BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25490_g1_i6 len=956 path=[8401:0-321 8723:322-388 8790:389-435
8836:436-480 14880:481-490 8890:491-524 2232:525-538 14994:539-549
8947:550-621 15027:622-622 9019:623-624 9021:625-663 9059:664-686
5338:687-691 6770:692-726 15096:727-741 15111:742-742 15112:743-745
9139:746-774 15138:775-778 9172:779-836 9230:837-850 15153:851-862
9256:863-864 9258:865-952 15215:953-955]

Length=956
                                                                      Score     E

ref|NP_001274907.1|  epoxide hydrolase                                  272   1e-85   
ref|NP_001274962.1|  epoxide hydrolase                                  272   2e-85   
ref|XP_004239806.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    265   7e-83   
ref|NP_001275417.1|  epoxide hydrolase                                  265   9e-83   
pdb|2CJP|A  Chain A, Structure Of Potato (Solanum Tuberosum) Epox...    265   1e-82   
pdb|3CXU|A  Chain A, Structure Of A Y149f Mutant Of Epoxide Hydro...    263   3e-82   
ref|XP_004239808.1|  PREDICTED: bifunctional epoxide hydrolase 2        262   1e-81   
ref|XP_009775927.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    259   2e-80   
ref|XP_009598630.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    258   4e-80   
ref|XP_003550367.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    252   7e-78   
emb|CAJ19276.1|  putative epoxide hydrolase                             251   2e-77   Solanum commersonii
emb|CDO98838.1|  unnamed protein product                                250   5e-77   
gb|AAA81893.1|  epoxide hydrolase                                       249   6e-77   Solanum tuberosum [potatoes]
ref|NP_001275381.1|  epoxide hydrolase                                  249   1e-76   
gb|EYU21013.1|  hypothetical protein MIMGU_mgv1a010239mg                248   3e-76   
gb|EYU43973.1|  hypothetical protein MIMGU_mgv1a010247mg                247   5e-76   
ref|XP_010105136.1|  Epoxide hydrolase 2                                248   1e-75   
gb|KDO71745.1|  hypothetical protein CISIN_1g017221mg                   248   1e-75   
ref|XP_006489040.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    245   2e-74   
ref|XP_006419515.1|  hypothetical protein CICLE_v10005186mg             245   2e-74   
ref|XP_004508197.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    244   2e-74   
ref|XP_004239805.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    242   6e-74   
ref|XP_010024724.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    240   5e-73   
ref|XP_009622776.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    240   5e-73   
ref|XP_011090999.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    239   5e-73   
ref|XP_007154300.1|  hypothetical protein PHAVU_003G106900g             238   2e-72   
ref|XP_010043042.1|  PREDICTED: bifunctional epoxide hydrolase 2        237   7e-72   
ref|XP_006600362.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    237   1e-71   
ref|XP_009352305.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    235   3e-71   
ref|XP_002516953.1|  epoxide hydrolase, putative                        235   3e-71   Ricinus communis
ref|XP_010024723.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    234   5e-71   
ref|XP_008341331.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    234   6e-71   
gb|KDP27824.1|  hypothetical protein JCGZ_18904                         234   7e-71   
ref|XP_008789846.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    234   9e-71   
gb|KEH32298.1|  epoxide hydrolase                                       235   9e-71   
ref|XP_006419522.1|  hypothetical protein CICLE_v10005425mg             234   1e-70   
ref|XP_004296863.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    233   2e-70   
ref|XP_006489041.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    233   2e-70   
ref|XP_006349824.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    233   3e-70   
ref|XP_002314368.1|  hypothetical protein POPTR_0010s01430g             233   3e-70   Populus trichocarpa [western balsam poplar]
gb|KFK41013.1|  hypothetical protein AALP_AA2G073900                    232   4e-70   
ref|XP_010105137.1|  Epoxide hydrolase 2                                232   4e-70   
ref|XP_004252913.1|  PREDICTED: bifunctional epoxide hydrolase 2        232   4e-70   
ref|XP_009350800.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    232   5e-70   
ref|XP_008371325.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    232   5e-70   
ref|XP_002314371.1|  hypothetical protein POPTR_0010s01440g             232   6e-70   Populus trichocarpa [western balsam poplar]
ref|XP_011006450.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    232   6e-70   
ref|XP_009622181.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    231   9e-70   
ref|XP_010911257.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    231   2e-69   
ref|XP_004229258.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    231   2e-69   
ref|XP_008340789.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    230   2e-69   
ref|XP_008361962.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    229   4e-69   
ref|XP_009411662.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    229   4e-69   
emb|CDP10752.1|  unnamed protein product                                229   5e-69   
emb|CAZ86692.1|  epoxide hydrolase 1                                    229   9e-69   
ref|XP_007222764.1|  hypothetical protein PRUPE_ppa008756mg             229   9e-69   
ref|XP_007221833.1|  hypothetical protein PRUPE_ppa020197mg             228   1e-68   
ref|XP_009788447.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    228   1e-68   
ref|XP_010921626.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    228   2e-68   
ref|XP_007222693.1|  hypothetical protein PRUPE_ppa008676mg             228   2e-68   
ref|XP_008223225.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    226   2e-68   
ref|XP_008246047.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    226   2e-68   
gb|KDP27828.1|  hypothetical protein JCGZ_18908                         227   3e-68   
ref|XP_009757467.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    228   4e-68   
emb|CDY09722.1|  BnaC07g33390D                                          227   4e-68   
gb|AFK34299.1|  unknown                                                 227   4e-68   
ref|XP_009622179.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    227   6e-68   
ref|XP_010094462.1|  Epoxide hydrolase 2                                226   6e-68   
gb|KDP27825.1|  hypothetical protein JCGZ_18905                         226   7e-68   
gb|KHN43502.1|  Epoxide hydrolase 2                                     222   8e-68   
gb|AFK41660.1|  unknown                                                 226   9e-68   
ref|XP_008223222.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    226   1e-67   
ref|XP_010104146.1|  Epoxide hydrolase 2                                226   1e-67   
emb|CDX90550.1|  BnaA03g42310D                                          226   1e-67   
ref|XP_006414412.1|  hypothetical protein EUTSA_v10025488mg             227   2e-67   
ref|XP_009757465.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    225   2e-67   
ref|XP_010649574.1|  PREDICTED: bifunctional epoxide hydrolase 2        225   2e-67   
ref|XP_006342824.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    225   2e-67   
ref|XP_008775993.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    225   2e-67   
ref|XP_006414587.1|  hypothetical protein EUTSA_v10025505mg             226   3e-67   
ref|XP_008784769.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    225   3e-67   
ref|XP_011006451.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    225   3e-67   
ref|XP_004494384.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    224   3e-67   
ref|XP_009136735.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    226   3e-67   
ref|XP_006378063.1|  hypothetical protein POPTR_0010s01420g             224   4e-67   
ref|XP_006342825.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    224   5e-67   
ref|XP_010039619.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    224   5e-67   
ref|XP_009386486.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    224   7e-67   
ref|XP_004298141.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    223   1e-66   
ref|XP_011091000.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    223   1e-66   
gb|KGN66047.1|  hypothetical protein Csa_1G569240                       223   1e-66   
ref|XP_009391487.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    223   1e-66   
ref|XP_004290776.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    223   1e-66   
ref|XP_010039627.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    223   1e-66   
ref|XP_007147004.1|  hypothetical protein PHAVU_006G088600g             223   2e-66   
ref|XP_006433457.1|  hypothetical protein CICLE_v10001881mg             223   2e-66   
emb|CBI22970.3|  unnamed protein product                                219   2e-66   
ref|XP_008784772.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    222   3e-66   
ref|XP_004229259.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    223   3e-66   
ref|XP_008784771.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    223   3e-66   
ref|XP_006489255.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    220   4e-66   
ref|XP_007035641.1|  Alpha/beta-Hydrolases superfamily protein          224   4e-66   
ref|XP_008784770.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    223   6e-66   
ref|XP_003554527.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    221   7e-66   
ref|XP_007163124.1|  hypothetical protein PHAVU_001G208300g             221   8e-66   
ref|XP_010914487.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    221   1e-65   
ref|XP_006644009.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    221   1e-65   
ref|XP_011079631.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    221   1e-65   
gb|EPS69728.1|  epoxide hydrolase                                       220   1e-65   
ref|XP_003632381.1|  PREDICTED: bifunctional epoxide hydrolase 2        220   1e-65   
gb|AAM28292.1|  epoxide hydrolase                                       220   1e-65   Ananas comosus
emb|CDO98837.1|  unnamed protein product                                221   2e-65   
ref|XP_007050977.1|  Alpha/beta-Hydrolases superfamily protein          220   2e-65   
ref|XP_008454327.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    220   2e-65   
ref|XP_006654297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    217   3e-65   
ref|XP_010921625.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    216   3e-65   
ref|XP_010434902.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    221   3e-65   
ref|XP_006419517.1|  hypothetical protein CICLE_v10005451mg             219   3e-65   
emb|CAD31713.1|  epoxide hydrolase                                      218   4e-65   Cicer arietinum [garbanzo]
gb|EYU46741.1|  hypothetical protein MIMGU_mgv1a009984mg                219   5e-65   
ref|XP_006604802.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    219   5e-65   
emb|CDP17111.1|  unnamed protein product                                219   6e-65   
gb|EYU43974.1|  hypothetical protein MIMGU_mgv1a009814mg                219   6e-65   
ref|XP_002271210.1|  PREDICTED: bifunctional epoxide hydrolase 2        218   9e-65   Vitis vinifera
gb|AES82420.2|  epoxide hydrolase                                       218   1e-64   
ref|XP_007031041.1|  Alpha/beta-Hydrolases superfamily protein          218   1e-64   
gb|KHG21329.1|  Epoxide hydrolase 2                                     220   1e-64   
ref|XP_004240550.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    218   2e-64   
gb|KEH24395.1|  epoxide hydrolase                                       218   2e-64   
ref|XP_006355815.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    217   2e-64   
ref|XP_010693594.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    219   2e-64   
ref|XP_010038230.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    217   2e-64   
ref|XP_004494576.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    217   3e-64   
gb|ACU23321.1|  unknown                                                 216   4e-64   Glycine max [soybeans]
ref|XP_003554635.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    216   4e-64   
ref|XP_008355493.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    216   4e-64   
ref|XP_002283462.1|  PREDICTED: bifunctional epoxide hydrolase 2        216   6e-64   Vitis vinifera
ref|XP_007200440.1|  hypothetical protein PRUPE_ppa008875mg             216   7e-64   
ref|XP_003626243.1|  Epoxide hydrolase                                  216   7e-64   
ref|XP_009414133.1|  PREDICTED: bifunctional epoxide hydrolase 2        216   9e-64   
ref|XP_008235117.1|  PREDICTED: bifunctional epoxide hydrolase 2        215   1e-63   
ref|NP_001055069.1|  Os05g0273800                                       216   1e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003626245.1|  Epoxide hydrolase                                  215   1e-63   
emb|CBI36880.3|  unnamed protein product                                211   1e-63   
gb|ACJ84958.1|  unknown                                                 215   1e-63   Medicago truncatula
gb|KEH24503.1|  epoxide hydrolase                                       215   1e-63   
ref|XP_006472971.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    222   1e-63   
ref|XP_010449872.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    217   2e-63   
ref|XP_009775353.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    215   2e-63   
gb|ACU19478.1|  unknown                                                 215   2e-63   Glycine max [soybeans]
ref|XP_009629123.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    214   3e-63   
ref|XP_006444386.1|  hypothetical protein CICLE_v10023691mg             214   3e-63   
ref|XP_003626244.1|  Epoxide hydrolase                                  214   3e-63   
gb|EMS45147.1|  Epoxide hydrolase 2                                     211   4e-63   
ref|XP_003554633.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    215   4e-63   
ref|XP_009335707.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    214   4e-63   
ref|NP_001240943.1|  uncharacterized protein LOC100803974               214   5e-63   
ref|NP_193331.6|  alpha/beta-Hydrolases superfamily protein             215   5e-63   Arabidopsis thaliana [mouse-ear cress]
emb|CDP17206.1|  unnamed protein product                                214   5e-63   
ref|XP_007015353.1|  Alpha/beta-Hydrolases superfamily protein          214   5e-63   
gb|KHG07158.1|  Epoxide hydrolase 2                                     213   6e-63   
ref|XP_006645722.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    211   7e-63   
