  D P+IK   Y   D T  PP LF YCGD+ T+DIVFPDWSFWGWP
Sbjct  480   YPEKLPDFDLMFECRDRPMIKTHLYQGPDAT-VPPPLFHYCGDDETYDIVFPDWSFWGWP  538

Query  1017  EINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARV  1196
             E NIKPW G  K+LKEGN + KW+DREPYAYWKGN ++   RK+L KC  +++QDW AR+
Sbjct  539   ETNIKPWNGFKKDLKEGNYRTKWIDREPYAYWKGNVKMGVVRKELFKCRNTDEQDWNARL  598

Query  1197  YAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFY  1376
             Y  DW +E + G++ S+LA QC HRYKIY EG  WSVSEKYILACDS+TLLVKP YY+F+
Sbjct  599   YIMDWGREVQSGFKTSDLASQCTHRYKIYTEGIGWSVSEKYILACDSVTLLVKPQYYEFF  658

Query  1377  TRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYM  1556
             TR L P+ HYWPI+  D CKSIK A DW NNH ++AQ+IG AGS ++QEE+KM++VYDYM
Sbjct  659   TRSLQPLVHYWPIKHKDMCKSIKFATDWCNNHTEKAQKIGKAGSGFVQEEIKMKFVYDYM  718

Query  1557  FHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPP  1736
             FHLLS YAKLLKYKPTVPP AVE C E M C   GLEK + ++S+VK +PS T PC MPP
Sbjct  719   FHLLSMYAKLLKYKPTVPPMAVEFCPEMMACAVEGLEKDYKLQSMVK-SPSDTGPCIMPP  777

Query  1737  PFDPATL  1757
             PF+ A L
Sbjct  778   PFNSAEL  784



>gb|KCW71636.1| hypothetical protein EUGRSUZ_E00163, partial [Eucalyptus grandis]
Length=430

 Score =   497 bits (1279),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 228/419 (54%), Positives = 303/419 (72%), Gaps = 16/419 (4%)
 Frame = +3

Query  501   LNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRE  680
             LNC+  T   +CP +Y    + T    R              +CP+YFRWI++DL AW+ 
Sbjct  13    LNCTNATKPQTCPIDYLTMFQPTDLPAR--------------ECPEYFRWIHEDLRAWKS  58

Query  681   SGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDL  860
             +GI++EMV   R  A++RLVI+ G  Y  ++RK +Q+RD  T+WGI+QLLR YPGK+PDL
Sbjct  59    TGITKEMVERTRDFAHYRLVILKGRVYVEHFRKPYQTRDVGTIWGIVQLLRLYPGKIPDL  118

Query  861   DLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWE  1040
             +LMF   D PVI K  Y      T PP LFR+CG+++ +DI FPDWSFWGW EINI PWE
Sbjct  119   ELMFYCNDQPVIMKNDY-QGPNATLPPPLFRFCGNQSAFDITFPDWSFWGWAEINIGPWE  177

Query  1041  GLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQE  1220
                + +++ + KI+W D+ PYAYWKGN  VAATR+DL+KCN +  QDW   +Y Q+W +E
Sbjct  178   STVRAIRQNSEKIEWNDKVPYAYWKGNTGVAATRRDLMKCNATSGQDWKTHLYHQEWSRE  237

Query  1221  HKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMK  1400
               QG++QS L DQC HRYKIY+EG AWSVSEKYI+AC+S+TL+VKP + DF+TRG++P++
Sbjct  238   VSQGFKQSKLEDQCTHRYKIYVEGEAWSVSEKYIMACNSMTLMVKPEFLDFFTRGMIPLE  297

Query  1401  HYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYA  1580
             HYWPIR D+KC+ IK AV+WGNNH Q+AQ IG +GSK+++E LKM+ VYDYMFHLLS Y 
Sbjct  298   HYWPIRPDNKCRDIKFAVEWGNNHPQEAQVIGESGSKFMEEGLKMKNVYDYMFHLLSGYG  357

Query  1581  KLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             KL+ YKP +PP A+E CSE M C A GL ++ M+ES+VK +PS + PCT+PPP++P   
Sbjct  358   KLITYKPEIPPGAIEYCSETMACPAQGLFRKNMLESMVK-SPSDSPPCTLPPPYEPGEF  415



>ref|XP_010054851.1| PREDICTED: O-glucosyltransferase rumi homolog [Eucalyptus grandis]
Length=397

 Score =   496 bits (1276),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 226/353 (64%), Positives = 282/353 (80%), Gaps = 3/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             MV  ARRTA+FRLV+++G AY   YR + Q+RD FTLWGILQLLRRYPG++PDL+LMFD 
Sbjct  1     MVERARRTAHFRLVVLDGRAYVEKYRSAVQTRDVFTLWGILQLLRRYPGRLPDLELMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
              D P+I+ + Y      + PP LFRYCGD  T DIVFPDWSFWGW E NIKPW  + K++
Sbjct  61    DDRPLIQMKDY--RRPKSGPPPLFRYCGDGKTLDIVFPDWSFWGWVETNIKPWTHVLKDI  118

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
              EGN +IKW DR PYAYWKGNP+VA+TR+DLLKCNV++K DW AR++ QDW ++ K+GY+
Sbjct  119   GEGNKRIKWEDRVPYAYWKGNPDVASTRRDLLKCNVTDKYDWNARLFKQDWGKQSKRGYK  178

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             QSNL DQC HRYKIYI+G AWSVS+KYILACDS+TL V+P YYDF+TRG++P++HYWPIR
Sbjct  179   QSNLEDQCTHRYKIYIDGWAWSVSKKYILACDSMTLFVRPSYYDFFTRGMVPLQHYWPIR  238

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             D+ KC S+K AV+WGNNH  +A+ I   GS +I  ELKMEYVYDYM+H+LSEY +LL YK
Sbjct  239   DNSKCTSLKFAVEWGNNHTNEAKTIANGGSHFIFNELKMEYVYDYMYHVLSEYGRLLTYK  298

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             P +PP+AVE+CSE M C +NG  ++FM ES+V  +P   APCT+PPPFDP +L
Sbjct  299   PRIPPKAVEVCSETMACPSNGTYRRFMEESMV-MSPRGGAPCTLPPPFDPPSL  350



>ref|XP_010512462.1| PREDICTED: O-glucosyltransferase rumi homolog [Camelina sativa]
Length=509

 Score =   500 bits (1287),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 245/465 (53%), Positives = 313/465 (67%), Gaps = 21/465 (5%)
 Frame = +3

Query  387   MVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIP--PLNC-SLRTPMASCPANYY--  551
             + + V  F+S  LLD             + I +   P  P  C +++        +YY  
Sbjct  28    VFIVVSLFISAALLDFLGFHDFNVLAGSKLITKKHQPTFPYQCDAVQNQSHQTQYHYYYQ  87

Query  552   ---PSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRT  722
                  S+L   R++ Q +           CP YFRWI++DL  W+E+GI++ MV  A RT
Sbjct  88    KNNSGSRLNPNRSKQQST-----------CPSYFRWIHEDLRPWKETGITKRMVEEASRT  136

Query  723   ANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKK  902
             A+FRLVI NG AY   YRKS Q+RD FTLWGILQLLRRYPG++PDLDLMFD  D PV++ 
Sbjct  137   AHFRLVIRNGKAYVKRYRKSIQTRDDFTLWGILQLLRRYPGRLPDLDLMFDADDRPVVRS  196

Query  903   QSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIK  1082
               ++       PP +FRYC D+A+ DIVFPDWSFWGW E+N+KPW+   + +KEGN   +
Sbjct  197   DDFI-GQPDKEPPPVFRYCSDDASLDIVFPDWSFWGWAEVNVKPWDESLEAIKEGNNITQ  255

Query  1083  WVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQC  1262
             W DR  YAYW+GNP V  TR DLLKCNVSE ++W  R+Y QDW +E K+GY+ S L +QC
Sbjct  256   WEDRVAYAYWRGNPYVDPTRGDLLKCNVSEHEEWNTRLYIQDWDKETKEGYKNSKLENQC  315

Query  1263  IHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSI  1442
              HRYKIYIEG AWSVSEKYI+ACDS+TL VKP +YDFY RG+MP++HYWPIRDD KC S+
Sbjct  316   THRYKIYIEGWAWSVSEKYIMACDSMTLYVKPRFYDFYIRGMMPLQHYWPIRDDSKCTSL  375

Query  1443  KHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAV  1622
             K AV WGN H  +A+EIG  GS++I+EE+ M+YVYDYMFHLL EYAKLLK+KP +P +A 
Sbjct  376   KFAVHWGNTHVDKAREIGEMGSRFIREEVNMKYVYDYMFHLLKEYAKLLKFKPEIPLDAE  435

Query  1623  ELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             E+  + M C A    + FM ES+V  +PS  +PC M PP+DP  L
Sbjct  436   EITPDSMGCAATERWRDFMAESMV-TSPSEESPCGMLPPYDPLVL  479



>gb|KCW55321.1| hypothetical protein EUGRSUZ_I01244, partial [Eucalyptus grandis]
Length=430

