BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25490_g2_i1 len=478 path=[15272:0-3 15276:4-59 9467:60-89
15355:90-106 9512:107-113 6656:114-147 15390:148-152 9556:153-200
9604:201-231 15446:232-242 9645:243-258 15483:259-269 15494:270-272
15497:273-477]

Length=478
                                                                      Score     E

emb|CDP10752.1|  unnamed protein product                                197   5e-59   
emb|CDO98838.1|  unnamed protein product                                192   8e-57   
ref|XP_009598691.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    186   3e-55   
ref|XP_009775927.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    187   4e-55   
ref|NP_001275381.1|  epoxide hydrolase                                  187   5e-55   
ref|XP_004239805.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    186   1e-54   
ref|XP_011090999.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    186   1e-54   
ref|XP_009598630.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    185   2e-54   
ref|XP_006342825.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    186   3e-54   
ref|XP_010321810.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    181   5e-54   
ref|XP_004229259.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    184   7e-54   
ref|XP_009757467.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    184   8e-54   
gb|EYU43973.1|  hypothetical protein MIMGU_mgv1a010247mg                184   9e-54   
emb|CDO98837.1|  unnamed protein product                                184   9e-54   
ref|XP_009757465.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    184   1e-53   
emb|CAJ19276.1|  putative epoxide hydrolase                             183   1e-53   Solanum commersonii
gb|EYU21013.1|  hypothetical protein MIMGU_mgv1a010239mg                183   2e-53   
ref|NP_001275417.1|  epoxide hydrolase                                  182   3e-53   
ref|XP_004239808.1|  PREDICTED: bifunctional epoxide hydrolase 2        182   4e-53   
ref|XP_004239806.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    181   7e-53   
ref|XP_009622179.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    182   7e-53   
ref|XP_006349824.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    181   1e-52   
gb|EPS69728.1|  epoxide hydrolase                                       181   2e-52   
pdb|2CJP|A  Chain A, Structure Of Potato (Solanum Tuberosum) Epox...    181   2e-52   
pdb|3CXU|A  Chain A, Structure Of A Y149f Mutant Of Epoxide Hydro...    181   2e-52   
ref|XP_006342824.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    181   2e-52   
ref|NP_001274962.1|  epoxide hydrolase                                  179   6e-52   
ref|XP_004229258.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    179   7e-52   
ref|NP_001274907.1|  epoxide hydrolase                                  177   2e-51   
ref|XP_009622181.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    177   3e-51   
emb|CDP15824.1|  unnamed protein product                                176   6e-51   
ref|XP_004252913.1|  PREDICTED: bifunctional epoxide hydrolase 2        175   2e-50   
ref|XP_009788447.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    171   1e-48   
ref|XP_009622776.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    170   2e-48   
ref|XP_006419519.1|  hypothetical protein CICLE_v10006037mg             162   4e-47   
gb|KDO38863.1|  hypothetical protein CISIN_1g044507mg                   161   5e-47   
ref|XP_008223222.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    166   6e-47   
ref|XP_009350799.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    161   7e-47   
ref|XP_007222693.1|  hypothetical protein PRUPE_ppa008676mg             165   2e-46   
ref|XP_006419521.1|  hypothetical protein CICLE_v10005425mg             162   3e-46   
ref|XP_007221833.1|  hypothetical protein PRUPE_ppa020197mg             163   9e-46   
ref|XP_007222764.1|  hypothetical protein PRUPE_ppa008756mg             163   1e-45   
ref|XP_010911257.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    162   1e-45   
ref|XP_007035641.1|  Alpha/beta-Hydrolases superfamily protein          164   2e-45   
gb|AAA81893.1|  epoxide hydrolase                                       162   2e-45   Solanum tuberosum [potatoes]
emb|CAZ86692.1|  epoxide hydrolase 1                                    162   2e-45   
ref|XP_011091000.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    161   4e-45   
ref|XP_006419522.1|  hypothetical protein CICLE_v10005425mg             161   4e-45   
ref|XP_006489041.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    161   6e-45   
gb|KDO38861.1|  hypothetical protein CISIN_1g026419mg                   159   6e-45   
ref|XP_009350800.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    160   7e-45   
ref|XP_004296863.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    160   1e-44   
gb|KEH32298.1|  epoxide hydrolase                                       160   1e-44   
ref|XP_008340934.1|  PREDICTED: bifunctional epoxide hydrolase 2        156   1e-44   
ref|XP_007015353.1|  Alpha/beta-Hydrolases superfamily protein          160   2e-44   
ref|XP_009386486.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    160   2e-44   
ref|XP_008353224.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    154   4e-44   
ref|XP_006419517.1|  hypothetical protein CICLE_v10005451mg             159   5e-44   
gb|KHG02721.1|  Epoxide hydrolase 2                                     157   5e-44   
ref|XP_010269590.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    158   5e-44   
ref|XP_009629123.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    158   7e-44   
gb|KDP27828.1|  hypothetical protein JCGZ_18908                         157   1e-43   
ref|XP_007015342.1|  Alpha/beta-Hydrolases superfamily protein          157   1e-43   
gb|KHG22415.1|  Epoxide hydrolase 2                                     157   2e-43   
ref|XP_008340789.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    157   2e-43   
ref|XP_009775353.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    156   3e-43   
ref|XP_009352305.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    156   3e-43   
ref|XP_008784769.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    156   3e-43   
ref|XP_011079630.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    156   4e-43   
ref|XP_004290776.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    156   4e-43   
ref|XP_009391487.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    155   5e-43   
gb|KDP27824.1|  hypothetical protein JCGZ_18904                         155   7e-43   
emb|CDP17110.1|  unnamed protein product                                155   1e-42   
ref|XP_008371325.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    154   2e-42   
ref|XP_003550367.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    154   2e-42   
ref|XP_011015180.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    152   2e-42   
ref|XP_004298141.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    154   2e-42   
ref|XP_006419516.1|  hypothetical protein CICLE_v10006950mg             151   2e-42   
ref|XP_009771842.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    154   3e-42   
ref|XP_008341331.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    154   3e-42   
ref|XP_006600362.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    154   3e-42   
gb|EYU43974.1|  hypothetical protein MIMGU_mgv1a009814mg                154   4e-42   
ref|XP_003554635.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    153   4e-42   
gb|KHG21329.1|  Epoxide hydrolase 2                                     155   5e-42   
ref|XP_006489040.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    154   5e-42   
ref|XP_008438903.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    154   6e-42   
gb|ACU23321.1|  unknown                                                 153   7e-42   Glycine max [soybeans]
gb|AFK39700.1|  unknown                                                 152   8e-42   
ref|XP_006419515.1|  hypothetical protein CICLE_v10005186mg             154   9e-42   
ref|NP_001238563.1|  epoxide hydrolase                                  153   9e-42   
ref|XP_006838632.1|  hypothetical protein AMTR_s00002p00236030          152   9e-42   
emb|CAA55294.1|  epoxide hydrolase                                      153   9e-42   Glycine max [soybeans]
ref|XP_004240550.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    152   1e-41   
ref|XP_008361962.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    152   1e-41   
gb|KHG16220.1|  Epoxide hydrolase 2                                     152   1e-41   
ref|XP_004134492.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    152   1e-41   
gb|EYU46741.1|  hypothetical protein MIMGU_mgv1a009984mg                152   2e-41   
gb|AFK46740.1|  unknown                                                 152   2e-41   
gb|KHG02720.1|  Epoxide hydrolase 2                                     157   2e-41   
ref|XP_011015179.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    152   2e-41   
ref|XP_010921626.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    151   2e-41   
ref|XP_006355815.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    151   3e-41   
gb|KDO71745.1|  hypothetical protein CISIN_1g017221mg                   152   3e-41   
gb|EYU46742.1|  hypothetical protein MIMGU_mgv1a010264mg                151   3e-41   
emb|CDP17111.1|  unnamed protein product                                151   3e-41   
ref|XP_009411662.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    151   3e-41   
ref|XP_003554527.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    151   4e-41   
ref|XP_006838629.1|  hypothetical protein AMTR_s00002p00235200          151   4e-41   
ref|XP_003554633.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    151   4e-41   
ref|XP_010429523.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    151   4e-41   
ref|XP_006838631.1|  hypothetical protein AMTR_s00002p00235860          150   5e-41   
ref|XP_002874922.1|  hypothetical protein ARALYDRAFT_490337             150   5e-41   
ref|XP_009620847.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    150   5e-41   
ref|XP_002516953.1|  epoxide hydrolase, putative                        150   6e-41   Ricinus communis
ref|XP_003591165.1|  Epoxide hydrolase                                  146   6e-41   
ref|XP_010910755.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    146   9e-41   
gb|KHN43314.1|  Epoxide hydrolase 2                                     150   9e-41   
ref|XP_002302724.1|  epoxide hydrolase family protein                   149   1e-40   Populus trichocarpa [western balsam poplar]
ref|XP_006396441.1|  hypothetical protein EUTSA_v10028814mg             149   1e-40   
ref|XP_007154300.1|  hypothetical protein PHAVU_003G106900g             149   1e-40   
ref|XP_003632381.1|  PREDICTED: bifunctional epoxide hydrolase 2        149   1e-40   
ref|XP_006433455.1|  hypothetical protein CICLE_v10001881mg             145   1e-40   
gb|ACU19478.1|  unknown                                                 149   1e-40   Glycine max [soybeans]
ref|XP_011041992.1|  PREDICTED: bifunctional epoxide hydrolase 2        149   2e-40   
gb|ACU23953.1|  unknown                                                 147   2e-40   Glycine max [soybeans]
ref|XP_006444395.1|  hypothetical protein CICLE_v10024303mg             148   2e-40   
gb|KDP27825.1|  hypothetical protein JCGZ_18905                         149   2e-40   
gb|KDO87161.1|  hypothetical protein CISIN_1g048209mg                   150   2e-40   
ref|XP_011079631.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    149   2e-40   
ref|XP_002320333.2|  epoxide hydrolase family protein                   149   2e-40   Populus trichocarpa [western balsam poplar]
gb|KDP28184.1|  hypothetical protein JCGZ_13955                         149   2e-40   
ref|XP_006604802.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    149   2e-40   
ref|XP_007163124.1|  hypothetical protein PHAVU_001G208300g             149   2e-40   
ref|XP_010556730.1|  PREDICTED: bifunctional epoxide hydrolase 2        149   2e-40   
ref|XP_006479996.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    147   3e-40   
gb|KHN02949.1|  Epoxide hydrolase 2                                     147   3e-40   
ref|XP_008784772.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    149   3e-40   
ref|XP_008784770.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    149   3e-40   
ref|XP_010914485.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    148   4e-40   
ref|XP_008784771.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    149   4e-40   
gb|ACU19450.1|  unknown                                                 148   4e-40   Glycine max [soybeans]
ref|XP_010105137.1|  Epoxide hydrolase 2                                148   4e-40   
emb|CDP17206.1|  unnamed protein product                                148   5e-40   
ref|XP_008454325.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    148   5e-40   
ref|XP_006288215.1|  hypothetical protein CARUB_v10001452mg             148   5e-40   
gb|ACE82566.1|  epoxide hydrolase                                       148   6e-40   Nicotiana benthamiana
ref|XP_006433456.1|  hypothetical protein CICLE_v10001881mg             145   6e-40   
ref|NP_567228.1|  putative epoxide hydrolase                            148   6e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006480000.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    147   7e-40   
ref|XP_007050977.1|  Alpha/beta-Hydrolases superfamily protein          147   7e-40   
ref|XP_010422608.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    147   7e-40   
gb|KGN66047.1|  hypothetical protein Csa_1G569240                       147   7e-40   
ref|XP_004230258.1|  PREDICTED: bifunctional epoxide hydrolase 2        147   8e-40   
ref|XP_006344695.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    147   8e-40   
gb|ADP68585.1|  epoxide hydrolase A                                     147   9e-40   
emb|CDY65635.1|  BnaAnng20800D                                          147   9e-40   
ref|XP_009111297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    147   9e-40   
ref|NP_001240943.1|  uncharacterized protein LOC100803974               147   1e-39   
gb|KHG07158.1|  Epoxide hydrolase 2                                     147   1e-39   
ref|XP_006388394.1|  hypothetical protein POPTR_0199s00210g             141   1e-39   
ref|XP_004494384.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    147   1e-39   
gb|KDO87174.1|  hypothetical protein CISIN_1g021158mg                   145   1e-39   
ref|XP_009393199.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    147   1e-39   
gb|EYU42746.1|  hypothetical protein MIMGU_mgv1a010198mg                147   1e-39   
ref|XP_004152361.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    147   1e-39   
ref|XP_002271210.1|  PREDICTED: bifunctional epoxide hydrolase 2        147   1e-39   Vitis vinifera
ref|XP_011092097.1|  PREDICTED: bifunctional epoxide hydrolase 2        147   2e-39   
gb|KDP23458.1|  hypothetical protein JCGZ_23291                         146   2e-39   
ref|XP_003556522.1|  PREDICTED: bifunctional epoxide hydrolase 2 ...    146   2e-39   
ref|XP_003626240.1|  Epoxide hydrolase                                  151   2e-39   
emb|CAN65686.1|  hypothetical protein VITISV_022460                     142   2e-39   Vitis vinifera
gb|KHN20253.1|  Epoxide hydrolase 2                                     146   2e-39   
ref|XP_003604118.1|  Epoxide hydrolase                                  146   2e-39   
ref|XP_002523107.1|  epoxide hydrolase, putative                        146   2e-39   Ricinus communis
gb|KFK30821.1|  hypothetical protein AALP_AA6G030400                    146   2e-39   
gb|AAO27849.1|AF482450_1  soluble epoxide hydrolase                     146   3e-39   Euphorbia lagascae
gb|EPS67066.1|  pectinesterase                                          152   3e-39   
ref|XP_009788536.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    146   3e-39   
ref|XP_007147002.1|  hypothetical protein PHAVU_006G088500g             146   3e-39   
ref|XP_006444387.1|  hypothetical protein CICLE_v10021228mg             146   3e-39   
ref|XP_007144960.1|  hypothetical protein PHAVU_007G198000g             146   3e-39   
ref|XP_008450607.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    146   3e-39   
ref|XP_004290809.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    145   4e-39   
ref|XP_007147003.1|  hypothetical protein PHAVU_006G088600g             144   5e-39   
ref|XP_011039566.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    146   5e-39   
ref|XP_006433457.1|  hypothetical protein CICLE_v10001881mg             145   5e-39   
ref|XP_011021885.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    146   5e-39   
ref|XP_002306333.2|  hypothetical protein POPTR_0005s08280g             145   6e-39   Populus trichocarpa [western balsam poplar]
ref|XP_007200440.1|  hypothetical protein PRUPE_ppa008875mg             145   7e-39   
ref|XP_008454327.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    145   8e-39   
ref|XP_006444386.1|  hypothetical protein CICLE_v10023691mg             144   1e-38   
gb|EPS62395.1|  hypothetical protein M569_12392                         144   1e-38   
ref|XP_009629075.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    144   1e-38   
ref|XP_002523108.1|  epoxide hydrolase, putative                        144   1e-38   Ricinus communis
ref|XP_004508197.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    145   1e-38   
ref|XP_006577223.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    140   1e-38   
ref|XP_009111296.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    144   1e-38   
gb|KEH24512.1|  epoxide hydrolase                                       142   1e-38   
ref|XP_010113065.1|  Epoxide hydrolase 2                                140   2e-38   
gb|KEH24510.1|  epoxide hydrolase                                       144   2e-38   
ref|XP_008789846.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    144   2e-38   
ref|XP_009393200.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    144   2e-38   
emb|CBI39538.3|  unnamed protein product                                143   2e-38   
gb|KCW50160.1|  hypothetical protein EUGRSUZ_K03595                     142   2e-38   
ref|XP_008235117.1|  PREDICTED: bifunctional epoxide hydrolase 2        144   2e-38   
emb|CDY05187.1|  BnaC05g46160D                                          144   2e-38   
gb|ACE82565.1|  epoxide hydrolase                                       144   2e-38   Nicotiana benthamiana
ref|XP_006388576.1|  hypothetical protein POPTR_0150s00210g             139   2e-38   
ref|XP_002512456.1|  epoxide hydrolase, putative                        144   2e-38   Ricinus communis
ref|XP_010456047.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    144   3e-38   
ref|XP_007147005.1|  hypothetical protein PHAVU_006G088700g             143   3e-38   
gb|KEH24396.1|  epoxide hydrolase                                       141   3e-38   
ref|XP_007147004.1|  hypothetical protein PHAVU_006G088600g             143   3e-38   
ref|XP_002283462.1|  PREDICTED: bifunctional epoxide hydrolase 2        143   3e-38   Vitis vinifera
gb|AES82458.2|  epoxide hydrolase                                       143   3e-38   
emb|CDY50394.1|  BnaCnng19260D                                          143   3e-38   
ref|XP_008775994.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    141   4e-38   
ref|XP_002270853.1|  PREDICTED: bifunctional epoxide hydrolase 2        143   4e-38   Vitis vinifera
emb|CDY65636.1|  BnaAnng20810D                                          143   5e-38   
ref|XP_011023717.1|  PREDICTED: bifunctional epoxide hydrolase 2        142   5e-38   
ref|XP_010649574.1|  PREDICTED: bifunctional epoxide hydrolase 2        142   5e-38   
ref|XP_011010960.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    142   6e-38   
ref|XP_006577222.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    140   6e-38   
ref|XP_011010961.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    142   7e-38   
ref|XP_008386679.1|  PREDICTED: bifunctional epoxide hydrolase 2        142   7e-38   
gb|KHN20392.1|  Epoxide hydrolase 2                                     140   8e-38   
gb|KEH24505.1|  epoxide hydrolase                                       138   8e-38   
ref|XP_003626243.1|  Epoxide hydrolase                                  142   8e-38   
gb|AFZ93648.1|  epoxide hydrolase                                       142   9e-38   
gb|AFK41347.1|  unknown                                                 141   9e-38   
ref|XP_004247402.1|  PREDICTED: bifunctional epoxide hydrolase 2        142   9e-38   
gb|ACJ84958.1|  unknown                                                 142   1e-37   Medicago truncatula
ref|XP_003626245.1|  Epoxide hydrolase                                  142   1e-37   
ref|XP_002884518.1|  hypothetical protein ARALYDRAFT_317420             142   1e-37   
ref|XP_010042740.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    140   1e-37   
ref|XP_006472971.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    145   1e-37   
ref|XP_006359858.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    141   1e-37   
ref|XP_008454330.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    141   1e-37   
gb|ACJ85188.1|  unknown                                                 141   1e-37   Medicago truncatula
ref|XP_003626241.1|  Epoxide hydrolase                                  141   1e-37   
ref|XP_010039296.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    141   2e-37   
gb|AFK39155.1|  unknown                                                 141   2e-37   
ref|XP_011006451.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    141   2e-37   
ref|XP_009414133.1|  PREDICTED: bifunctional epoxide hydrolase 2        142   2e-37   
gb|KHG24497.1|  Epoxide hydrolase 2                                     141   2e-37   
ref|XP_010088295.1|  Epoxide hydrolase 2                                141   2e-37   
gb|KDP28185.1|  hypothetical protein JCGZ_13956                         141   2e-37   
ref|XP_010038235.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    141   3e-37   
gb|KHN03961.1|  Epoxide hydrolase 2                                     140   3e-37   
ref|XP_007147001.1|  hypothetical protein PHAVU_006G088400g             140   3e-37   
gb|KDP28186.1|  hypothetical protein JCGZ_13957                         140   3e-37   
gb|KEH24395.1|  epoxide hydrolase                                       140   3e-37   
gb|KEH24504.1|  epoxide hydrolase                                       139   3e-37   
ref|XP_010546737.1|  PREDICTED: bifunctional epoxide hydrolase 2        141   3e-37   
ref|NP_001276233.1|  bifunctional epoxide hydrolase 2-like              140   3e-37   
ref|XP_010088294.1|  Epoxide hydrolase 2                                140   3e-37   
ref|XP_010102979.1|  Epoxide hydrolase 2                                140   3e-37   
gb|KCW50060.1|  hypothetical protein EUGRSUZ_K03501                     140   4e-37   
gb|KDO38860.1|  hypothetical protein CISIN_1g043205mg                   137   4e-37   
ref|XP_010038233.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    140   4e-37   
ref|XP_008355493.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    140   4e-37   
gb|ABN08019.1|  Epoxide hydrolase                                       136   4e-37   Medicago truncatula
ref|XP_004152245.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    140   4e-37   
ref|XP_009335707.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    140   4e-37   
ref|XP_008775993.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    140   5e-37   
ref|XP_010486015.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    140   5e-37   
emb|CDY27752.1|  BnaA05g31610D                                          140   5e-37   
gb|AFK36778.1|  unknown                                                 137   6e-37   
ref|XP_011006454.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    139   6e-37   
ref|XP_010693594.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    140   6e-37   
ref|NP_187211.1|  alpha/beta-Hydrolases superfamily protein             140   6e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008454323.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    138   7e-37   
gb|AFK45529.1|  unknown                                                 140   7e-37   
ref|XP_003626244.1|  Epoxide hydrolase                                  140   7e-37   
ref|XP_010094462.1|  Epoxide hydrolase 2                                139   8e-37   
ref|XP_003626202.1|  Epoxide hydrolase                                  144   8e-37   
ref|XP_010104146.1|  Epoxide hydrolase 2                                139   8e-37   
ref|XP_002318980.2|  epoxide hydrolase family protein                   139   8e-37   Populus trichocarpa [western balsam poplar]
ref|XP_004156834.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    139   8e-37   
ref|XP_004152244.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    139   9e-37   
gb|KCW50054.1|  hypothetical protein EUGRSUZ_K03494                     137   9e-37   
ref|XP_002314368.1|  hypothetical protein POPTR_0010s01430g             140   1e-36   
ref|XP_002314371.1|  hypothetical protein POPTR_0010s01440g             139   1e-36   
gb|AFK34299.1|  unknown                                                 139   1e-36   
ref|XP_004152242.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    139   1e-36   
ref|XP_002275186.1|  PREDICTED: bifunctional epoxide hydrolase 2        139   2e-36   
emb|CAN77654.1|  hypothetical protein VITISV_032325                     139   2e-36   
ref|XP_011006450.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    139   2e-36   
gb|KEH24503.1|  epoxide hydrolase                                       138   2e-36   
ref|XP_010105136.1|  Epoxide hydrolase 2                                139   2e-36   
gb|AES82420.2|  epoxide hydrolase                                       138   3e-36   
ref|XP_008454322.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    137   4e-36   
ref|XP_006433454.1|  hypothetical protein CICLE_v10003596mg             136   5e-36   
ref|XP_007031041.1|  Alpha/beta-Hydrolases superfamily protein          137   5e-36   
ref|XP_004981166.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    137   5e-36   
ref|XP_009147218.1|  PREDICTED: bifunctional epoxide hydrolase 2        137   7e-36   
ref|XP_010038234.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    137   9e-36   
ref|NP_001051780.1|  Os03g0829100                                       137   9e-36   
ref|XP_004494577.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    137   1e-35   
gb|ACJ84799.1|  unknown                                                 137   1e-35   
gb|EAY92419.1|  hypothetical protein OsI_14153                          137   1e-35   
gb|ABK21215.1|  unknown                                                 136   1e-35   
ref|XP_010038230.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    136   1e-35   
ref|XP_010464087.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    136   2e-35   
pir||D71425  probable ATsEH - Arabidopsis thaliana                      133   2e-35
gb|KCW84774.1|  hypothetical protein EUGRSUZ_B015792                    132   2e-35   
gb|AAM28292.1|  epoxide hydrolase                                       136   2e-35   
gb|AFK41660.1|  unknown                                                 136   2e-35   
gb|EYU42194.1|  hypothetical protein MIMGU_mgv1a010473mg                135   2e-35   
gb|KEH20403.1|  epoxide hydrolase                                       134   2e-35   
ref|XP_004494576.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    135   2e-35   
ref|XP_008677783.1|  PREDICTED: epoxide hydrolase 2 isoform X1          135   2e-35   
ref|XP_003626242.1|  Epoxide hydrolase                                  139   2e-35   
gb|KFK37968.1|  hypothetical protein AALP_AA3G053200                    135   3e-35   
ref|XP_010429482.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    136   3e-35   
ref|XP_006299523.1|  hypothetical protein CARUB_v10015695mg             136   3e-35   
gb|AES82460.2|  epoxide hydrolase                                       138   3e-35   
ref|XP_010024724.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    135   4e-35   
ref|XP_002521508.1|  epoxide hydrolase, putative                        135   4e-35   
ref|XP_004494951.1|  PREDICTED: uncharacterized protein LOC101500941    138   4e-35   
gb|KDP27827.1|  hypothetical protein JCGZ_18907                         129   5e-35   
ref|XP_004152243.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    135   5e-35   
gb|ACF83934.1|  unknown                                                 135   6e-35   
emb|CDP01962.1|  unnamed protein product                                134   6e-35   
gb|AAL16157.1|AF428389_1  At2g26740/F18A8.11                            132   7e-35   
gb|KDP37443.1|  hypothetical protein JCGZ_08284                         134   8e-35   
ref|XP_010024723.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    134   8e-35   
ref|XP_010693593.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    135   1e-34   
ref|XP_010914488.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    134   1e-34   
gb|AFK46496.1|  unknown                                                 134   1e-34   
ref|XP_008454324.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    134   1e-34   
ref|NP_001150215.1|  epoxide hydrolase 2                                134   1e-34   
gb|KEH20402.1|  epoxide hydrolase                                       134   1e-34   
dbj|BAK07144.1|  predicted protein                                      134   1e-34   
ref|XP_008338037.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    134   1e-34   
ref|XP_009346066.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    133   2e-34   
ref|XP_009346065.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    133   2e-34   
ref|XP_001753609.1|  predicted protein                                  133   2e-34   
gb|ABR16314.1|  unknown                                                 133   2e-34   
gb|KCW84773.1|  hypothetical protein EUGRSUZ_B015792                    131   2e-34   
ref|XP_010254688.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    133   3e-34   
ref|XP_002455386.1|  hypothetical protein SORBIDRAFT_03g009830          133   3e-34   
ref|XP_006423390.1|  hypothetical protein CICLE_v10028838mg             130   3e-34   
ref|XP_008354646.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    132   3e-34   
ref|XP_002463580.1|  hypothetical protein SORBIDRAFT_01g002410          133   4e-34   
ref|XP_006487348.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    132   4e-34   
gb|KFK41013.1|  hypothetical protein AALP_AA2G073900                    132   4e-34   
ref|NP_001151201.1|  epoxide hydrolase 2                                132   5e-34   
emb|CDY09722.1|  BnaC07g33390D                                          132   6e-34   
ref|XP_010229424.1|  PREDICTED: uncharacterized protein LOC100841009    136   7e-34   
ref|XP_008366789.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    132   7e-34   
tpg|DAA53983.1|  TPA: epoxide hydrolase 2                               132   8e-34   
ref|XP_006296031.1|  hypothetical protein CARUB_v10025176mg             132   8e-34   
ref|NP_001148885.1|  epoxide hydrolase 2                                132   8e-34   
ref|XP_010684348.1|  PREDICTED: bifunctional epoxide hydrolase 2        131   9e-34   
ref|XP_010649601.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    132   9e-34   
ref|XP_010039627.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    131   1e-33   
gb|KFK32480.1|  hypothetical protein AALP_AA6G247900                    131   1e-33   
ref|XP_008644360.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    132   1e-33   
ref|XP_006423389.1|  hypothetical protein CICLE_v10028838mg             131   1e-33   
dbj|BAJ89155.1|  predicted protein                                      132   1e-33   
gb|KDO49467.1|  hypothetical protein CISIN_1g020621mg                   131   1e-33   
ref|NP_180242.1|  soluble epoxide hydrolase                             131   1e-33   
gb|ACG46051.1|  epoxide hydrolase 2                                     131   1e-33   
ref|XP_008680999.1|  PREDICTED: uncharacterized protein LOC100191...    131   1e-33   
ref|XP_009136735.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    132   1e-33   
dbj|BAJ91671.1|  predicted protein                                      131   1e-33   
ref|XP_010039619.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    131   1e-33   
ref|XP_007202507.1|  hypothetical protein PRUPE_ppa010766mg             129   1e-33   
dbj|BAJ90007.1|  predicted protein                                      131   1e-33   
gb|KDP27829.1|  hypothetical protein JCGZ_18909                         125   2e-33   
ref|XP_010449872.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    132   2e-33   
ref|XP_004967831.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    131   2e-33   
ref|XP_010914487.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    130   2e-33   
ref|XP_010038231.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    130   2e-33   
gb|KCW55383.1|  hypothetical protein EUGRSUZ_I01294                     129   2e-33   
ref|XP_009346058.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    130   2e-33   
ref|XP_010434902.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    131   2e-33   
ref|XP_004509321.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    130   2e-33   
ref|NP_180243.1|  alpha/beta-hydrolases superfamily protein             130   3e-33   
ref|XP_006397371.1|  hypothetical protein EUTSA_v10022504mg             130   3e-33   
emb|CDX90550.1|  BnaA03g42310D                                          130   3e-33   
ref|XP_010417820.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    130   4e-33   
gb|EMT04118.1|  hypothetical protein F775_13984                         130   4e-33   
ref|XP_002880830.1|  predicted protein                                  129   5e-33   
ref|WP_033355385.1|  epoxide hydrolase                                  124   6e-33   
ref|XP_010275537.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    129   6e-33   
emb|CDX77051.1|  BnaC04g38460D                                          125   6e-33   
gb|EAY73345.1|  hypothetical protein OsI_01222                          126   6e-33   
emb|CDJ26419.1|  unnamed protein product                                129   7e-33   
gb|EPS69185.1|  hypothetical protein M569_05583                         129   7e-33   
ref|XP_008241748.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    129   7e-33   
ref|XP_010236884.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    125   8e-33   
ref|NP_001078398.1|  alpha/beta-Hydrolases superfamily protein          125   9e-33   
ref|XP_008807392.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    129   9e-33   
ref|XP_007202253.1|  hypothetical protein PRUPE_ppa008854mg             129   1e-32   
ref|NP_849393.1|  alpha/beta-Hydrolases superfamily protein             125   1e-32   
ref|XP_010043042.1|  PREDICTED: bifunctional epoxide hydrolase 2        129   1e-32   
ref|XP_010039280.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    129   1e-32   
ref|XP_006414415.1|  hypothetical protein EUTSA_v10025689mg             129   1e-32   
ref|XP_010275536.1|  PREDICTED: bifunctional epoxide hydrolase 2        128   1e-32   
ref|XP_007156093.1|  hypothetical protein PHAVU_003G257900g             129   1e-32   
ref|XP_006650837.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    129   1e-32   
emb|CDX90553.1|  BnaA03g42280D                                          128   1e-32   
ref|XP_010473058.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    128   1e-32   
ref|XP_003577254.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    128   1e-32   
ref|XP_010028623.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    128   2e-32   
emb|CDY57860.1|  BnaC08g47760D                                          128   2e-32   
ref|WP_017211938.1|  epoxide hydrolase                                  128   2e-32   
ref|XP_009136732.1|  PREDICTED: bifunctional epoxide hydrolase 2        128   2e-32   
ref|WP_039768945.1|  epoxide hydrolase                                  128   2e-32   
ref|WP_026886947.1|  epoxide hydrolase                                  128   2e-32   
ref|XP_002310826.2|  epoxide hydrolase family protein                   128   2e-32   
ref|WP_012852003.1|  epoxide hydrolase                                  127   2e-32   
ref|XP_006299381.1|  hypothetical protein CARUB_v10015540mg             128   3e-32   
ref|XP_004981168.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    127   3e-32   
ref|XP_003566463.1|  PREDICTED: bifunctional epoxide hydrolase 2        127   3e-32   
emb|CDY48181.1|  BnaA04g15450D                                          127   4e-32   
ref|XP_009140747.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    127   4e-32   
ref|XP_002985384.1|  hypothetical protein SELMODRAFT_181715             127   4e-32   
ref|XP_010548981.1|  PREDICTED: bifunctional epoxide hydrolase 2        127   5e-32   
ref|XP_008354647.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    127   5e-32   
ref|XP_008241747.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    126   5e-32   
gb|AFK36273.1|  unknown                                                 127   6e-32   
ref|XP_010674075.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    127   6e-32   
ref|WP_012060020.1|  epoxide hydrolase                                  127   6e-32   
ref|XP_008337725.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    127   6e-32   
ref|XP_010039297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    125   6e-32   
gb|AFK43935.1|  unknown                                                 127   6e-32   
ref|XP_008775992.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    126   6e-32   
ref|XP_002868171.1|  hypothetical protein ARALYDRAFT_329917             129   6e-32   
gb|AGV54241.1|  epoxide hydrolase 2-like protein                        127   7e-32   
emb|CAB46034.1|  putative epoxide hydrolase                             129   7e-32   
ref|XP_002443655.1|  hypothetical protein SORBIDRAFT_08g022970          127   7e-32   
ref|NP_001152729.1|  LOC100286370                                       126   7e-32   
emb|CAD30841.1|  soluble epoxide hydrolase                              126   8e-32   
ref|XP_006414412.1|  hypothetical protein EUTSA_v10025488mg             127   8e-32   
ref|WP_038677555.1|  epoxide hydrolase                                  126   1e-31   
ref|XP_006283220.1|  hypothetical protein CARUB_v10004250mg             129   1e-31   
ref|XP_011025873.1|  PREDICTED: bifunctional epoxide hydrolase 2        125   1e-31   
ref|NP_001154238.1|  alpha/beta-Hydrolases superfamily protein          125   1e-31   
ref|NP_001067364.1|  Os12g0636400                                       125   2e-31   
ref|XP_006479998.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    121   2e-31   
ref|NP_193331.6|  alpha/beta-Hydrolases superfamily protein             126   2e-31   
ref|XP_010107837.1|  Epoxide hydrolase 2                                125   2e-31   
gb|KHN00509.1|  Epoxide hydrolase 2                                     125   2e-31   
ref|XP_008662613.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    125   3e-31   
ref|WP_031039925.1|  epoxide hydrolase                                  125   3e-31   
gb|EMT01002.1|  hypothetical protein F775_32452                         125   3e-31   
gb|EWM13997.1|  epoxide hydrolase                                       125   3e-31   
ref|XP_003520282.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    125   3e-31   
ref|WP_023975668.1|  epoxide hydrolase                                  125   3e-31   
ref|WP_030317745.1|  epoxide hydrolase                                  125   3e-31   
ref|XP_010449873.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    124   4e-31   
ref|XP_004981167.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    124   4e-31   
ref|XP_007046808.1|  Alpha/beta-Hydrolases superfamily protein is...    124   4e-31   
ref|WP_018656912.1|  hypothetical protein                               124   4e-31   
ref|NP_001147768.1|  LOC100281378                                       124   5e-31   
ref|NP_001042621.1|  Os01g0255000                                       124   5e-31   
ref|XP_007046807.1|  Alpha/beta-Hydrolases superfamily protein is...    124   5e-31   
ref|WP_035692775.1|  epoxide hydrolase                                  124   6e-31   
gb|KFK41012.1|  hypothetical protein AALP_AA2G073800                    124   6e-31   
ref|NP_001055069.1|  Os05g0273800                                       124   6e-31   
gb|EAZ11286.1|  hypothetical protein OsJ_01142                          125   6e-31   
dbj|BAJ99775.1|  predicted protein                                      124   7e-31   
ref|XP_004287856.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    124   7e-31   
ref|WP_030021863.1|  epoxide hydrolase                                  124   7e-31   
ref|WP_016574863.1|  epoxide hydrolase                                  124   7e-31   
ref|WP_026400729.1|  epoxide hydrolase                                  124   7e-31   
ref|WP_028801039.1|  epoxide hydrolase                                  124   7e-31   
ref|XP_010440227.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    124   1e-30   
ref|XP_010440228.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    124   1e-30   
ref|XP_004963322.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    123   1e-30   
ref|WP_015615791.1|  putative hydrolase or acyltransferase of alp...    123   1e-30   
emb|CAN65368.1|  hypothetical protein VITISV_021974                     123   1e-30   
ref|XP_010524544.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    124   1e-30   
ref|XP_010649095.1|  PREDICTED: bifunctional epoxide hydrolase 2        123   2e-30   
ref|WP_027528024.1|  epoxide hydrolase                                  123   2e-30   
ref|XP_010254690.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    123   2e-30   
ref|XP_006650836.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    123   2e-30   
emb|CDY09727.1|  BnaC07g33340D                                          122   2e-30   
ref|WP_010981577.1|  epoxide hydrolase                                  123   2e-30   
ref|XP_002967234.1|  hypothetical protein SELMODRAFT_87385              122   2e-30   
ref|WP_020121719.1|  epoxide hydrolase                                  122   2e-30   
ref|XP_002979677.1|  hypothetical protein SELMODRAFT_111571             122   2e-30   
ref|WP_018641625.1|  epoxide hydrolase                                  122   2e-30   
ref|WP_033347946.1|  epoxide hydrolase                                  122   3e-30   
ref|XP_004965308.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    123   3e-30   
ref|WP_030278743.1|  MULTISPECIES: epoxide hydrolase                    122   3e-30   
ref|WP_003991010.1|  epoxide hydrolase                                  122   4e-30   
ref|XP_002443185.1|  hypothetical protein SORBIDRAFT_08g014640          122   4e-30   
ref|XP_010033445.1|  PREDICTED: bifunctional epoxide hydrolase 2        122   4e-30   
ref|WP_026151444.1|  epoxide hydrolase                                  122   4e-30   
emb|CDM82646.1|  unnamed protein product                                122   4e-30   
ref|WP_033279821.1|  epoxide hydrolase                                  122   4e-30   
ref|XP_006644009.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    122   4e-30   
gb|KHN27037.1|  Epoxide hydrolase 2                                     122   4e-30   
ref|NP_001240134.1|  uncharacterized protein LOC100809053               122   5e-30   
gb|AFK43554.1|  unknown                                                 122   5e-30   
ref|WP_021594424.1|  hypothetical protein                               121   5e-30   