gb|AFK45529.1|  unknown                                                 213   7e-63   
ref|NP_001238563.1|  epoxide hydrolase                                  214   8e-63   
gb|ACU19450.1|  unknown                                                 213   8e-63   Glycine max [soybeans]
ref|XP_010914488.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    213   8e-63   
gb|KHN43314.1|  Epoxide hydrolase 2                                     213   9e-63   
ref|XP_010914485.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    213   9e-63   
ref|XP_010674075.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    213   1e-62   
ref|XP_011010960.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    213   1e-62   
ref|XP_011010961.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    213   1e-62   
ref|XP_009771842.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    213   2e-62   
ref|NP_001042621.1|  Os01g0255000                                       213   2e-62   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002318980.2|  epoxide hydrolase family protein                   212   2e-62   Populus trichocarpa [western balsam poplar]
emb|CAA55294.1|  epoxide hydrolase                                      213   2e-62   Glycine max [soybeans]
dbj|BAK07144.1|  predicted protein                                      213   2e-62   
ref|XP_007147005.1|  hypothetical protein PHAVU_006G088700g             212   2e-62   
ref|XP_010269590.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    212   2e-62   
ref|XP_004290809.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    212   2e-62   
gb|KHG24497.1|  Epoxide hydrolase 2                                     212   2e-62   
ref|XP_006480000.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    212   3e-62   
gb|EMT09897.1|  hypothetical protein F775_52362                         212   3e-62   
ref|NP_001042622.1|  Os01g0255100                                       212   3e-62   Oryza sativa Japonica Group [Japonica rice]
gb|ACJ84799.1|  unknown                                                 211   4e-62   Medicago truncatula
ref|XP_009393199.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    211   4e-62   
ref|XP_003604118.1|  Epoxide hydrolase                                  211   4e-62   
ref|XP_010556730.1|  PREDICTED: bifunctional epoxide hydrolase 2        211   5e-62   
gb|KDP28184.1|  hypothetical protein JCGZ_13955                         211   5e-62   
ref|XP_004134492.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    211   5e-62   
ref|XP_007015342.1|  Alpha/beta-Hydrolases superfamily protein          211   5e-62   
ref|XP_009620847.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    211   6e-62   
ref|XP_008386679.1|  PREDICTED: bifunctional epoxide hydrolase 2        211   6e-62   
ref|XP_008450607.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    210   9e-62   
ref|XP_008775992.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    210   1e-61   
ref|XP_010039280.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    211   1e-61   
ref|NP_001132040.1|  uncharacterized protein LOC100193450               212   1e-61   Zea mays [maize]
ref|XP_006396441.1|  hypothetical protein EUTSA_v10028814mg             210   1e-61   
emb|CDY65636.1|  BnaAnng20810D                                          210   1e-61   
ref|XP_009111296.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    210   1e-61   
gb|AFK39700.1|  unknown                                                 210   1e-61   
emb|CDY50394.1|  BnaCnng19260D                                          210   2e-61   
gb|AFW56302.1|  hypothetical protein ZEAMMB73_530848                    212   2e-61   
gb|KHN03961.1|  Epoxide hydrolase 2                                     209   2e-61   
gb|KHN20253.1|  Epoxide hydrolase 2                                     209   2e-61   
ref|XP_002874922.1|  hypothetical protein ARALYDRAFT_490337             209   2e-61   
ref|XP_002443185.1|  hypothetical protein SORBIDRAFT_08g014640          211   2e-61   Sorghum bicolor [broomcorn]
ref|XP_004494951.1|  PREDICTED: uncharacterized protein LOC101500941    217   2e-61   
ref|XP_008807392.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    209   3e-61   
ref|XP_003626202.1|  Epoxide hydrolase                                  218   3e-61   
ref|NP_567228.1|  putative epoxide hydrolase                            209   3e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008454330.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    209   3e-61   
ref|XP_010693593.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    211   3e-61   
ref|XP_003556522.1|  PREDICTED: bifunctional epoxide hydrolase 2 ...    209   4e-61   
gb|AES82458.2|  epoxide hydrolase                                       208   5e-61   
ref|XP_006288215.1|  hypothetical protein CARUB_v10001452mg             209   6e-61   
ref|XP_006359858.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    208   8e-61   
ref|XP_003563920.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    209   9e-61   
ref|XP_008438903.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    209   1e-60   
gb|ACE82565.1|  epoxide hydrolase                                       207   1e-60   Nicotiana benthamiana
ref|XP_004152245.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    207   1e-60   
ref|XP_004965308.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    209   1e-60   
ref|XP_004967831.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    207   1e-60   
ref|XP_004152242.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    207   2e-60   
ref|XP_010038231.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    207   2e-60   
gb|AFK46740.1|  unknown                                                 207   2e-60   
ref|XP_010544298.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    207   2e-60   
gb|EMS55500.1|  Epoxide hydrolase 2                                     205   2e-60   
gb|AFZ93648.1|  epoxide hydrolase                                       206   3e-60   
ref|XP_010088295.1|  Epoxide hydrolase 2                                206   3e-60   
gb|KDP28186.1|  hypothetical protein JCGZ_13957                         206   3e-60   
ref|XP_010088294.1|  Epoxide hydrolase 2                                206   5e-60   
ref|XP_002523108.1|  epoxide hydrolase, putative                        206   7e-60   Ricinus communis
ref|XP_007147001.1|  hypothetical protein PHAVU_006G088400g             205   8e-60   
ref|XP_006283220.1|  hypothetical protein CARUB_v10004250mg             214   8e-60   
ref|NP_001276233.1|  bifunctional epoxide hydrolase 2-like              205   8e-60   
gb|EMT04118.1|  hypothetical protein F775_13984                         205   1e-59   
ref|XP_011041992.1|  PREDICTED: bifunctional epoxide hydrolase 2        205   1e-59   
ref|XP_008454322.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    205   1e-59   
ref|XP_006444387.1|  hypothetical protein CICLE_v10021228mg             205   1e-59   
ref|XP_011092097.1|  PREDICTED: bifunctional epoxide hydrolase 2        204   2e-59   
ref|XP_006344695.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    204   2e-59   
gb|KFK30821.1|  hypothetical protein AALP_AA6G030400                    204   2e-59   
ref|XP_010102979.1|  Epoxide hydrolase 2                                204   2e-59   
ref|XP_002455386.1|  hypothetical protein SORBIDRAFT_03g009830          204   3e-59   Sorghum bicolor [broomcorn]
gb|KDP23458.1|  hypothetical protein JCGZ_23291                         204   3e-59   
gb|EYU46742.1|  hypothetical protein MIMGU_mgv1a010264mg                204   3e-59   
ref|XP_011023717.1|  PREDICTED: bifunctional epoxide hydrolase 2        204   3e-59   
ref|XP_010038235.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    204   4e-59   
ref|XP_010684348.1|  PREDICTED: bifunctional epoxide hydrolase 2        203   5e-59   
ref|XP_010039296.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    204   5e-59   
gb|KDO87161.1|  hypothetical protein CISIN_1g048209mg                   204   8e-59   
gb|KEH24510.1|  epoxide hydrolase                                       202   9e-59   
ref|XP_004247402.1|  PREDICTED: bifunctional epoxide hydrolase 2        202   9e-59   
ref|XP_004230258.1|  PREDICTED: bifunctional epoxide hydrolase 2        202   9e-59   
ref|XP_010456047.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    202   1e-58   
ref|XP_004494577.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    203   1e-58   
ref|XP_009393200.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    202   1e-58   
ref|XP_010449873.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    202   2e-58   
emb|CDP17110.1|  unnamed protein product                                202   2e-58   
ref|XP_010422608.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    202   2e-58   
ref|XP_007147002.1|  hypothetical protein PHAVU_006G088500g             202   2e-58   
dbj|BAJ99775.1|  predicted protein                                      202   2e-58   
ref|XP_007144960.1|  hypothetical protein PHAVU_007G198000g             201   3e-58   
ref|XP_002320333.2|  epoxide hydrolase family protein                   201   4e-58   Populus trichocarpa [western balsam poplar]
ref|XP_009629075.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    201   4e-58   
gb|KCW84776.1|  hypothetical protein EUGRSUZ_B015791                    196   4e-58   
ref|XP_004152244.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    201   4e-58   
emb|CAB46034.1|  putative epoxide hydrolase                             206   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002512456.1|  epoxide hydrolase, putative                        200   7e-58   Ricinus communis
emb|CDY05187.1|  BnaC05g46160D                                          201   7e-58   
ref|XP_010429523.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    201   7e-58   
ref|XP_003626240.1|  Epoxide hydrolase                                  209   1e-57   
ref|XP_010434903.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    200   2e-57   
gb|EPS62395.1|  hypothetical protein M569_12392                         199   2e-57   
gb|ACN28644.1|  unknown                                                 198   2e-57   Zea mays [maize]
ref|XP_002270853.1|  PREDICTED: bifunctional epoxide hydrolase 2        199   2e-57   Vitis vinifera
gb|ACJ85188.1|  unknown                                                 199   2e-57   Medicago truncatula
ref|XP_002302724.1|  epoxide hydrolase family protein                   199   2e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004156834.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    199   2e-57   
ref|XP_006408053.1|  hypothetical protein EUTSA_v100212090mg            197   3e-57   
ref|XP_003626241.1|  Epoxide hydrolase                                  198   4e-57   
ref|XP_009788536.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    198   4e-57   
emb|CDM82646.1|  unnamed protein product                                198   4e-57   
ref|XP_010548981.1|  PREDICTED: bifunctional epoxide hydrolase 2        199   4e-57   
emb|CBI22973.3|  unnamed protein product                                194   4e-57   
ref|XP_011015179.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    198   5e-57   
ref|XP_010038233.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    199   5e-57   
ref|XP_008454325.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    198   5e-57   
gb|ACE82566.1|  epoxide hydrolase                                       198   6e-57   
ref|XP_004152361.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    197   9e-57   
tpg|DAA53983.1|  TPA: epoxide hydrolase 2                               197   1e-56   
ref|XP_010544295.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    197   1e-56   
ref|XP_010038234.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    197   1e-56   
gb|KDP28185.1|  hypothetical protein JCGZ_13956                         197   1e-56   
ref|XP_002868171.1|  hypothetical protein ARALYDRAFT_329917             202   1e-56   
ref|NP_001148885.1|  epoxide hydrolase 2                                197   1e-56   
ref|XP_003566463.1|  PREDICTED: bifunctional epoxide hydrolase 2        197   1e-56   
emb|CAD30841.1|  soluble epoxide hydrolase                              197   1e-56   
ref|XP_010440228.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    197   2e-56   
gb|KCW50060.1|  hypothetical protein EUGRSUZ_K03501                     197   2e-56   
emb|CDY27752.1|  BnaA05g31610D                                          197   2e-56   
ref|XP_009147218.1|  PREDICTED: bifunctional epoxide hydrolase 2        197   2e-56   
ref|XP_006414415.1|  hypothetical protein EUTSA_v10025689mg             197   2e-56   
ref|XP_009140747.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    196   2e-56   
gb|ADP68585.1|  epoxide hydrolase A                                     196   3e-56   
ref|XP_006414584.1|  hypothetical protein EUTSA_v10025778mg             196   3e-56   
gb|AAO27849.1|AF482450_1  soluble epoxide hydrolase                     196   5e-56   
gb|KFK37968.1|  hypothetical protein AALP_AA3G053200                    196   5e-56   
emb|CDY48181.1|  BnaA04g15450D                                          195   6e-56   
ref|XP_010544465.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    194   8e-56   
gb|AFK39155.1|  unknown                                                 195   9e-56   
ref|XP_011079630.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    195   1e-55   
ref|XP_002523107.1|  epoxide hydrolase, putative                        195   1e-55   
ref|XP_010524544.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    196   1e-55   
ref|XP_010546737.1|  PREDICTED: bifunctional epoxide hydrolase 2        195   1e-55   
ref|XP_010429482.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    194   2e-55   
emb|CDY09727.1|  BnaC07g33340D                                          194   2e-55   
emb|CDY50393.1|  BnaCnng19250D                                          191   3e-55   
gb|KHG17815.1|  Epoxide hydrolase 2                                     190   7e-55   
ref|XP_002884518.1|  hypothetical protein ARALYDRAFT_317420             192   8e-55   
ref|XP_004981166.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    192   1e-54   
ref|XP_006397371.1|  hypothetical protein EUTSA_v10022504mg             192   1e-54   
emb|CDX90553.1|  BnaA03g42280D                                          191   3e-54   
ref|NP_187211.1|  alpha/beta-Hydrolases superfamily protein             191   4e-54   
ref|XP_009136732.1|  PREDICTED: bifunctional epoxide hydrolase 2        191   4e-54   
gb|EPS67066.1|  pectinesterase                                          200   5e-54   
gb|EAZ11286.1|  hypothetical protein OsJ_01142                          192   5e-54   
ref|XP_002463580.1|  hypothetical protein SORBIDRAFT_01g002410          191   6e-54   