 Score =   496 bits (1276),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 233/420 (55%), Positives = 308/420 (73%), Gaps = 12/420 (3%)
 Frame = +3

Query  498   PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWR  677
             PL C+      +CPANY   +K T  R               ++CP +FRWI++DL  W+
Sbjct  2     PLKCTEWNMTQTCPANY--PTKQTHDR-------HLYHRIPGNECPSFFRWIHEDLRPWK  52

Query  678   ESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPD  857
             E GI+++MV  A++ A+F LVI++G  Y   ++ ++Q+RD FTLWG+LQLLR YPG +PD
Sbjct  53    EIGITKDMVERAQQDAHFHLVILDGKVYLERFKPAYQTRDVFTLWGMLQLLRWYPGDLPD  112

Query  858   LDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPW  1037
             L+LMF+  D P+++ + +           LF YC    T D+VFPDWSFWGW E NIKPW
Sbjct  113   LELMFNCNDRPIVQSKDFPHPKPGPP--PLFGYCRHRRTLDLVFPDWSFWGWVETNIKPW  170

Query  1038  EGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQ  1217
             + + K+++E N +  W DR+PYAYW+GNP VA  RKDLLKCNV+++ DW  RVY QDW +
Sbjct  171   KHVLKDIEESNKRTPWSDRKPYAYWRGNPYVAQARKDLLKCNVTKEHDWNTRVYIQDWGR  230

Query  1218  EHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPM  1397
             E KQGY+ SNLADQC HRYKIYIEG AWSVSEKYILAC+S+TLL+KP Y DF+TRGL+P+
Sbjct  231   ETKQGYKDSNLADQCTHRYKIYIEGQAWSVSEKYILACNSMTLLIKPQYMDFFTRGLVPL  290

Query  1398  KHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEY  1577
             +HYWPIRD+ KC S+K AV+WGNNH ++A+ IG AGS++I E+LKME+VYDYM+HLL+EY
Sbjct  291   QHYWPIRDNKKCTSLKVAVEWGNNHTEKAKAIGEAGSRFIYEDLKMEHVYDYMYHLLNEY  350

Query  1578  AKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             AKL +YKPTVP  AVELCSE M C   G  K+FM++S+VK +P   +PC++PPP+DP +L
Sbjct  351   AKLFRYKPTVPKGAVELCSETMACPTKGTYKKFMLDSMVK-SPRRASPCSLPPPYDPPSL  409



>ref|NP_176531.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE34097.1| uncharacterized protein AT1G63420 [Arabidopsis thaliana]
 gb|AHL38895.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=578

 Score =   501 bits (1290),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 253/443 (57%), Positives = 326/443 (74%), Gaps = 19/443 (4%)
 Frame = +3

Query  453   PTRLSHQKIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKC  632
             P R+S +K  E     ++CS          N   S   +RT   +Q   +   T+S+  C
Sbjct  121   PVRVSEKKSPEETGSSVDCS-------SFLNQNRSGSCSRT---LQSGYNQNQTESNRSC  170

Query  633   PDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLW  812
             PDYF+WI++DL  WRE+GI++EMV   + TA+FRLVI+NG  +  NY+KS Q+RD FTLW
Sbjct  171   PDYFKWIHEDLKPWRETGITKEMVERGKTTAHFRLVILNGKVFVENYKKSIQTRDAFTLW  230

Query  813   GILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSY-VLNDTT-TAPPALFRYCGDEATWDIV  986
             GILQLLR+YPGK+PD+DLMFD  D PVI+   Y +LN T   APP LFRYCGD  T DIV
Sbjct  231   GILQLLRKYPGKLPDVDLMFDCDDRPVIRSDGYNILNRTVENAPPPLFRYCGDRWTVDIV  290

Query  987   FPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA-TRKDLLKCN  1163
             FPDWSFWGW EINI+ W  + KE++EG  K K+++R+ YAYWKGNP VA+ +R+DLL CN
Sbjct  291   FPDWSFWGWQEINIREWSKVLKEMEEGKKKKKFMERDAYAYWKGNPFVASPSREDLLTCN  350

Query  1164  VSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLT  1343
             +S   DW AR++ QDWI E ++G++ SN+A+QC +RYKIYIEG AWSVSEKYILACDS+T
Sbjct  351   LSSLHDWNARIFIQDWISEGQRGFENSNVANQCTYRYKIYIEGYAWSVSEKYILACDSVT  410

Query  1344  LLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQE  1523
             L+VKP+YYDF++R L P++HYWPIRD DKC+SIK AVDW NNH Q+AQEIG   S+++Q 
Sbjct  411   LMVKPYYYDFFSRTLQPLQHYWPIRDKDKCRSIKFAVDWLNNHTQKAQEIGREASEFMQR  470

Query  1524  ELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVC-----GANGLEKQFMMES  1688
             +L ME VYDYMFHLL+EY+KLLKYKP VP  +VELC+E +VC       NG++K+FM+ S
Sbjct  471   DLSMENVYDYMFHLLNEYSKLLKYKPQVPKNSVELCTEALVCPSEGEDVNGVDKKFMIGS  530

Query  1689  LVKAAPSTTAPCTMPPPFDPATL  1757
             LV + P  + PC++PPPFD   L
Sbjct  531   LV-SRPHASGPCSLPPPFDSNGL  552



>ref|XP_002887961.1| hypothetical protein ARALYDRAFT_475010 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64220.1| hypothetical protein ARALYDRAFT_475010 [Arabidopsis lyrata subsp. 
lyrata]
Length=571

 Score =   501 bits (1290),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 241/382 (63%), Positives = 301/382 (79%), Gaps = 7/382 (2%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYF+WI++DL  WRE+GI++EMV   + TA+FRLVIVNG  +  NY+KS Q+RD FTL
Sbjct  166   CPDYFKWIHEDLKPWRETGITKEMVERGKTTAHFRLVIVNGKVFVENYKKSIQTRDAFTL  225

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTT--APPALFRYCGDEATWDI  983
             WGILQLLR+YPGK+PD+DLMFD  D PVI+   Y  ++ T    PP LFRYCGD  T DI
Sbjct  226   WGILQLLRKYPGKLPDVDLMFDCDDRPVIRSDGYNRSNRTAEDVPPPLFRYCGDRWTVDI  285

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA-TRKDLLKC  1160
             VFPDWSFWGW EINIK W  + KE++EG  K K+++RE YAYWKGNP VA+ +R+DLL C
Sbjct  286   VFPDWSFWGWQEINIKEWSKVLKEMEEGKKKKKFMEREAYAYWKGNPFVASPSREDLLTC  345

Query  1161  NVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSL  1340
             N+S   DW AR++ QDWI E ++G++ SN+A+QC +RYKIYIEG AWSVSEKYILACDS+
Sbjct  346   NLSSLHDWNARIFIQDWISEGQRGFENSNVANQCTYRYKIYIEGYAWSVSEKYILACDSV  405

Query  1341  TLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQ  1520
             TL+VKP+YYDF++R L P++HYWPIRD DKC+SIK AVDW NNH Q+AQEIG   S+++Q
Sbjct  406   TLMVKPYYYDFFSRTLQPLQHYWPIRDKDKCRSIKFAVDWLNNHTQKAQEIGREASEFMQ  465

Query  1521  EELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVC---GANGLEKQFMMESL  1691
              +L ME VYDYMFHLL+EY+KLLKYKP VP  +VELC+E MVC     NG+ K+FMM SL
Sbjct  466   RDLSMENVYDYMFHLLNEYSKLLKYKPQVPKNSVELCTEAMVCPSEDVNGVNKRFMMGSL  525

Query  1692  VKAAPSTTAPCTMPPPFDPATL  1757
             V + P  ++PC++PPPFD   L
Sbjct  526   V-SRPHVSSPCSLPPPFDSNGL  546



>gb|KFK37372.1| kdel motif-containing protein 1 [Arabis alpina]
Length=512

 Score =   498 bits (1283),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 224/376 (60%), Positives = 288/376 (77%), Gaps = 2/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP YFRWI++DL  W+E+GI+R M+  ARRTA+FR++I+NG  Y   YRKS Q+RD FTL
Sbjct  108   CPSYFRWIHEDLRPWKETGITRGMLEKARRTAHFRIIILNGKVYVKKYRKSIQTRDDFTL  167

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGI+QLLR YPG++PDL+L+FD  D P ++ + + L     APP LFRYC D+ + DIVF
Sbjct  168   WGIVQLLRWYPGRLPDLELLFDADDRPTVRSKDF-LGQHHPAPPPLFRYCSDDVSLDIVF  226

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGW E+NIKPW      ++EGN    W +R  YAYW+GNP VA TR DLL+CNVS
Sbjct  227   PDWSFWGWAEVNIKPWAKSVVAIEEGNKMTSWKERVAYAYWRGNPFVAPTRGDLLRCNVS  286

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             +++DW  R+Y QDW++E ++G++ SNL +QC HRYKIYIEG AWSVSEKYI+ACDS+TL 
Sbjct  287   DQEDWNTRLYIQDWVRESREGFKNSNLENQCTHRYKIYIEGWAWSVSEKYIMACDSMTLY  346