>emb|CDP10752.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   197 bits (501),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 91/108 (84%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI HK V VNGINMHIAELGEGPLVLFLHGFPELW+SWRHQILFLA+HGYRAVAPDLR
Sbjct  1    MDKIEHKNVSVNGINMHIAELGEGPLVLFLHGFPELWYSWRHQILFLASHGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +DSSKF+  HIVGDLI L Q+IAP+++KVFVVGHDWGA
Sbjct  61   GYGDTTGAPVNDSSKFSSLHIVGDLIALTQAIAPDQEKVFVVGHDWGA  108



>emb|CDO98838.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   192 bits (487),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 86/108 (80%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI HK V VNG+++HIAELG+GPLVLF+HGFPELW+SWRHQILFLAAHGYRAVAPDLR
Sbjct  1    MDKIEHKNVNVNGLSIHIAELGQGPLVLFIHGFPELWYSWRHQILFLAAHGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +DSS+FT  H+VGDL+ LL +IAP+E+KVFVVGHDWGA
Sbjct  61   GYGDTTGAPVNDSSEFTCLHVVGDLVALLHAIAPDEEKVFVVGHDWGA  108



>ref|XP_009598691.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=255

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNG+ MH+AELG+GP++LF+HGFPELW+SWRHQI +LA  GYRAVAPDLR
Sbjct  1    MEKIEHKMVDVNGLQMHVAELGQGPIILFIHGFPELWYSWRHQIFYLAERGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +D +KF++FH+VGDLI L+++IAP EDKVFVVGHDWGA
Sbjct  61   GYGDTTGAPINDHTKFSIFHLVGDLIALIEAIAPNEDKVFVVGHDWGA  108



>ref|XP_009775927.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009775928.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Nicotiana 
sylvestris]
Length=321

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 83/108 (77%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNG+ MH+AELG+GP +LFLHGFPELW+SWRHQIL+LA  GYRAVAPDLR
Sbjct  1    MEKIEHKMVAVNGLQMHVAELGQGPTILFLHGFPELWYSWRHQILYLAERGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +D +KF++FH+VGDLI L+++IAP EDKVFVVGHDWGA
Sbjct  61   GYGDTTGAPINDHTKFSIFHLVGDLIALIEAIAPNEDKVFVVGHDWGA  108



>ref|NP_001275381.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81890.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   187 bits (474),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNG+NMHIAELG+GP +LF+HGFPELW+SWRHQ+++LA  GYRAVAPDLR
Sbjct  1    MEKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +D SKF++FH+VGD++ LL++IAP EDKVFVV HDWGA
Sbjct  61   GYGDTTGAPINDPSKFSIFHLVGDVVALLEAIAPNEDKVFVVAHDWGA  108



>ref|XP_004239805.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=321

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNG+NMHIAELG+GP +LF+HGFPELW+SWRHQ+++LA  GY AVAPDLR
Sbjct  1    MEKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYCAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +D SKFT+FH+VGDL+ LL++IAP EDKVFVV HDWGA
Sbjct  61   GYGDTTGAPLNDPSKFTIFHLVGDLVALLEAIAPNEDKVFVVAHDWGA  108



>ref|XP_011090999.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=317

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/108 (79%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I HK + VNGI MH+AELG+GPLVLF+HGFPELW+SWRHQ++FLAAHGYRAVAPD+R
Sbjct  1    MENIEHKIIPVNGIKMHVAELGKGPLVLFVHGFPELWYSWRHQMVFLAAHGYRAVAPDMR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYG+TTGAP DD SKFTV H+VGDLI LL +IAP E+KVFVVGHDWGA
Sbjct  61   GYGETTGAPLDDPSKFTVLHLVGDLILLLDAIAPGEEKVFVVGHDWGA  108



>ref|XP_009598630.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=321

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNG+ MH+AELG+GP++LF+HGFPELW+SWRHQI +LA  GYRAVAPDLR
Sbjct  1    MEKIEHKMVDVNGLQMHVAELGQGPIILFIHGFPELWYSWRHQIFYLAERGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +D +KF++FH+VGDLI L+++IAP EDKVFVVGHDWGA
Sbjct  61   GYGDTTGAPINDHTKFSIFHLVGDLIALIEAIAPNEDKVFVVGHDWGA  108



>ref|XP_006342825.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=334

 Score =   186 bits (471),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 93/106 (88%), Gaps = 0/106 (0%)
 Frame = -2

Query  318  KITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGY  139
            ++ HKTV VNGINMH  E+GEGP+VLF+HGFPE W+SWRHQ+ F+A  GYRAVAPDLRGY
Sbjct  4    QVEHKTVAVNGINMHFVEIGEGPIVLFIHGFPECWYSWRHQMSFMAKQGYRAVAPDLRGY  63

Query  138  GDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GDTTGAPNDD SKFT   IVGDL+ELL +IAP+E+KVFVVGHDWGA
Sbjct  64   GDTTGAPNDDPSKFTTLDIVGDLVELLNNIAPQEEKVFVVGHDWGA  109



>ref|XP_010321810.1| PREDICTED: bifunctional epoxide hydrolase 2-like, partial [Solanum 
lycopersicum]
Length=193

 Score =   181 bits (458),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEK+ HKT+ VNGINMHIAE+G+GP+VLFLHGFPELW+SWRHQ+ F+AAHGYR VAPDLR
Sbjct  1    MEKVEHKTMRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRHQMQFMAAHGYRVVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDTTGAP  D +KFT  H+VGDL+ELL  IAP+  KVF+VGHDWGA
Sbjct  61   GFGDTTGAPKGDFTKFTTLHVVGDLVELLNIIAPDR-KVFLVGHDWGA  107



>ref|XP_004229259.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=335

 Score =   184 bits (468),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 94/107 (88%), Gaps = 0/107 (0%)
 Frame = -2

Query  321  EKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRG  142
            +++ HKTV VNGINMH  E+G+GPLVLF+HGFPE W+SWRHQ+ F+A  GYRAVAPDLRG
Sbjct  3    DQVEHKTVAVNGINMHFVEIGQGPLVLFIHGFPECWYSWRHQMSFMAKQGYRAVAPDLRG  62

Query  141  YGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            YGDTTGAPNDD +KFT   IVGDL+ELL +IAP+E+KVFVVGHDWGA
Sbjct  63   YGDTTGAPNDDPNKFTTLDIVGDLVELLNNIAPQEEKVFVVGHDWGA  109



>ref|XP_009757467.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=340

 Score =   184 bits (468),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -2

Query  330  REMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPD  151
             E+E+I HKT+ VNG+NMHIAE+G+GP+VLFLHGFPELW+SWRHQ+ F+AAHGYRAVA D
Sbjct  2    EEVEEIQHKTLRVNGLNMHIAEMGQGPIVLFLHGFPELWYSWRHQMPFVAAHGYRAVALD  61

Query  150  LRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            LRG+GDTTGAP DD +KFT  H+VGD++ELL  IAP+++KVFVVGHDWGA
Sbjct  62   LRGFGDTTGAPEDDFTKFTTLHVVGDIVELLNIIAPDQEKVFVVGHDWGA  111



>gb|EYU43973.1| hypothetical protein MIMGU_mgv1a010247mg [Erythranthe guttata]
Length=318

 Score =   184 bits (466),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 99/109 (91%), Gaps = 1/109 (1%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H+T+ VNGI+MH+AELGEGPLVLFLHGFPELW+SWRHQ++F+AA GYRAVAPD+R
Sbjct  1    MEEIQHRTIPVNGISMHVAELGEGPLVLFLHGFPELWYSWRHQMVFVAARGYRAVAPDMR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPE-EDKVFVVGHDWGA  1
            GYGDTTGAP DD SKFT+ H+VGDLI LL +++P+  DKVFVVGHDWGA
Sbjct  61   GYGDTTGAPLDDPSKFTLLHLVGDLISLLDAVSPDGADKVFVVGHDWGA  109