gb|KGN52820.1|  hypothetical protein Csa_4G001870                       185   8e-54   
gb|EAY73346.1|  hypothetical protein OsI_01223                          189   8e-54   
ref|XP_006299381.1|  hypothetical protein CARUB_v10015540mg             190   1e-53   
ref|XP_006299523.1|  hypothetical protein CARUB_v10015695mg             190   1e-53   
gb|KFK41012.1|  hypothetical protein AALP_AA2G073800                    190   1e-53   
ref|XP_006650836.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    190   1e-53   
ref|XP_010100621.1|  Epoxide hydrolase 2                                188   1e-53   
ref|XP_010513335.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    185   1e-53   
ref|XP_002306333.2|  hypothetical protein POPTR_0005s08280g             189   4e-53   
gb|KFK32480.1|  hypothetical protein AALP_AA6G247900                    188   4e-53   
ref|XP_009111297.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    188   4e-53   
gb|ACF83934.1|  unknown                                                 188   5e-53   
ref|NP_001150215.1|  epoxide hydrolase 2                                188   5e-53   
emb|CDY65635.1|  BnaAnng20800D                                          187   6e-53   
ref|XP_010417820.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    187   1e-52   
ref|XP_010557474.1|  PREDICTED: bifunctional epoxide hydrolase 2        186   1e-52   
ref|XP_002880830.1|  predicted protein                                  186   1e-52   
ref|XP_006296031.1|  hypothetical protein CARUB_v10025176mg             186   2e-52   
ref|XP_010464087.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    186   3e-52   
ref|XP_006444388.1|  hypothetical protein CICLE_v10021228mg             180   6e-52   
ref|XP_011039566.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    186   7e-52   
ref|NP_001051780.1|  Os03g0829100                                       185   8e-52   
ref|XP_010440227.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    185   1e-51   
gb|EMS55414.1|  Epoxide hydrolase 2                                     180   2e-51   
gb|EMT14639.1|  hypothetical protein F775_19531                         185   2e-51   
ref|NP_180242.1|  soluble epoxide hydrolase                             183   3e-51   
gb|EAY73347.1|  hypothetical protein OsI_01224                          183   4e-51   
ref|XP_004152243.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    182   5e-51   
ref|XP_010473058.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    182   7e-51   
gb|KHG16220.1|  Epoxide hydrolase 2                                     182   1e-50   
ref|XP_002880829.1|  predicted protein                                  181   1e-50   
gb|KHG22415.1|  Epoxide hydrolase 2                                     181   2e-50   
dbj|BAJ91671.1|  predicted protein                                      182   2e-50   
ref|XP_011021885.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    181   2e-50   
ref|NP_180243.1|  alpha/beta-hydrolases superfamily protein             181   2e-50   
ref|XP_008454324.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    181   3e-50   
dbj|BAK06387.1|  predicted protein                                      181   3e-50   
ref|XP_010486015.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    181   4e-50   
gb|KHG02720.1|  Epoxide hydrolase 2                                     187   4e-50   
dbj|BAJ89155.1|  predicted protein                                      180   6e-50   
emb|CBI22971.3|  unnamed protein product                                175   1e-49   
gb|EAY92418.1|  hypothetical protein OsI_14152                          178   3e-49   
ref|XP_004981168.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    177   4e-49   
gb|EYU42194.1|  hypothetical protein MIMGU_mgv1a010473mg                177   5e-49   
ref|XP_004981167.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    177   7e-49   
gb|EMT29558.1|  hypothetical protein F775_27882                         174   1e-48   
gb|EPS69185.1|  hypothetical protein M569_05583                         175   2e-48   
emb|CDX77049.1|  BnaC04g38440D                                          171   3e-48   
gb|ABR16314.1|  unknown                                                 175   3e-48   
ref|XP_010229424.1|  PREDICTED: uncharacterized protein LOC100841009    182   3e-48   
emb|CBI39538.3|  unnamed protein product                                174   4e-48   
ref|XP_010649601.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    174   1e-47   
ref|XP_006650837.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    171   2e-46   
ref|XP_003577254.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    170   2e-46   
ref|XP_002459617.1|  hypothetical protein SORBIDRAFT_02g007580          170   2e-46   
gb|EAZ29152.1|  hypothetical protein OsJ_13213                          169   3e-46   
gb|AFK41347.1|  unknown                                                 169   3e-46   
ref|XP_006296069.1|  hypothetical protein CARUB_v10025219mg             168   6e-46   
gb|ABK21215.1|  unknown                                                 168   1e-45   
ref|XP_006382453.1|  hypothetical protein POPTR_0005s02320g             165   1e-45   
ref|NP_001051781.1|  Os03g0829200                                       169   1e-45   
emb|CDJ26419.1|  unnamed protein product                                168   2e-45   
dbj|BAJ90007.1|  predicted protein                                      167   5e-45   
ref|XP_006388575.1|  hypothetical protein POPTR_0150s00200g             161   5e-45   
emb|CDJ26688.1|  unnamed protein product                                166   8e-45   
gb|AFW67077.1|  hypothetical protein ZEAMMB73_214444                    162   2e-44   
gb|EMT01002.1|  hypothetical protein F775_32452                         165   2e-44   
gb|EYU42746.1|  hypothetical protein MIMGU_mgv1a010198mg                165   3e-44   
gb|EMT01977.1|  hypothetical protein F775_13757                         162   6e-44   
ref|NP_001151201.1|  epoxide hydrolase 2                                164   7e-44   
ref|XP_008680999.1|  PREDICTED: uncharacterized protein LOC100191...    162   2e-43   
gb|KHG02721.1|  Epoxide hydrolase 2                                     160   4e-43   
ref|XP_002979677.1|  hypothetical protein SELMODRAFT_111571             161   5e-43   
gb|EMT10704.1|  hypothetical protein F775_20354                         159   7e-43   
gb|EAY92419.1|  hypothetical protein OsI_14153                          161   9e-43   
ref|XP_003577188.2|  PREDICTED: bifunctional epoxide hydrolase 2-...    159   3e-42   
gb|ACG46051.1|  epoxide hydrolase 2                                     158   1e-41   
ref|NP_001154238.1|  alpha/beta-Hydrolases superfamily protein          157   1e-41   
gb|EMT20019.1|  hypothetical protein F775_43824                         155   3e-41   
ref|XP_008644360.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    157   4e-41   
ref|XP_002985384.1|  hypothetical protein SELMODRAFT_181715             156   5e-41   
gb|EMS67715.1|  Epoxide hydrolase 3                                     154   5e-41   
gb|AES82460.2|  epoxide hydrolase                                       159   1e-40   
ref|XP_003626242.1|  Epoxide hydrolase                                  159   1e-40   
ref|XP_006380777.1|  hypothetical protein POPTR_0007s13460g             152   1e-40   
ref|XP_002451255.1|  hypothetical protein SORBIDRAFT_05g026560          152   1e-39   
ref|XP_002310826.2|  epoxide hydrolase family protein                   152   2e-39   
gb|AFW67074.1|  hypothetical protein ZEAMMB73_400532                    147   4e-39   
ref|XP_006838631.1|  hypothetical protein AMTR_s00002p00235860          150   6e-39   
ref|XP_011025873.1|  PREDICTED: bifunctional epoxide hydrolase 2        149   2e-38   
emb|CDY57860.1|  BnaC08g47760D                                          149   2e-38   
ref|XP_009598691.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    147   4e-38   
ref|XP_002960490.1|  hypothetical protein SELMODRAFT_266570             146   3e-37   
ref|XP_002967234.1|  hypothetical protein SELMODRAFT_87385              145   6e-37   
ref|XP_006838629.1|  hypothetical protein AMTR_s00002p00235200          144   1e-36   
ref|XP_010107837.1|  Epoxide hydrolase 2                                143   3e-36   
ref|XP_010275536.1|  PREDICTED: bifunctional epoxide hydrolase 2        142   5e-36   
gb|KDP37443.1|  hypothetical protein JCGZ_08284                         141   1e-35   
ref|XP_006838632.1|  hypothetical protein AMTR_s00002p00236030          140   2e-35   
gb|EMS52534.1|  Epoxide hydrolase 3                                     139   2e-35   
ref|XP_002521508.1|  epoxide hydrolase, putative                        141   3e-35   
ref|XP_006444395.1|  hypothetical protein CICLE_v10024303mg             139   4e-35   
ref|XP_008338037.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    140   6e-35   
ref|XP_007156093.1|  hypothetical protein PHAVU_003G257900g             140   8e-35   
gb|AGV54241.1|  epoxide hydrolase 2-like protein                        139   1e-34   
gb|EMS59633.1|  Epoxide hydrolase 2                                     138   1e-34   
ref|XP_007046807.1|  Alpha/beta-Hydrolases superfamily protein is...    139   1e-34   
ref|XP_009346065.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    139   1e-34   
ref|XP_008354646.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    139   1e-34   
gb|KHN02949.1|  Epoxide hydrolase 2                                     137   1e-34   
ref|XP_009346066.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    139   1e-34   
ref|XP_011006454.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    138   2e-34   
emb|CAN77654.1|  hypothetical protein VITISV_032325                     138   3e-34   
ref|XP_008354647.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    138   3e-34   
ref|XP_003520282.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    138   4e-34   
ref|XP_010028623.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    137   5e-34   
ref|NP_001240134.1|  uncharacterized protein LOC100809053               137   5e-34   
ref|XP_008337725.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    137   7e-34   
ref|XP_008241748.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    136   1e-33   
gb|AFK46496.1|  unknown                                                 136   1e-33   
gb|KHN27037.1|  Epoxide hydrolase 2                                     136   2e-33   
ref|XP_002275186.1|  PREDICTED: bifunctional epoxide hydrolase 2        135   2e-33   
ref|XP_004287855.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    135   2e-33   
ref|XP_004509321.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    135   3e-33   
ref|XP_004287856.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    135   3e-33   
gb|AFK36273.1|  unknown                                                 134   6e-33   
ref|XP_003557340.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    134   6e-33   
dbj|BAK08144.1|  predicted protein                                      134   6e-33   
gb|AFK43935.1|  unknown                                                 134   7e-33   
ref|XP_004959124.1|  PREDICTED: uncharacterized protein LOC101755220    130   7e-33   
gb|KHG08034.1|  Epoxide hydrolase 2                                     134   7e-33   
ref|XP_006433454.1|  hypothetical protein CICLE_v10003596mg             133   8e-33   
gb|KEH20402.1|  epoxide hydrolase                                       134   1e-32   
ref|XP_010275537.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    134   1e-32   
ref|XP_010254690.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    133   2e-32   
ref|XP_004963323.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    133   2e-32   
ref|XP_009346058.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    132   3e-32   
dbj|BAJ98388.1|  predicted protein                                      132   3e-32   
ref|XP_010515481.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    132   3e-32   
ref|XP_007202253.1|  hypothetical protein PRUPE_ppa008854mg             132   3e-32   
ref|XP_008366789.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    132   5e-32   
gb|AFK43554.1|  unknown                                                 132   6e-32   
ref|XP_010503777.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    132   6e-32   
ref|XP_011100955.1|  PREDICTED: bifunctional epoxide hydrolase 2        132   6e-32   
ref|XP_010679802.1|  PREDICTED: bifunctional epoxide hydrolase 2        131   7e-32   
ref|NP_190669.1|  alpha/beta-Hydrolases superfamily protein             131   7e-32   
ref|XP_010426641.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    131   9e-32   
ref|XP_010039281.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    129   1e-31   
ref|XP_010547454.1|  PREDICTED: LOW QUALITY PROTEIN: bifunctional...    131   1e-31   
ref|NP_001067364.1|  Os12g0636400                                       131   1e-31   
ref|XP_008662613.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    130   2e-31   
gb|ABN08018.1|  hypothetical protein MtrDRAFT_AC154391g34v2             128   2e-31   
ref|XP_008241747.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    129   2e-31   
emb|CDX90672.1|  BnaA03g41090D                                          131   4e-31   
ref|XP_010254688.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    129   4e-31   
gb|KHN20392.1|  Epoxide hydrolase 2                                     127   4e-31   
ref|XP_006419521.1|  hypothetical protein CICLE_v10005425mg             127   6e-31   
ref|XP_001753609.1|  predicted protein                                  129   6e-31   
ref|XP_010033445.1|  PREDICTED: bifunctional epoxide hydrolase 2        129   7e-31   
emb|CDP01962.1|  unnamed protein product                                128   9e-31   
ref|XP_002877783.1|  hypothetical protein ARALYDRAFT_485452             127   2e-30   
ref|XP_006291410.1|  hypothetical protein CARUB_v10017549mg             128   2e-30   
ref|XP_003579088.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    127   3e-30   
gb|KCW84773.1|  hypothetical protein EUGRSUZ_B015792                    125   4e-30   
ref|XP_004963322.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    127   4e-30   
ref|XP_010649095.1|  PREDICTED: bifunctional epoxide hydrolase 2        126   5e-30   
ref|XP_009136579.1|  PREDICTED: bifunctional epoxide hydrolase 2-...    126   5e-30   
emb|CDY26530.1|  BnaC01g23690D                                          126   5e-30   
gb|EMT05547.1|  hypothetical protein F775_29061                         123   6e-30   
emb|CDY33304.1|  BnaA01g19710D                                          126   6e-30   
gb|KHN00509.1|  Epoxide hydrolase 2                                     125   6e-30   
ref|XP_006403966.1|  hypothetical protein EUTSA_v10010546mg             125   1e-29   