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             V+P +YDFY RG+MP++HYWPIRD+ KC S+KHAV WGN H  QA++IG  GS++I+EE+
Sbjct  347   VRPKFYDFYIRGMMPLQHYWPIRDNSKCTSLKHAVHWGNTHLDQARKIGEEGSRFIREEV  406

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KMEYVYDYMFHL++EYAKLLK+KP +P  A E+  + M C A G  + FM ES+V  +PS
Sbjct  407   KMEYVYDYMFHLMNEYAKLLKFKPEIPWGATEITPDNMGCPAIGRWRDFMAESMV-MSPS  465

Query  1710  TTAPCTMPPPFDPATL  1757
               APC MP P+DP  L
Sbjct  466   EVAPCEMPSPYDPLAL  481



>ref|XP_010661757.1| PREDICTED: O-glucosyltransferase rumi homolog [Vitis vinifera]
Length=537

 Score =   499 bits (1285),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 244/465 (52%), Positives = 304/465 (65%), Gaps = 26/465 (6%)
 Frame = +3

Query  363   SSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIENEIPPLNCSLRTPMASCPA  542
             S+    FF++L +GAF   R  D ++ +      +       E    NC+      +C  
Sbjct  70    STTVPLFFVLLFIGAFFFIRWFDVSLFSGTSLEKAFSTFQTTE---ENCTKEN--TTCST  124

Query  543   NYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRT  722
               +P S                     + CPDYFRWIY+DL  W E+GI++EM+ +A+  
Sbjct  125   KQHPLS--------------------GNACPDYFRWIYEDLRPWAETGITQEMMEAAKDP  164

Query  723   ANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKK  902
             A FRLVI++G  Y   Y+ +FQ+RD FT+WGILQLL+ YPGKVPDL+LMF+  D P IK 
Sbjct  165   AFFRLVILDGKVYMEKYKGAFQTRDVFTIWGILQLLKLYPGKVPDLELMFECGDRPRIKA  224

Query  903   QSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIK  1082
               Y         P LF YC  + T DIVFPDWSFWGWPEINIKPW  L KEL+EGN + K
Sbjct  225   TDYGGRKGKKKVPPLFHYCASDDTLDIVFPDWSFWGWPEINIKPWNSLRKELEEGNNRTK  284

Query  1083  WVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQC  1262
             W+DREPYAYWKGN   +  R+ L KC  S   DW ARVY  DW +E  +G++ SNLA QC
Sbjct  285   WMDREPYAYWKGNIRTSGNRQALFKCRPSNNHDWNARVYDMDWGRESHEGFKDSNLASQC  344

Query  1263  IHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSI  1442
              H+YKIY+EG AWSVSEKYILACDS++L+ +  YYDF+TR L P  HYWPI+ +D C+S+
Sbjct  345   THKYKIYMEGIAWSVSEKYILACDSMSLVPRSRYYDFFTRSLQPTIHYWPIQQNDICRSV  404

Query  1443  KHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAV  1622
             K+AVDWGN H Q+AQ+IG A S ++ EELKM YVYDYMFHLLSEYAKL KYKPTVPP A+
Sbjct  405   KYAVDWGNKHPQKAQKIGKAASNFVLEELKMNYVYDYMFHLLSEYAKLFKYKPTVPPGAI  464

Query  1623  ELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             E+  E M      LEK +  ES VK  P+TT+PCTMPPP+DP  L
Sbjct  465   EIVPETMANTGGDLEKIYKNESSVK-GPATTSPCTMPPPYDPKAL  508



>ref|XP_010523736.1| PREDICTED: O-glucosyltransferase rumi homolog [Tarenaya hassleriana]
 ref|XP_010523737.1| PREDICTED: O-glucosyltransferase rumi homolog [Tarenaya hassleriana]
Length=513

 Score =   497 bits (1280),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 249/488 (51%), Positives = 325/488 (67%), Gaps = 23/488 (5%)
 Frame = +3

Query  309   HFTDTNWRPLPAIKTLPRSSLA---VFFFMVLCV--GAFVSTRLLDSTVTAQHPTRLSHQ  473
             H T+TN R L    +    S+A   VFF   L V  G F     LD T  A    R + +
Sbjct  15    HHTNTNRRFLGKTTSQRGKSIAKATVFFISSLFVLAGLFDFLGCLDFTTFAGFTRRNTSK  74

Query  474   KIIENEIPPLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWI  653
                     P  C +   +A+   +     K  R+R            +SS+ CP YFRWI
Sbjct  75    TTNTIREFPHKCDV---VANQTRDIPMPEKTNRSR------------RSSATCPSYFRWI  119

Query  654   YDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLR  833
             ++DL  W+E+GI+R+M+  A++TA+ R+VI++G  Y   YRK+ Q+RD FTLWGILQL+R
Sbjct  120   HEDLRPWKETGITRDMIERAKKTAHVRVVILDGKVYVKKYRKAIQTRDVFTLWGILQLIR  179

Query  834   RYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGW  1013
              YPG++PDL+LMFD  D P ++   +        PP LFRYC D+A+ DIVFPDWSFWGW
Sbjct  180   WYPGRLPDLELMFDCNDRPTVRSNDF--KGQPAGPPPLFRYCSDDASLDIVFPDWSFWGW  237

Query  1014  PEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGAR  1193
              E+NIKPW    + LKEGN   +W DR PYAYW+GNP V  TR+DLL+CNVS+++DW  R
Sbjct  238   AEVNIKPWGKSLEALKEGNKMTQWKDRTPYAYWRGNPHVDPTRRDLLRCNVSDREDWNTR  297

Query  1194  VYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDF  1373
             +Y QDW +E K+G++ SNL +QC HRYKIYIEG AWSVSEKYI+ACDS+TL V+P +YDF
Sbjct  298   LYIQDWDKETKEGFKSSNLENQCTHRYKIYIEGWAWSVSEKYIMACDSMTLYVRPRFYDF  357

Query  1374  YTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDY  1553
             Y RG+MP++HYWPIRD+ KC S+K AV WGNNH  +A+ I  AGS++I+E++KME VYDY
Sbjct  358   YIRGMMPLQHYWPIRDNSKCTSLKFAVHWGNNHIDKARGIAEAGSRFIREDVKMELVYDY  417

Query  1554  MFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMP  1733
             MFHLL+EY KLLK++P +P  A E+  E M C A G  K FM ES+V  +PS   PC +P
Sbjct  418   MFHLLNEYGKLLKFRPEIPRGATEITPENMGCPATGRWKDFMAESMV-MSPSERYPCGLP  476

Query  1734  PPFDPATL  1757
             PP+DP  L
Sbjct  477   PPYDPLVL  484



>ref|XP_006576346.1| PREDICTED: O-glucosyltransferase rumi homolog [Glycine max]
Length=475

 Score =   496 bits (1276),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 237/463 (51%), Positives = 317/463 (68%), Gaps = 20/463 (4%)
 Frame = +3

Query  381   FFMVLCVGAFV-STRLLDSTVTAQHPTRLSHQKIIENEIPP---LNCSLRTPMASCPANY  548
             FF V+ + AFV ST  L+  +     T +    I+ N   P   LNC+      +CP+ Y
Sbjct  6     FFSVILLAAFVASTFFLEIDLFRITTTTILKTNIVFNRQQPQFPLNCTNEKLATTCPS-Y  64

Query  549   YPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRTAN  728
             YP      T+ +  D+ S T       CP+YFRWI++DL  W  SGI+R+M+   +  ++
Sbjct  65    YP------TKFQFYDNSSTT------SCPEYFRWIHEDLKPWESSGITRDMIERGKNISH  112

Query  729   FRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQS  908
             FRLVIVNG AY   + KS+Q+RD FT+WGILQLLR YPGKVPDL+LMF   D  V+ K+ 
Sbjct  113   FRLVIVNGKAYIEKFAKSYQTRDVFTIWGILQLLRLYPGKVPDLELMFHCGDKTVVFKKD  172

Query  909   YVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWV  1088
             +       +PP +F YCG+E ++DIVFPDW+FWGW E++I+PWE     ++EGN  +KW 
Sbjct  173   F--QGPQMSPPPVFHYCGEENSYDIVFPDWTFWGWAELSIRPWETTLHNIQEGNKMVKWK  230

Query  1089  DREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIH  1268
             DR PYA+WKGNP+V+  R++L KCNV+EKQDW AR+Y   W+QE    ++ S L +QC  
Sbjct  231   DRIPYAFWKGNPKVSIIRRELGKCNVTEKQDWNARIYDIQWLQERASNFENSKLENQCTF  290

Query  1269  RYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKH  1448
             RYKIY EG+ WSVSEKYI+ACDS+T+ ++P YYDF+TR ++P++HYWPI   + C+ IK+
Sbjct  291   RYKIYAEGATWSVSEKYIIACDSMTMFIEPKYYDFFTRNMLPLRHYWPISTKNMCEEIKY  350

Query  1449  AVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVEL  1628
             AVDWGN H   AQ IG  G+ YI E LKM++VYDYMFHLL+ Y+KLLK+KPT+P  AVE+
Sbjct  351   AVDWGNAHLDHAQAIGDGGTNYILENLKMKFVYDYMFHLLNNYSKLLKFKPTIPIGAVEI  410