>emb|CDO98837.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   184 bits (467),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNGINMH+AE+G+GP+VLFLHGFPE W++WRHQ+ F+A+HG+RAVAPDLR
Sbjct  1    MEKIEHKNVEVNGINMHVAEIGQGPVVLFLHGFPECWYTWRHQMSFMASHGHRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+G TTGAP DD SKFT  H+VGD+IELL+ +AP+EDKVF+VGHDWGA
Sbjct  61   GFGGTTGAPIDDPSKFTTLHVVGDIIELLKIVAPDEDKVFLVGHDWGA  108



>ref|XP_009757465.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=331

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME + HKTV VNGINMH AE+G+GPLVLF+HGFPELW+S+RHQ+ F+A HGYRAVAPDLR
Sbjct  1    MEGVEHKTVSVNGINMHYAEIGQGPLVLFIHGFPELWYSFRHQMSFMANHGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTG P DD S FT   IVGDL+ELL SIAP+E+KVFV+GHDWGA
Sbjct  61   GYGDTTGVPKDDPSNFTTLSIVGDLVELLNSIAPQEEKVFVIGHDWGA  108



>emb|CAJ19276.1| putative epoxide hydrolase [Solanum commersonii]
Length=321

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNG+NMHIAELG+GP +LF+HGFPELW+SWRHQ+++LA  GYR VAPDLR
Sbjct  1    MEKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRTVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +D SKF++FHIVGD++ LL++IAP E KVFVV HDWGA
Sbjct  61   GYGDTTGAPINDPSKFSIFHIVGDVVALLEAIAPNEGKVFVVAHDWGA  108



>gb|EYU21013.1| hypothetical protein MIMGU_mgv1a010239mg [Erythranthe guttata]
Length=318

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 98/109 (90%), Gaps = 1/109 (1%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H+T+ VNGI+MH+AELGEGPLVLFLHGFPELW+SWRHQ++F+AA GYRAVAPD+R
Sbjct  1    MEEIQHRTIPVNGISMHVAELGEGPLVLFLHGFPELWYSWRHQMVFVAARGYRAVAPDMR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPE-EDKVFVVGHDWGA  1
            GYGDTTGAP DD SKFT+ H+VGDLI LL +++P   DKVFVVGHDWGA
Sbjct  61   GYGDTTGAPLDDPSKFTLLHLVGDLISLLDAVSPNGADKVFVVGHDWGA  109



>ref|NP_001275417.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81892.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNG+NMH+AELGEGP +LF+HGFPELW+SWRHQ+++LA  GYRAVAPDLR
Sbjct  1    MEKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +D SKF++ H+VGD++ LL++IAP E+KVFVV HDWGA
Sbjct  61   GYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGA  108



>ref|XP_004239808.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=321

 Score =   182 bits (462),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 80/108 (74%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNG+NMHIAELG+G  +LF+HGFPELW+SWRHQ+++LA  GYRAVAPDLR
Sbjct  1    MEKIEHKMVNVNGLNMHIAELGQGSTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +D SKF++FH+VGDL+ LL++IAP E+KVFVV HDWGA
Sbjct  61   GYGDTTGAPLNDPSKFSIFHLVGDLVALLEAIAPNEEKVFVVAHDWGA  108



>ref|XP_004239806.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=321

 Score =   181 bits (460),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 97/108 (90%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI HK V VNG+NMHIAELG+GP +LF+HGFPELW+SWRHQ+++LA  GYRAVAPDLR
Sbjct  1    MDKIEHKMVAVNGLNMHIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +D SKF++FH+VGD++ LL++I+P E+KVFVV HDWGA
Sbjct  61   GYGDTTGAPLNDPSKFSIFHLVGDVVALLEAISPNEEKVFVVAHDWGA  108



>ref|XP_009622179.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=325

 Score =   182 bits (461),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -2

Query  330  REMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPD  151
             EM++I HK + VNGINMHIAE+G+GP+VLFLHGFPELW+SWR+Q+ F+A HGYRAVAPD
Sbjct  2    EEMKEIQHKLLRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRYQMPFMAGHGYRAVAPD  61

Query  150  LRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            LRG+GDTTGA NDD +KFT  H+VGD++ELL  I+P+++KVFVVGHDWGA
Sbjct  62   LRGFGDTTGALNDDFTKFTTLHVVGDIVELLNIISPDQEKVFVVGHDWGA  111



>ref|XP_006349824.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Solanum 
tuberosum]
Length=323

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 89/103 (86%), Gaps = 0/103 (0%)
 Frame = -2

Query  309  HKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGYGDT  130
            HK V VNGINMH+ E G+GP VLF+HGFPELW+SWRHQI+F+A HGYRAVAPDLRGYGDT
Sbjct  8    HKIVEVNGINMHVVEKGQGPFVLFIHGFPELWYSWRHQIIFMAKHGYRAVAPDLRGYGDT  67

Query  129  TGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            TG P DD SKF+   +VGDL+ELL +I PEEDKVFVVGHDWGA
Sbjct  68   TGVPKDDPSKFSSLRVVGDLVELLNTIVPEEDKVFVVGHDWGA  110



>gb|EPS69728.1| epoxide hydrolase [Genlisea aurea]
Length=318

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M++I H+TV  NG+ MH+AELGEGP VLF+HGFPELW+SWRHQ+ FLAA GYRAVAPDLR
Sbjct  1    MDEIRHRTVAANGLQMHVAELGEGPTVLFVHGFPELWYSWRHQMSFLAARGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDTTGAP  D+SKFTV H+VGDLI LL +IAP+E KVFVVGHDWGA
Sbjct  61   GFGDTTGAPIGDASKFTVVHLVGDLIALLDAIAPDEGKVFVVGHDWGA  108



>pdb|2CJP|A Chain A, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase 
I (Steh1)
 pdb|2CJP|B Chain B, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase 
I (Steh1)
Length=328

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI HK V VNG+NMH+AELGEGP +LF+HGFPELW+SWRHQ+++LA  GYRAVAPDLR
Sbjct  8    MKKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  67

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +D SKF++ H+VGD++ LL++IAP E+KVFVV HDWGA
Sbjct  68   GYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGA  115



>pdb|3CXU|A Chain A, Structure Of A Y149f Mutant Of Epoxide Hydrolase From 
Solanum Tuberosum
 pdb|3CXU|B Chain B, Structure Of A Y149f Mutant Of Epoxide Hydrolase From 
Solanum Tuberosum
Length=328

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI HK V VNG+NMH+AELGEGP +LF+HGFPELW+SWRHQ+++LA  GYRAVAPDLR
Sbjct  8    MKKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLR  67

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +D SKF++ H+VGD++ LL++IAP E+KVFVV HDWGA
Sbjct  68   GYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGA  115



>ref|XP_006342824.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=325

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEK+ HKT+ VNGINMHIAE+G+GP+VLFLHGFPELW+SWRHQ+ F+AAHGYR VAPDLR
Sbjct  1    MEKVEHKTMRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRHQMPFMAAHGYRVVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDTTGAP  D +KFT  H+VGDL+ELL  IAP++ KVF+VGHDWGA
Sbjct  61   GFGDTTGAPKGDFTKFTTLHVVGDLVELLNIIAPDQ-KVFLVGHDWGA  107



>ref|NP_001274962.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81889.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNG+NMHIAELG+GP +LFLHGFPELW+SWRHQ+++LA  GYRAVAPDLR
Sbjct  1    MEKIEHKMVAVNGLNMHIAELGQGPTILFLHGFPELWYSWRHQMVYLAECGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGA  +D SKF++ H+VGD++ LL++IAP E+KVFVV HDWGA
Sbjct  61   GYGDTTGASLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGA  108



>ref|XP_004229258.2| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=325

 Score =   179 bits (454),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 95/108 (88%), Gaps = 1/108 (1%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEK+ HKT+ VNGINMHIAE+G+GP+VLFLHGFPELW+SWRHQ+LF+AAHGY  VAPDLR
Sbjct  1    MEKVEHKTMRVNGINMHIAEMGQGPIVLFLHGFPELWYSWRHQMLFMAAHGYHVVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDTTGAP  D +KFT  H+VGDL+ELL  IAP+  KVF+VGHDWGA
Sbjct  61   GFGDTTGAPKGDFTKFTTLHVVGDLVELLNIIAPDR-KVFLVGHDWGA  107



>ref|NP_001274907.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81891.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 94/108 (87%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNG+NMHIAELG+GP +LFLHGFPELW+SWRHQ+++LA  GYRAVAP LR
Sbjct  1    MEKIEHKMVAVNGLNMHIAELGQGPTILFLHGFPELWYSWRHQMVYLAERGYRAVAPVLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +D SKF++  +VGD++ LL++IAP E+KVFVV HDWGA
Sbjct  61   GYGDTTGAPLNDPSKFSILQLVGDVVALLEAIAPNEEKVFVVAHDWGA  108



>ref|XP_009622181.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=333

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 93/110 (85%), Gaps = 2/110 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME + HKTV VNGINMH AE+G+GPLVL +HGFPE W+SWRHQ+ F+A HGYRAVAPDLR
Sbjct  1    MEGVEHKTVSVNGINMHYAEIGKGPLVLLIHGFPECWYSWRHQMSFMANHGYRAVAPDLR  60

Query  144  GYGDT-TGAPN-DDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT TG PN DD S FT   IVGDL+ELL SIAP+E+KVFVVGHDWGA
Sbjct  61   GYGDTATGVPNKDDPSNFTTLSIVGDLVELLNSIAPQEEKVFVVGHDWGA  110



>emb|CDP15824.1| unnamed protein product [Coffea canephora]
Length=308

 Score =   176 bits (446),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 78/108 (72%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+K   +++ VN INMHIAEL  GPLVLFLHGFP LW+SWRHQILF+A  GYRAVAPDLR
Sbjct  1    MDKTDSESIRVNSINMHIAELVAGPLVLFLHGFPGLWYSWRHQILFMATRGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDTTGAP +DSSKF+  H+VGDLI +LQ+I P++++VFVVGHDWGA
Sbjct  61   GYGDTTGAPVNDSSKFSTIHVVGDLIAVLQAIGPDKEQVFVVGHDWGA  108



>ref|XP_004252913.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=323

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = -2

Query  309  HKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGYGDT  130
            HK V VNGINMH+ E G GP VLF+HGFPELW+SWRHQI+F+A HGYRA+APDLRGYGDT
Sbjct  8    HKIVEVNGINMHVVEKGHGPFVLFIHGFPELWYSWRHQIIFMAKHGYRAMAPDLRGYGDT  67

Query  129  TGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            TG P DD SKF+   +VGDL+ELL +I  EEDKVFVVGHDWGA
Sbjct  68   TGVPKDDPSKFSSLRVVGDLVELLNTIVSEEDKVFVVGHDWGA  110



>ref|XP_009788447.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=323

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -2

Query  309  HKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGYGDT  130
            HKTV VNGINMH+ E G+GP++LF+HGFPELW+SWRHQI F + HGYRAVAPDLRG+GDT
Sbjct  7    HKTVVVNGINMHVVEAGQGPVILFIHGFPELWYSWRHQISFASKHGYRAVAPDLRGFGDT  66

Query  129  TGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            T    DD SKFT   +VGDL+ELL +IAP+E+KVFVVGHDWGA
Sbjct  67   TEVSKDDPSKFTSLQVVGDLVELLNTIAPKEEKVFVVGHDWGA  109



>ref|XP_009622776.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=323

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = -2

Query  309  HKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGYGDT  130
            HK V VNGINMH+ E G+GP++LF+HGFPELW+SWRHQI F+A HGYRAVAPDLRG+GDT
Sbjct  7    HKIVPVNGINMHVVEAGQGPVILFIHGFPELWYSWRHQISFVAKHGYRAVAPDLRGFGDT  66

Query  129  TGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            TG    D SKFT   +VGDL+ELL +IAP+E+KVFVVGHDWGA
Sbjct  67   TGVLKHDPSKFTSLQVVGDLVELLNTIAPKEEKVFVVGHDWGA  109



>ref|XP_006419519.1| hypothetical protein CICLE_v10006037mg [Citrus clementina]
 gb|ESR32759.1| hypothetical protein CICLE_v10006037mg [Citrus clementina]
Length=174

 Score =   162 bits (410),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V VNGINMHIAE G+GP++LFLHGFPELW+SWRHQI  LA+ GYRAVAPDLR
Sbjct  1    MEGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P  D + +T FH++GDL+ L+ ++AP ++KVFVVGHDWGA
Sbjct  61   GFGDTDAPP--DVTSYTCFHVIGDLVGLIDTVAPNDEKVFVVGHDWGA  106



>gb|KDO38863.1| hypothetical protein CISIN_1g044507mg, partial [Citrus sinensis]
Length=157

 Score =   161 bits (408),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V VNGINMHIAE G+GP++LFLHGFPELW+SWRHQI  LA+ GYRAVAPDLR
Sbjct  1    MEGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P  D + +T FH++GDL+ L+ ++AP ++KVFVVGHDWGA
Sbjct  61   GFGDTDAPP--DVTSYTCFHVIGDLVGLIDTVAPNDEKVFVVGHDWGA  106



>ref|XP_008223222.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Prunus mume]
Length=323

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            EME + H+TV VNGINMHIAE G+GPL+LFLHGFPELW+SWRHQI  LA+ GYRAVAPDL
Sbjct  3    EMEGVEHRTVQVNGINMHIAEKGQGPLILFLHGFPELWYSWRHQITALASLGYRAVAPDL  62

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RG+GDT  AP D  + +T  H++GDL+ LL +IAP++DKVFVVGHDWGA
Sbjct  63   RGFGDTD-AP-DSPTSYTCLHVIGDLVALLDAIAPDQDKVFVVGHDWGA  109



>ref|XP_009350799.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=171

 Score =   161 bits (408),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            E + I H+TV VNGINMH+AE G GPL+LFLHGFPELW+SWRHQIL L+A GYRAVAPDL
Sbjct  2    ESQGIEHRTVQVNGINMHVAEKGNGPLILFLHGFPELWYSWRHQILSLSALGYRAVAPDL  61

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +T  H+VGDL+ LL +IAP+++KVFVV HDWGA
Sbjct  62   RGYGDTD-APASPSS-YTCLHMVGDLVALLDAIAPDQEKVFVVAHDWGA  108



>ref|XP_007222693.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica]
 gb|EMJ23892.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica]
Length=323

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 92/109 (84%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            EM+ I H+TV VNGINMHIAE G+GPL+LF+HGFPELW+SWRHQI  LA+ GYRAVAPDL
Sbjct  3    EMDGIEHRTVQVNGINMHIAEKGQGPLILFIHGFPELWYSWRHQITALASLGYRAVAPDL  62

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RG+GDT  AP D  + +T  H++GDL+ LL +IAP++DKVFVVGHDWGA
Sbjct  63   RGFGDTD-AP-DSPTSYTCLHVIGDLVALLDAIAPDQDKVFVVGHDWGA  109



>ref|XP_006419521.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
 gb|ESR32761.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
Length=243

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V VNGINMHIAE G+GP++LFLHGFPELW+SWRHQI  LA  GYRAVAPDLR
Sbjct  1    MEGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALACLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P  D + +T FH++GDL+ L+ ++AP ++KVFVVGHDWGA
Sbjct  61   GFGDTDAPP--DVTSYTCFHVIGDLVGLIDTVAPNDEKVFVVGHDWGA  106



>ref|XP_007221833.1| hypothetical protein PRUPE_ppa020197mg [Prunus persica]
 gb|EMJ23032.1| hypothetical protein PRUPE_ppa020197mg [Prunus persica]
Length=320

 Score =   163 bits (412),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 90/108 (83%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGINMHIAE G+GPL+LF+HGFPELW+SW HQI  LA+ GYRAVAPDLR
Sbjct  1    MEGIEHRTVQVNGINMHIAEKGQGPLILFVHGFPELWYSWSHQITALASFGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT  AP D  + +T  H+VGDLI LL +IAP++DKVFVVGHDWGA
Sbjct  61   GFGDTD-AP-DSPTSYTCLHVVGDLIALLDAIAPDQDKVFVVGHDWGA  106



>ref|XP_007222764.1| hypothetical protein PRUPE_ppa008756mg [Prunus persica]
 gb|EMJ23963.1| hypothetical protein PRUPE_ppa008756mg [Prunus persica]
Length=320

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 90/108 (83%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+ I H+TV VNGINMHIAE G+GPL+LF+HGFPELW+SWRHQI  LA+ GYRAVAPDLR
Sbjct  1    MDGIEHRTVQVNGINMHIAEKGQGPLILFIHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT  AP D  + +T  H+VGDLI LL +IAP+ DKVFVVGHDWGA
Sbjct  61   GFGDTD-AP-DSPTSYTCLHVVGDLIALLDTIAPDHDKVFVVGHDWGA  106



>ref|XP_010911257.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=317

 Score =   162 bits (411),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 92/108 (85%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME ITH+TV VNGINMHIAE GEGP+VLF+HGFPELW+SWRHQ++ LAA GYRAVAPDLR
Sbjct  1    MEGITHRTVAVNGINMHIAEKGEGPMVLFIHGFPELWYSWRHQMVALAARGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+  ++ +T+FH+VGDL+ LL ++A  +D+VF VGHDWGA
Sbjct  61   GYGDTDAPPS--TTDYTIFHLVGDLVALLDALA--QDQVFAVGHDWGA  104



>ref|XP_007035641.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY06567.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=396

 Score =   164 bits (415),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 96/120 (80%), Gaps = 5/120 (4%)
 Frame = -2

Query  351  TKPGRSRR---EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLA  181
            ++PG  R    EME+I H+ V VNGINMH+AE G+GP++LFLHGFPELW+SWRHQI   A
Sbjct  62   SRPGYPREGNVEMEEIEHRIVNVNGINMHVAEKGKGPVILFLHGFPELWYSWRHQITAFA  121

Query  180  AHGYRAVAPDLRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            + GY+AVAPDL GYGDT  AP D +S +TV ++VGDL+ LL  +APE+DKVFVVGHDWGA
Sbjct  122  SLGYQAVAPDLCGYGDTD-AP-DAASSYTVLNVVGDLVALLDVVAPEQDKVFVVGHDWGA  179



>gb|AAA81893.1| epoxide hydrolase, partial [Solanum tuberosum]
Length=305

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 84/92 (91%), Gaps = 0/92 (0%)
 Frame = -2

Query  276  HIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGYGDTTGAPNDDSSKF  97
            HIAELG+GP +LF+HGFPELW+SWRHQ+++LA  GYRAVAPDLRGYGDTTGAP +D SKF
Sbjct  1    HIAELGQGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPINDPSKF  60

Query  96   TVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            ++FH+VGD++ LL++IAP EDKVFVV HDWGA
Sbjct  61   SIFHLVGDVVALLEAIAPNEDKVFVVAHDWGA  92



>emb|CAZ86692.1| epoxide hydrolase 1 [Prunus persica]
Length=323

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            EME I H+TV VNGINMHIAE G+G L+LF+HGFPELW+SWRHQI  LA+ GYRAVAPDL
Sbjct  3    EMEGIEHRTVQVNGINMHIAEKGQGLLILFIHGFPELWYSWRHQITALASLGYRAVAPDL  62

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RG+GDT  AP D  + +T  H+VGDLI LL +IAP+ DKVFVVGHDWGA
Sbjct  63   RGFGDTD-AP-DSPTSYTCLHVVGDLIALLDTIAPDHDKVFVVGHDWGA  109



>ref|XP_011091000.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=327

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 87/109 (80%), Gaps = 1/109 (1%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M  + HKT+ +NGI+MH+AE+G GP++LFLHGFP+ W++WRHQI F A HGYRA+APDLR
Sbjct  1    MVGVEHKTLSLNGISMHVAEMGHGPIILFLHGFPQCWYTWRHQITFFATHGYRALAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEED-KVFVVGHDWGA  1
            GY DTTG P  D +KFT  H+VGD++ L+ ++AP  D KV VVGHDWGA
Sbjct  61   GYADTTGVPPSDPAKFTTLHVVGDIVALIDALAPPNDQKVLVVGHDWGA  109



>ref|XP_006419522.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
 gb|ESR32762.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
Length=324

 Score =   161 bits (408),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V VNGINMHIAE G+GP++LFLHGFPELW+SWRHQI  LA  GYRAVAPDLR
Sbjct  1    MEGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALACLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P  D + +T FH++GDL+ L+ ++AP ++KVFVVGHDWGA
Sbjct  61   GFGDTDAPP--DVTSYTCFHVIGDLVGLIDTVAPNDEKVFVVGHDWGA  106



>ref|XP_006489041.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=319

 Score =   161 bits (407),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V VNGINMHIAE G+GP++LFLHGFPELW+SWRHQI  LA+ GYRAVAPDLR
Sbjct  1    MEGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P  D + +T FH++GDL+ L+ ++AP ++KVFVVGHDWGA
Sbjct  61   GFGDTDAPP--DVTSYTCFHVIGDLVGLIDTVAPNDEKVFVVGHDWGA  106



>gb|KDO38861.1| hypothetical protein CISIN_1g026419mg [Citrus sinensis]
Length=238

 Score =   159 bits (401),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+ I H+ V VNGINMHIAE G+GP++LFLHGFPELW+SWRHQI  LA+ GYRAVAPDLR
Sbjct  1    MDGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P  + + +T FH++GDL+ L+ ++AP ++KVFVVGHDWGA
Sbjct  61   GFGDTDARP--EVTSYTCFHVIGDLVGLIDTVAPSDEKVFVVGHDWGA  106



>ref|XP_009350800.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=322

 Score =   160 bits (406),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            E + I H+TV VNGINMH+AE G GPL+LFLHGFPELW+SWRHQIL L+A GYRAVAPDL
Sbjct  2    ESQGIEHRTVQVNGINMHVAEKGNGPLILFLHGFPELWYSWRHQILALSALGYRAVAPDL  61

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +T  H+VGDL+ LL +IAP+++KVFVV HDWGA
Sbjct  62   RGYGDTD-APASPSS-YTCLHMVGDLVALLDAIAPDQEKVFVVAHDWGA  108



>ref|XP_004296863.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 90/108 (83%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGINMH+AE G+GP++LF+HGFPELW+ WRHQI  LAA GYRAVAPDLR
Sbjct  1    MEGIEHRTVKVNGINMHVAEKGQGPVILFIHGFPELWYCWRHQIQALAAVGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP D SS +T  H+VGDL+ LL ++A +++KVFVVGHDWGA
Sbjct  61   GYGDTD-APADQSS-YTCLHVVGDLVALLDAVAADQEKVFVVGHDWGA  106



>gb|KEH32298.1| epoxide hydrolase [Medicago truncatula]
Length=355

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 93/117 (79%), Gaps = 2/117 (2%)
 Frame = -2

Query  351  TKPGRSRREMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHG  172
            +K      E+E I H+TV VNGINMHIAE G+GPL+LF+HGFP+LW+SWRHQI +LA HG
Sbjct  28   SKDSHREMELEGIEHRTVTVNGINMHIAEKGQGPLILFIHGFPDLWYSWRHQITYLACHG  87