>ref|NP_001274907.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81891.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 154/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VHF+PR+P+ + VE ++A+YG+DHYI RFQVPGEIEAEFAP+G K+ L+   ++R P P 
Sbjct  130  VHFLPRNPKMNTVEGLKAVYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKILTFRDPAPF  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKG  A  D   AL +WL EE+LDY+ +++E+TGFTGGVNYYRAL ++WELTAPW+
Sbjct  190  YFPKGKGLEALPDAPVALSSWLSEEELDYYANKFEQTGFTGGVNYYRALSINWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFIVG+ DLVYHI GAKEYIH+GGFK DVPLLE+VVVL+G AHF+NQE   E
Sbjct  250  GAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVNQERPHE  309

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  310  ISKHIYD  316



>ref|NP_001274962.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81889.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   272 bits (695),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/187 (66%), Positives = 153/187 (82%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VHF+PR+P+ + VE ++A+YG+DHYI RFQVPGEIEAEFAP+G K+ L+   +YR P P 
Sbjct  130  VHFLPRNPKMNTVEWLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSILKKILTYRDPAPF  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKG  A  D   AL +WL EE+LDY+ +++E+TGFTGGVNYYRAL + WELTAPW+
Sbjct  190  YFPKGKGLEALPDAPVALSSWLSEEELDYYANKFEQTGFTGGVNYYRALPISWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFIVG+ DLVYHI GAKEYIH+GGFK DVPLLE+VVVL+G AHF+NQE   E
Sbjct  250  GAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKEDVPLLEEVVVLEGSAHFVNQERPHE  309

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  310  ISKHIYD  316



>ref|XP_004239806.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=321

 Score =   265 bits (677),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VHF PR+P  + VE ++A+YG+DHYI RFQVPG+IEAEFAP+G K+ L+   ++R   P 
Sbjct  130  VHFFPRNPNMNTVEGLKAVYGEDHYISRFQVPGDIEAEFAPIGAKSVLKKILTFRDTAPF  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKG  A  D   AL +WL EE+LDY+ +++EKTGFTGGVNYYRAL ++WELTAPW+
Sbjct  190  YFPKGKGLEALPDAPVALSSWLSEEELDYYANKFEKTGFTGGVNYYRALPINWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VPTKFIVG+ DLVYHI GAKEYIH+GGFK+DVPLLE+VVVL+G AHF+NQE   E
Sbjct  250  GAQLKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKNDVPLLEEVVVLEGAAHFVNQERPHE  309

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  310  ISKHIYD  316



>ref|NP_001275417.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81892.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   265 bits (677),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VHF  R+P+ ++VE ++A+YG+DHYI RFQVPGEIEAEFAP+G K+ L+   +YR P P 
Sbjct  130  VHFSKRNPKMNVVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPF  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKG  A  D   AL +WL EE+LDY+ +++E+TGFTG VNYYRAL ++WELTAPW+
Sbjct  190  YFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFIVG+ DLVYHI GAKEYIH+GGFK DVPLLE+VVVL+G AHF++QE   E
Sbjct  250  GAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQERPHE  309