Query  1629  CSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             CSE M C  +G  K FM+ES+V  +PS T PC +PPP+ P TL
Sbjct  411   CSESMACSLHGQRKHFMVESMV-ISPSDTPPCILPPPYTPETL  452



>ref|XP_011023362.1| PREDICTED: KDEL motif-containing protein 1-like [Populus euphratica]
Length=476

 Score =   495 bits (1274),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 232/376 (62%), Positives = 286/376 (76%), Gaps = 2/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP+YFRWI++DL  W+ +GISR MV  A+  A+FRLVI+ G  Y   Y+KSF +RD FT+
Sbjct  78    CPEYFRWIHEDLRIWKSTGISRAMVERAKDYAHFRLVILKGKIYVEKYKKSFHTRDEFTI  137

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGILQLLR YPGKVPDL+LMF   D PVI K+ Y   + T++P ++F+YCG E    IVF
Sbjct  138   WGILQLLRLYPGKVPDLELMFWCEDRPVILKKDYRGTNATSSP-SIFQYCGHEDALGIVF  196

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDW+FWGW E N+ PW+ LSK+LKE N + KW DR PYAYW+GNP VAA+R+ L+ CNVS
Sbjct  197   PDWTFWGWAETNVSPWKTLSKDLKEANKRTKWKDRVPYAYWRGNPNVAASRRQLMWCNVS  256

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             +K DW AR+Y QDW  E +QGY+ S L DQC HRYKIYIEG  WSVS+K ILACDS+TL 
Sbjct  257   DKYDWNARLYKQDWRTESEQGYEHSRLEDQCTHRYKIYIEGRGWSVSDKNILACDSMTLF  316

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VKP YYDF+ R ++P++HYWP+   +KC+ IK AV+WGNNH  +AQ IG AGSK+IQE L
Sbjct  317   VKPEYYDFFIRSMVPLQHYWPVSARNKCRDIKFAVEWGNNHTDKAQAIGKAGSKFIQENL  376

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KMEYVYDYMFHLL++YAKLLK+KP +P  AVE+ SE M     GL K+FM E+LV   PS
Sbjct  377   KMEYVYDYMFHLLTKYAKLLKFKPRIPEGAVEVYSETMARPHRGLWKKFMAETLVN-FPS  435

Query  1710  TTAPCTMPPPFDPATL  1757
              T PCTMPPP++P TL
Sbjct  436   DTLPCTMPPPYEPRTL  451



>ref|XP_010028565.1| PREDICTED: protein O-glucosyltransferase 1-like [Eucalyptus grandis]
Length=421

 Score =   492 bits (1267),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 230/409 (56%), Positives = 304/409 (74%), Gaps = 12/409 (3%)
 Frame = +3

Query  531   SCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMS  710
             +CPANY   +K T  R               ++CP +FRWI++DL  W+E GI+++MV  
Sbjct  4     TCPANY--PTKQTHDR-------HLYHRIPGNECPSFFRWIHEDLRPWKEIGITKDMVER  54

Query  711   ARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWP  890
             A++ A+F LVI++G  Y   ++ ++Q+RD FTLWG+LQLLR YPG +PDL+LMF+  D P
Sbjct  55    AQQDAHFHLVILDGKVYLERFKPAYQTRDVFTLWGMLQLLRWYPGDLPDLELMFNCNDRP  114

Query  891   VIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGN  1070
             +++ + +           LF YC    T D+VFPDWSFWGW E NIKPW+ + K+++E N
Sbjct  115   IVQSKDFPHPKPGPP--PLFGYCRHRRTLDLVFPDWSFWGWVETNIKPWKHVLKDIEESN  172

Query  1071  VKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNL  1250
              +  W DR+PYAYW+GNP VA  RKDLLKCNV+++ DW  RVY QDW +E KQGY+ SNL
Sbjct  173   KRTPWSDRKPYAYWRGNPYVAQARKDLLKCNVTKEHDWNTRVYIQDWGRETKQGYKDSNL  232

Query  1251  ADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDK  1430
             ADQC HRYKIYIEG AWSVSEKYILAC+S+TLL+KP Y DF+TRGL+P++HYWPIRD+ K
Sbjct  233   ADQCTHRYKIYIEGQAWSVSEKYILACNSMTLLIKPQYMDFFTRGLVPLQHYWPIRDNKK  292

Query  1431  CKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVP  1610
             C S+K AV+WGNNH ++A+ IG AGS++I E+LKME+VYDYM+HLL+EYAKL +YKPTVP
Sbjct  293   CTSLKVAVEWGNNHTEKAKAIGEAGSRFIYEDLKMEHVYDYMYHLLNEYAKLFRYKPTVP  352

Query  1611  PEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
               AVELCSE M C   G  K+FM++S+VK +P   +PC++PPP+DP +L
Sbjct  353   KGAVELCSETMACPTKGTYKKFMLDSMVK-SPRRASPCSLPPPYDPPSL  400



>gb|EYU32097.1| hypothetical protein MIMGU_mgv1a020993mg [Erythranthe guttata]
Length=439

 Score =   491 bits (1265),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 214/376 (57%), Positives = 297/376 (79%), Gaps = 3/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP+YFRWI++DL AWR++GI++EMV +A+  A+ R++IVNG  Y   Y+  +Q+RD  T+
Sbjct  48    CPEYFRWIHEDLRAWRDTGITKEMVENAKNVAHIRIIIVNGRLYTQKYKDVYQTRDVVTV  107

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WG+LQLLR YPG++PDLDLM +  D PVIKK++YV  D++  P  LF YCGDE+++DIVF
Sbjct  108   WGLLQLLRLYPGRLPDLDLMLECADKPVIKKRNYVGPDSSVPP--LFHYCGDESSYDIVF  165

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGWPE+NIKPWE L +++KEG+ +IKW D+EPYAYWKGN ++ A R++LLKCN+S
Sbjct  166   PDWSFWGWPEVNIKPWEELKEDIKEGSRRIKWKDKEPYAYWKGNAKLGAARRELLKCNIS  225

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             +++D  AR+++ +W +E KQ ++ ++LA QC +RYKIY+EG +WSVS+KYILACDS+ L+
Sbjct  226   DRKDTKARIFSMEWKEEKKQNFRNTDLASQCNYRYKIYVEGVSWSVSQKYILACDSMALV  285

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             +KP YYDF+TR L+P  HYWPI + + CKSI++AV+WGN +  +A+EIG  GS+++QE L
Sbjct  286   IKPRYYDFFTRSLLPSIHYWPIDEKNMCKSIEYAVEWGNKYADKAEEIGKDGSEFVQENL  345

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
              MEY+YDY FHLL+EYAKLLKYKP VP  A+E CSE ++C   G +++F   S+VK  PS
Sbjct  346   AMEYIYDYTFHLLNEYAKLLKYKPRVPQGAIETCSENLICSVKGQKRRFRKHSMVK-NPS  404

Query  1710  TTAPCTMPPPFDPATL  1757
              + PC +PP +D A L
Sbjct  405   DSLPCDLPPAYDIAAL  420



>ref|XP_008232795.1| PREDICTED: O-glucosyltransferase rumi homolog [Prunus mume]
Length=379

 Score =   489 bits (1259),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 227/353 (64%), Positives = 273/353 (77%), Gaps = 3/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             M+  A  TANF+L IV+G AY   YR+S QSRD FTLWGILQLLR YPG++PDL+L+F  
Sbjct  1     MIERAHMTANFKLFIVDGKAYIEKYRQSVQSRDMFTLWGILQLLRVYPGRLPDLELIFSC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
              D PVI  + +        PP  F YCGDE + DIVFPDWSFWGWPE NIKPW  L + +
Sbjct  61    GDLPVIPSKKF--RGPNANPPPSFHYCGDEGSLDIVFPDWSFWGWPETNIKPWGSLLQII  118

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             KEGN + KW DR PYAYWKGNP VA TR DLLKCNVS+K DW   +Y Q+W QE K G++
Sbjct  119   KEGNKRTKWEDRVPYAYWKGNPTVARTRMDLLKCNVSDKNDWNTHLYIQNWKQESKHGFK  178

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
              SNL +QC HRYKIYIEG+AWSVSEKYILACDS+TL V+P YYDF+TRG+ P++H+WPIR
Sbjct  179   DSNLENQCKHRYKIYIEGNAWSVSEKYILACDSMTLYVRPRYYDFFTRGMEPLQHFWPIR  238

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             D+ KC S+K AV+WGNNH  + + IG A S +IQE+LKM+YVYDYMFH+L+EYAKLLK+K
Sbjct  239   DNSKCTSLKFAVEWGNNHKDKVKAIGEAASNFIQEDLKMDYVYDYMFHVLNEYAKLLKFK  298

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             PT+PP AVELCSEKM C A G  K+FM+ES+VK +PS   PCT+PPP+DP  L
Sbjct  299   PTIPPNAVELCSEKMACPATGTWKKFMVESMVK-SPSDELPCTLPPPYDPLAL  350