Query  171  YRAVAPDLRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            YR VAPDLRGYGDT   P+  +S +T  H+VGD+I LL +IA +++KVFVVGHDWGA
Sbjct  88   YRCVAPDLRGYGDTD-IPSSPTS-YTSLHVVGDIIGLLDAIAGDQEKVFVVGHDWGA  142



>ref|XP_008340934.1| PREDICTED: bifunctional epoxide hydrolase 2 [Malus domestica]
Length=204

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            E + I H+TV VNGINMH+AE G GPL+LF+HGFPELW+SWRHQIL L+A GYRAVAPDL
Sbjct  2    ESQGIEHRTVQVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILXLSALGYRAVAPDL  61

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +   ++VGDL+ LL +IAP++++VFVV HDWGA
Sbjct  62   RGYGDTD-APASPSS-YNCLYMVGDLVALLDAIAPDQEQVFVVAHDWGA  108



>ref|XP_007015353.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32972.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=320

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 92/108 (85%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME + H+T+ VNGINMHIAE G+GP++LFLHGFPELW+SWRHQI  L++ GYRAVAPDLR
Sbjct  1    MEGVEHRTLKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQINALSSLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT  AP D  S +T FH+VGDL++LL ++AP ++KVFVVGHDWGA
Sbjct  61   GFGDTD-AP-DRVSSYTCFHVVGDLVQLLDAVAPPQEKVFVVGHDWGA  106



>ref|XP_009386486.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 92/108 (85%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I+H+T+ VNG+N+H+AE+GEGP+VL LHGFPELWFSWRHQI+ LAA GYRAVAPDLR
Sbjct  1    MEGISHRTLLVNGVNIHVAEMGEGPVVLLLHGFPELWFSWRHQIVSLAARGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GD+   P+  SS +T FH+VGDL+ L+Q++ P  D+VFVVGHDWGA
Sbjct  61   GFGDSDAPPS--SSVYTAFHVVGDLVALIQALGP--DQVFVVGHDWGA  104



>ref|XP_008353224.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=160

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 87/109 (80%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            E + I H+TV VNGINMH+AE G GPL+LF+HGFPELW+SWRHQIL L+A GYRAVAPDL
Sbjct  2    ESQGIEHRTVXVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSALGYRAVAPDL  61

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +     VGDL+ LL +IAP++++VFVV HDWGA
Sbjct  62   RGYGDTD-APASPSS-YNCLXXVGDLVALLDAIAPDQEQVFVVAHDWGA  108



>ref|XP_006419517.1| hypothetical protein CICLE_v10005451mg [Citrus clementina]
 gb|ESR32757.1| hypothetical protein CICLE_v10005451mg [Citrus clementina]
Length=319

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+ I H+ V VNGINMHIAE G+GP++LFLHGFPELW+SWRHQI  LA+ GYRAVAPDLR
Sbjct  1    MDGIQHRIVKVNGINMHIAEKGQGPVILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P  + + +T FH++GDL+ L+ ++AP ++KVFVVGHDWGA
Sbjct  61   GFGDTDAPP--EVTSYTCFHVIGDLVGLIDTVAPSDEKVFVVGHDWGA  106



>gb|KHG02721.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=275

 Score =   157 bits (398),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 90/110 (82%), Gaps = 4/110 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I HKTV VNGINMHIAE GEGPL+LFLHGFPELW+SWR+QI  LAA GYRA+APDLR
Sbjct  1    MEGIQHKTVSVNGINMHIAEKGEGPLILFLHGFPELWYSWRNQINGLAALGYRALAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPE--EDKVFVVGHDWGA  1
            GYG T  AP D  + +T  H+VGDLI LL ++AP+  EDKVFVVGHDWGA
Sbjct  61   GYGGTD-AP-DSVADYTCCHLVGDLIALLDTVAPQEKEDKVFVVGHDWGA  108



>ref|XP_010269590.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nelumbo nucifera]
Length=318

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V VNGINMHIAE GEGP+VLF+HGFPELW+SWRHQI+ LAA GYRAVAPDLR
Sbjct  1    MEGIEHRMVSVNGINMHIAEKGEGPVVLFIHGFPELWYSWRHQIVALAARGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+  S  ++VFHIVGDLI LL  +   +D+VFVVGHDWGA
Sbjct  61   GYGDTDAPPSITS--YSVFHIVGDLIALLNILG--QDQVFVVGHDWGA  104



>ref|XP_009629123.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=318

 Score =   158 bits (399),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 89/108 (82%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V +NGINMH+AE+GEGP V+F+HGFPELW+SWRHQ+L+L+  GYRA+APDLR
Sbjct  1    MEKIQHKNVSINGINMHVAEIGEGPAVVFVHGFPELWYSWRHQMLYLSNKGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P  D++ +TVFHIVGDL+ LL  +    D+V++VGHDWGA
Sbjct  61   GYGDTDSPP--DATNYTVFHIVGDLVALLDVLG--LDQVYLVGHDWGA  104



>gb|KDP27828.1| hypothetical protein JCGZ_18908 [Jatropha curcas]
Length=321

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 4/110 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG--EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPD  151
            ME I HKTV VNGINMH+AELG  +GP++LF+HGFPELW+ WR +IL LA+ GYRAVAPD
Sbjct  1    MEAIEHKTVNVNGINMHVAELGPVQGPVILFIHGFPELWYCWRREILALASQGYRAVAPD  60

Query  150  LRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            LRGYGDT  AP D  S +  FHIVGDLI LL ++AP+++KVF VGHDWGA
Sbjct  61   LRGYGDTD-APADPQS-YPCFHIVGDLIGLLDAVAPQQEKVFGVGHDWGA  108



>ref|XP_007015342.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32961.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=320

 Score =   157 bits (397),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/108 (70%), Positives = 91/108 (84%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I HKTV VNGINMH+AE GEGP++LFLHGFPELW+SWRHQI  LA+ GYRA+APDLR
Sbjct  1    MEGIQHKTVRVNGINMHLAEKGEGPVILFLHGFPELWYSWRHQINGLASLGYRALAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYG+T  AP   +S +T  H+VGDLI LL ++AP+++KVFVVGHDWGA
Sbjct  61   GYGETD-APASIAS-YTCLHVVGDLIALLDAVAPDQEKVFVVGHDWGA  106



>gb|KHG22415.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=317

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V VNG N+HIAE GEGP++LFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MEGIEHRMVKVNGTNIHIAEKGEGPVILFLHGFPELWYSWRHQILALSSMGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+    + DS  +T FHI+GDL+EL+  + P+E KVFVVGHDWGA
Sbjct  61   GYGDSDVPDSVDS--YTCFHIIGDLVELINVVDPDEGKVFVVGHDWGA  106



>ref|XP_008340789.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   157 bits (396),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            E + I H+TV VNGINMH+AE G GPL+LF+HGFPELW+SWRHQIL L+A GYRAVAPDL
Sbjct  2    ESQGIEHRTVPVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSALGYRAVAPDL  61

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +   H+VGDL+ LL +IAP++++VFVV HDWGA
Sbjct  62   RGYGDTD-APASPSS-YNCLHVVGDLVALLDAIAPDQEQVFVVAHDWGA  108



>ref|XP_009775353.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional epoxide hydrolase 
2-like [Nicotiana sylvestris]
Length=318

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNGINMH+AE+GEGP V+F+HGFPELW+SWRHQ+L+L+  GYRA+APDLR
Sbjct  1    MEKIQHKYVSVNGINMHVAEIGEGPAVVFVHGFPELWYSWRHQMLYLSKKGYRAMAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P  D++ +T FHIVGDL+ LL  +    D+VF+VGHDWGA
Sbjct  61   GYGDTDSPP--DATHYTAFHIVGDLVALLDVLG--LDQVFLVGHDWGA  104



>ref|XP_009352305.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=322

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            E E I H+TV VNGINMH+AE G GPL+LF+HGFP+LW+SWRHQIL L+A GYR VAPDL
Sbjct  2    ESEGIEHRTVQVNGINMHVAEKGHGPLILFIHGFPDLWYSWRHQILALSALGYRTVAPDL  61

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +T  H+VGDL+ LL +IAP++++VFVV HDWG+
Sbjct  62   RGYGDTD-APASPSS-YTCLHVVGDLVALLDTIAPDQEQVFVVAHDWGS  108



>ref|XP_008784769.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=322

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 89/108 (82%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M +I+H+ V VNGINMHIAE GEGP+VL LHGFPELW+SWRHQIL LAA GYRA+APDLR
Sbjct  6    MAEISHRLVEVNGINMHIAEKGEGPVVLLLHGFPELWYSWRHQILALAARGYRAIAPDLR  65

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P  D S +T+FH+VGDL+ L+ ++   ++KVFVVGHDWGA
Sbjct  66   GFGDTDAPP--DVSSYTMFHVVGDLVALIHTLG--QEKVFVVGHDWGA  109



>ref|XP_011079630.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=316

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I HK + VNGINMH+AE+G+GP VLFLHGFPELW+SWRHQ+L+L+A GYRA+APDLR
Sbjct  1    MERIVHKNLNVNGINMHVAEIGDGPAVLFLHGFPELWYSWRHQMLYLSARGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+   S +T FHIVGDL+ LL ++    D+VF+V HDWGA
Sbjct  61   GYGDTDAPPS--PSSYTTFHIVGDLVALLDALG--LDQVFLVAHDWGA  104



>ref|XP_004290776.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   156 bits (394),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 90/108 (83%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I HKT+ VNGINMH+AE G+GP++LFLHGFPELW+ WRHQ+  LA+ GYRAVAPDLR
Sbjct  1    MEGIEHKTIKVNGINMHVAEKGQGPVILFLHGFPELWYCWRHQMHALASLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT  AP + SS +T  H+VGDLI LL ++A +++KVFVVGHDWGA
Sbjct  61   GFGDTD-APAEASS-YTCLHVVGDLIALLDAVAADQEKVFVVGHDWGA  106



>ref|XP_009391487.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 90/108 (83%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+ITH+TV VNGINMH+AE GEGP+VL +HGFPELW+SWRHQI+ LAAHGY AVAPDLR
Sbjct  1    MEEITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYSWRHQIVALAAHGYHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P    + +T+FH+VGD++ L++++    D+VFVVGHDWGA
Sbjct  61   GFGDTDAPPA--VTSYTMFHVVGDIVGLIEALG--RDQVFVVGHDWGA  104



>gb|KDP27824.1| hypothetical protein JCGZ_18904 [Jatropha curcas]
Length=321

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (83%), Gaps = 4/110 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG--EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPD  151
            M+ I H+ V VNGIN+H+AE G   GP++LF+HGFPELW+SWRHQI+ LA+ GYRAVAPD
Sbjct  1    MDAIEHRFVQVNGINIHVAEAGPVNGPVILFIHGFPELWYSWRHQIVALASLGYRAVAPD  60

Query  150  LRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            +RGYGDT  AP DD   +T FHIVGDLI LL ++AP+++KVFVVGHDWGA
Sbjct  61   MRGYGDTD-AP-DDLQSYTCFHIVGDLIGLLDAVAPQQEKVFVVGHDWGA  108



>emb|CDP17110.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H++V VNGINMH+AE+GEGP VL LHGFPELW+SWRHQ+L+LA+ GYRA+APDLR
Sbjct  1    MENIKHQSVVVNGINMHVAEVGEGPAVLLLHGFPELWYSWRHQMLYLASKGYRALAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+   S +T FH+VGDL+ LL S+    DKVF+VGHDWG+
Sbjct  61   GYGDSDAPPS--PSSYTAFHVVGDLVALLNSLG--LDKVFLVGHDWGS  104



>ref|XP_008371325.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 89/109 (82%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            E + I H+TV VNGINMH+AE G GPL+LF+HGFPELW+SWRHQIL L+A GYRAVAPDL
Sbjct  2    ESQGIEHRTVQVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILTLSALGYRAVAPDL  61

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +   ++VGDL+ LL +IAP++++VFVV HDWGA
Sbjct  62   RGYGDTD-APASPSS-YNCLYMVGDLVALLDAIAPDQEQVFVVAHDWGA  108



>ref|XP_003550367.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Glycine 
max]
Length=319

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+T+ VNGINMHIAE GEGPL+LF+HGFP+LW+SWRHQI  LA+ GYR VAPDLR
Sbjct  1    MEGIEHQTLNVNGINMHIAEKGEGPLILFIHGFPDLWYSWRHQITALASLGYRCVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT    N   + +T  H+VGDL+ LL +I  +E+KVFVVGHDWGA
Sbjct  61   GYGDTDVPAN--PTAYTSLHVVGDLVGLLDAIVGDEEKVFVVGHDWGA  106



>ref|XP_011015180.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Populus 
euphratica]
Length=253

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI H+T+  NGINMHIA +G GP+VLFLHGFPELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MDKIEHQTIATNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT    N  + ++T+FHIVGDL+ L+ S+    DKVF+VGHDWGA
Sbjct  61   GYGDTDAPKN--AREYTIFHIVGDLVGLIDSLG--IDKVFLVGHDWGA  104



>ref|XP_004298141.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=322

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME + H+TV VNGINMH+AE G+G +VL +HGFPELW+SWRHQI  LA+ GYRAVAPDLR
Sbjct  1    MEGVEHRTVRVNGINMHVAEKGQGQVVLLIHGFPELWYSWRHQIQSLASLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT  AP D SS +T FH+VGDLI LL ++A ++ KVFVVGHDWGA
Sbjct  61   GFGDTD-APADASS-YTCFHVVGDLIALLDTVAGDQKKVFVVGHDWGA  106



>ref|XP_006419516.1| hypothetical protein CICLE_v10006950mg, partial [Citrus clementina]
 gb|ESR32756.1| hypothetical protein CICLE_v10006950mg, partial [Citrus clementina]
Length=219

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V VNGINMH+AE G+GP++LFLHGFPELW+SWRHQI  LA+ GYRAVAPDLR
Sbjct  1    MEGIQHRIVKVNGINMHVAEKGQGPVILFLHGFPELWYSWRHQITALASLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P  + + +T FH + DL+ L+  +AP ++K+FVVGHDWGA
Sbjct  61   GFGDTDAPP--EVTSYTCFHGIADLVGLIDIVAPNDEKMFVVGHDWGA  106



>ref|XP_009771842.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=318

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 89/109 (82%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPL-VLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            MEKI HK + VNGINMHIAE+GEGP  +LFLHGFPELW++WRHQ++ L++ GYRA+APDL
Sbjct  1    MEKIQHKNLSVNGINMHIAEIGEGPTAILFLHGFPELWYTWRHQLISLSSRGYRAIAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT   P+   S +TVFHIVGDLI LL ++    D+VF+VGHDWGA
Sbjct  61   RGYGDTDAPPS--PSSYTVFHIVGDLIALLDTLG--LDQVFLVGHDWGA  105



>ref|XP_008341331.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            E + I H+TV VNGINMH+AE G GPL+LF+HGFPELW+SWRHQIL L+  GYR VAPDL
Sbjct  2    ESQGIEHRTVQVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSDLGYRXVAPDL  61

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +T  H+VGDL+ LL +IAP++++VFVV HDWGA
Sbjct  62   RGYGDTD-APASPSS-YTCLHMVGDLVALLDAIAPDQEQVFVVAHDWGA  108



>ref|XP_006600362.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Glycine 
max]
 ref|XP_006600363.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Glycine 
max]
Length=354

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+T+ VNGINMHIAE GEGPL+LF+HGFP+LW+SWRHQI  LA+ GYR VAPDLR
Sbjct  1    MEGIEHQTLNVNGINMHIAEKGEGPLILFIHGFPDLWYSWRHQITALASLGYRCVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT    N   + +T  H+VGDL+ LL +I  +E+KVFVVGHDWGA
Sbjct  61   GYGDTDVPAN--PTAYTSLHVVGDLVGLLDAIVGDEEKVFVVGHDWGA  106



>gb|EYU43974.1| hypothetical protein MIMGU_mgv1a009814mg [Erythranthe guttata]
Length=331

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 87/112 (78%), Gaps = 4/112 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H+++ +NG+ MH+AE G GP++LFLHGFPE W++WRHQ++F A+ GYRAVAPDLR
Sbjct  1    MEEIEHRSLSINGLTMHVAEAGRGPIILFLHGFPECWYTWRHQMVFFASRGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEED----KVFVVGHDWGA  1
            G+ DTTGAP  D SKFT  H+ GDL+ L+ ++A        KVFVVGHDWGA
Sbjct  61   GFADTTGAPASDPSKFTTLHVAGDLVALIDAVAAAPADDGGKVFVVGHDWGA  112



>ref|XP_003554635.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|KHN43313.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   153 bits (387),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME + H+TV VNGI MHIAE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MEGVIHRTVEVNGIKMHIAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+ DS  +T FHIVGDL+ L+ S+  ++  VF+V HDWGA
Sbjct  61   GYGDTEAPPSIDS--YTCFHIVGDLVALIDSLGVQQ--VFLVAHDWGA  104



>gb|KHG21329.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=386

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 90/112 (80%), Gaps = 2/112 (2%)
 Frame = -2

Query  336  SRREMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVA  157
            SR EME I H+ +  NGINMH+AE G+GP++LFLHGFPELW++WRHQI   A+ GYRA+A
Sbjct  65   SRPEMEGIEHRVIKANGINMHVAEKGKGPVILFLHGFPELWYTWRHQITAFASLGYRALA  124

Query  156  PDLRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            PDLRG+G+T  AP DD+S +T   +VGDLI LL  +A ++D+VFVVGHDWGA
Sbjct  125  PDLRGFGETE-AP-DDASTYTSLDVVGDLIALLDVVAADQDQVFVVGHDWGA  174



>ref|XP_006489040.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=375

 Score =   154 bits (390),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 95/128 (74%), Gaps = 10/128 (8%)
 Frame = -2

Query  363  FTSKTKPGRSRREM-------EKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSW  205
            F +  KP R + E        E I HK V VNGINMH+AE G+GPL+LF+HGFP LW+SW
Sbjct  38   FLTTQKP-RQKEEKNIGSSMEEDIQHKVVNVNGINMHVAEKGQGPLILFIHGFPLLWYSW  96

Query  204  RHQILFLAAHGYRAVAPDLRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVF  25
            RHQI  LA+ GYRAVAPDLRGYGDT  AP + SS +T  H+VGD+I LL ++A +++KVF
Sbjct  97   RHQIAALASLGYRAVAPDLRGYGDTD-APAEVSS-YTCLHLVGDVIALLDAVAADQEKVF  154

Query  24   VVGHDWGA  1
            VVGHDWGA
Sbjct  155  VVGHDWGA  162



>ref|XP_008438903.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=369

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 91/113 (81%), Gaps = 3/113 (3%)
 Frame = -2

Query  336  SRREMEKITHKTVGVNGINMHIAELGE-GPLVLFLHGFPELWFSWRHQILFLAAHGYRAV  160
            ++ E+  I H+T+ VNGIN+HIAE GE GPL+LF+HGFPELW+SWR+QIL L++ GYRAV
Sbjct  44   NQMELSSIRHRTLNVNGINLHIAEKGESGPLILFIHGFPELWYSWRYQILDLSSRGYRAV  103

Query  159  APDLRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            APDLRGYGD+   P+   + +T FHIVGDLI L+ +I   E+KVFVVGHDWGA
Sbjct  104  APDLRGYGDSDSPPS--VNDYTCFHIVGDLIALIDAIVGVEEKVFVVGHDWGA  154



>gb|ACU23321.1| unknown [Glycine max]
Length=318

 Score =   153 bits (386),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME + H+TV VNGI MHIAE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MEGVIHRTVEVNGIKMHIAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+ DS  +T FHIVGDL+ L+ S+  ++  VF+V HDWGA
Sbjct  61   GYGDTETPPSIDS--YTCFHIVGDLVALIDSLGVQQ--VFLVAHDWGA  104



>gb|AFK39700.1| unknown [Lotus japonicus]
Length=322

 Score =   152 bits (385),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MESIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSRGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP+  +S +T FH+VGD+I L+ S+    DKV++VGHDWGA
Sbjct  61   GYGDTE-APSSVTS-YTCFHLVGDIIALIDSLG--VDKVYLVGHDWGA  104



>ref|XP_006419515.1| hypothetical protein CICLE_v10005186mg [Citrus clementina]
 gb|ESR32755.1| hypothetical protein CICLE_v10005186mg [Citrus clementina]
Length=375

 Score =   154 bits (388),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 94/128 (73%), Gaps = 10/128 (8%)
 Frame = -2

Query  363  FTSKTKPGRSRREM-------EKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSW  205
            F +  KP R + E        E I HK V VNGINMH+AE G+GPL+LF HGFP LW+SW
Sbjct  38   FLTTQKP-RQKEEKNIGSSMEEDIQHKVVNVNGINMHVAEKGQGPLILFFHGFPLLWYSW  96

Query  204  RHQILFLAAHGYRAVAPDLRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVF  25
            RHQI  LA+ GYRAVAPDLRGYGDT  AP + SS +T  H+VGD+I LL ++A +++KVF
Sbjct  97   RHQIAALASLGYRAVAPDLRGYGDTD-APAEVSS-YTCLHLVGDVIALLDAVAADQEKVF  154

Query  24   VVGHDWGA  1
            VVGHDWGA
Sbjct  155  VVGHDWGA  162



>ref|NP_001238563.1| epoxide hydrolase [Glycine max]
 dbj|BAA09852.1| Epoxide hydrolase [Glycine max]
 emb|CAA55293.1| epoxide hydrolase [Glycine max]
Length=341

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 87/109 (80%), Gaps = 4/109 (4%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            EME+I H+TV VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDL
Sbjct  25   EMEQIKHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDL  84

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT   P+   S +  FHIVGDL+ L+ S+  ++  VF+V HDWGA
Sbjct  85   RGYGDTEAPPS--ISSYNCFHIVGDLVALIDSLGVQQ--VFLVAHDWGA  129



>ref|XP_006838632.1| hypothetical protein AMTR_s00002p00236030 [Amborella trichopoda]
 gb|ERN01201.1| hypothetical protein AMTR_s00002p00236030 [Amborella trichopoda]
Length=315

 Score =   152 bits (385),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 87/106 (82%), Gaps = 3/106 (3%)
 Frame = -2

Query  318  KITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGY  139
            ++ H++V  NG++MH+AE G GPLVLF+HGFPELWFSWRHQ+ F+A HGYRAVAPDLRGY
Sbjct  2    EVVHRSVKTNGMDMHVAEQGSGPLVLFIHGFPELWFSWRHQMDFMARHGYRAVAPDLRGY  61

Query  138  GDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GDT  AP    + +TVFHIVGDLI LL ++   +D+VFVVGHDWGA
Sbjct  62   GDTE-APALPHTSYTVFHIVGDLIGLLDALG--QDQVFVVGHDWGA  104



>emb|CAA55294.1| epoxide hydrolase [Glycine max]
Length=341

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 87/109 (80%), Gaps = 4/109 (4%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            EME+I H+TV VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDL
Sbjct  25   EMEQIKHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDL  84