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  310  ISKHIYD  316



>pdb|2CJP|A Chain A, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase 
I (Steh1)
 pdb|2CJP|B Chain B, Structure Of Potato (Solanum Tuberosum) Epoxide Hydrolase 
I (Steh1)
Length=328

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VHF  R+P+ ++VE ++A+YG+DHYI RFQVPGEIEAEFAP+G K+ L+   +YR P P 
Sbjct  137  VHFSKRNPKMNVVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPF  196

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKG  A  D   AL +WL EE+LDY+ +++E+TGFTG VNYYRAL ++WELTAPW+
Sbjct  197  YFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWT  256

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFIVG+ DLVYHI GAKEYIH+GGFK DVPLLE+VVVL+G AHF++QE   E
Sbjct  257  GAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQERPHE  316

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  317  ISKHIYD  323



>pdb|3CXU|A Chain A, Structure Of A Y149f Mutant Of Epoxide Hydrolase From 
Solanum Tuberosum
 pdb|3CXU|B Chain B, Structure Of A Y149f Mutant Of Epoxide Hydrolase From 
Solanum Tuberosum
Length=328

 Score =   263 bits (673),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 152/187 (81%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VHF  R+P+ ++VE ++A++G+DHYI RFQVPGEIEAEFAP+G K+ L+   +YR P P 
Sbjct  137  VHFSKRNPKMNVVEGLKAIFGEDHYISRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPF  196

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKG  A  D   AL +WL EE+LDY+ +++E+TGFTG VNYYRAL ++WELTAPW+
Sbjct  197  YFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWT  256

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFIVG+ DLVYHI GAKEYIH+GGFK DVPLLE+VVVL+G AHF++QE   E
Sbjct  257  GAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQERPHE  316

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  317  ISKHIYD  323



>ref|XP_004239808.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=321

 Score =   262 bits (669),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VHF  R+P+ + VE ++A+YG+DHYI RFQVPGEIEAEFAP+G K+ L+   +YR   PL
Sbjct  130  VHFPRRNPKMNTVEGLKAIYGEDHYISRFQVPGEIEAEFAPIGAKSVLKKILTYRDTAPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKG G  A  D   AL +WL EE+LDY+ ++YE+TGFTG VNYYRA  ++WELTAPW+
Sbjct  190  YFPKGSGLDALPDAPAALSSWLSEEELDYYANKYEQTGFTGAVNYYRAFPINWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFIVG+ DLVYHI G KEYIH+GGFK DVPLLE+VVVL+G AHF+NQE   E
Sbjct  250  GAQVKVPTKFIVGEFDLVYHIPGVKEYIHNGGFKKDVPLLEEVVVLEGAAHFVNQERPHE  309

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  310  INKHIYD  316



>ref|XP_009775927.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009775928.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Nicotiana 
sylvestris]
Length=321

 Score =   259 bits (661),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 149/187 (80%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VH+ PR+P+ + V+ +RA+YGDDHY+ RFQVPGEIEAEF+P+G K+ L+ F  +R   P+
Sbjct  130  VHYFPRNPQMNTVDGLRAIYGDDHYVWRFQVPGEIEAEFSPIGAKSVLKKFLRFRGSEPI  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKG  A  D    L +WL EEDLDY+ S++E+TGFTGGVNYYRA  + WE TAPW+
Sbjct  190  YFPKGKGVEAIPDAPIELSSWLTEEDLDYYASKFEQTGFTGGVNYYRAFPISWEFTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AKV VP KFIVG+LDLVYHI GAK+YIH+G FK DVPLLE+VVVL+G AHF+NQE  +E
Sbjct  250  GAKVKVPAKFIVGELDLVYHIPGAKDYIHNGEFKKDVPLLEEVVVLEGAAHFVNQERPDE  309

Query  415  VNNHIYN  395
            ++ HI++
Sbjct  310  ISKHIFD  316



>ref|XP_009598630.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=321

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 150/187 (80%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            +H+ P +P+ + V+ +RA+YGDDHY+ RFQVPGEIEAEFAP+GVK+ L+ F  +R   P 
Sbjct  130  IHYFPTNPQMNTVDGLRAIYGDDHYVWRFQVPGEIEAEFAPIGVKSVLKKFLRFRDSAPF  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKG  A  D    L +WL EEDLDY+ S++E+TGFTGGVNYYRA  ++WELTAPW+
Sbjct  190  YFPKGKGVEAIPDAPIELSSWLTEEDLDYYSSKFEQTGFTGGVNYYRAFPINWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KF+VG+LDLVYHI GAK+YIH+G FK DVPLLE+VVVL+G AHF+NQE  +E
Sbjct  250  GAQVKVPAKFMVGELDLVYHIPGAKDYIHNGEFKKDVPLLEEVVVLEGAAHFVNQERPDE  309

Query  415  VNNHIYN  395
            +N HI++
Sbjct  310  INKHIFD  316



>ref|XP_003550367.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Glycine 
max]
Length=319

 Score =   252 bits (644),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 146/187 (78%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   ++ +RA+YG+D+YI RFQ PGEIEAEFA +G    L++F +YR P PL
Sbjct  128  VVFTPRNPKRKPLDTLRAVYGNDYYICRFQEPGEIEAEFAQIGTARVLKEFLTYRNPGPL  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y PKGK F+  TD   ALP+WL EE+ DY+ S+Y+KTGFTGG+NYYR L L+WELTA W+
Sbjct  188  YLPKGKAFAHPTDSPIALPSWLSEEECDYYASKYDKTGFTGGLNYYRNLDLNWELTASWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVGDLDL Y+  GAKEYIH GGFK DVPLLEDVVVL+G  HF++QE  +E
Sbjct  248  GAQVKVPVKFIVGDLDLTYNAPGAKEYIHKGGFKRDVPLLEDVVVLEGAGHFLHQERPDE  307

Query  415  VNNHIYN  395
            ++NHIY+
Sbjct  308  ISNHIYD  314



>emb|CAJ19276.1| putative epoxide hydrolase [Solanum commersonii]
Length=321

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 147/187 (79%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VH+ P++   + +E ++A+YG+D+YI RFQVPG+IEAEFAP+G K+ L+   +YR P P 
Sbjct  130  VHYPPKNSNMNPIEGLKALYGEDYYICRFQVPGDIEAEFAPIGAKSVLKKMLTYRDPAPF  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKG  A  D   AL  WL EE+LDY+ S++E+TGFTG +NYYRAL +  ELTAPW+
Sbjct  190  YFPKGKGLEAIADAPIALSTWLSEEELDYYASKFEQTGFTGALNYYRALSISSELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFIVG+ DLVYH++GAKEYIH+GGFK  VPLLE+VVVL+G AHFINQE   E
Sbjct  250  GAEVKVPTKFIVGEFDLVYHMQGAKEYIHNGGFKKYVPLLEEVVVLEGAAHFINQERPHE  309

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  310  ISKHIYD  316



>emb|CDO98838.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   250 bits (638),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 148/187 (79%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FIPR+P    VE++RA  GDD+YI RFQ PG+IEAE A +G K  L+   +YR P PL
Sbjct  130  VAFIPRNPLAKPVEMLRAYGGDDYYICRFQEPGDIEAELAQMGCKDFLKKMLAYRTPGPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            ++PKGKGF  + DG   LP+WL EED+DY+ S+++KTGFTGG+NYYRA+ L WELTAPW+
Sbjct  190  FWPKGKGFGDSPDGPVVLPSWLTEEDVDYYASKFDKTGFTGGLNYYRAVNLHWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VPTKF+VG+LDL Y+++G ++YIH GGFK+DVPLLEDVVV++  AHFINQE  +E
Sbjct  250  GAKIKVPTKFVVGELDLTYYMRGVQDYIHKGGFKNDVPLLEDVVVVKDAAHFINQERPDE  309

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  310  INKHIYD  316



>gb|AAA81893.1| epoxide hydrolase, partial [Solanum tuberosum]
Length=305

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 146/187 (78%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VH++PR+   + VE ++A+YG+D+YI RFQV G+IEAEFAP+G K+ L+   +YR P P 
Sbjct  114  VHYLPRNSNMNPVEGLKALYGEDYYICRFQVQGDIEAEFAPIGAKSVLKKMLTYRDPAPF  173

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKG  A  D   AL  WL EE+LDY+ S++E+TGFTG +NYYRAL +D ELTAPW 
Sbjct  174  YFPKGKGLEAIADAPIALSTWLSEEELDYYASKFEQTGFTGALNYYRALSIDSELTAPWQ  233

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFIVG+  LVYH++GAKEYIH+GGFK  VPLLE+VVVL+G AHF+NQE   E
Sbjct  234  GAEVKVPTKFIVGEFALVYHMRGAKEYIHNGGFKKYVPLLEEVVVLEGAAHFVNQERPHE  293

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  294  ISKHIYD  300



>ref|NP_001275381.1| epoxide hydrolase [Solanum tuberosum]
 gb|AAA81890.1| epoxide hydrolase [Solanum tuberosum]
Length=321

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 146/187 (78%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VH+ PR+   + +E ++A+YG+D+YI RFQVPGEIEAEFAP+G K+ L+   +YR P P 
Sbjct  130  VHYHPRNSNMNPIEGLKALYGEDYYICRFQVPGEIEAEFAPIGAKSVLKKMLTYRDPAPF  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKG  A  D    L  WL EE+LDY+ +++E+TGFTG +NYYRAL ++ ELTAPW+
Sbjct  190  YFPKGKGLEAIADAPIVLSTWLSEEELDYYANKFEQTGFTGALNYYRALSINSELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFIVG+ DL YH++GAKEYIH+GGFK  VPLLE+VVVL+G AHF+NQE   E
Sbjct  250  GAQVNVPTKFIVGEFDLAYHMRGAKEYIHNGGFKKYVPLLEEVVVLEGAAHFVNQERPHE  309

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  310  ISKHIYD  316



>gb|EYU21013.1| hypothetical protein MIMGU_mgv1a010239mg [Erythranthe guttata]
Length=318