>ref|XP_009112948.1| PREDICTED: O-glucosyltransferase rumi homolog [Brassica rapa]
Length=578

 Score =   496 bits (1278),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 238/382 (62%), Positives = 298/382 (78%), Gaps = 7/382 (2%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYF+WI+ DL  WRE+GI+REMV   + TA+FRL+IVNG  +  NY+KS Q+RD FTL
Sbjct  172   CPDYFKWIHVDLKPWRETGITREMVERGQTTAHFRLLIVNGKVFVENYKKSIQTRDVFTL  231

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTT--TAPPALFRYCGDEATWDI  983
             WGILQLLR+YPGK+PD+DLMFD  D PVI+   Y  ++ T   APP LFRY GD  T DI
Sbjct  232   WGILQLLRKYPGKLPDVDLMFDCDDRPVIRSDGYDKSNLTAENAPPVLFRYGGDRWTADI  291

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA-TRKDLLKC  1160
             VFPDWSFWGW EINIKPW  + KE++EG  K K+++RE YAYWKGNP VA+ +R+DLL C
Sbjct  292   VFPDWSFWGWQEINIKPWSKVLKEMEEGKKKKKFMERESYAYWKGNPFVASPSREDLLTC  351

Query  1161  NVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSL  1340
             N+S + DW AR++ QDWI E ++G++ SN+ADQC +RYKIYIEG  WSVSEKYILACDS+
Sbjct  352   NLSSQHDWNARIFIQDWISEGQKGFENSNVADQCTYRYKIYIEGYGWSVSEKYILACDSV  411

Query  1341  TLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQ  1520
             TL+VKP+YYDF++R L P++HYWPI D +KC+SIK AVDW NNH Q+AQEIG   S+++Q
Sbjct  412   TLMVKPYYYDFFSRTLQPLQHYWPINDKNKCRSIKFAVDWLNNHTQKAQEIGRGASEFMQ  471

Query  1521  EELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVC---GANGLEKQFMMESL  1691
              +L ME VYDYMFHLL+EY+KLLK+KP V   +VE+C+E MVC    ANG  K+F+M SL
Sbjct  472   RDLSMENVYDYMFHLLNEYSKLLKFKPQVSQNSVEICTEAMVCPSGNANGTNKKFLMGSL  531

Query  1692  VKAAPSTTAPCTMPPPFDPATL  1757
             V   P  + PC++PPPFDP  L
Sbjct  532   VD-EPHISGPCSLPPPFDPNGL  552



>emb|CDY25494.1| BnaC09g11190D [Brassica napus]
Length=579

 Score =   496 bits (1278),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 237/382 (62%), Positives = 299/382 (78%), Gaps = 7/382 (2%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYF+WI++DL  WRE+GI+REMV   + TA+FRL+IVNG  +  NY+KS Q+RD FTL
Sbjct  173   CPDYFKWIHEDLKPWRETGITREMVERGQTTAHFRLLIVNGKVFVENYKKSIQTRDAFTL  232

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTT--TAPPALFRYCGDEATWDI  983
             WGILQLLR+YPGK+PD+DLMFD  D PVI+   Y  ++ T   APP LFRY GD  T DI
Sbjct  233   WGILQLLRKYPGKLPDVDLMFDCDDRPVIRSDGYDKSNLTAENAPPVLFRYGGDRWTADI  292

Query  984   VFPDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAA-TRKDLLKC  1160
             VFPDWSFWGW EINIKPW  + KE++EG  K K+++RE YAYWKGNP VA+ +R+DLL C
Sbjct  293   VFPDWSFWGWQEINIKPWSKVLKEMEEGKKKKKFMERESYAYWKGNPFVASPSREDLLTC  352

Query  1161  NVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSL  1340
             N+S + DW AR++ QDWI E ++G++ SN+ADQC +RYKIYIEG  WSVSEKYILACDS+
Sbjct  353   NLSSQHDWNARIFIQDWISEGQKGFENSNVADQCTYRYKIYIEGYGWSVSEKYILACDSV  412

Query  1341  TLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQ  1520
             TL+VKP+YYDF++R L P++HYWPI D +KC+SIK AV+W NNH Q+AQEIG   S+++Q
Sbjct  413   TLMVKPYYYDFFSRTLQPLQHYWPINDKNKCRSIKFAVEWLNNHTQKAQEIGRGASEFMQ  472

Query  1521  EELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVC---GANGLEKQFMMESL  1691
              +L ME VYDYMFHLL+EY+KLLK+KP V   +VE+C+E MVC    ANG  K+F+M SL
Sbjct  473   RDLSMENVYDYMFHLLNEYSKLLKFKPQVSQNSVEICTEAMVCPSGNANGTNKRFLMGSL  532

Query  1692  VKAAPSTTAPCTMPPPFDPATL  1757
             V   P  + PC++PPPFDP  L
Sbjct  533   VD-EPHISGPCSLPPPFDPNGL  553



>emb|CAN65870.1| hypothetical protein VITISV_012498 [Vitis vinifera]
Length=504

 Score =   493 bits (1270),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 229/376 (61%), Positives = 277/376 (74%), Gaps = 1/376 (0%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYFRWIY+DL  W E+GI++EM+ +A+  A FRLVI++G  Y   Y+ +FQ+RD FT+
Sbjct  101   CPDYFRWIYEDLRPWAETGITQEMMEAAKDPAFFRLVILDGKVYMEKYKGAFQTRDVFTI  160

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGILQLL+ YPGKVPDL+LMF+  D P IK   Y         P LF YC  + T DIVF
Sbjct  161   WGILQLLKLYPGKVPDLELMFECGDRPRIKASDYGGRKGKKKVPPLFHYCASDDTLDIVF  220

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGWPEINIKPW  L KEL+EGN + KW+DREPYAYWKGN   +  R+ L KC  S
Sbjct  221   PDWSFWGWPEINIKPWNSLRKELEEGNNRTKWMDREPYAYWKGNIRTSGNRQALFKCRPS  280

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
                DW ARVY  DW +E  +G++ SNLA QC H+YKIY+EG AWSVSEKYILACDS++L+
Sbjct  281   NNHDWNARVYDMDWGRESHEGFKDSNLASQCTHKYKIYMEGIAWSVSEKYILACDSMSLV  340

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
              +  YYDF+TR L P  HYWPI+ +D C+S+K+AVDWGN H Q+AQ+IG A S ++ EEL
Sbjct  341   PRSRYYDFFTRSLQPTIHYWPIQQNDICRSVKYAVDWGNKHPQKAQKIGKAASNFVLEEL  400

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KM YVYDYMFHLLSEYAKL KYKPTVPP A+E+  E M      LEK +  ES VK  P+
Sbjct  401   KMNYVYDYMFHLLSEYAKLFKYKPTVPPGAIEIVPETMANTGGDLEKIYKNESSVK-GPA  459

Query  1710  TTAPCTMPPPFDPATL  1757
             TT+PCTMPPP+DP  L
Sbjct  460   TTSPCTMPPPYDPKAL  475



>ref|XP_009630106.1| PREDICTED: O-glucosyltransferase rumi-like [Nicotiana tomentosiformis]
Length=517

 Score =   493 bits (1270),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 229/422 (54%), Positives = 306/422 (73%), Gaps = 19/422 (5%)
 Frame = +3

Query  498   PLNCSLRTPMASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWR  677
             PL+C       +CP NY  S K                      CP+YFRWIY+DL  W+
Sbjct  87    PLDCGAWNQSNTCPRNYLKSYKPLNPNNST--------------CPEYFRWIYEDLKPWK  132

Query  678   ESGISREMVMSARRTANFRLVIVNGIAYYHNY--RKSFQSRDTFTLWGILQLLRRYPGKV  851
             E+GI+REMV  A+R A+FRL+I++G  Y   Y  ++  Q+R  +T++GI+QLLR YPGK+
Sbjct  133   ETGITREMVEKAKRHAHFRLIILDGKIYVEKYNTKRFIQTRHLYTMYGIIQLLRWYPGKL  192

Query  852   PDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIK  1031
             P+L++MFDT D PVI+ Q Y      + PP LFRYC D  + DIVFPDWSFWGW E NIK
Sbjct  193   PNLEIMFDTDDRPVIRSQDY--RQPNSGPPPLFRYCSDWHSLDIVFPDWSFWGWAETNIK  250

Query  1032  PWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDW  1211
             PW  ++K++K+GN   KW DR P+AYWKGNP V+  RKDL+KCN+++KQ++   +Y QDW
Sbjct  251   PWRSVTKDIKQGNEITKWKDRLPFAYWKGNPHVSPIRKDLMKCNITDKQNFDTLLYVQDW  310

Query  1212  IQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLM  1391
               + K+G+++SNL +QC HRYKIY+EG AWSVSEKYILACDS TL +KP Y+DF+TRG++
Sbjct  311   NDQSKKGFKESNLGNQCTHRYKIYVEGWAWSVSEKYILACDSPTLYIKPRYHDFFTRGMI  370