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT   P+   S +  FHIVGDL+ L+ S+  ++  VF+V HDWGA
Sbjct  85   RGYGDTEAPPS--ISSYNCFHIVGDLVALIDSLGVQQ--VFLVAHDWGA  129



>ref|XP_004240550.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=318

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGP-LVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME I HK + VNGINMHIAE+GEGP  +LFLHGFPELW+SWRHQ++ L++ GYRA+APDL
Sbjct  1    MENIQHKNLTVNGINMHIAEIGEGPSTILFLHGFPELWYSWRHQLISLSSKGYRAIAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT   P+   S +TVFHIVGDLI LL ++    D+VF+VGHDWGA
Sbjct  61   RGYGDTDSPPS--PSSYTVFHIVGDLIALLDALG--LDQVFLVGHDWGA  105



>ref|XP_008361962.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 87/109 (80%), Gaps = 2/109 (2%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            E + I H+TV VNGINMH+AE G GPL+LF+HGFPELW+SWRHQIL L+A GYRAVAPDL
Sbjct  2    ESQGIEHRTVPVNGINMHVAEKGNGPLILFVHGFPELWYSWRHQILALSALGYRAVAPDL  61

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +     VGDL+ LL +IAP++++VFVV HDWGA
Sbjct  62   RGYGDTD-APASPSS-YNCLXXVGDLVALLDAIAPDQEQVFVVAHDWGA  108



>gb|KHG16220.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=317

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME + H+ V VNGIN+HIAE GEGP++LFLHGFPELW+SWRHQIL L+  G+R VAPDLR
Sbjct  1    MEGVQHRMVEVNGINIHIAEKGEGPVILFLHGFPELWYSWRHQILALSNMGFRTVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+    + DS  +T FH+VGDL+EL+  + P E KVFVVGHDWGA
Sbjct  61   GYGDSDIPESVDS--YTCFHMVGDLVELIDVLDPREGKVFVVGHDWGA  106



>ref|XP_004134492.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004162212.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN57130.1| hypothetical protein Csa_3G164490 [Cucumis sativus]
Length=324

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/110 (65%), Positives = 88/110 (80%), Gaps = 3/110 (3%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGE-GPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPD  151
            E+  I H T+ +NGIN+HIAE GE GPL+LF+HGFPELW+SWRHQIL L++ GYRAVAPD
Sbjct  2    ELSSIRHTTLNLNGINLHIAEKGESGPLILFIHGFPELWYSWRHQILDLSSRGYRAVAPD  61

Query  150  LRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            LRGYGD+   P+   + +T FHIVGDLI L+ ++   E+KVFVVGHDWGA
Sbjct  62   LRGYGDSDSPPS--VNDYTCFHIVGDLIALIDALVGVEEKVFVVGHDWGA  109



>gb|EYU46741.1| hypothetical protein MIMGU_mgv1a009984mg [Erythranthe guttata]
Length=325

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI HK +  NGIN+H+AE+G GP VLFLHGFPELW+SWRHQ+LFL++ GYRA+APDLR
Sbjct  1    MDKIQHKNIRSNGINIHVAEIGRGPAVLFLHGFPELWYSWRHQMLFLSSRGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+  +S +T FHI+GDL+ LL ++    D+V++VGHDWGA
Sbjct  61   GYGDSDAPPS--ASSYTAFHIIGDLVGLLDALG--LDRVYLVGHDWGA  104



>gb|AFK46740.1| unknown [Lotus japonicus]
Length=323

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MHIAE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MESIKHRTVQVNGIKMHIAEKGEGPVVLFLHGFPELWYSWRHQILALSSQGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+   + +  F+IVGD++ L+ S+    D+VF+VGHDWGA
Sbjct  61   GYGDTEAPPS--VTSYNCFNIVGDIVALIDSLG--VDQVFLVGHDWGA  104



>gb|KHG02720.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=778

 Score =   157 bits (397),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 4/110 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I HKTV VNGINMHIAE GEGPL+LFLHGFPELW+SWR+QI  LAA GYRA+APDLR
Sbjct  1    MEGIQHKTVSVNGINMHIAEKGEGPLILFLHGFPELWYSWRNQINGLAALGYRALAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPE--EDKVFVVGHDWGA  1
            GYG T     D  + +T  H+VGDLI LL ++AP+  EDKVFVVGHDWGA
Sbjct  61   GYGGTDAP--DSVADYTCCHLVGDLIALLDTVAPQEKEDKVFVVGHDWGA  108


 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 84/111 (76%), Gaps = 4/111 (4%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            +++ +    V VNGINMHIAE GEGPL+LF+HGFPELW++WRHQI  LAA GYRA+APDL
Sbjct  263  DLDLVYTMPVSVNGINMHIAEKGEGPLILFIHGFPELWYTWRHQINGLAALGYRALAPDL  322

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAP--EEDKVFVVGHDWGA  1
            RGYG T     D  + +T FH VGDLI LL   AP  +EDKVFVVGHDWGA
Sbjct  323  RGYGGTDAP--DCVADYTCFHAVGDLIALLDMEAPPEKEDKVFVVGHDWGA  371



>ref|XP_011015179.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Populus 
euphratica]
Length=316

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI H+T+  NGINMHIA +G GP+VLFLHGFPELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MDKIEHQTIATNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT    N  + ++T+FHIVGDL+ L+ S+    DKVF+VGHDWGA
Sbjct  61   GYGDTDAPKN--AREYTIFHIVGDLVGLIDSLG--IDKVFLVGHDWGA  104



>ref|XP_010921626.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=318

 Score =   151 bits (382),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 88/106 (83%), Gaps = 4/106 (4%)
 Frame = -2

Query  318  KITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGY  139
            +I H+ V VNGINMHIAE GEGP+VL LHGFPELW+SWRHQIL L+A GYRA+APDLRG+
Sbjct  4    EIHHRFVAVNGINMHIAEKGEGPVVLLLHGFPELWYSWRHQILALSAAGYRAIAPDLRGF  63

Query  138  GDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GDT   P  ++S +T+FH+VGDL+ L+ ++   ++KVFVVGHDWGA
Sbjct  64   GDTDAPP--EASSYTMFHVVGDLVALIHTLG--QEKVFVVGHDWGA  105



>ref|XP_006355815.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=318

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 88/109 (81%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGP-LVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME I HK + VNGINMH+AE+GEGP  +LFLHGFPELW++WRHQ++ L++ GYRA+APDL
Sbjct  1    MENIQHKNLSVNGINMHVAEIGEGPSTILFLHGFPELWYTWRHQLISLSSKGYRAIAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT   P+   S +TVFHIVGDLI LL ++    D+VF+VGHDWGA
Sbjct  61   RGYGDTDSPPS--PSSYTVFHIVGDLIALLDALG--LDQVFLVGHDWGA  105



>gb|KDO71745.1| hypothetical protein CISIN_1g017221mg [Citrus sinensis]
Length=375

 Score =   152 bits (385),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 87/107 (81%), Gaps = 2/107 (2%)
 Frame = -2

Query  321  EKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRG  142
            E I HK V VNGINMH+AE G+GPL+LF+HGFP LW+SWRHQI  LA+ GYRAVAPDLRG
Sbjct  58   EDIQHKVVNVNGINMHVAEKGQGPLILFIHGFPLLWYSWRHQITALASLGYRAVAPDLRG  117

Query  141  YGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            YGDT  AP +  S +T  H+VGD+I LL ++A +++KVFVVGHDWGA
Sbjct  118  YGDTD-APAEVPS-YTCLHLVGDVIALLDAVAADQEKVFVVGHDWGA  162



>gb|EYU46742.1| hypothetical protein MIMGU_mgv1a010264mg [Erythranthe guttata]
Length=317

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H  + VNGINMH+AE+G+GP VLFLHGFPELW++WRHQ+L+L+A GYRA+APDLR
Sbjct  1    MEKIKHSNMSVNGINMHVAEIGDGPAVLFLHGFPELWYTWRHQMLYLSARGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+   + +T FH+VGDL+ LL ++  E+  VF+V HDWGA
Sbjct  61   GYGDTDAPPS--PADYTAFHLVGDLVALLDALGLEQ--VFLVAHDWGA  104



>emb|CDP17111.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI H+ V VNGIN+H+AE+G+GP +LFLHGFPELW+SWRHQ+L L+A GYRA+APDLR
Sbjct  1    MDKIQHRQVPVNGINLHVAEIGDGPAILFLHGFPELWYSWRHQLLSLSAKGYRALAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+   S +T  HIVGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDAPPS--PSNYTALHIVGDLVGLLDSLG--LDRVFLVGHDWGA  104



>ref|XP_009411662.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   151 bits (381),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 89/108 (82%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I+H+ + VNGINMH+AE G+GP+VLF+HGFPELW+SWRHQI  LAA GYRAVAPDLR
Sbjct  3    MEGISHRKLHVNGINMHVAEKGDGPVVLFVHGFPELWYSWRHQIASLAARGYRAVAPDLR  62

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+  +S +T+ H+VGDL+ L+ ++   +D+VFVVGHDWGA
Sbjct  63   GYGDSDAPPS--ASAYTILHLVGDLVALIHALG--QDQVFVVGHDWGA  106



>ref|XP_003554527.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
Length=317

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HKTV  NGINMH+A +G GP+VLFLHGFPELW++WRHQ+L L+A GYRA+APDLR
Sbjct  1    MEKIEHKTVRTNGINMHVASIGSGPVVLFLHGFPELWYTWRHQLLSLSAVGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P  D+S ++  HIV DL+ LL ++  E  +VF+VGHDWGA
Sbjct  61   GYGDTDAPP--DASSYSALHIVADLVGLLDALGIE--RVFLVGHDWGA  104



>ref|XP_006838629.1| hypothetical protein AMTR_s00002p00235200 [Amborella trichopoda]
 gb|ERN01198.1| hypothetical protein AMTR_s00002p00235200 [Amborella trichopoda]
Length=321

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 72/106 (68%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -2

Query  318  KITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGY  139
            ++ H++V  NGI MH+AE G GPLVLFLHGFPELWFSWRHQ+ F+A HGYRAVAPDLRGY
Sbjct  5    EVVHRSVKTNGIEMHVAEQGSGPLVLFLHGFPELWFSWRHQMEFMARHGYRAVAPDLRGY  64

Query  138  GDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GDT   P   +S +TVFHIVGDLI LL ++   E + FVVGHDWGA
Sbjct  65   GDTEAPPLPYTS-YTVFHIVGDLIGLLDALG--EAQAFVVGHDWGA  107



>ref|XP_003554633.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
Length=341

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 4/109 (4%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            EME+I H+ V VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDL
Sbjct  25   EMEQIKHRIVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDL  84

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT   P+   S +  FHIVGDL+ L+ S+  ++  VF+V HDWGA
Sbjct  85   RGYGDTEAPPS--ISSYNCFHIVGDLVALIDSLGVQQ--VFLVAHDWGA  129



>ref|XP_010429523.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP++LFLHGFP+LW+SWRHQ+L  AA GYRA+APDLR
Sbjct  1    MEKIEHTTVSTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +T+ HIVGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDAPPSPES--YTILHIVGDLVGLLDSLG--VDRVFLVGHDWGA  104



>ref|XP_006838631.1| hypothetical protein AMTR_s00002p00235860 [Amborella trichopoda]
 gb|ERN01200.1| hypothetical protein AMTR_s00002p00235860 [Amborella trichopoda]
Length=321

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 84/106 (79%), Gaps = 3/106 (3%)
 Frame = -2

Query  318  KITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGY  139
            ++ H++V  NGI MHIAE G GPLVLFLHGFPELWFSWRHQ+ F+A HGYRAVAPDLRGY
Sbjct  5    EVVHRSVKTNGIEMHIAEQGSGPLVLFLHGFPELWFSWRHQMAFMARHGYRAVAPDLRGY  64

Query  138  GDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GDT   P   +S +TVFHIVGD++ LL ++   E + FVVGHDWGA
Sbjct  65   GDTEAPPLPYTS-YTVFHIVGDIVGLLDTLG--EAQAFVVGHDWGA  107



>ref|XP_002874922.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51181.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP++LFLHGFP+LW+SWRHQ+L  AA GYRA+APDLR
Sbjct  1    MEKIEHTTVSTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +T+ HIVGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDAPPSRES--YTILHIVGDLVGLLNSLG--VDRVFLVGHDWGA  104



>ref|XP_009620847.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=318

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEG-PLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            MEKI HK + VNGINMHIAE+GEG   +LFLHGFPELW++WRHQ+L L++ GYRA+APDL
Sbjct  1    MEKIQHKNLTVNGINMHIAEIGEGQSAILFLHGFPELWYTWRHQLLALSSKGYRAIAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT   P+   S +TVFHIVGDLI LL ++    D+VF+VGHDWGA
Sbjct  61   RGYGDTDAPPS--PSSYTVFHIVGDLIALLDTL--RLDQVFLVGHDWGA  105



>ref|XP_002516953.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF45567.1| epoxide hydrolase, putative [Ricinus communis]
Length=321

 Score =   150 bits (380),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 87/110 (79%), Gaps = 4/110 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG--EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPD  151
            M+ I H+ + VNGINMH+AE+G   GP++LF+HGFPELW+SWRHQI+ LA+ GYRAVAPD
Sbjct  1    MDAIEHRVIKVNGINMHVAEMGPVNGPVILFIHGFPELWYSWRHQIVALASLGYRAVAPD  60

Query  150  LRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            LRG+GDT   P   S  +TV H VGDLI +L  +AP ++KVFVVGHDWGA
Sbjct  61   LRGFGDTDAPPEQRS--YTVMHSVGDLIGVLDVVAPLQEKVFVVGHDWGA  108



>ref|XP_003591165.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES61416.1| epoxide hydrolase [Medicago truncatula]
Length=177

 Score =   146 bits (369),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME + H+ V VNGI MH+AE GEGP+VL LHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MESVEHRIVEVNGIKMHVAEKGEGPVVLMLHGFPELWYSWRHQILDLSSKGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP   +S +T FH+VGD+I L+ S+    DKV++VGHDWGA
Sbjct  61   GYGDTE-APESVTS-YTCFHLVGDIIALIDSLG--VDKVYLVGHDWGA  104



>ref|XP_010910755.1| PREDICTED: bifunctional epoxide hydrolase 2-like, partial [Elaeis 
guineensis]
Length=195

 Score =   146 bits (369),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 88/105 (84%), Gaps = 4/105 (4%)
 Frame = -2

Query  315  ITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGYG  136
            ITH+ V VNGINMH+AE GEGP+VL +HGFPELW++WRHQI  LAA G+RAVAPDLRG+G
Sbjct  44   ITHRAVVVNGINMHVAEKGEGPVVLLVHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  103

Query  135  DTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            DT  +P D SS +++FH+VGDL+ L+ S+   +D+VFVVGHDWGA
Sbjct  104  DTD-SPADVSS-YSMFHLVGDLVALIDSLG--QDQVFVVGHDWGA  144



>gb|KHN43314.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   150 bits (378),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MEGIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+   S +  FHIVGDL+ L+ S+  ++  VF+V HDWGA
Sbjct  61   GYGDTEAPPS--ISSYNCFHIVGDLVALIDSLGVQQ--VFLVAHDWGA  104



>ref|XP_002302724.1| epoxide hydrolase family protein [Populus trichocarpa]
 gb|EEE81997.1| epoxide hydrolase family protein [Populus trichocarpa]
Length=316

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI H+TV  NGINMHIA +G GP++LFLHGFPELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MDKIEHQTVATNGINMHIASIGTGPVILFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT    N    ++T+FHIVGDL+ L+ S+    DKVF+VGHDWG+
Sbjct  61   GYGDTDAPKN--VREYTIFHIVGDLVGLIDSLG--IDKVFLVGHDWGS  104



>ref|XP_006396441.1| hypothetical protein EUTSA_v10028814mg [Eutrema salsugineum]
 gb|ESQ37894.1| hypothetical protein EUTSA_v10028814mg [Eutrema salsugineum]
Length=316

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H T+  NGINMH+A +G GP++LFLHGFP+LW+SWRHQ+L  A  GYRA+APDLR
Sbjct  1    MEKIEHTTISTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFADLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ DS  +T+ HIVGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDAPPSPDS--YTILHIVGDLVGLLNSLG--VDRVFLVGHDWGA  104



>ref|XP_007154300.1| hypothetical protein PHAVU_003G106900g [Phaseolus vulgaris]
 gb|ESW26294.1| hypothetical protein PHAVU_003G106900g [Phaseolus vulgaris]
Length=319

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 85/108 (79%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME + H+TV VNGINMHIAE+GEGP +LF+HGFP+LWFSWRHQ+  LA+ GYR VAPDLR
Sbjct  1    MEGVRHRTVNVNGINMHIAEMGEGPSILFIHGFPDLWFSWRHQMKALASLGYRCVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT    +   + +T  H+VGD++ LL  IA + +KVFVVGHDWGA
Sbjct  61   GYGDTDVPAS--PTAYTSLHVVGDIVGLLDEIAGDNEKVFVVGHDWGA  106



>ref|XP_003632381.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H+ + VNGINMH+AE+GEGP +LFLHGFPELW+SWRHQ+L L++ GYRA+APDLR
Sbjct  1    MEKIQHRNLRVNGINMHVAEIGEGPPILFLHGFPELWYSWRHQLLSLSSLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+  S  +T  HIVGDLI LL S+     +VF+VGHDWGA
Sbjct  61   GYGDSDAPPSPAS--YTALHIVGDLIALLDSL--RLGQVFLVGHDWGA  104



>ref|XP_006433455.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
 gb|ESR46695.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
Length=174

 Score =   145 bits (366),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H  VGVNGI MHIAE GEGP+VLFLHGFPELW++WR QIL L++ GYRA+APDLR
Sbjct  1    MEEIKHGMVGVNGIRMHIAEKGEGPVVLFLHGFPELWYTWRRQILALSSLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP+  SS ++  HIVGDL+ L+ S+  E+  VFVV HDWGA
Sbjct  61   GYGDTE-APSSISS-YSCHHIVGDLVALINSLGVEQ--VFVVAHDWGA  104



>gb|ACU19478.1| unknown [Glycine max]
 gb|KHN43316.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H+ V VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MEQIKHRIVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+   S +  FHIVGDL+ L+ S+  ++  VF+V HDWGA
Sbjct  61   GYGDTEAPPS--ISSYNCFHIVGDLVALIDSLGVQQ--VFLVAHDWGA  104



>ref|XP_011041992.1| PREDICTED: bifunctional epoxide hydrolase 2 [Populus euphratica]
Length=317

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMHIA +G GP +LFLHGFPELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MEKIEHTTVATNGINMHIASIGTGPEILFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP  D  ++TVFHI+GDL+ L+ S+    DKVF+VGHDWGA
Sbjct  61   GYGDTD-APK-DHREYTVFHILGDLVGLIDSLG--IDKVFLVGHDWGA  104



>gb|ACU23953.1| unknown [Glycine max]
Length=238

 Score =   147 bits (371),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MH+AE GEG +VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MESIEHRTVEVNGIKMHVAEKGEGAVVLFLHGFPELWYSWRHQILALSSLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP+  +S +T FH+VGD+I L+ S+    DKVF+V HDWGA
Sbjct  61   GYGDTE-APSTVNS-YTCFHLVGDIIALIDSLG--VDKVFLVAHDWGA  104



>ref|XP_006444395.1| hypothetical protein CICLE_v10024303mg, partial [Citrus clementina]
 gb|ESR57635.1| hypothetical protein CICLE_v10024303mg, partial [Citrus clementina]
Length=280

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TVG NGINMH+A +G GP+VLF+HGFPELW+SWR+Q+L+L++ GYRA+APDLR
Sbjct  1    MEKIEHTTVGTNGINMHVASIGTGPVVLFIHGFPELWYSWRNQLLYLSSRGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+  S  +T  H+VGDLI LL  +   +  VF+VGHDWGA
Sbjct  61   GYGDTDAPPSVTS--YTALHLVGDLIGLLDKLGIHQ--VFLVGHDWGA  104



>gb|KDP27825.1| hypothetical protein JCGZ_18905 [Jatropha curcas]
Length=321

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 90/110 (82%), Gaps = 4/110 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG--EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPD  151
            M+ + H+ V VNGIN+H+AE G   GP++LF+HGFPELW+SWR+QI+ LA+ GYRA+APD
Sbjct  1    MDAVEHRFVHVNGINIHVAEAGPVNGPVILFIHGFPELWYSWRYQIVALASLGYRAIAPD  60

Query  150  LRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            +RGYGDT  AP D  S +T  HIVGDLI LL ++AP+++KVFVVGHDWGA
Sbjct  61   MRGYGDTD-APADPQS-YTCLHIVGDLIGLLDAVAPQQEKVFVVGHDWGA  108



>gb|KDO87161.1| hypothetical protein CISIN_1g048209mg, partial [Citrus sinensis]
Length=349

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 88/113 (78%), Gaps = 4/113 (4%)
 Frame = -2

Query  339  RSRREMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAV  160
            + ++ MEKI H TVG NGINMH+A +G GP+VLF+HGFPELW+SWR+Q+L+L++ GYRA+
Sbjct  15   KHKQTMEKIEHTTVGTNGINMHVASIGTGPVVLFIHGFPELWYSWRNQLLYLSSRGYRAI  74

Query  159  APDLRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            APDLRGYGDT   P+  S  +T  H+VGDLI LL  +   +  VF+VGHDWGA
Sbjct  75   APDLRGYGDTDAPPSVTS--YTALHLVGDLIGLLDKLGIHQ--VFLVGHDWGA  123



>ref|XP_011079631.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=317

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H+ +  NGIN+H+AE+GEGP +LFLHGFPELW++WRHQ+L L++ GYRA+APDLR
Sbjct  1    MERIQHRHIQTNGINIHVAEIGEGPAILFLHGFPELWYTWRHQMLSLSSRGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+  +S +T FHI+GDL+ LL ++    D+VF+VGHDWGA
Sbjct  61   GYGDSDAPPS--ASSYTAFHIIGDLVGLLDALG--LDQVFLVGHDWGA  104



>ref|XP_002320333.2| epoxide hydrolase family protein [Populus trichocarpa]
 gb|ABK93786.1| unknown [Populus trichocarpa]
 gb|EEE98648.2| epoxide hydrolase family protein [Populus trichocarpa]
Length=317

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMHIA +G GP +LFLHGFPELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MEKIEHTTVATNGINMHIASIGTGPEILFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT    N    ++TVFHI+GDL+ L+ S+    DKVF+VGHDWGA
Sbjct  61   GYGDTDAPKN--YREYTVFHILGDLVGLIDSLG--IDKVFLVGHDWGA  104



>gb|KDP28184.1| hypothetical protein JCGZ_13955 [Jatropha curcas]
Length=315

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H T+  NGINMH+A +G GP++LFLHGFPELW+SWRHQ+L L+A GYR +APDLR
Sbjct  1    MEKIEHTTIPTNGINMHVASIGTGPVILFLHGFPELWYSWRHQLLSLSALGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+   +++T+ H+VGDL+ LL S+  E+  VF+VGHDWGA
Sbjct  61   GYGDTDAPPS--PTQYTILHLVGDLVGLLDSLGIEQ--VFLVGHDWGA  104