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 146/186 (78%), Gaps = 4/186 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FIPRDP  + V+ MR++YG+DHYI RFQ PG+IEAEF  +GVK  L++  ++R P PL
Sbjct  131  VAFIPRDPEMNPVQKMRSLYGEDHYICRFQEPGDIEAEFEKIGVKEVLKNILAFRNPAPL  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKGF+ + D +     WL EE+LDY+V+++EKTGFTGG+NYYRA  L WEL APW+
Sbjct  191  YFPKGKGFTYSADRA----PWLTEEELDYYVTKFEKTGFTGGINYYRAFGLSWELNAPWA  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFIVG+LDLVYH  G K++IH GGFK  VPLL+++VVL+G AHF+NQE  +E
Sbjct  247  GAQVNVPTKFIVGELDLVYHTPGTKDFIHKGGFKKFVPLLQEIVVLEGAAHFVNQERADE  306

Query  415  VNNHIY  398
            +N HIY
Sbjct  307  INQHIY  312



>gb|EYU43973.1| hypothetical protein MIMGU_mgv1a010247mg [Erythranthe guttata]
Length=318

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 146/186 (78%), Gaps = 4/186 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FIPRDP  + V+ MR++YG+DHYI RFQ PG+IEAEF  +GVK  L++  ++R P PL
Sbjct  131  VAFIPRDPEMNPVQKMRSLYGEDHYICRFQEPGDIEAEFEKIGVKEVLKNILAFRNPAPL  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKGF+ + D +     WL EE+LDY+V+++EKTGFTGG+NYYRA  L WEL APW+
Sbjct  191  YFPKGKGFTYSADRA----PWLTEEELDYYVTKFEKTGFTGGINYYRAFGLSWELNAPWA  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFIVG+LDLVYH  G K++IH GGFK  VPLL+++VVL+G AHF+NQE  +E
Sbjct  247  GAQVNVPTKFIVGELDLVYHTPGTKDFIHKGGFKKFVPLLQEIVVLEGAAHFVNQERADE  306

Query  415  VNNHIY  398
            +N HIY
Sbjct  307  INEHIY  312



>ref|XP_010105136.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXC03944.1| Epoxide hydrolase 2 [Morus notabilis]
Length=347

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P     E +RA+YGDD+Y+ RFQ PGEIEAEFA +G  T +++F++YR P+PL
Sbjct  113  VAFNPRNPNRKPYETLRALYGDDYYVCRFQEPGEIEAEFAEIGAATVIKEFYTYRSPKPL  172

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGK F    D   ALP+W+ EED+DY+ S++EKTGFTGG+NYYR +  +WELTAPW+
Sbjct  173  FMPKGKCFGHPKDTPIALPSWVSEEDMDYYASKFEKTGFTGGINYYRNIDRNWELTAPWT  232

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVGD DLVY++ G K+YIH GGFK DVP L++VVV++GV HF+N+E  +E
Sbjct  233  GAKMQVPVKFIVGDQDLVYNLYGTKDYIHKGGFKRDVPFLQEVVVMEGVGHFVNEEKADE  292

Query  415  VNNHIYN  395
            V  HIY+
Sbjct  293  VTQHIYD  299



>gb|KDO71745.1| hypothetical protein CISIN_1g017221mg [Citrus sinensis]
Length=375

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +++ +A+YGDD+YI RFQ PGEIEAEFA +G +T L++F +YR P PL
Sbjct  184  VVFNPRNPNMKPLQVFKAVYGDDYYICRFQEPGEIEAEFAQMGTETVLKEFLTYRNPGPL  243

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF    D   ALP+WL EED+ Y+ S+YEK GFTGG+NYYR ++L+WEL APW+
Sbjct  244  FLPKGKGFGHPPDAQIALPSWLSEEDVKYYASKYEKAGFTGGINYYRNIELNWELLAPWT  303

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KFIVGDLDL Y+  G K+YI+ GGFK  VPLLE+V+V++GV HFIN+E  +E
Sbjct  304  GAQIKVPVKFIVGDLDLTYNAPGTKDYINKGGFKKAVPLLEEVIVMEGVGHFINEEKPDE  363

Query  415  VNNHIYN  395
            VN HIYN
Sbjct  364  VNKHIYN  370



>ref|XP_006489040.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=375

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +++ +A+YGDD+YI RFQ PGEIEAEFA +G +T L++F +YR P PL
Sbjct  184  VVFNPRNPNMKPLQVFKAVYGDDYYICRFQEPGEIEAEFAQMGTETVLKEFLTYRNPGPL  243

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF    D    LP+WL EED+ Y+ S+YEK GFTGG+NYYR ++L+WEL APW+
Sbjct  244  FLPKGKGFGHPPDARIDLPSWLSEEDVKYYASKYEKAGFTGGINYYRNIELNWELLAPWT  303

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KFIVGDLDL Y+  G K+YI+ GGFK  VPLLE+V+V++GV HFIN+E  +E
Sbjct  304  GAQIKVPVKFIVGDLDLTYNAPGTKDYINKGGFKKAVPLLEEVIVMEGVGHFINEEKPDE  363

Query  415  VNNHIYN  395
            VN HIYN
Sbjct  364  VNKHIYN  370



>ref|XP_006419515.1| hypothetical protein CICLE_v10005186mg [Citrus clementina]
 gb|ESR32755.1| hypothetical protein CICLE_v10005186mg [Citrus clementina]
Length=375

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +++ +A+YGDD+YI RFQ PGEIEAEFA +G +T L++F +YR P PL
Sbjct  184  VVFNPRNPNMKPLQVFKAVYGDDYYICRFQEPGEIEAEFAQMGTETVLKEFLTYRNPGPL  243

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF    D    LP+WL EED+ Y+ S+YEK GFTGG+NYYR ++L+WEL APW+
Sbjct  244  FLPKGKGFGHPPDARIDLPSWLSEEDVKYYASKYEKAGFTGGINYYRNIELNWELLAPWT  303

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KFIVGDLDL Y+  G K+YI+ GGFK  VPLLE+V+V++GV HFIN+E  +E
Sbjct  304  GAQIKVPVKFIVGDLDLTYNAPGTKDYINKGGFKKAVPLLEEVIVMEGVGHFINEEKPDE  363

Query  415  VNNHIYN  395
            VN HIYN
Sbjct  364  VNKHIYN  370



>ref|XP_004508197.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=357

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   +E +RA+YG+D+YI RFQ PG+IEAEFA +G    L++F +YR P PL
Sbjct  166  VSFTPRNPKRKPLETLRAVYGNDYYISRFQEPGDIEAEFAEIGTARVLKEFLTYRNPGPL  225

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y PKGKGF    D    LP+WL EE+ +Y+ S+Y+KTGFTGG+NYYR L L+WELTAPWS
Sbjct  226  YLPKGKGFGHPIDSPIVLPSWLSEEECNYYASKYDKTGFTGGLNYYRNLDLNWELTAPWS  285

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVGD DL Y+  GAK+YI  GG K DVPLLEDVVV++G  HFI+QE  +E
Sbjct  286  GAKIKVPVKFIVGDQDLTYNAPGAKDYILKGGMKRDVPLLEDVVVIEGAGHFIHQERPDE  345

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  346  INKHIYD  352



>ref|XP_004239805.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=321

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VH++PR+   + VE ++A+YG+D+YI RFQ  G+IEAEFAP+G K+ L+   +YR P P 
Sbjct  130  VHYLPRNSNMNPVEGLKALYGEDYYICRFQEEGDIEAEFAPIGAKSVLKKMLTYRDPAPF  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
             FPKGKG  A  D  + L  WL EE+LDY+ +++E TGFTG +NYYRAL ++ ELTAPW+
Sbjct  190  CFPKGKGLEAIADAPSDLSTWLSEEELDYYANKFEHTGFTGALNYYRALSMNAELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFIVG+ DLVYH++GAKEYIH+GGFK  VPLLE+VVVL+G AHF+NQE   E
Sbjct  250  GAQVNVPTKFIVGEFDLVYHMRGAKEYIHNGGFKKYVPLLEEVVVLEGAAHFVNQERPHE  309

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  310  ISKHIYD  316



>ref|XP_010024724.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW61194.1| hypothetical protein EUGRSUZ_H03958 [Eucalyptus grandis]
Length=323

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    +E +RA YG+D+YI RFQ PGE+EAEFA +G +  L +F +YR P PL
Sbjct  132  VPFTPRHPARKPLESLRAAYGEDYYICRFQEPGEMEAEFAQIGTRRVLEEFLTYRNPGPL  191

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF   TD    LP+WL EED+DYF S+YE TGFTGG NYYRAL L+WELTAPW+
Sbjct  192  FLPKGKGFGHPTDTPIVLPSWLTEEDVDYFTSKYETTGFTGGFNYYRALDLNWELTAPWT  251

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KF+VGDLDL Y+  G K++IH GG K  VP LEDVVV++GVAHFI++E  +E
Sbjct  252  GAQIRVPAKFMVGDLDLTYNSPGTKDFIHKGGLKKYVPFLEDVVVMEGVAHFIHEERPQE  311

Query  415  VNNHIYN  395
            V  HI++
Sbjct  312  VTQHIHD  318



>ref|XP_009622776.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=323

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 112/187 (60%), Positives = 140/187 (75%), Gaps = 3/187 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   +E +RA+YG+D+Y+VRFQ PGEIEAEFA +G K  L +F SYR P PL
Sbjct  131  VAFSPRNPKRKPLETLRAVYGEDYYVVRFQEPGEIEAEFAKIGTKKVLENFLSYRNPGPL  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y PK K F    D    LP+WLPE+++DY  S+YEK GFTGGVNYYRA+ L+WELTA W+
Sbjct  191  YLPKSKLFD---DSPVILPSWLPEKEVDYVASKYEKAGFTGGVNYYRAIDLNWELTAAWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AKV VP KFIVGDLDL Y+  G K+Y+H GG K DVPLLE+VV+L+ V HF+ QE  +E
Sbjct  248  GAKVKVPVKFIVGDLDLTYNAPGVKDYVHKGGMKKDVPLLEEVVILENVGHFLQQEKPDE  307

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  308  INKHIYD  314



>ref|XP_011090999.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=317

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 142/186 (76%), Gaps = 4/186 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P  + VE+ R +YGDDHYI RFQ PG+IEAEFA +GVK  +++ F++R P P 
Sbjct  130  VAFYPRNPEVNPVEMFRGLYGDDHYICRFQEPGDIEAEFANIGVKEVVKNIFAFRTPGPF  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YFPKGKGF  + + +     WL EEDLDY+VS +E+TGFTGGVNYYRA  L+WEL APWS
Sbjct  190  YFPKGKGFGYSLERAP----WLTEEDLDYYVSTFEQTGFTGGVNYYRAFGLNWELNAPWS  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVG+ D+ YH+ G K++IH GGFK  VPLL++VVVL+G AHFINQE  +E
Sbjct  246  GAQVKVPAKFIVGEFDITYHVPGTKDHIHKGGFKKFVPLLQEVVVLEGAAHFINQERPDE  305