Query  1392  PMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLS  1571
             P +HYWPIRD+DKC+S+K AV WGNN+  +A+ IG +GS +IQE++KMEYV+DYMFHLL+
Sbjct  371   PQQHYWPIRDNDKCRSLKFAVQWGNNNTDKAEAIGKSGSNFIQEDMKMEYVFDYMFHLLN  430

Query  1572  EYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPA  1751
             EYAKLLK++P V  +AVE+CSE + C + G+ K+FM E L K  PS T PCT+PPP++P 
Sbjct  431   EYAKLLKFEPKVTADAVEICSESLACTSEGIWKKFMEEGLEK-TPSYTNPCTLPPPYEPQ  489

Query  1752  TL  1757
              +
Sbjct  490   EI  491



>ref|XP_009396165.1| PREDICTED: protein O-glucosyltransferase 1 [Musa acuminata subsp. 
malaccensis]
Length=527

 Score =   494 bits (1271),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 238/471 (51%), Positives = 318/471 (68%), Gaps = 12/471 (3%)
 Frame = +3

Query  366   SLAVFFFMVLCVGAFVSTRLLDSTVT------AQHPTRLSHQKIIENEIP-PLNCSLRTP  524
             +L VFF ++L + AF+S+R  D T         Q P+R   +    +     L C  +T 
Sbjct  39    ALVVFFLVLLALVAFISSRWFDGTTFTMVTSWGQQPSRSHRRHHRSHSRRVTLTCPNQTT  98

Query  525   MASCPANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMV  704
               +     +     + + +          ++    CPDYFRWI++DL  WR +GI+REMV
Sbjct  99    AQTQYCRRFTYPSPSVSPSPSPSPLPIASSEPPPSCPDYFRWIHEDLRPWRSTGITREMV  158

Query  705   MSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVD  884
              SA++ A FRL++++G  Y   Y + FQ+RD FTLWG +QL  RYPG +PDLDLMF+  D
Sbjct  159   ESAQKLAAFRLLVIDGRVYVEQYHRVFQTRDLFTLWGFVQLANRYPGYLPDLDLMFNCED  218

Query  885   WPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKE  1064
              P +K   Y     T+ PP LFRYC D+ T DIVFPDWSFWGWPEINIKPWE LS+E+KE
Sbjct  219   VPTVKAADY----KTSPPPPLFRYCKDDTTVDIVFPDWSFWGWPEINIKPWEPLSEEMKE  274

Query  1065  GNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQS  1244
              N ++KW  R+PYAYWKGNP V+  R+DLLKCN+S   DW ARV+AQ+W +E + G+++S
Sbjct  275   ANERVKWEKRKPYAYWKGNPGVSRQRQDLLKCNLSTGHDWNARVFAQNWEKETQNGFKES  334

Query  1245  NLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDD  1424
             NLA+QC++RYKI++EG AWSVSEKY LACDS  L V  H+YDF TRGL+P +HYWPIR+ 
Sbjct  335   NLAEQCMYRYKIFVEGRAWSVSEKYTLACDSPALFVTTHFYDFMTRGLIPGRHYWPIRET  394

Query  1425  DKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPT  1604
              KC+SIK AVDWGN H ++AQ +G  GS++I EE+KM+YVY YM HLL+EYA LL+YKPT
Sbjct  395   AKCRSIKFAVDWGNKHQKKAQAMGKEGSRFILEEVKMDYVYQYMLHLLTEYANLLRYKPT  454

Query  1605  VPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             +P +A +LC E + C   G  K+F+M+S+VK   S + PC +PP +    L
Sbjct  455   LPEKATDLCLESVACREQGRVKEFLMQSMVKRT-SDSEPCDLPPAYTSREL  504



>ref|NP_182107.3| downstream target of AGL15 2 [Arabidopsis thaliana]
 gb|AEC10607.1| downstream target of AGL15 2 [Arabidopsis thaliana]
 gb|AHL38793.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=523

 Score =   493 bits (1270),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 243/466 (52%), Positives = 316/466 (68%), Gaps = 31/466 (7%)
 Frame = +3

Query  369   LAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQ-KIIENE--IPPLNCSLRTPMASCP  539
             L  F F        V+T +  S +T+Q   R  +Q  +++N+  + P N S R       
Sbjct  55    LGCFDFTTFTGLKQVTTSIRKSPITSQ---RFPNQCGVVQNQTQLFPQNGSSRN------  105

Query  540   ANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARR  719
              N  P S  +R  T                CP YFRWI++DL  W+E+G++R M+  ARR
Sbjct  106   -NDKPRSSHSRIST----------------CPSYFRWIHEDLRPWKETGVTRGMLEKARR  148

Query  720   TANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIK  899
             TA+FR+VI++G  Y   YRKS Q+RD FTLWGI+QLLR YPG++PDL+LMFD  D P ++
Sbjct  149   TAHFRVVILDGRVYVKKYRKSIQTRDVFTLWGIVQLLRWYPGRLPDLELMFDPDDRPTVR  208

Query  900   KQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKI  1079
              + +       APP LFRYC D+A+ DIVFPDWSFWGW E+NIKPW+     ++EGN   
Sbjct  209   SKDFQ-GQQHPAPPPLFRYCSDDASLDIVFPDWSFWGWAEVNIKPWDKSLVAIEEGNKMT  267

Query  1080  KWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQ  1259
             +W DR  YAYW+GNP VA TR+DLL+CNVS ++DW  R+Y QDW +E ++G++ SNL +Q
Sbjct  268   QWKDRVAYAYWRGNPNVAPTRRDLLRCNVSAQEDWNTRLYIQDWDRESREGFKNSNLENQ  327

Query  1260  CIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKS  1439
             C HRYKIYIEG AWSVSEKYI+ACDS+TL V+P +YDFY RG+MP++HYWPIRD  KC S
Sbjct  328   CTHRYKIYIEGWAWSVSEKYIMACDSMTLYVRPMFYDFYVRGMMPLQHYWPIRDTSKCTS  387

Query  1440  IKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEA  1619
             +K AV WGN H  QA +IG  GS++I+EE+KMEYVYDYMFHL++EYAKLLK+KP +P  A
Sbjct  388   LKFAVHWGNTHLDQASKIGEEGSRFIREEVKMEYVYDYMFHLMNEYAKLLKFKPEIPWGA  447

Query  1620  VELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              E+  + M C A G  + FM ES+V   PS  +PC MP PF+P  L
Sbjct  448   TEITPDIMGCSATGRWRDFMEESMV-MFPSEESPCEMPSPFNPHDL  492



>gb|AAC28541.1| unknown protein [Arabidopsis thaliana]
Length=517

 Score =   493 bits (1269),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 243/466 (52%), Positives = 316/466 (68%), Gaps = 31/466 (7%)
 Frame = +3

Query  369   LAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQ-KIIENE--IPPLNCSLRTPMASCP  539
             L  F F        V+T +  S +T+Q   R  +Q  +++N+  + P N S R       
Sbjct  49    LGCFDFTTFTGLKQVTTSIRKSPITSQ---RFPNQCGVVQNQTQLFPQNGSSRN------  99

Query  540   ANYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARR  719
              N  P S  +R  T                CP YFRWI++DL  W+E+G++R M+  ARR
Sbjct  100   -NDKPRSSHSRIST----------------CPSYFRWIHEDLRPWKETGVTRGMLEKARR  142

Query  720   TANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIK  899
             TA+FR+VI++G  Y   YRKS Q+RD FTLWGI+QLLR YPG++PDL+LMFD  D P ++
Sbjct  143   TAHFRVVILDGRVYVKKYRKSIQTRDVFTLWGIVQLLRWYPGRLPDLELMFDPDDRPTVR  202

Query  900   KQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKI  1079
              + +       APP LFRYC D+A+ DIVFPDWSFWGW E+NIKPW+     ++EGN   
Sbjct  203   SKDF-QGQQHPAPPPLFRYCSDDASLDIVFPDWSFWGWAEVNIKPWDKSLVAIEEGNKMT  261

Query  1080  KWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQ  1259
             +W DR  YAYW+GNP VA TR+DLL+CNVS ++DW  R+Y QDW +E ++G++ SNL +Q
Sbjct  262   QWKDRVAYAYWRGNPNVAPTRRDLLRCNVSAQEDWNTRLYIQDWDRESREGFKNSNLENQ  321

Query  1260  CIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKS  1439
             C HRYKIYIEG AWSVSEKYI+ACDS+TL V+P +YDFY RG+MP++HYWPIRD  KC S
Sbjct  322   CTHRYKIYIEGWAWSVSEKYIMACDSMTLYVRPMFYDFYVRGMMPLQHYWPIRDTSKCTS  381

Query  1440  IKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEA  1619
             +K AV WGN H  QA +IG  GS++I+EE+KMEYVYDYMFHL++EYAKLLK+KP +P  A
Sbjct  382   LKFAVHWGNTHLDQASKIGEEGSRFIREEVKMEYVYDYMFHLMNEYAKLLKFKPEIPWGA  441

Query  1620  VELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
              E+  + M C A G  + FM ES+V   PS  +PC MP PF+P  L
Sbjct  442   TEITPDIMGCSATGRWRDFMEESMV-MFPSEESPCEMPSPFNPHDL  486