>ref|XP_006604802.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|KHN43315.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MEGIEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILSLSSLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+   S +  FHIVGDL+ L+ S+  ++  VF+V HDWGA
Sbjct  61   GYGDTEAPPS--ISSYNCFHIVGDLVALIDSLGVQQ--VFLVAHDWGA  104



>ref|XP_007163124.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris]
 gb|ESW35118.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris]
Length=317

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP+VLFLHGFPELW++WRHQ+L L++ GYRA+APDLR
Sbjct  1    MEKIEHTTVSTNGINMHVASIGSGPVVLFLHGFPELWYTWRHQLLSLSSVGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+  +S ++V HIV DL+ LL ++    D+VF+VGHDWGA
Sbjct  61   GYGDTDAPPS--ASSYSVLHIVADLVGLLDALG--IDQVFLVGHDWGA  104



>ref|XP_010556730.1| PREDICTED: bifunctional epoxide hydrolase 2 [Tarenaya hassleriana]
Length=316

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP +LFLHGFP+LW+SWRHQ+L L+A GYRA+APDLR
Sbjct  1    MEKIVHTTVSTNGINMHVASIGSGPPILFLHGFPDLWYSWRHQLLSLSALGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +TV H+VGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDAPPSLES--YTVLHLVGDLVGLLDSLG--LDRVFLVGHDWGA  104



>ref|XP_006479996.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Citrus 
sinensis]
Length=257

 Score =   147 bits (371),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP VLFLHGFPELW+SWR Q+L+L++ GYRA+APDLR
Sbjct  1    MEKIKHTTVATNGINMHVASIGTGPAVLFLHGFPELWYSWRKQLLYLSSRGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+  S  +T  H+VGDL+ LL     E+  VF+VGHDWGA
Sbjct  61   GYGDTDAPPSITS--YTALHVVGDLVGLLDEFGIEQ--VFLVGHDWGA  104



>gb|KHN02949.1| Epoxide hydrolase 2 [Glycine soja]
Length=249

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 82/108 (76%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V VNGINMHIAE GEGPL+LF+HGFP+LW+SW HQI  LA+ GYR VAPDLR
Sbjct  1    MEGIEHRRVNVNGINMHIAEKGEGPLILFIHGFPDLWYSWHHQIAALASLGYRCVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT        + +T  H+VGDL  LL  +A +E+KVFVVGHDWGA
Sbjct  61   GYGDTDLPAT--PTAYTSLHVVGDLTGLLDVVAGDEEKVFVVGHDWGA  106



>ref|XP_008784772.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Phoenix 
dactylifera]
Length=322

 Score =   149 bits (375),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = -2

Query  315  ITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGYG  136
            ITH+TV VNGINMH+AE GEGP+VL +HGFPELW++WRHQI  LAA G+RAVAPDLRG+G
Sbjct  11   ITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  70

Query  135  DTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            DT   P    S +++FH+VGDL+ L+ S+   +D+VFVVGHDWGA
Sbjct  71   DTDAPPG--VSSYSMFHLVGDLVALIDSLG--QDQVFVVGHDWGA  111



>ref|XP_008784770.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Phoenix 
dactylifera]
Length=359

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = -2

Query  315  ITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGYG  136
            ITH+TV VNGINMH+AE GEGP+VL +HGFPELW++WRHQI  LAA G+RAVAPDLRG+G
Sbjct  48   ITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  107

Query  135  DTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            DT   P    S +++FH+VGDL+ L+ S+   +D+VFVVGHDWGA
Sbjct  108  DTDAPPG--VSSYSMFHLVGDLVALIDSLG--QDQVFVVGHDWGA  148



>ref|XP_010914485.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=319

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 84/105 (80%), Gaps = 4/105 (4%)
 Frame = -2

Query  315  ITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGYG  136
            I+H+TV VNGI MH+AE GEGP VL LHGFPELW++WRHQI  LAA GYRA+APDLRGYG
Sbjct  7    ISHRTVEVNGIRMHVAEKGEGPPVLLLHGFPELWYTWRHQIAGLAARGYRAIAPDLRGYG  66

Query  135  DTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            DT   P  D + +TVFH+VGDL+ LL ++A    +VFVVGHDWGA
Sbjct  67   DTDAPP--DVASYTVFHLVGDLVALLDTLA--LSQVFVVGHDWGA  107



>ref|XP_008784771.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Phoenix 
dactylifera]
Length=338

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 86/105 (82%), Gaps = 4/105 (4%)
 Frame = -2

Query  315  ITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGYG  136
            ITH+TV VNGINMH+AE GEGP+VL +HGFPELW++WRHQI  LAA G+RAVAPDLRG+G
Sbjct  27   ITHRTVAVNGINMHVAEKGEGPVVLLIHGFPELWYTWRHQIHGLAARGFRAVAPDLRGFG  86

Query  135  DTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            DT   P    S +++FH+VGDL+ L+ S+   +D+VFVVGHDWGA
Sbjct  87   DTDAPPG--VSSYSMFHLVGDLVALIDSLG--QDQVFVVGHDWGA  127



>gb|ACU19450.1| unknown [Glycine max]
Length=315

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H+TV VNGI MH+AE GEGP+VLFLHGFPELW+SW HQIL L++ GYRAVAPDLR
Sbjct  1    MEQIKHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWHHQILSLSSLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+   S +  FHIVGDL+ L+ S+  ++  VF+V HDWGA
Sbjct  61   GYGDTEAPPS--ISSYNCFHIVGDLVALIDSLGVQQ--VFLVAHDWGA  104



>ref|XP_010105137.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXC03945.1| Epoxide hydrolase 2 [Morus notabilis]
Length=319

 Score =   148 bits (374),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 88/108 (81%), Gaps = 2/108 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+ I H+TV VNGI+MH+AE G+GP++LF+HGFPELW+SWRHQI  L++ G+RAVAPDLR
Sbjct  1    MDGIEHRTVEVNGIHMHVAEKGDGPVILFIHGFPELWYSWRHQIAALSSLGFRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+  A  +  + +T   IVGDLI LL +IA ++DKVFVVGHDWGA
Sbjct  61   GYGDS--AAPESPAVYTCLDIVGDLIALLDAIAADQDKVFVVGHDWGA  106



>emb|CDP17206.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I HK V +NGINMH+AE GEGP+VLFLHGFPELW++WRHQI   A  GYRAVAPDLR
Sbjct  1    MEGIEHKIVDLNGINMHVAEKGEGPVVLFLHGFPELWYTWRHQITAFATLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP+  SS +T FHIVGDL+ L+QS+    D VF+V HDWGA
Sbjct  61   GYGDTD-APSSISS-YTCFHIVGDLVALIQSLG--VDHVFLVAHDWGA  104



>ref|XP_008454325.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=324

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H T+  NGINMH+A +G GP VLFLHGFP+LW+SWRHQ+LFLA+ G+RA+APDLR
Sbjct  1    MEKIEHTTIPTNGINMHVASIGSGPAVLFLHGFPQLWYSWRHQLLFLASKGFRALAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P+   S +T  HI+GDLI LL  +  E  KVF+VGHDWGA
Sbjct  61   GFGDTDAPPS--PSSYTFLHIIGDLIGLLDHLGLE--KVFLVGHDWGA  104



>ref|XP_006288215.1| hypothetical protein CARUB_v10001452mg [Capsella rubella]
 gb|EOA21113.1| hypothetical protein CARUB_v10001452mg [Capsella rubella]
Length=324

 Score =   148 bits (374),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP++LFLHGFP+LW+SWRHQ+L  A  GYRA+APDLR
Sbjct  1    MEKIEHTTVSTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFATLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +++ HIVGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDAPPSPES--YSILHIVGDLVGLLDSLG--VDRVFLVGHDWGA  104



>gb|ACE82566.1| epoxide hydrolase [Nicotiana benthamiana]
Length=315

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGINMH+AE G+GP+VLFLHGFPELW++WRHQ++  A  GYRAVAPDLR
Sbjct  1    MESIEHRTVNVNGINMHVAEKGKGPVVLFLHGFPELWYTWRHQLVAFADLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP D +S +T FH+VGDL+ L++S+  E   VF+V HDWGA
Sbjct  61   GYGDTD-APADVAS-YTCFHVVGDLVALIESLGVES--VFLVAHDWGA  104



>ref|XP_006433456.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
 gb|ESR46696.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
Length=241

 Score =   145 bits (367),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H  VGVNGI MHIAE GEGP+VLFLHGFPELW++WR QIL L++ GYRA+APDLR
Sbjct  1    MEEIKHGMVGVNGIRMHIAEKGEGPVVLFLHGFPELWYTWRRQILALSSLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP+  SS ++  HIVGDL+ L+ S+  E+  VFVV HDWGA
Sbjct  61   GYGDTE-APSSISS-YSCHHIVGDLVALINSLGVEQ--VFVVAHDWGA  104



>ref|NP_567228.1| putative epoxide hydrolase [Arabidopsis thaliana]
 gb|AAC19281.1| T14P8.15 [Arabidopsis thaliana]
 emb|CAB80727.1| AT4g02340 [Arabidopsis thaliana]
 gb|AAM26670.1| AT4g02340/T14P8_15 [Arabidopsis thaliana]
 gb|AAN18121.1| At4g02340/T14P8_15 [Arabidopsis thaliana]
 gb|AEE82157.1| putative epoxide hydrolase [Arabidopsis thaliana]
Length=324

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H T+  NGINMH+A +G GP++LF+HGFP+LW+SWRHQ++  AA GYRA+APDLR
Sbjct  1    MEKIEHTTISTNGINMHVASIGSGPVILFVHGFPDLWYSWRHQLVSFAALGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +T+ HIVGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDAPPSRES--YTILHIVGDLVGLLDSLG--VDRVFLVGHDWGA  104



>ref|XP_006480000.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=316

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TVG NGINMH+A +G GP+VLF+HGFPELW+SWR+Q+L+L++ GYRA+APDLR
Sbjct  1    MEKIEHTTVGTNGINMHVASIGTGPVVLFIHGFPELWYSWRNQLLYLSSRGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+  S  +T  H+VGDLI LL  +   +  VF+VGHDWGA
Sbjct  61   GYGDTDAPPSVTS--YTALHLVGDLIGLLDKLGIHQ--VFLVGHDWGA  104



>ref|XP_007050977.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX95134.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=316

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H  V  NGINMH+A +G GP++LFLHGFPELW+SWRHQ+L L++ GYR VAPDLR
Sbjct  1    MEKIEHTMVTTNGINMHVASVGSGPVILFLHGFPELWYSWRHQLLSLSSLGYRCVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P+  ++ +TVFHIVGDL+ LL ++    D VF+VGHDWGA
Sbjct  61   GFGDTDAPPS--AASYTVFHIVGDLVGLLDALG--VDSVFLVGHDWGA  104



>ref|XP_010422608.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H T+  NGINMH+  +G GP++LFLHGFP+LW+SWRHQ+L  AA GYRA+APDLR
Sbjct  1    MERIEHTTISTNGINMHVTSIGTGPVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +T+ HIVGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDAPPSPES--YTILHIVGDLVGLLDSLG--VDRVFLVGHDWGA  104



>gb|KGN66047.1| hypothetical protein Csa_1G569240 [Cucumis sativus]
Length=317

 Score =   147 bits (372),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+ I+H+TV VNGINMHIAE GEGP+VLF+HGFPELW++WRHQIL L++ GY AVAPDLR
Sbjct  1    MDTISHRTVSVNGINMHIAEKGEGPIVLFIHGFPELWYTWRHQILALSSLGYHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+  AP D  S +++ HIVGDL+ L++S   +E  VFVV HDWGA
Sbjct  61   GYGDSD-AP-DSISSYSIMHIVGDLVALVESFGVKE--VFVVAHDWGA  104



>ref|XP_004230258.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=314

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+T+ VNGINMH+AE G+GP+VLFLHGFPELW++WRHQI+ LA  GYRAVAPDLR
Sbjct  1    MEGIEHRTLNVNGINMHVAEKGKGPVVLFLHGFPELWYTWRHQIVALADQGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP + +S +T FH+VGDL+ L++S+  E   VF+V HDWGA
Sbjct  61   GYGDTD-APKEVTS-YTYFHVVGDLVALIESLGVES--VFLVAHDWGA  104



>ref|XP_006344695.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=314

 Score =   147 bits (371),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+T+ VNGINMH+AE G+GP+VLFLHGFPELW++WRHQI+ LA  GYRAVAPDLR
Sbjct  1    MEGIEHRTLNVNGINMHVAEKGKGPVVLFLHGFPELWYTWRHQIVALADQGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP + +S +T FH+VGDL+ L++S+  E   VF+V HDWGA
Sbjct  61   GYGDTD-APKEVTS-YTYFHVVGDLVALIESLGVE--NVFLVAHDWGA  104



>gb|ADP68585.1| epoxide hydrolase A [Vigna radiata]
Length=319

 Score =   147 bits (372),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H+TV VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MEEIEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP   SS +T+ H+VGD++ L+ S+     +VF+V HDWGA
Sbjct  61   GYGDTE-APESISS-YTIMHLVGDIVALIDSLG--VGQVFLVAHDWGA  104



>emb|CDY65635.1| BnaAnng20800D [Brassica napus]
Length=315

 Score =   147 bits (371),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP+VLFLHGFP+LW+SWRHQ+L  A  GYRA+APDLR
Sbjct  1    MEKIEHTTVSTNGINMHVASIGSGPVVLFLHGFPDLWYSWRHQLLSFADLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +T+ HIVGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDSPPSHES--YTLLHIVGDLVGLLDSLG--VDQVFLVGHDWGA  104



>ref|XP_009111297.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=315

 Score =   147 bits (371),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP+VLFLHGFP+LW+SWRHQ+L  A  GYRA+APDLR
Sbjct  1    MEKIEHTTVSTNGINMHVASIGSGPVVLFLHGFPDLWYSWRHQLLSFADLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +T+ HIVGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDSPPSHES--YTLLHIVGDLVGLLDSLG--VDQVFLVGHDWGA  104



>ref|NP_001240943.1| uncharacterized protein LOC100803974 [Glycine max]
 gb|ACU18288.1| unknown [Glycine max]
 gb|KHN03960.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L+  GYRAVAPDLR
Sbjct  1    MEGIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSNLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP   SS +T+ H+V D++ L+ S+A   D+VF+V HDWGA
Sbjct  61   GYGDTE-APASISS-YTILHLVSDIVALIHSLA--VDQVFLVAHDWGA  104



>gb|KHG07158.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=316

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGI MH+A +G GP++LFLHGFPELW++WR Q+L L++ GYR VAPDLR
Sbjct  1    MEKIEHTTVTTNGIKMHVASIGSGPIILFLHGFPELWYTWRRQLLSLSSLGYRCVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +TVFH+VGDL+ LL ++    DKVF+VGHDWGA
Sbjct  61   GYGDSDAPPSPES--YTVFHVVGDLVGLLDALG--VDKVFLVGHDWGA  104



>ref|XP_006388394.1| hypothetical protein POPTR_0199s00210g, partial [Populus trichocarpa]
 gb|ERP47308.1| hypothetical protein POPTR_0199s00210g, partial [Populus trichocarpa]
Length=111

 Score =   141 bits (355),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 4/110 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGE--GPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPD  151
            M+ I H+T+  NGI MH+A  G    P++LFLHGFPE W+SWR+QIL L++ GYR+VAPD
Sbjct  1    MDSIEHRTIHANGITMHVAIKGSENAPVILFLHGFPESWYSWRYQILALSSLGYRSVAPD  60

Query  150  LRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            LRGYGDT  AP + +S +T FH+VGDLI LL  +AP EDKVFVV HDWGA
Sbjct  61   LRGYGDTD-APAEITS-YTCFHLVGDLIGLLDVVAPNEDKVFVVAHDWGA  108



>ref|XP_004494384.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=317

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGI MHIA +G GP++LFLHGFPELW+SWRHQ+L L++ GYRA+APDLR
Sbjct  1    MEKIEHTTVNTNGIKMHIASIGSGPVILFLHGFPELWYSWRHQLLSLSSLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P    S ++  HIVGDL+ LL  +    D+VF+VGHDWGA
Sbjct  61   GYGDTDAPPC--PSSYSALHIVGDLVGLLDGLG--VDRVFLVGHDWGA  104



>gb|KDO87174.1| hypothetical protein CISIN_1g021158mg [Citrus sinensis]
Length=247

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP VLF+HGFPELW+SWR+Q+L+L++ GYRA+APDLR
Sbjct  1    MEKIEHTTVATNGINMHVASIGTGPAVLFIHGFPELWYSWRNQLLYLSSRGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+  S  +T  H+VGDLI LL  +   +  VF+VGHDWGA
Sbjct  61   GYGDTDAPPSVTS--YTALHLVGDLIGLLDKLGIHQ--VFLVGHDWGA  104



>ref|XP_009393199.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 89/109 (82%), Gaps = 4/109 (4%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            E   ITH+TV VNGI++H+AE GEGP+VL +HGFPELW+SWRHQIL LAA GYRA+APDL
Sbjct  2    EEHGITHRTVEVNGISIHVAEKGEGPVVLLVHGFPELWYSWRHQILGLAARGYRALAPDL  61

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGD++  P+   + ++VFHIVGDL+ LL ++A  +  VF+VGHDWGA
Sbjct  62   RGYGDSSAPPS--VASYSVFHIVGDLVALLDALAIPQ--VFLVGHDWGA  106



>gb|EYU42746.1| hypothetical protein MIMGU_mgv1a010198mg [Erythranthe guttata]
Length=319

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPL-VLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME+I HK + VNGINMH+AELG+GP  VLFLHGFPELW+SWRHQ++ L+  GYR +APDL
Sbjct  1    MEQIVHKNLKVNGINMHVAELGQGPAAVLFLHGFPELWYSWRHQMVHLSGKGYRTIAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT   P+  S  +TV HIVGDL+ LL ++    D+VF+VGHDWGA
Sbjct  61   RGYGDTDAPPSPTS--YTVLHIVGDLVALLDALG--LDQVFLVGHDWGA  105



>ref|XP_004152361.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156886.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52823.1| hypothetical protein Csa_4G001900 [Cucumis sativus]
Length=322

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H T+  NGINMH+A +G GP VLFLHGFP+LW+SWRHQ+LFLA+ G+RA+APDLR
Sbjct  1    MEKIEHTTIPTNGINMHVASIGSGPAVLFLHGFPQLWYSWRHQLLFLASKGFRALAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P+   S +T  HI+GDLI LL       DKVF+VGHDWGA
Sbjct  61   GFGDTDAPPS--PSSYTFHHIIGDLIGLLDHFG--LDKVFLVGHDWGA  104



>ref|XP_002271210.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   147 bits (370),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H+TV  NGIN+HIAE G+GP++LFLHGFPELW+SWRHQI  LA+ GYRAVAPDLR
Sbjct  1    MEEIQHRTVEANGINIHIAEKGQGPIILFLHGFPELWYSWRHQIHALASLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT  AP D +S +T  H+VGD+I +L +I    D+VFVVGHDWGA
Sbjct  61   GFGDTD-APADGTS-YTSLHVVGDIIGVLDAIG--ADRVFVVGHDWGA  104



>ref|XP_011092097.1| PREDICTED: bifunctional epoxide hydrolase 2 [Sesamum indicum]
Length=317

 Score =   147 bits (370),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 3/108 (3%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGINMH+AE G+GP+VLFLHGFPELW++WRHQI+  AA GYRAVAPDLR
Sbjct  1    MEGIEHRTVSVNGINMHVAEKGQGPIVLFLHGFPELWYTWRHQIVAFAALGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP + SS ++  H+VGD++ L++S+    D+VF+V HDWGA
Sbjct  61   GYGDTD-APAEVSS-YSCLHVVGDIVALIESLG-GGDQVFLVAHDWGA  105



>gb|KDP23458.1| hypothetical protein JCGZ_23291 [Jatropha curcas]
Length=317

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H+ V VNGINMHIAE GEGP++LFLHGFPELW++WRHQIL L++ G+ AVAPDLR
Sbjct  1    MEEINHRVVNVNGINMHIAEKGEGPMILFLHGFPELWYTWRHQILSLSSLGFHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP   SS +T  HIVGDLI L+  +  E  KVF+VGHDWGA
Sbjct  61   GYGDTE-APALSSS-YTCHHIVGDLIALIDHLGAE--KVFLVGHDWGA  104



>ref|XP_003556522.1| PREDICTED: bifunctional epoxide hydrolase 2 isoform X1 [Glycine 
max]
 ref|XP_006606541.1| PREDICTED: bifunctional epoxide hydrolase 2 isoform X2 [Glycine 
max]
Length=322

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MH+AE GEG +VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MESIEHRTVEVNGIKMHVAEKGEGAVVLFLHGFPELWYSWRHQILALSSLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP+  +S +T FH+VGD+I L+ S+    DKVF+V HDWGA
Sbjct  61   GYGDTE-APSTVNS-YTCFHLVGDIIALIDSLG--VDKVFLVAHDWGA  104



>ref|XP_003626240.1| Epoxide hydrolase [Medicago truncatula]
Length=752

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 97/130 (75%), Gaps = 7/130 (5%)
 Frame = -2

Query  381  MQLASAFTSK--TKPGRSRREMEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWF  211
            + L  AFTS+  T     +REME I H+TV VNGI MHIAE G EGP+VLFLHGFPELW+
Sbjct  413  LYLNIAFTSQSQTHTHHKKREMEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWY  472

Query  210  SWRHQILFLAAHGYRAVAPDLRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDK  31
            SWRHQI  L + GYRAVAPDLRGYGDT  AP   SS +T+FH+VGD++ L+ S+    D+
Sbjct  473  SWRHQIAALGSLGYRAVAPDLRGYGDTD-APASISS-YTIFHLVGDIVALIDSLG--VDQ  528

Query  30   VFVVGHDWGA  1
            VF+V HDWGA
Sbjct  529  VFLVAHDWGA  538


 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 87/109 (80%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME+I H+TV VNGI MHIAE G EGP+VLFLHGFPELW+SWRHQI  L + GYRAVAPDL
Sbjct  1    MEEIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQISALGSLGYRAVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +T+FH+VGD++ L+ S+    D+VF+V HDWGA
Sbjct  61   RGYGDTD-APASISS-YTIFHLVGDIVALIDSLG--VDRVFLVAHDWGA  105



>emb|CAN65686.1| hypothetical protein VITISV_022460 [Vitis vinifera]
Length=175

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V VNGI MH+AE G+GP+VLFLHGFPELW++WRHQI+ +A+HGY AVAPDLR
Sbjct  1    MEGIEHRMVSVNGIKMHVAEKGQGPVVLFLHGFPELWYTWRHQIIAMASHGYHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GY D+  AP   +S +T  H+VGDLI L+  +    DKVF+VGHDWGA
Sbjct  61   GYSDSE-APASFTS-YTCLHVVGDLIALIDYLG--ADKVFLVGHDWGA  104