Query  415  VNNHIY  398
            +N HIY
Sbjct  306  INEHIY  311



>ref|XP_007154300.1| hypothetical protein PHAVU_003G106900g [Phaseolus vulgaris]
 gb|ESW26294.1| hypothetical protein PHAVU_003G106900g [Phaseolus vulgaris]
Length=319

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   ++ ++A+YG+D+YI RFQ PG IEAEF  +G +  L++F +YR P P+
Sbjct  128  VAFTPRNPKRKPLDTLKAVYGNDYYICRFQEPGNIEAEFEQIGTERVLKEFLTYRNPAPI  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y  +GKGF    D    LP+WL EE+  Y+ S+YEKTGFTGG+NYYR L L+WELTAPW+
Sbjct  188  YLHEGKGFGHPIDSPLKLPSWLSEEECHYYASKYEKTGFTGGLNYYRNLDLNWELTAPWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AKV VP KFIVGDLDL Y+  GAK+YIH GG K DVPLLEDVVV+QG  HF++QE   E
Sbjct  248  GAKVKVPVKFIVGDLDLTYNAPGAKDYIHKGGLKRDVPLLEDVVVIQGAGHFLHQERPHE  307

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  308  INQHIYD  314



>ref|XP_010043042.1| PREDICTED: bifunctional epoxide hydrolase 2 [Eucalyptus grandis]
 gb|KCW85062.1| hypothetical protein EUGRSUZ_B01907 [Eucalyptus grandis]
Length=318

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 140/187 (75%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    VE +RA +GDD+YI RFQ PG+IE++   LGV+  LR   + RKP P 
Sbjct  127  VPFRPRNPAAKPVESLRAHFGDDYYICRFQEPGDIESDIERLGVRNVLRKILTERKPGPP  186

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
             +PKG+ FS       ALP+WL EEDLDY+ S++EK GFTGG+NYYRAL L+WELTAPW+
Sbjct  187  MWPKGQDFSCRPGKPMALPSWLSEEDLDYYTSKFEKRGFTGGLNYYRALDLNWELTAPWT  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            +A+V VP KF+VGDLD+ Y   G KE++H GGFK  VPLLEDVVV++G +HFINQE  EE
Sbjct  247  DARVRVPVKFVVGDLDITYTTPGVKEFVHGGGFKKHVPLLEDVVVIEGASHFINQERPEE  306

Query  415  VNNHIYN  395
            VN+HI+N
Sbjct  307  VNSHIHN  313



>ref|XP_006600362.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Glycine 
max]
 ref|XP_006600363.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Glycine 
max]
Length=354

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/222 (53%), Positives = 147/222 (66%), Gaps = 35/222 (16%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQV-----------------------------  863
            V F PR+P+   ++ +RA+YG+D+YI RFQV                             
Sbjct  128  VVFTPRNPKRKPLDTLRAVYGNDYYICRFQVSKHGLSRSDEKKMLFSRGKPWFAKWLCCS  187

Query  862  ------PGEIEAEFAPLGVKTCLRDFFSYRKPRPLYFPKGKGFSANTDGSTALPAWLPEE  701
                  PGEIEAEFA +G    L++F +YR P PLY PKGK F+  TD   ALP+WL EE
Sbjct  188  SALLQEPGEIEAEFAQIGTARVLKEFLTYRNPGPLYLPKGKAFAHPTDSPIALPSWLSEE  247

Query  700  DLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEAKVMVPTKFIVGDLDLVYHIKGAK  521
            + DY+ S+Y+KTGFTGG+NYYR L L+WELTA W+ A+V VP KFIVGDLDL Y+  GAK
Sbjct  248  ECDYYASKYDKTGFTGGLNYYRNLDLNWELTASWTGAQVKVPVKFIVGDLDLTYNAPGAK  307

Query  520  EYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVNNHIYN  395
            EYIH GGFK DVPLLEDVVVL+G  HF++QE  +E++NHIY+
Sbjct  308  EYIHKGGFKRDVPLLEDVVVLEGAGHFLHQERPDEISNHIYD  349



>ref|XP_009352305.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=322

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+  +++ ++A+YGDD+YI RFQ PG IEAEFA +G    L++F +YR P PL
Sbjct  130  VAFSPRNPQRKIIKSLQAVYGDDYYICRFQEPGVIEAEFAQMGTTRILKEFLTYRNPGPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF   TD    LP+WL E++++Y+ +++EKTGFTGG+NYYR L L+WELT  W+
Sbjct  190  FLPKGKGFGRPTDAPIVLPSWLSEDEVNYYATKFEKTGFTGGINYYRNLDLNWELTTAWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVGD DLVY+  GAK++IH GGFK   PLLE VVV++GVAHF+ QE  +E
Sbjct  250  GAQVKVPVKFIVGDQDLVYNSPGAKDFIHKGGFKKYAPLLEQVVVMEGVAHFLQQEKPDE  309

Query  415  VNNHIYN  395
            +N HI++
Sbjct  310  INTHIHD  316



>ref|XP_002516953.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF45567.1| epoxide hydrolase, putative [Ricinus communis]
Length=321

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 140/187 (75%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P   +VE++RA+YGDD+Y+ RFQ  G+IEAEFA LG +  +++F +YR P PL
Sbjct  130  VSFSPRNPHKKIVEMLRAVYGDDYYMCRFQEVGDIEAEFAELGTERVIKEFLTYRYPGPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGK F+ + +    LP+WL EED  Y+V ++E+ GFTGG+N YR L L+WELTAPW+
Sbjct  190  FLPKGKAFNRSPENPLVLPSWLSEEDAQYYVGKFEEKGFTGGLNLYRNLDLNWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AKV VP KFIVGD DL Y+  G K YI  GGFK DVP LE+VV+++GVAHFINQE  EE
Sbjct  250  GAKVKVPIKFIVGDQDLTYNSLGNKAYIEKGGFKRDVPFLEEVVIMEGVAHFINQEKAEE  309

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  310  INKHIYD  316



>ref|XP_010024723.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW61193.1| hypothetical protein EUGRSUZ_H03957 [Eucalyptus grandis]
Length=323

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +E +RA YG+D+YI RFQ PGE+EAEFA +G +  L +F + R P  L
Sbjct  132  VPFTPRNPAQKPLESLRAGYGEDYYICRFQEPGEMEAEFAQIGTRRVLEEFLTIRNPDQL  191

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGK F    D    LP+WL EED+DY+ S+YEKTGFTGG NYYRAL L+WELTAPW+
Sbjct  192  FLPKGKAFGYPMDDLIILPSWLTEEDVDYYASKYEKTGFTGGFNYYRALDLNWELTAPWT  251

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KFIVGDLDL Y   GAK+YIH GG K  VP LEDVVV+QGVAHFI++E  +E
Sbjct  252  GAQIRVPAKFIVGDLDLTYTSPGAKDYIHRGGLKKYVPFLEDVVVMQGVAHFIHEERPQE  311

Query  415  VNNHIYN  395
            V +HI++
Sbjct  312  VTHHIHD  318



>ref|XP_008341331.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FIPR+P+   +E  +A YGDD+Y+ RFQ PG IEAEFA +G    +++F +YR P PL
Sbjct  130  VQFIPRNPQRKFIESFQAAYGDDYYMCRFQEPGVIEAEFAQMGTTRVIKEFLTYRNPXPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF    D    LP+WL E++++Y+ ++++KTGFTGG+NYYR L ++WELTAPW+
Sbjct  190  FLPKGKGFGHPXDTPIVLPSWLSEDEVNYYAAKFDKTGFTGGINYYRNLDINWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KF+VGD DLVY+  GA+++IH GGFK  VPLLE+V+VL+GVAHF+ QE  +E
Sbjct  250  GAQVKVPVKFVVGDQDLVYNSLGAQDFIHKGGFKKFVPLLEEVIVLEGVAHFLQQEKPDE  309

Query  415  VNNHIYN  395
            ++ HI++
Sbjct  310  ISKHIHB  316



>gb|KDP27824.1| hypothetical protein JCGZ_18904 [Jatropha curcas]
Length=321

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 140/187 (75%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F  R+P    +E+MRA+YGDD+Y+ RFQ PGEIEAEFA LG +  L++FF+YR P P+
Sbjct  130  VVFALRNPNGKRIEVMRAVYGDDYYMCRFQEPGEIEAEFAELGTERILKEFFTYRHPGPI  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGK FS   +    LP+W  EED+ Y+ +++EK GFTGG+NYYR L  +WELTAPW+
Sbjct  190  FLPKGKAFSRLPETPLVLPSWFSEEDVQYYTNKFEKKGFTGGLNYYRILDRNWELTAPWN  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVGD DL Y+  GAK+YI  GGFK  VP LE+VV+++GVAHF+NQE  EE
Sbjct  250  GAQVKVPAKFIVGDQDLTYNSFGAKDYIEKGGFKKAVPFLEEVVIMEGVAHFLNQEKPEE  309

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  310  INKHIYD  316



>ref|XP_008789846.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=317

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 135/186 (73%), Gaps = 0/186 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V+ +RA++GDDHYI RFQ PG +EAEFA +     L+ F +YRKP  L
Sbjct  126  VAFSPRNPARRPVDSLRALFGDDHYICRFQEPGAVEAEFARISTALLLKKFLAYRKPEAL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
               K KGF  + D    LP+WL EED++Y+ S++EK+GFTGG+NYYR L L+WELTAPW+
Sbjct  186  LVSKEKGFGGSPDTEITLPSWLTEEDVNYYTSKFEKSGFTGGLNYYRCLNLNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLDL YH  G ++Y+H GGFK DVP L DVVV+QGV HF+NQE   E
Sbjct  246  GVQIKVPVKFIVGDLDLTYHTPGIQDYLHKGGFKRDVPFLHDVVVMQGVGHFLNQEKPHE  305

Query  415  VNNHIY  398
            +++HIY
Sbjct  306  ISDHIY  311



>gb|KEH32298.1| epoxide hydrolase [Medicago truncatula]
Length=355

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   ++ +RA+YG+D+YI RFQ PG+IEAEFA +G +  L++F +YR P PL
Sbjct  164  VAFTPRNPKRKPLDTLRAVYGNDYYISRFQEPGDIEAEFAEIGTQRVLKEFLTYRNPGPL  223