>ref|XP_006583309.1| PREDICTED: O-glucosyltransferase rumi homolog isoform X2 [Glycine 
max]
Length=475

 Score =   491 bits (1264),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 235/465 (51%), Positives = 313/465 (67%), Gaps = 24/465 (5%)
 Frame = +3

Query  381   FFMVLCVGAFVSTRLLD----STVTAQHPTRLSHQKIIENEIP--PLNCSLRTPMASCPA  542
              F V  + AFV++        S +T+   T L    +  N+ P  PLNC+     ++CP+
Sbjct  6     LFSVTVLAAFVASSFFLEIDLSRITST--TILKTIIVFNNQQPQFPLNCTNGKSASTCPS  63

Query  543   NYYPSSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESGISREMVMSARRT  722
              YYP      T+    D  S T       CP+YFRWI++DL  W  +GI+R+MV   +  
Sbjct  64    -YYP------TKLEFDDDSSNT------SCPEYFRWIHEDLKPWESTGITRDMVERGKHI  110

Query  723   ANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDTVDWPVIKK  902
             ++FRLVIVNG AY   + KS+Q+RD FT+WGILQLLR YPGK+PDL+LMF   D  V+ K
Sbjct  111   SHFRLVIVNGKAYIEKFAKSYQTRDVFTIWGILQLLRLYPGKIPDLELMFQCGDRTVVFK  170

Query  903   QSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKELKEGNVKIK  1082
             + + +     +PP +F YCG+E ++DIVFPDW+FWGW E++I+PWE     + EGN  +K
Sbjct  171   KDFQV--PKMSPPPVFHYCGEENSYDIVFPDWTFWGWAELSIRPWETTLHNILEGNKLVK  228

Query  1083  WVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQQSNLADQC  1262
             W DR PYA+WKGNP V+  R++L KCN +EK DW AR+Y   W++E    ++ S L +QC
Sbjct  229   WKDRIPYAFWKGNPTVSIIRRELGKCNTTEKHDWNARIYDIQWLRERASNFENSKLENQC  288

Query  1263  IHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIRDDDKCKSI  1442
               RYKIY EG  WSVSEKYI+ACDS+T+ ++P YYDF+TR ++P++HYWPI   + C+ I
Sbjct  289   TFRYKIYAEGITWSVSEKYIIACDSMTMFIEPRYYDFFTRSMLPLQHYWPINTKNMCEEI  348

Query  1443  KHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYKPTVPPEAV  1622
             K+AVDWGN H   AQ IG  G+ YI E LKM++VYDYMFHLL+ Y+KLLK+KPT+P  AV
Sbjct  349   KYAVDWGNAHLDNAQAIGNGGTNYIVENLKMKFVYDYMFHLLNRYSKLLKFKPTIPIGAV  408

Query  1623  ELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             E+CSE M C   GL K FM+ES+V  +PS T PCTMPPP+ P TL
Sbjct  409   EICSESMACSLRGLRKSFMVESMV-TSPSDTPPCTMPPPYTPETL  452



>ref|XP_006292623.1| hypothetical protein CARUB_v10018865mg [Capsella rubella]
 gb|EOA25521.1| hypothetical protein CARUB_v10018865mg [Capsella rubella]
Length=500

 Score =   492 bits (1266),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 228/376 (61%), Positives = 284/376 (76%), Gaps = 2/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP YFRWI++DL  W+E+GI+R MV  A RTA+FRLVI NG AY   Y+KS Q+R  FTL
Sbjct  98    CPSYFRWIHEDLRPWKETGITRRMVEEASRTAHFRLVIRNGKAYVKRYKKSIQTRADFTL  157

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGI+QLLR YPGK+PDL+LMFD  D PV++   ++      APP +FRYC D+A+ DIVF
Sbjct  158   WGIVQLLRWYPGKLPDLELMFDADDRPVVRSVDFIGQRDKEAPP-VFRYCSDDASLDIVF  216

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGW E+N+KPWE   + +KEGN   +W DR  YAYW+GNP V  TR DLLKCNVS
Sbjct  217   PDWSFWGWAEVNVKPWEKSLEAIKEGNNMTQWEDRVAYAYWRGNPYVDPTRGDLLKCNVS  276

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             E +DW  R+Y QDW +E K+G++ SNL +QC HRYKIYIEG AWSVSEKYI+ACDS+TL 
Sbjct  277   EHEDWNTRLYVQDWDKESKEGFKNSNLENQCTHRYKIYIEGWAWSVSEKYIMACDSMTLY  336

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VKP +YDFY RG+ P++HYWPIRDD KC S+K AV WGN +  +A+EIG  GS++I+EE+
Sbjct  337   VKPRFYDFYIRGMTPLQHYWPIRDDSKCTSLKFAVHWGNTNVHKAREIGEMGSRFIREEV  396

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
              M+YVYDYMFHLL+EYAKLLK+KP VP +A E+  + M C A    + FM ES+V  +PS
Sbjct  397   NMKYVYDYMFHLLTEYAKLLKFKPEVPFDAEEITPDSMGCPATERWRDFMAESMV-MSPS  455

Query  1710  TTAPCTMPPPFDPATL  1757
               +PC M PP+DP  L
Sbjct  456   EESPCEMLPPYDPLEL  471



>ref|XP_006402499.1| hypothetical protein EUTSA_v10006441mg, partial [Eutrema salsugineum]
 gb|ESQ43952.1| hypothetical protein EUTSA_v10006441mg, partial [Eutrema salsugineum]
Length=449

 Score =   490 bits (1261),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 229/376 (61%), Positives = 281/376 (75%), Gaps = 2/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP YFRWI++DL  W+E+GI+R+M+  A RTA+FRLVI NG AY   YRKS Q+RD FTL
Sbjct  47    CPSYFRWIHEDLRPWKETGITRDMIEKASRTAHFRLVIHNGKAYVKRYRKSIQTRDDFTL  106

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGI+QLLR YPG++PDL+LMFD  D PV++   +   +   APP LFRYC D+A+ DIVF
Sbjct  107   WGIVQLLRWYPGRLPDLELMFDADDRPVVRSDDFRGQNKKVAPP-LFRYCSDDASLDIVF  165

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGW E+NIKPW    + +K+GN   +W DR  YAYW+GNP V   R DLLKCNVS
Sbjct  166   PDWSFWGWAEVNIKPWGKSLEAIKQGNNMTQWKDRVAYAYWRGNPYVDPARGDLLKCNVS  225

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
             E Q W  R+Y QDW  E K+G++ SNL +QC HRYKIYIEG AWSVSEKYI+ACDS+TL 
Sbjct  226   EHQGWNTRLYIQDWDNETKEGFKNSNLENQCTHRYKIYIEGWAWSVSEKYIMACDSMTLY  285

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             VKP +YDFY RG+MP++HYWPIRDD KC S+K AV WGN H  +A+EIG  GS++I+EE+
Sbjct  286   VKPRFYDFYIRGMMPLQHYWPIRDDSKCTSLKFAVHWGNTHVDKAREIGEVGSRFIREEV  345

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
              M+YVYDYMFHLLSEYAKLLK+KP +P  A E+  + M C A G  + FM ES+V  +PS
Sbjct  346   NMKYVYDYMFHLLSEYAKLLKFKPEIPLNAEEITPDSMGCPATGRWRDFMAESMV-MSPS  404

Query  1710  TTAPCTMPPPFDPATL  1757
                PC M PP+D   L
Sbjct  405   EEFPCEMLPPYDLLAL  420



>ref|XP_010672143.1| PREDICTED: O-glucosyltransferase rumi homolog [Beta vulgaris 
subsp. vulgaris]
Length=515

 Score =   492 bits (1266),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 249/477 (52%), Positives = 316/477 (66%), Gaps = 24/477 (5%)
 Frame = +3

Query  354   LPRSSLAVFFFMVLCVGAFVSTRLLDSTVTAQHPTRLSHQKIIEN---EIPP-----LNC  509
             L R S  +  F +  +   + TR  D T      +R +     +N   + P      LNC
Sbjct  32    LYRFSAYLLLFFIF-IYMLLLTRWSDITSLVTSSSRFNFSMFYKNNNHDYPKRDEYLLNC  90

Query  510   SLRTPMASCPANYYP-SSKLTRTRTRIQDspsptptqsssKCPDYFRWIYDDLWAWRESG  686
             +      +CPANY+P  S LT T +    + +         CP+YFRWI++DL  W++ G
Sbjct  91    TSSNMTLTCPANYFPPKSNLTFTSSSSSSNET---------CPEYFRWIHEDLKTWKKKG  141

Query  687   ISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDL  866
             I+REMV S +  A+FRLVIVNG AY   Y K+FQ+RD +TLWGILQLL+ YPGK+PDLD 
Sbjct  142   ITREMVESLKDVAHFRLVIVNGTAYVKQYSKAFQTRDVYTLWGILQLLKLYPGKLPDLDF  201

Query  867   MFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGL  1046
             +F   D   IKK +Y       APP  F YCGD++T+DIVFPDWSFWGWPEINIKPW  L
Sbjct  202   VFQCHDQASIKKANYKGKKAAFAPPQ-FHYCGDDSTFDIVFPDWSFWGWPEINIKPWVPL  260