>gb|KHN20253.1| Epoxide hydrolase 2 [Glycine soja]
Length=322

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MH+AE GEG +VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MESIEHRTVEVNGIKMHVAEKGEGAVVLFLHGFPELWYSWRHQILALSSLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP+  +S +T FH+VGD+I L+ S+    DKVF+V HDWGA
Sbjct  61   GYGDTE-APSTVNS-YTCFHLVGDIIALIDSLG--VDKVFLVAHDWGA  104



>ref|XP_003604118.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES86315.1| epoxide hydrolase [Medicago truncatula]
Length=322

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME + H+ V VNGI MH+AE GEGP+VL LHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MENVEHRIVEVNGIKMHVAEKGEGPVVLMLHGFPELWYSWRHQILDLSSKGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP +  + +T FH+VGD+I L+ S+    DKV++VGHDWGA
Sbjct  61   GYGDTE-AP-ESVTNYTCFHLVGDIIALIDSLG--VDKVYLVGHDWGA  104



>ref|XP_002523107.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF39292.1| epoxide hydrolase, putative [Ricinus communis]
Length=315

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMHIA +G+GP++LFLHGFP+LW++WRHQ+L L++ GYR +APDLR
Sbjct  1    MEKIEHTTVYTNGINMHIASIGKGPVILFLHGFPDLWYTWRHQLLALSSLGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P+   +++TV HIVGDL+ LL S+  E+  VF+VGHDWGA
Sbjct  61   GFGDTDAPPS--PNEYTVLHIVGDLVGLLDSLGVEQ--VFLVGHDWGA  104



>gb|KFK30821.1| hypothetical protein AALP_AA6G030400 [Arabis alpina]
Length=316

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H T+  NGINMH+A +G GP++LFLHGFP+LW+SWRHQ+L  A  GY+A+APDLR
Sbjct  1    MEKIEHTTISTNGINMHVASIGSGPVILFLHGFPDLWYSWRHQLLSFADLGYKAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +TV HIVGDLI LL S+    DKV +VGHDWGA
Sbjct  61   GYGDSDAPPSHES--YTVLHIVGDLIGLLNSLG--VDKVLLVGHDWGA  104



>gb|AAO27849.1|AF482450_1 soluble epoxide hydrolase [Euphorbia lagascae]
Length=321

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 87/109 (80%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            MEKI H  V  NGINMHIA +G +GP++LFLHGFP+LW+SWRHQ+L+L++ GYR +APDL
Sbjct  5    MEKIEHSMVSTNGINMHIASIGTQGPVILFLHGFPDLWYSWRHQLLYLSSVGYRCIAPDL  64

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT   P    +++TVFHI+GDL+ LL S+    D+VF+VGHDWGA
Sbjct  65   RGYGDTDAPPA--INQYTVFHILGDLVGLLDSLG--IDQVFLVGHDWGA  109



>gb|EPS67066.1| pectinesterase [Genlisea aurea]
Length=955

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H  +  NGIN+H+AE+GEGP VLFLHGFPELW+SWRHQ+LFL++ GYRA+APDLR
Sbjct  1    MESIRHAMIPTNGINLHVAEVGEGPAVLFLHGFPELWYSWRHQMLFLSSRGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+  ++++T FHIVGDLI LL ++    D+V +V HDWGA
Sbjct  61   GYGDSDAPPS--AAEYTAFHIVGDLIGLLDALG--LDRVLLVAHDWGA  104



>ref|XP_009788536.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=315

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGINMH+AE G+GP+VLFLHGFPELW++WRHQ++  A  GYRAVAPDLR
Sbjct  1    MEGIEHRTVNVNGINMHVAEKGQGPVVLFLHGFPELWYTWRHQLVAFADLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP + +S +T FH+VGDL+ L++S+  E   VF+V HDWGA
Sbjct  61   GYGDTD-APAEAAS-YTCFHVVGDLVALIESLGVES--VFLVAHDWGA  104



>ref|XP_007147002.1| hypothetical protein PHAVU_006G088500g [Phaseolus vulgaris]
 gb|ESW18996.1| hypothetical protein PHAVU_006G088500g [Phaseolus vulgaris]
Length=320

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME + H+TV VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L+A GYRAVAPDLR
Sbjct  1    MEGVEHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSALGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP   SS +T+ H+V D++ L+ S+    D+VF+V HDWGA
Sbjct  61   GYGDTD-APASVSS-YTILHLVADVVALIDSLG--VDQVFLVAHDWGA  104



>ref|XP_006444387.1| hypothetical protein CICLE_v10021228mg [Citrus clementina]
 ref|XP_006479995.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR57627.1| hypothetical protein CICLE_v10021228mg [Citrus clementina]
 gb|KDO87172.1| hypothetical protein CISIN_1g021184mg [Citrus sinensis]
Length=316

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP VLFLHGFPELW+SWR Q+L+L++ GYRA+APDLR
Sbjct  1    MEKIKHTTVATNGINMHVASIGTGPAVLFLHGFPELWYSWRKQLLYLSSRGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+  S  +T  H+VGDL+ LL     E+  VF+VGHDWGA
Sbjct  61   GYGDTDAPPSITS--YTALHVVGDLVGLLDEFGIEQ--VFLVGHDWGA  104



>ref|XP_007144960.1| hypothetical protein PHAVU_007G198000g [Phaseolus vulgaris]
 gb|ESW16954.1| hypothetical protein PHAVU_007G198000g [Phaseolus vulgaris]
Length=322

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 6/109 (6%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V +NGINMH+AE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MENILHRMVELNGINMHVAEKGEGPVVLFLHGFPELWYSWRHQILHLSSLGYRAVAPDLR  60

Query  144  GYGDTTG-APNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   AP    + +T FH+VGD++ L+ S+    DKVF+V HDWGA
Sbjct  61   GYGDTDAPAP---LTTYTCFHLVGDIVALIDSLG--VDKVFLVAHDWGA  104



>ref|XP_008450607.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=317

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+ I H+TV VNGIN+HIAE GEGP+VLF+HGFPELW++WRHQIL L++ GY AVAPDLR
Sbjct  1    MDTINHRTVSVNGINVHIAEKGEGPIVLFIHGFPELWYTWRHQILALSSLGYHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+  AP D  S +++ HIVGDL+ L++S+  +E  VFVV HDWGA
Sbjct  61   GYGDSD-AP-DSISSYSIMHIVGDLVALVESLGVKE--VFVVAHDWGA  104



>ref|XP_004290809.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP +LFLHGFPELW+SWRHQ+L L+A GYR +APDLR
Sbjct  1    MEKIEHTTVPTNGINMHVASIGSGPPILFLHGFPELWYSWRHQLLSLSALGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P  D+S +T  HIVGDLI LL  +  E+  VF+V HDWGA
Sbjct  61   GFGDTDAPP--DASSYTAMHIVGDLIGLLDHLGIEQ--VFLVAHDWGA  104



>ref|XP_007147003.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
 gb|ESW18997.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
Length=247

 Score =   144 bits (362),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I HK V VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MEGIQHKEVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP   SS ++ F IVGDL+ L+  +  E+  VF+V HDWGA
Sbjct  61   GYGDTE-APASMSS-YSCFDIVGDLVALIDLLGVEQ--VFLVAHDWGA  104



>ref|XP_011039566.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
 ref|XP_011039567.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=349

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI H TV  NGINMH+A +G GP++LFLHGFPELW+SWRHQ+L L++ GYR VAPDLR
Sbjct  1    MDKIEHITVATNGINMHVASIGTGPVILFLHGFPELWYSWRHQLLHLSSLGYRCVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP + +S++T  H+VGDLI LL S     D+VF+VGHDWGA
Sbjct  61   GYGDTD-AP-ESASQYTGLHVVGDLIGLLDSFG--IDQVFLVGHDWGA  104



>ref|XP_006433457.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
 gb|ESR46697.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
Length=317

 Score =   145 bits (366),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H  VGVNGI MHIAE GEGP+VLFLHGFPELW++WR QIL L++ GYRA+APDLR
Sbjct  1    MEEIKHGMVGVNGIRMHIAEKGEGPVVLFLHGFPELWYTWRRQILALSSLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP+  SS ++  HIVGDL+ L+ S+  E+  VFVV HDWGA
Sbjct  61   GYGDTE-APSSISS-YSCHHIVGDLVALINSLGVEQ--VFVVAHDWGA  104



>ref|XP_011021885.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
 ref|XP_011021886.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=349

 Score =   146 bits (368),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI H TV  NGINMH+A +G GP++LFLHGFPELW+SWRHQ+L L++ GYR VAPDLR
Sbjct  1    MDKIEHITVATNGINMHVASIGTGPVILFLHGFPELWYSWRHQLLHLSSLGYRCVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP + +S++T  H+VGDLI LL S     D+VF+VGHDWGA
Sbjct  61   GYGDTD-AP-ESASQYTGLHVVGDLIGLLDSFG--IDQVFLVGHDWGA  104



>ref|XP_002306333.2| hypothetical protein POPTR_0005s08280g [Populus trichocarpa]
 gb|EEE93329.2| hypothetical protein POPTR_0005s08280g [Populus trichocarpa]
Length=349

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI H TV  NGINMH+A +G GP++LFLHGFPELW+SWRHQ+L L++ GYR VAPDLR
Sbjct  1    MDKIEHITVATNGINMHVASIGTGPVILFLHGFPELWYSWRHQLLHLSSLGYRCVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP + +S++T  H+VGDLI LL S     D+VF+VGHDWGA
Sbjct  61   GYGDTD-AP-ESASQYTGLHVVGDLIGLLDSFG--IDQVFLVGHDWGA  104



>ref|XP_007200440.1| hypothetical protein PRUPE_ppa008875mg [Prunus persica]
 emb|CAZ86693.1| epoxide hydrolase 2 [Prunus persica]
 gb|EMJ01639.1| hypothetical protein PRUPE_ppa008875mg [Prunus persica]
Length=316

 Score =   145 bits (365),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMHIA +G GP+VLFLHGFPELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MEKIEHTTVSTNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P+  S  ++  HIVGDLI LL  +    D+VF+VGHDWGA
Sbjct  61   GFGDTDAPPSPAS--YSALHIVGDLIGLLDHLG--IDQVFLVGHDWGA  104



>ref|XP_008454327.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=315

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI H T+  NGIN+H A +G GP+VLFLHGFPELW+SWRHQ+LFLA+ G+RA+APDLR
Sbjct  1    MDKIQHSTISTNGINIHFASIGSGPVVLFLHGFPELWYSWRHQLLFLASKGFRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GD+   P+   S +T  HIVGDLI LL  +    D+VF+VGHDWGA
Sbjct  61   GFGDSDAPPS--PSSYTPHHIVGDLIGLLDHLG--IDQVFLVGHDWGA  104



>ref|XP_006444386.1| hypothetical protein CICLE_v10023691mg [Citrus clementina]
 ref|XP_006479994.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
 dbj|BAD13534.1| soluble epoxide hydrolase [Citrus jambhiri]
 gb|ESR57626.1| hypothetical protein CICLE_v10023691mg [Citrus clementina]
 gb|KDO87173.1| hypothetical protein CISIN_1g021158mg [Citrus sinensis]
Length=316

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP VLF+HGFPELW+SWR+Q+L+L++ GYRA+APDLR
Sbjct  1    MEKIEHTTVATNGINMHVASIGTGPAVLFIHGFPELWYSWRNQLLYLSSRGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+  S  +T  H+VGDLI LL  +   +  VF+VGHDWGA
Sbjct  61   GYGDTDAPPSVTS--YTALHLVGDLIGLLDKLGIHQ--VFLVGHDWGA  104



>gb|EPS62395.1| hypothetical protein M569_12392 [Genlisea aurea]
Length=318

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H T+  NGIN+H+AE+G+GP VLFLHGFP LW++WRHQ+LFL++ GYRA+APDLR
Sbjct  1    MESIRHSTIPTNGINLHVAEIGDGPAVLFLHGFPGLWYTWRHQMLFLSSKGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYG +   P+   S +T+FH+VGDL+ LL  +    DKVF+VGHDWG+
Sbjct  61   GYGGSDVPPS--PSSYTIFHVVGDLVGLLDGLG--VDKVFLVGHDWGS  104



>ref|XP_009629075.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=315

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H++V VNGINMH+AE G+GP+VLFLHGFPELW++WRHQ++  A  GYRAVAPDLR
Sbjct  1    MEGIEHRSVNVNGINMHVAEKGQGPVVLFLHGFPELWYTWRHQLVAFAELGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP + +S +T FH+VGDL+ L++S+  E   VF+V HDWGA
Sbjct  61   GYGDTD-APGEVAS-YTYFHVVGDLVALIESLGVE--SVFLVAHDWGA  104



>ref|XP_002523108.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF39293.1| epoxide hydrolase, putative [Ricinus communis]
Length=316

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP +LFLHGFPELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MEKIEHTTVATNGINMHVAAIGTGPEILFLHGFPELWYSWRHQLLSLSSRGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP +  + +T  HIVGDLI LL S+  E+  VF+VGHDWGA
Sbjct  61   GYGDTD-AP-ESLTGYTALHIVGDLIGLLDSMGIEQ--VFLVGHDWGA  104



>ref|XP_004508197.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=357

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 88/111 (79%), Gaps = 4/111 (4%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELG--EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAP  154
            E E++ HKTV VNGIN+HIAE G  + PL+LF+HGFP+LW+SWRHQI  LA+ GYR +AP
Sbjct  36   EFEELQHKTVIVNGINIHIAEKGTSQSPLILFIHGFPDLWYSWRHQITALASLGYRCIAP  95

Query  153  DLRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            DLRG+GDT   P   +S +T  H+VGDLI +L ++A +EDKVFVVGHDWGA
Sbjct  96   DLRGFGDTD-VPASPTS-YTSLHVVGDLIGVLDAVAGDEDKVFVVGHDWGA  144



>ref|XP_006577223.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Glycine 
max]
Length=171

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MHIAE GEGP+VLFLHGFPELW  W +QI+ L + GY AVAPDLR
Sbjct  1    MEGIEHRTVEVNGIKMHIAEKGEGPVVLFLHGFPELWHCWHNQIVALGSLGYHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+ DS  +T FHIV DL+ L+ S+  E+  VF+V HDWGA
Sbjct  61   GYGDTDAPPSIDS--YTCFHIVADLVALIDSLGAEQ--VFLVAHDWGA  104



>ref|XP_009111296.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=316

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H T+  NGIN+H+A +G GP +LFLHGFP+LW+SWR Q+L LA  GYRA+APDLR
Sbjct  1    MEKIEHTTISTNGINLHVASIGSGPAILFLHGFPDLWYSWRRQLLSLADLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +TV H+VGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDSPPSHES--YTVLHVVGDLVGLLDSLG--VDRVFLVGHDWGA  104



>gb|KEH24512.1| epoxide hydrolase [Medicago truncatula]
Length=238

 Score =   142 bits (358),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME I H+TV VNGI MHIAE G EGP+VLFLHGFPELW+SWRHQI+ L + GYRAVAPDL
Sbjct  1    MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIVALGSLGYRAVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP+  SS +T FHIVGDL+ L+  +    D+VF+V HDWGA
Sbjct  61   RGYGDTE-APSSISS-YTGFHIVGDLVALIDLLG--VDQVFLVAHDWGA  105



>ref|XP_010113065.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXC61613.1| Epoxide hydrolase 2 [Morus notabilis]
Length=191

 Score =   140 bits (354),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGE--GPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPD  151
            MEKI H TV  NGINMH+A +G    P ++FLHGFPELW+SWRHQ++ L++ GYR +APD
Sbjct  1    MEKIEHTTVPTNGINMHVASIGSTTAPAIIFLHGFPELWYSWRHQMISLSSLGYRCIAPD  60

Query  150  LRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            LRGYG+T   P+ +S  +TVFHIVGDL+ LL  +    D++FVVGHDWGA
Sbjct  61   LRGYGETDAPPSPES--YTVFHIVGDLVGLLDHLG--LDQIFVVGHDWGA  106



>gb|KEH24510.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 87/109 (80%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME+I H+TV VNGI MHIAE G EGP+VLFLHGFPELW+SWRHQI  L + GYRAVAPDL
Sbjct  1    MEEIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQISALGSLGYRAVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +T+FH+VGD++ L+ S+    D+VF+V HDWGA
Sbjct  61   RGYGDTD-APASISS-YTIFHLVGDIVALIDSLG--VDRVFLVAHDWGA  105



>ref|XP_008789846.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=317

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 91/108 (84%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME ITH+TV VNGINMHIAE GEGP+VLF+HGFPELW+SWRHQ++ LA  GYRAVAPDLR
Sbjct  1    MEGITHRTVAVNGINMHIAEKGEGPMVLFVHGFPELWYSWRHQMVALAGRGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+  ++ +T+FH+VGDL+ LL ++A   D+VFVVGHDWGA
Sbjct  61   GYGDTDAPPS--ATDYTIFHLVGDLVALLDALA--LDQVFVVGHDWGA  104



>ref|XP_009393200.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 87/109 (80%), Gaps = 4/109 (4%)
 Frame = -2

Query  327  EMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            E E + H+ V  NGI+MH+AE GEGP VL LHGFPELW+SWRHQI  LAA GYRA+APDL
Sbjct  2    EGEGVAHRMVEANGISMHVAEKGEGPAVLLLHGFPELWYSWRHQIAGLAARGYRAIAPDL  61

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT+ AP+  +S +TVFHIVGDLI LL ++A  +  V++VGHDWGA
Sbjct  62   RGYGDTS-APSAAAS-YTVFHIVGDLIALLDALAIPQ--VYLVGHDWGA  106



>emb|CBI39538.3| unnamed protein product [Vitis vinifera]
Length=294

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V VNGI MH+AE G+GP+VLFLHGFPELW++WRHQI+ +A+HGY AVAPDLR
Sbjct  1    MEGIEHRMVSVNGIKMHVAEKGQGPVVLFLHGFPELWYTWRHQIIAMASHGYHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GY D+  AP   +S +T  H+VGDLI L+  +    DKVF+VGHDWGA
Sbjct  61   GYSDSE-APASFTS-YTCLHVVGDLIALIDCLG--ADKVFLVGHDWGA  104



>gb|KCW50160.1| hypothetical protein EUGRSUZ_K03595, partial [Eucalyptus grandis]
Length=240

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 85/109 (78%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGP-LVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            MEKI H TV  NGINMH+A +G+GP  VLF+HGFPELW+SWRHQ++ LAA GYR VAPDL
Sbjct  1    MEKIEHATVRTNGINMHVASVGDGPDTVLFIHGFPELWYSWRHQMVSLAALGYRTVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYG+T   P+ DS  +T FH+VGDL+ +L ++     +VFVVGHDWGA
Sbjct  61   RGYGNTDAPPSVDS--YTAFHVVGDLVGMLDALG--IGRVFVVGHDWGA  105



>ref|XP_008235117.1| PREDICTED: bifunctional epoxide hydrolase 2 [Prunus mume]
Length=316

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMHIA +G GP+VLFLHGFPELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MEKIEHTTVRTNGINMHIASIGTGPVVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P+  S  ++  HIVGDLI LL  +    D+VF+VGHDWGA
Sbjct  61   GFGDTDAPPSPAS--YSALHIVGDLIGLLDHLG--IDQVFLVGHDWGA  104



>emb|CDY05187.1| BnaC05g46160D [Brassica napus]
Length=340

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 89/117 (76%), Gaps = 4/117 (3%)
 Frame = -2

Query  345  PGRSRREMEKITHKTVGVNGINMHIAELG--EGPLVLFLHGFPELWFSWRHQILFLAAHG  172
            P +++ EME I H+ V VNGI MHIAE G  EG +VL LHGFP+LW++WRHQI  L++ G
Sbjct  3    PTKNKGEMEGIDHRMVSVNGITMHIAEKGPKEGTVVLLLHGFPDLWYTWRHQITALSSLG  62

Query  171  YRAVAPDLRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            YRAVAPDLRGYGD+     +  S++T  H+VGDL+ LL S+  +++KVF+VGHDWGA
Sbjct  63   YRAVAPDLRGYGDSDSP--ESFSEYTCLHLVGDLVALLDSVVGDQEKVFLVGHDWGA  117



>gb|ACE82565.1| epoxide hydrolase [Nicotiana benthamiana]
Length=315

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGINMH+AE G+GP++LFLHGFPELW++WRHQ++  A  G+RAVAPDLR
Sbjct  1    MESIEHRTVNVNGINMHVAEKGKGPVILFLHGFPELWYTWRHQLVAFADLGHRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP + +S +T FH+VGDL+ L++S+  E   VF+V HDWGA
Sbjct  61   GYGDTD-APAEAAS-YTCFHVVGDLVALIESLGVES--VFLVAHDWGA  104



>ref|XP_006388576.1| hypothetical protein POPTR_0150s00210g [Populus trichocarpa]
 gb|ERP47490.1| hypothetical protein POPTR_0150s00210g [Populus trichocarpa]
Length=169

 Score =   139 bits (351),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI H+TV  NGINMHIA  G GP++LFLHGFPELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MDKIEHRTVATNGINMHIASTGTGPVILFLHGFPELWYSWRHQLLSLSSVGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP   S   T  H+VGDLI LL S+    D VF+VGHDWG 
Sbjct  61   GYGDTD-APRSVSEN-TGLHVVGDLIGLLDSLG--IDMVFLVGHDWGG  104



>ref|XP_002512456.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF49908.1| epoxide hydrolase, putative [Ricinus communis]
Length=317

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I HKTV VNGI MHIAE GEGP++LFLHGFPELW++WRHQIL L + GYRAVAPDLR
Sbjct  1    MEGIMHKTVNVNGIKMHIAEKGEGPVILFLHGFPELWYTWRHQILGLTSLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+  AP   SS +T  HIVGDLI L+  +  E+  VF+V HDWGA
Sbjct  61   GYGDSD-APTLCSS-YTCHHIVGDLIALIDHLGVEQ--VFLVAHDWGA  104



>ref|XP_010456047.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=324

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H T+  NGINMH+A +G G ++LFLHGFP+LW+SWRHQ+L  AA GYRA+APDLR
Sbjct  1    MEKIEHTTISTNGINMHVASIGSGSVILFLHGFPDLWYSWRHQLLSFAALGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+  AP    S +T+ HIVGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSD-APQSPES-YTILHIVGDLVGLLDSLG--VDRVFLVGHDWGA  104



>ref|XP_007147005.1| hypothetical protein PHAVU_006G088700g [Phaseolus vulgaris]
 gb|ESW18999.1| hypothetical protein PHAVU_006G088700g [Phaseolus vulgaris]
Length=318

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L++ GY AVAPDLR
Sbjct  1    MEGIVHRTVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP   SS +T F IVGDL+ L+  +  E+  VF+V HDWGA
Sbjct  61   GYGDTE-APASMSS-YTCFDIVGDLVALIDLLGVEQ--VFLVAHDWGA  104



>gb|KEH24396.1| epoxide hydrolase [Medicago truncatula]
Length=236

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGI MH+A +G GP+++FLHGFPELW+SWRHQ+L L+A GYRAVAPDLR
Sbjct  1    MEKIEHTTVQTNGIKMHVASIGSGPVIIFLHGFPELWYSWRHQLLSLSALGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT        S +T  HIVGDL+ LL ++    D+VF+VGHDWGA
Sbjct  61   GYGDTDSP--SSPSSYTAHHIVGDLVGLLDAL--NVDRVFLVGHDWGA  104



>ref|XP_007147004.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
 gb|ESW18998.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
Length=318

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I HK V VNGI MH+AE GEGP+VLFLHGFPELW+SWRHQIL L++ GYRAVAPDLR
Sbjct  1    MEGIQHKEVEVNGIKMHVAEKGEGPVVLFLHGFPELWYSWRHQILALSSRGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP   SS ++ F IVGDL+ L+  +  E+  VF+V HDWGA
Sbjct  61   GYGDTE-APASMSS-YSCFDIVGDLVALIDLLGVEQ--VFLVAHDWGA  104



>ref|XP_002283462.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+ V VNGI MH+AE G+GP+VLFLHGFPELW++WRHQI+ +A+HGY AVAPDLR
Sbjct  1    MEGIEHRMVSVNGIKMHVAEKGQGPVVLFLHGFPELWYTWRHQIIAMASHGYHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GY D+  AP   +S +T  H+VGDLI L+  +    DKVF+VGHDWGA
Sbjct  61   GYSDSE-APASFTS-YTCLHVVGDLIALIDCLG--ADKVFLVGHDWGA  104



>gb|AES82458.2| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME I H+TV VNGI MHIAE G EGP+VLFLHGFPELW+SWRHQI  L + GYRAVAPDL
Sbjct  1    MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +T+FH+VGD++ L+ S+    D+VF+V HDWGA
Sbjct  61   RGYGDTD-APASISS-YTIFHLVGDIVALIDSLG--VDQVFLVAHDWGA  105



>emb|CDY50394.1| BnaCnng19260D [Brassica napus]
Length=316

 Score =   143 bits (360),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H T+  NGIN+H+A +G GP +LFLHGFP+LW+SWR Q+L  A  GYRA+APDLR
Sbjct  1    MEKIEHTTISTNGINLHVASIGSGPAILFLHGFPDLWYSWRRQLLSFAGLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +TV H+VGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDSPPSHES--YTVLHVVGDLVGLLDSLG--VDRVFLVGHDWGA  104



>ref|XP_008775994.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Phoenix 
dactylifera]
Length=254

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 4/105 (4%)
 Frame = -2

Query  315  ITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRGYG  136
            I+H+TV VNGI MH+AE GEGP VL LHGFPEL +SWRHQI  LAA GYRA+APDLRGYG
Sbjct  7    ISHRTVEVNGIRMHVAEKGEGPAVLLLHGFPELGYSWRHQIAGLAARGYRAIAPDLRGYG  66

Query  135  DTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            DT   P  D + +T+ H+VGDL+ LL +++    +VFVVGHDWGA
Sbjct  67   DTDAPP--DVASYTICHLVGDLVALLDALS--LSQVFVVGHDWGA  107



>ref|XP_002270853.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H TV  NGIN+H+AE G+GP++L LHGFPE W+SWRHQI  LA+ GYRAVAPDLR
Sbjct  1    MEGIEHTTVRANGINIHLAEKGQGPIILLLHGFPEFWYSWRHQIHALASLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+    + DS  +T FH+VGDLI +L +I    DKVFVVGHDWGA
Sbjct  61   GYGDSDAPADVDS--YTYFHLVGDLIGVLDAIG--ADKVFVVGHDWGA  104



>emb|CDY65636.1| BnaAnng20810D [Brassica napus]
Length=316

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H T+  NGIN+H+A +G GP +LFLHGFP+LW+SWR Q+L  A  GYRA+APDLR
Sbjct  1    MEKIEHTTISTNGINLHVASIGSGPAILFLHGFPDLWYSWRRQLLSFADLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+   P+ +S  +TV H+VGDL+ LL S+    D+VF+VGHDWGA
Sbjct  61   GYGDSDAPPSHES--YTVLHVVGDLVGLLDSLG--VDRVFLVGHDWGA  104



>ref|XP_011023717.1| PREDICTED: bifunctional epoxide hydrolase 2 [Populus euphratica]
Length=317

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+ I+H+ V VNGI+MHIAE G+GP+VLFLHGFPELW+SWRHQIL L++ GY+AVAPDLR
Sbjct  1    MDGISHRMVKVNGIDMHIAEKGQGPVVLFLHGFPELWYSWRHQILALSSLGYQAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP   SS ++  HIVGDLI L+  +  E  KVF+V HDWGA
Sbjct  61   GYGDTE-APASISS-YSCLHIVGDLIALIDYLGVE--KVFLVAHDWGA  104



>ref|XP_010649574.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
 emb|CBI22972.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   142 bits (359),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME + H+TV  NGIN+H+AE GEGP++LF+HGFPE W+SWRHQI  LA  GYRAVAPDLR
Sbjct  1    MEGVEHRTVKANGINIHVAEKGEGPIILFIHGFPESWYSWRHQIHALALLGYRAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGD+  AP+D  S +T  H+VGDLI +L ++    DKVFVVGHDWGA
Sbjct  61   GYGDSD-APSDVGS-YTCLHVVGDLIGVLDAMG--ADKVFVVGHDWGA  104



>ref|XP_011010960.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=316

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI H+TV  NGINMHIA  G GP++LFLHGFPELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MDKIEHRTVATNGINMHIASTGTGPVILFLHGFPELWYSWRHQLLSLSSVGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP    S++T  H+VGDLI LL S+    D VF+VGHDWGA
Sbjct  61   GYGDTD-APR-SVSEYTGLHLVGDLIGLLDSLG--IDMVFLVGHDWGA  104



>ref|XP_006577222.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Glycine 
max]
Length=250

 Score =   140 bits (354),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MHIAE GEGP+VLFLHGFPELW  W +QI+ L + GY AVAPDLR
Sbjct  1    MEGIEHRTVEVNGIKMHIAEKGEGPVVLFLHGFPELWHCWHNQIVALGSLGYHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+ DS  +T FHIV DL+ L+ S+  E+  VF+V HDWGA
Sbjct  61   GYGDTDAPPSIDS--YTCFHIVADLVALIDSLGAEQ--VFLVAHDWGA  104



>ref|XP_011010961.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=316

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            M+KI H+TV  NGINMHIA  G GP++LFLHGFPELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MDKIEHRTVATNGINMHIASTGTGPVILFLHGFPELWYSWRHQLLSLSSVGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP    S++T  H+VGDLI LL S+    D VF+VGHDWGA
Sbjct  61   GYGDTD-APR-SVSEYTGLHLVGDLIGLLDSLG--IDMVFLVGHDWGA  104



>ref|XP_008386679.1| PREDICTED: bifunctional epoxide hydrolase 2 [Malus domestica]
Length=316

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP VLFLHGFPELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MEKIEHTTVPTNGINMHVASIGAGPPVLFLHGFPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT   P+  S  +T  HIVGDLI LL  +    D+VF+V HDWGA
Sbjct  61   GFGDTDAPPSPTS--YTAMHIVGDLIGLLDHLG--IDQVFLVAHDWGA  104



>gb|KHN20392.1| Epoxide hydrolase 2 [Glycine soja]
Length=229

 Score =   140 bits (352),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 78/99 (79%), Gaps = 2/99 (2%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HKTV  NGINMH+A +G GP+VLFLHGFPELW++WRHQ+L L+A GYRA+APDLR
Sbjct  1    MEKIEHKTVSTNGINMHVASIGSGPVVLFLHGFPELWYTWRHQLLSLSAAGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKV  28
            GYGDT   P  D+S  ++ HIV DL+ LL ++  E D+V
Sbjct  61   GYGDTDAPP--DASSHSILHIVADLVGLLDALGIEPDRV  97



>gb|KEH24505.1| epoxide hydrolase [Medicago truncatula]
Length=178

 Score =   138 bits (348),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME I H+ V VNGI MHIAE G EGP+VLFLHGFPELW+SWRHQI  L + GYRAVAPDL
Sbjct  1    MEGIEHRRVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP+  SS +T FHIVGDL+ L+  +    D+VF+V HDWGA
Sbjct  61   RGYGDTE-APSSISS-YTGFHIVGDLVALIDLLGV--DQVFLVAHDWGA  105



>ref|XP_003626243.1| Epoxide hydrolase [Medicago truncatula]
 gb|ABN08020.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82461.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   142 bits (358),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME I H+TV VNGI MHIAE G EGP+VLFLHGFPELW+SWRHQI  L + GYRAVAPDL
Sbjct  1    MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP   SS +T+FH+VGD++ L+ S+    D+VF+V HDWGA
Sbjct  61   RGYGDTD-APASISS-YTIFHLVGDIVALIDSLG--VDQVFLVAHDWGA  105



>gb|AFZ93648.1| epoxide hydrolase [Euphorbia lathyris]
 gb|AFZ93653.1| epoxide hydrolase [Euphorbia lathyris]
Length=315

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H  V  NGINMH+A +GEG  +LFLHG+PELW+SWRHQ+L L++ GYR +APDLR
Sbjct  1    MEKIEHTKVATNGINMHVASIGEGRPILFLHGYPELWYSWRHQLLSLSSLGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP+    K+TV HIVGDL+ LL ++  + D+VF+VGHDWGA
Sbjct  61   GYGDTD-APH-SVEKYTVLHIVGDLVGLLDAL--QIDQVFLVGHDWGA  104



>gb|AFK41347.1| unknown [Medicago truncatula]
Length=269

 Score =   141 bits (355),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME I H+TV VNGI MHIAE G EGP+VLFLHGFPELW+SWRHQI+ L + GYRAVAPDL
Sbjct  1    MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIVALGSLGYRAVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP+  SS +T FHIVGDL+ L+  +    D+VF+V HDWGA
Sbjct  61   RGYGDTE-APSSISS-YTGFHIVGDLVALIDLLG--VDQVFLVAHDWGA  105



>ref|XP_004247402.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=318

 Score =   142 bits (358),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HKTV  NGI MH+AE+GEGP VLFLHGFPELW+SWRHQ+L+ +  GYRA+APDLR
Sbjct  1    MEKIQHKTVSANGIKMHVAEIGEGPAVLFLHGFPELWYSWRHQLLYFSNKGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P++ SS +T FHIVGDLI LL  +  E  KVF++GHDWGA
Sbjct  61   GYGDTE-IPSEISS-YTAFHIVGDLISLLDILDLE--KVFLIGHDWGA  104



>gb|ACJ84958.1| unknown [Medicago truncatula]
 gb|AFK43465.1| unknown [Medicago truncatula]
Length=319

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME I H+TV VNGI MHIAE G EGP+VLFLHGFPELW+SWRHQI+ L + GYRAVAPDL
Sbjct  1    MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIVALGSLGYRAVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP+  SS +T FHIVGDL+ L+  +    D+VF+V HDWGA
Sbjct  61   RGYGDTE-APSSISS-YTGFHIVGDLVALIDLLG--VDQVFLVAHDWGA  105



>ref|XP_003626245.1| Epoxide hydrolase [Medicago truncatula]
 gb|ABN08024.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82463.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME I H+TV VNGI MHIAE G EGP+VLFLHGFPELW+SWRHQI+ L + GYRAVAPDL
Sbjct  1    MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIVALGSLGYRAVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT  AP+  SS +T FHIVGDL+ L+  +    D+VF+V HDWGA
Sbjct  61   RGYGDTE-APSSISS-YTGFHIVGDLVALIDLLG--VDQVFLVAHDWGA  105



>ref|XP_002884518.1| hypothetical protein ARALYDRAFT_317420 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60777.1| hypothetical protein ARALYDRAFT_317420 [Arabidopsis lyrata subsp. 
lyrata]
Length=331

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 86/110 (78%), Gaps = 4/110 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG--EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPD  151
            ME I H+ V VNGI MHIAE G  EGP+VL LHGFP+LW++WRHQI  L++ GYRAVAPD
Sbjct  1    MEGIDHRMVSVNGITMHIAEKGPKEGPVVLLLHGFPDLWYTWRHQICGLSSLGYRAVAPD  60

Query  150  LRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            LRGYGD+     +  S++T  ++VGDL+ LL S+A +++KVF+VGHDWGA
Sbjct  61   LRGYGDSDSP--ESFSEYTCLNVVGDLVALLDSVAGDQEKVFLVGHDWGA  108



>ref|XP_010042740.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=238

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 84/110 (76%), Gaps = 6/110 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGE--GPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPD  151
            ME I H TV  NGINMH+A +G   G  VLFLHGFP+LW++WRHQ+L LAA GYRAVAPD
Sbjct  1    METIEHATVPTNGINMHVASVGGAGGDTVLFLHGFPDLWYTWRHQMLSLAALGYRAVAPD  60

Query  150  LRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            LRGYGDT   P+  ++ +T FHIVGDL+ LL ++  E  +VF+VGHDWGA
Sbjct  61   LRGYGDTDAPPS--AASYTAFHIVGDLVGLLDALGVE--RVFLVGHDWGA  106



>ref|XP_006472971.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=571

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I H  VGVNGI MHIAE GEGP+VLFLHGFPELW++WR QIL L++ GYRA+APDLR
Sbjct  1    MEEIKHGMVGVNGIRMHIAEKGEGPVVLFLHGFPELWYTWRRQILALSSLGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP+  SS ++  HIVGDL+ L+ S+  E+  VFVV HDWGA
Sbjct  61   GYGDTE-APSSISS-YSCHHIVGDLVALINSLGVEQ--VFVVAHDWGA  104


 Score =   142 bits (357),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 3/113 (3%)
 Frame = -2

Query  339  RSRREMEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAV  160
            + RR+M++I H TV VNGI +HIAE GE P+VLFLHGFPE W++WRHQIL L+  GYRAV
Sbjct  316  KFRRKMDEIKHSTVNVNGIKIHIAEKGEVPVVLFLHGFPEFWYAWRHQILALSCLGYRAV  375

Query  159  APDLRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            APDLRGYGDT   P+   + +T FH+ GD+I L+  +  E+  VFVV HD+GA
Sbjct  376  APDLRGYGDTE-VPSSSFTSYTCFHVAGDIIALIDFLGVEQ--VFVVAHDFGA  425



>ref|XP_006359858.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=318

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/108 (69%), Positives = 87/108 (81%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI HK V VNGI MH+AE+GEGP VLFLHGFPELW+SWRHQ+L+ +  GYRA+APDLR
Sbjct  1    MEKIQHKNVTVNGIKMHVAEIGEGPAVLFLHGFPELWYSWRHQLLYFSNKGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P++ SS +T FHIVGDLI LL  +  E  KVF+VGHDWGA
Sbjct  61   GYGDTE-IPSEISS-YTAFHIVGDLIALLDILDLE--KVFLVGHDWGA  104



>ref|XP_008454330.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=316

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H T+  NGINMHIA +G GP+VL LHGFPELW+SWRHQ+L+L++ GYRA+APDLR
Sbjct  1    MEAIEHTTINTNGINMHIASIGTGPVVLLLHGFPELWYSWRHQLLYLSSVGYRAIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT  AP +  + +T FHIVGDL+  L  +  E  KVFVVGHDWGA
Sbjct  61   GFGDTD-AP-ESHTVYTPFHIVGDLVGALDELGIE--KVFVVGHDWGA  104



>gb|ACJ85188.1| unknown [Medicago truncatula]
Length=316

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME I H+TV VNGI MHIAE G EGP+VLFLHGFPELW+SWRHQI  L + GYRAVAPDL
Sbjct  1    MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT   P+  +S +T+FH+VGD++ L+ S+    D+VF+V HDWGA
Sbjct  61   RGYGDTD-VPSSVNS-YTIFHLVGDIVALIDSLG--VDQVFLVAHDWGA  105



>ref|XP_003626241.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82459.1| epoxide hydrolase [Medicago truncatula]
Length=316

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME I H+TV VNGI MHIAE G EGP+VLFLHGFPELW+SWRHQI  L + GYRAVAPDL
Sbjct  1    MEGIEHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT   P+  +S +T+FH+VGD++ L+ S+    D+VF+V HDWGA
Sbjct  61   RGYGDTD-VPSSVNS-YTIFHLVGDIVALIDSLG--VDQVFLVAHDWGA  105



>ref|XP_010039296.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=325

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 85/109 (78%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGP-LVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            MEKI H TV  NGINMH+A +G+GP  VLF+HGFPELW+SWRHQ++ LAA GYR VAPDL
Sbjct  1    MEKIEHATVRTNGINMHVASVGDGPDTVLFIHGFPELWYSWRHQMVSLAALGYRTVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYG+T   P+ DS  +T FH+VGDL+ +L ++     +VFVVGHDWGA
Sbjct  61   RGYGNTDAPPSVDS--YTAFHVVGDLVGMLDALG--IGRVFVVGHDWGA  105



>gb|AFK39155.1| unknown [Medicago truncatula]
Length=316

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 86/109 (79%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELG-EGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            ME I H+TV VNGI MHIAE G EGP+VLFLHGFPELW+SWRHQI  L + GYRAVAPDL
Sbjct  1    MEGIVHRTVEVNGIKMHIAEKGKEGPVVLFLHGFPELWYSWRHQIAALGSLGYRAVAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYGDT   P+  +S +T+FH+VGD++ L+ S+    D+VF+V HDWGA
Sbjct  61   RGYGDTD-VPSSVNS-YTIFHLVGDVVALIDSLG--VDQVFLVAHDWGA  105



>ref|XP_011006451.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=322

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 85/110 (77%), Gaps = 4/110 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGE--GPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPD  151
            M+ I H+T+  NGI MH+A  G    P++LFLHGFPE W+SWR+QIL L++ GYR+VAPD
Sbjct  1    MDSIEHRTIHANGITMHVAIKGSENAPVILFLHGFPESWYSWRYQILALSSLGYRSVAPD  60

Query  150  LRGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            LRGYGDT  AP + +S +T FH+VGDLI LL  +AP EDKVFVV HDWGA
Sbjct  61   LRGYGDTD-APAEITS-YTCFHLVGDLIGLLDVVAPNEDKVFVVAHDWGA  108



>ref|XP_009414133.1| PREDICTED: bifunctional epoxide hydrolase 2 [Musa acuminata subsp. 
malaccensis]
Length=349

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 84/107 (79%), Gaps = 4/107 (4%)
 Frame = -2

Query  321  EKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLRG  142
            E I+H+ V VNGINMH+AE GEGP VL LHGFPELW++WRHQ+  LAA G+RAVAPDLRG
Sbjct  35   EGISHRMVSVNGINMHVAEKGEGPTVLLLHGFPELWYTWRHQMHGLAACGFRAVAPDLRG  94

Query  141  YGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            +GDT       ++ +++ HIVGDLI LL S+   +DKVFVVGHDWG+
Sbjct  95   FGDTDAP--PAAAAYSILHIVGDLIALLDSLG--QDKVFVVGHDWGS  137



>gb|KHG24497.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=317

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 85/108 (79%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME+I HK V VNGI+MH+AE GEGP++LFLHGFPELW++WRHQI+ L++ GY AVAPDLR
Sbjct  1    MERIRHKMVNVNGISMHVAEKGEGPVILFLHGFPELWYTWRHQIIALSSLGYHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP   SS ++   IVGDL+ L+ S+  E+  VF+V HDWGA
Sbjct  61   GYGDTE-APTAISS-YSCMQIVGDLVALIDSLGVEQ--VFLVAHDWGA  104



>ref|XP_010088295.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB33520.1| Epoxide hydrolase 2 [Morus notabilis]
Length=316

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            MEKI H TV  NGINMH+A +G GP +LFLHGFPELW+SWRHQ++ L++ GYR +APDLR
Sbjct  1    MEKIEHSTVHTNGINMHVASVGTGPAILFLHGFPELWYSWRHQMISLSSLGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+  S  +T  HIVGDL+ L+  +  E  K+F+VGHDWGA
Sbjct  61   GYGDTDAPPSPTS--YTSLHIVGDLVGLIDHLVIE--KLFLVGHDWGA  104



>gb|KDP28185.1| hypothetical protein JCGZ_13956 [Jatropha curcas]
Length=315

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H  V  NGINMH+A +G GP +LFLHGFPELW+SWRHQ+L L+A GYR +APDLR
Sbjct  1    MENIQHIRVAANGINMHVATIGTGPAILFLHGFPELWYSWRHQLLHLSALGYRCIAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            G+GDT  AP +  +++T FHIVGDLI LL  +  E  KVF+VGHDWGA
Sbjct  61   GFGDTD-AP-ESVTEYTGFHIVGDLIGLLDELGIE--KVFLVGHDWGA  104



>ref|XP_010038235.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=325

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGP-LVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDL  148
            MEKI H TV  NGINMH+A +G+GP  VLF+HGFPELW+SWRHQ+L LAA GYRA+APDL
Sbjct  1    MEKIEHATVRTNGINMHVASVGDGPDTVLFIHGFPELWYSWRHQMLSLAALGYRAIAPDL  60

Query  147  RGYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            RGYG T   P  +S  +T FH+VGDL+ +L ++     +VFVVGHDWGA
Sbjct  61   RGYGGTDAPPRVES--YTAFHVVGDLVGMLDALG--IGRVFVVGHDWGA  105



>gb|KHN03961.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MHIAE GEGP+VLFLHGFPELW  W +QI+ L + GY AVAPDLR
Sbjct  1    MEGIEHRTVEVNGIKMHIAEKGEGPVVLFLHGFPELWHCWHNQIVALGSLGYHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT   P+ DS  +T FHIV DL+ L+ S+  E+  VF+V HDWGA
Sbjct  61   GYGDTDAPPSIDS--YTCFHIVADLVALIDSLGAEQ--VFLVAHDWGA  104



>ref|XP_007147001.1| hypothetical protein PHAVU_006G088400g [Phaseolus vulgaris]
 gb|ESW18995.1| hypothetical protein PHAVU_006G088400g [Phaseolus vulgaris]
Length=316

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  324  MEKITHKTVGVNGINMHIAELGEGPLVLFLHGFPELWFSWRHQILFLAAHGYRAVAPDLR  145
            ME I H+TV VNGI MH+AE GEGP VLFLHGFPELW++WRHQIL L++ GY AVAPDLR
Sbjct  1    MEYIVHRTVEVNGIKMHVAEKGEGPAVLFLHGFPELWYTWRHQILDLSSRGYHAVAPDLR  60

Query  144  GYGDTTGAPNDDSSKFTVFHIVGDLIELLQSIAPEEDKVFVVGHDWGA  1
            GYGDT  AP   SS ++ F IVGDL+ L+  +    D+VF+V HDWGA
Sbjct  61   GYGDTE-APASMSS-YSCFDIVGDLVALIDLLG--VDQVFLVAHDWGA  104



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 506240637208