Query  1047  SKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHK  1226
              K+ K+GN    W  R+PYA+WKGN    A R  L KCN     DW A++  QDW +E  
Sbjct  261   EKDFKDGNTMKNWTSRKPYAFWKGNLHTGA-RLKLEKCN--SVNDWNAQIVNQDWNKEVA  317

Query  1227  QGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHY  1406
             +G++ S+L+ QC+HRYKIY+EG+AWSVSEKYILACDS+TLL+ P YY+F+TR L+PMKHY
Sbjct  318   EGFRNSDLSKQCVHRYKIYMEGNAWSVSEKYILACDSMTLLINPIYYEFFTRSLVPMKHY  377

Query  1407  WPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKL  1586
             WPI   + CKSIK AVDWGN++  +AQ+IG  GSK+I E++KMEYVYDYMFH+L EYAKL
Sbjct  378   WPINPQNLCKSIKFAVDWGNHNTDKAQKIGKEGSKFIFEQIKMEYVYDYMFHVLYEYAKL  437

Query  1587  LKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             L Y+PTVP  AVELCSEK  C   GLE  +  E++V   PS   PC +PPP+D  TL
Sbjct  438   LNYRPTVPEGAVELCSEKFACSPPGLETTYKKETMVH-GPSERGPCKLPPPYDSRTL  493



>dbj|BAF00020.1| hypothetical protein [Arabidopsis thaliana]
Length=418

 Score =   488 bits (1256),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 223/376 (59%), Positives = 285/376 (76%), Gaps = 2/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CP YFRWI++DL  W+E+G++R M+  ARRTA+FR+VI++G  Y   YRKS Q+RD FTL
Sbjct  14    CPSYFRWIHEDLRPWKETGVTRGMLEKARRTAHFRVVILDGRVYVKKYRKSIQTRDVFTL  73

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WGI+QLLR YPG++PDL+LMFD  D P ++ + +       APP LFRYC D+A+ DIVF
Sbjct  74    WGIVQLLRWYPGRLPDLELMFDPDDRPTVRSKDF-QGQQHPAPPPLFRYCSDDASLDIVF  132

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGW E+NIKPW+     ++EGN   +W DR  YAYW+GNP VA TR+DLL+CNVS
Sbjct  133   PDWSFWGWAEVNIKPWDKSLVAIEEGNKMTQWKDRVAYAYWRGNPNVAPTRRDLLRCNVS  192

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
              ++DW  R+Y QDW +E ++G++ SNL +QC HRYKIYIEG AWSVSEKYI+ACDS+TL 
Sbjct  193   AQEDWNTRLYIQDWDRESREGFKNSNLENQCTHRYKIYIEGWAWSVSEKYIMACDSMTLY  252

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             V+P +YDFY RG+MP++HYWPIRD  KC S+K AV WGN H  QA +IG  GS++I+EE+
Sbjct  253   VRPMFYDFYVRGMMPLQHYWPIRDTSKCTSLKFAVHWGNTHLDQASKIGEEGSRFIREEV  312

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KMEYVYDYMFHL++EYAKLLK+KP +P  A E+  + M C A G  + FM ES+V   PS
Sbjct  313   KMEYVYDYMFHLMNEYAKLLKFKPEIPWGATEITPDIMGCSATGRWRDFMEESMV-MFPS  371

Query  1710  TTAPCTMPPPFDPATL  1757
               +PC MP PF+P  L
Sbjct  372   EESPCEMPSPFNPHDL  387



>gb|KDO86108.1| hypothetical protein CISIN_1g017178mg [Citrus sinensis]
Length=376

 Score =   486 bits (1251),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 217/353 (61%), Positives = 280/353 (79%), Gaps = 3/353 (1%)
 Frame = +3

Query  699   MVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTLWGILQLLRRYPGKVPDLDLMFDT  878
             M+  AR+TA+FRLVIVNG AY   Y++S Q+RD FTLWGILQLLR YPG++PDL+LMFD 
Sbjct  1     MIERARKTAHFRLVIVNGKAYVEKYKQSIQTRDKFTLWGILQLLRLYPGRLPDLELMFDC  60

Query  879   VDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVFPDWSFWGWPEINIKPWEGLSKEL  1058
              D PV++ + +      + PP LFRYC D ++ DIVFPDWSFWGW E NI+PW  + K++
Sbjct  61    NDRPVVRARDF--GGPNSGPPPLFRYCSDGSSLDIVFPDWSFWGWAETNIRPWSNVLKDI  118

Query  1059  KEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVSEKQDWGARVYAQDWIQEHKQGYQ  1238
             +EGN + KW +R PYAYW+GNP V+  RK+L+ CN S+K DW AR+Y QDW QE KQ ++
Sbjct  119   EEGNKRTKWKERVPYAYWRGNPNVSPIRKELMTCNASDKNDWNARLYVQDWGQESKQNFK  178

Query  1239  QSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLLVKPHYYDFYTRGLMPMKHYWPIR  1418
             QSNL DQC HRYKIYIEG AWSVSEKYILACDS+TL+V+P YYDF++RG++PM+HYWPIR
Sbjct  179   QSNLGDQCSHRYKIYIEGWAWSVSEKYILACDSMTLIVRPRYYDFFSRGMVPMQHYWPIR  238

Query  1419  DDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEELKMEYVYDYMFHLLSEYAKLLKYK  1598
             D+ KC S+K AVDWGN H ++A+ IG A S++I+E+LKM YVYDYMFHLL+EYA+LL++K
Sbjct  239   DNSKCTSLKFAVDWGNAHTEKAEAIGEAASRFIREDLKMGYVYDYMFHLLNEYARLLRFK  298

Query  1599  PTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPSTTAPCTMPPPFDPATL  1757
             P++P  A+ELCSE M C A G  ++FM ES+VK +PS + PC++PPP+ P  L
Sbjct  299   PSIPAGALELCSETMACSAKGTWRKFMEESMVK-SPSDSIPCSLPPPYHPPAL  350



>ref|XP_009395424.1| PREDICTED: protein O-glucosyltransferase 1-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   491 bits (1265),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 218/376 (58%), Positives = 284/376 (76%), Gaps = 4/376 (1%)
 Frame = +3

Query  630   CPDYFRWIYDDLWAWRESGISREMVMSARRTANFRLVIVNGIAYYHNYRKSFQSRDTFTL  809
             CPDYFRWI++DL  W  +GI+R+M+ SAR+ A FRL+++ G  Y   Y + FQ+RD FTL
Sbjct  127   CPDYFRWIHEDLRPWNSTGITRKMLESARQFAAFRLLVIGGRVYVDQYHRVFQTRDLFTL  186

Query  810   WGILQLLRRYPGKVPDLDLMFDTVDWPVIKKQSYVLNDTTTAPPALFRYCGDEATWDIVF  989
             WG +QL  RYPG++PDLDLMF+  D P +K   Y   +T+  PP LFRYC D++T DIVF
Sbjct  187   WGFVQLANRYPGRLPDLDLMFNCEDMPTVKADDY---NTSHPPPPLFRYCKDDSTVDIVF  243

Query  990   PDWSFWGWPEINIKPWEGLSKELKEGNVKIKWVDREPYAYWKGNPEVAATRKDLLKCNVS  1169
             PDWSFWGWPEIN+KPWE L +E+KE N ++ W  R+PYA+WKGNP V+  RKDL++CN S
Sbjct  244   PDWSFWGWPEINVKPWEVLREEMKEANDRMAWEKRKPYAFWKGNPTVSGHRKDLMRCNSS  303

Query  1170  EKQDWGARVYAQDWIQEHKQGYQQSNLADQCIHRYKIYIEGSAWSVSEKYILACDSLTLL  1349
                DW ARVYAQDW++E + G++ SNLA+QCI+RYKI++EG AWSVS KYILACDS  L 
Sbjct  304   NGHDWNARVYAQDWVKEIENGFKDSNLAEQCIYRYKIFVEGRAWSVSSKYILACDSPALF  363

Query  1350  VKPHYYDFYTRGLMPMKHYWPIRDDDKCKSIKHAVDWGNNHHQQAQEIGMAGSKYIQEEL  1529
             V  H++DF TRGLMP +HYWPIR+D++C+SIK AVDWGN H ++ Q +G  GS +I EE+
Sbjct  364   VTTHFHDFMTRGLMPGRHYWPIREDNQCRSIKFAVDWGNKHQEKVQAMGKEGSSFILEEV  423

Query  1530  KMEYVYDYMFHLLSEYAKLLKYKPTVPPEAVELCSEKMVCGANGLEKQFMMESLVKAAPS  1709
             KME+VY YM HLL+EYAKLL+Y+PT+P  A ELC E + CG  G  ++F+ME++VK    
Sbjct  424   KMEFVYQYMLHLLTEYAKLLRYEPTLPENATELCLESVACGEEGRVREFLMEAMVKWT-C  482

Query  1710  TTAPCTMPPPFDPATL  1757
              + PCT+PPP+    L
Sbjct  483   DSEPCTLPPPYSAGEL  498



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5193175752787