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y PKGKGF    D    LP WL E++ +Y+ S+++KTGFTG +NYYR + L+WEL APW+
Sbjct  224  YLPKGKGFGHPIDSPILLPPWLSEQECNYYASKFDKTGFTGALNYYRNIDLNWELNAPWT  283

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVGDLDL Y+  GAK+YIH GG K DVPLLEDVVV++G  HFI+QE  ++
Sbjct  284  GAQVKVPVKFIVGDLDLTYNAPGAKDYIHKGGMKRDVPLLEDVVVIEGAGHFIHQERADK  343

Query  415  VNNHIYN  395
            +N +IY+
Sbjct  344  INTYIYD  350



>ref|XP_006419522.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
 gb|ESR32762.1| hypothetical protein CICLE_v10005425mg [Citrus clementina]
Length=324

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = -2

Query  937  DPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYFPKGK  758
            +  ++ +E +RA YGDD+Y+ RFQ PGEIEAEFA +G +T +++F ++R P P+  PKGK
Sbjct  139  ESNNNPIEALRAYYGDDYYMCRFQEPGEIEAEFAQIGTETVIKEFLTFRTPGPIILPKGK  198

Query  757  GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEAKVMV  578
            GF    D   ALP+WL EED+ YF ++++K GFTGG+NYYR + L  EL APW+ +++ +
Sbjct  199  GFGHPPDAPMALPSWLSEEDVKYFTAKFDKKGFTGGINYYRNINLSQELLAPWAGSRLQI  258

Query  577  PTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVNNHIY  398
            PTKFI+GDLDLVYH+ G KEYIH GGFK DVPLLE+VV+++GV HFINQE  +E++ HIY
Sbjct  259  PTKFIIGDLDLVYHMPGVKEYIHKGGFKRDVPLLEEVVIMEGVGHFINQEKGDEISKHIY  318

Query  397  N  395
            +
Sbjct  319  D  319



>ref|XP_004296863.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=319

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+    E++RA+YGDD+Y+ RFQ PGEIEAEFA +G    +++F +YR P PL
Sbjct  128  VAFSPRNPQRKTTEMLRAVYGDDYYMCRFQEPGEIEAEFAQIGTARVMKEFLTYRHPGPL  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF    D    LP+WL E+D++Y+VS +EK GFTGG+NYYR    +WELTAPW+
Sbjct  188  FLPKGKGFRHPPDAPIPLPSWLSEDDVNYYVSFFEKKGFTGGINYYRNFDRNWELTAPWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KFIVGD DLVY+  GAK++IH GGFK  VPLLE+VVV++GV HFIN+E   E
Sbjct  248  GARIKVPVKFIVGDQDLVYNSLGAKDFIHKGGFKKYVPLLEEVVVMEGVGHFINEERPNE  307

Query  415  VNNHIYN  395
            ++ HI++
Sbjct  308  ISEHIHD  314



>ref|XP_006489041.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=319

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F P    ++++E +RA YGD++Y+ RFQ PGEIEAEFA +G +T +++F ++R P P+
Sbjct  128  VVFNPFGSINNVIEALRAYYGDNYYMCRFQEPGEIEAEFAQIGTETVIKEFLTFRTPGPI  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKGKGF    D   ALP+WL EED+ +F ++++K GFTGG+NYYR + L  EL APW+
Sbjct  188  ILPKGKGFGHPPDAPMALPSWLSEEDVKHFTAKFDKKGFTGGINYYRNINLSQELLAPWA  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             +++ +PTKFI+GDLDLVYH+ G KEYIH GGFK DVPLLE+VV+++GV HFINQE  +E
Sbjct  248  GSRLQIPTKFIIGDLDLVYHMPGVKEYIHKGGFKRDVPLLEEVVIMEGVGHFINQEKGDE  307

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  308  ISKHIYD  314



>ref|XP_006349824.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Solanum 
tuberosum]
Length=323

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 139/187 (74%), Gaps = 3/187 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   +E ++A+YGDD+YIVRFQ PG +EAEFA  G K  L ++ +YR P PL
Sbjct  132  VPFSPRNPKRKPIESLKAIYGDDYYIVRFQEPGVMEAEFAKTGTKKVLENYLTYRNPGPL  191

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y PKGK F    D    LP+WL ++++DYF S+YE+TGFTGG NYYRAL L+WELTA WS
Sbjct  192  YLPKGKPFD---DSPVILPSWLSQKEVDYFASKYEQTGFTGGFNYYRALDLNWELTAAWS  248

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AKV VP KFIVGDLDL Y+  GAK+YI+ GG K DVPLLE VV+L+ V HF+ QE  +E
Sbjct  249  GAKVKVPVKFIVGDLDLTYNTPGAKDYINKGGMKKDVPLLEKVVILENVGHFLQQEKPDE  308

Query  415  VNNHIYN  395
            +N HI++
Sbjct  309  INKHIHD  315



>ref|XP_002314368.1| hypothetical protein POPTR_0010s01430g [Populus trichocarpa]
 gb|EEF00539.1| hypothetical protein POPTR_0010s01430g [Populus trichocarpa]
Length=335

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 142/188 (76%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P   ++  ++A+YGDD+YI+RFQ PGEIEAEFA +G +  L++F +YR P P+
Sbjct  131  VLFNPRNPSRKVIATLKAVYGDDYYIIRFQEPGEIEAEFAEIGTEKVLKEFLTYRTPAPI  190

Query  775  YFPKGKGFSAN-TDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
            + PKG+GF+    D    LP+WL EED+ Y+ S++E+ GFTGG+NYYR L  +WELTAPW
Sbjct  191  FLPKGQGFNGKPLDTPVVLPSWLSEEDVKYYTSKFEQKGFTGGLNYYRNLDRNWELTAPW  250

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + A++ VP KFIVGD DL Y+  GAK+YI  GGFK DVP L+D+VV++GV HFIN+E  E
Sbjct  251  TGAQIKVPVKFIVGDQDLTYNSLGAKDYIAKGGFKRDVPFLQDLVVMEGVGHFINEEKPE  310

Query  418  EVNNHIYN  395
            E++ HIY+
Sbjct  311  EISKHIYD  318



>gb|KFK41013.1| hypothetical protein AALP_AA2G073900 [Arabis alpina]
Length=325

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 139/187 (74%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V  +R ++GDD+YI RFQ PGEIEAEF  LG +  L++F +Y+ P+PL
Sbjct  133  VVFTPRNPDRVPVPTLRRVFGDDYYICRFQKPGEIEAEFKKLGTEKVLKEFLTYKTPKPL  192

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKG+ F  + + + ALP WL +EDLDY+ ++YEK GFTG +NYYR L   WELTAPW+
Sbjct  193  FIPKGELFKGSENAAAALPHWLTQEDLDYYTTKYEKRGFTGAINYYRNLDRSWELTAPWT  252

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVGD DL Y+  GAKEYIH GGFK DVPLL++ VVL+G+ HF+++E  EE
Sbjct  253  GAKIAVPVKFIVGDQDLTYNSPGAKEYIHGGGFKKDVPLLDETVVLEGLGHFLHEENPEE  312

Query  415  VNNHIYN  395
            +N HI++
Sbjct  313  INQHIHS  319



>ref|XP_010105137.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXC03945.1| Epoxide hydrolase 2 [Morus notabilis]
Length=319

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+PR   +  MRA+ GD++YI RFQ  GEIEAE   +G+   LR+F +YR P PL
Sbjct  128  VAFNPRNPRRRPIHSMRAVCGDNYYICRFQEFGEIEAELEKIGIDRVLREFLTYRHPGPL  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF    D   +LP WL EEDL Y+VS++EKTGFTGG+NYYR +  +WEL APW+
Sbjct  188  FLPKGKGFERPVDVPISLPDWLSEEDLKYYVSKFEKTGFTGGINYYRNIDRNWELVAPWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
               + VP KFIVGDLDL Y+  GAK+Y+H GGFK DVP L++VV+++GV HFINQE  +E
Sbjct  248  GTPIKVPVKFIVGDLDLTYNSFGAKDYVHKGGFKRDVPFLQEVVIMEGVGHFINQERPQE  307

Query  415  VNNHIYN  395
            +N+HIY+
Sbjct  308  INHHIYD  314



>ref|XP_004252913.1| PREDICTED: bifunctional epoxide hydrolase 2 [Solanum lycopersicum]
Length=323

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 139/187 (74%), Gaps = 3/187 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   +E ++A+YGDD+Y+VRFQ PG +EAEFA +G K  L  F +YR P PL
Sbjct  132  VPFSPRNPKRKPIESLKAIYGDDYYVVRFQEPGVMEAEFAKIGTKKVLGKFLTYRNPGPL  191

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y PKGK F    D    LP+WL ++++DYF S+YE+TGFTGG NYYRAL L+WELTA WS
Sbjct  192  YMPKGKPFD---DSPVILPSWLSQKEVDYFASKYEQTGFTGGFNYYRALDLNWELTAAWS  248

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AKV VP KFIVGDLDL Y+  GAK+YI+ GG K DVPLLE VV+L+ V HF+ QE  +E
Sbjct  249  GAKVKVPVKFIVGDLDLTYNAPGAKDYINKGGMKKDVPLLEKVVILENVGHFLQQEKPDE  308

Query  415  VNNHIYN  395
            +N HI++
Sbjct  309  INKHIHD  315



>ref|XP_009350800.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=322

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+PR  ++E   A YGDD+Y+ RFQ PG IEAEFA +G    +++F +YR P PL
Sbjct  130  VQFMPRNPRRKVIESFHAAYGDDYYMCRFQEPGVIEAEFAQMGTTRVIKEFLTYRNPGPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGK F   TD    LP+WL E+D++Y+ ++++KTGFTG VNYYR L ++WELTAPW+
Sbjct  190  FLPKGKAFGHPTDTPIVLPSWLSEDDVNYYTAKFDKTGFTGPVNYYRNLDVNWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KF+VGD DLVY+ +GA ++IH GGFK  VPLLE+VVVL+GVAHF+ QE  +E
Sbjct  250  GAQVKVPVKFVVGDQDLVYNSQGAPDFIHKGGFKKFVPLLEEVVVLEGVAHFLQQEKPDE  309

Query  415  VNNHIYN  395
            ++ HI++
Sbjct  310  ISKHIHD  316



>ref|XP_008371325.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 144/187 (77%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P+  ++E ++A YGDD+YI RFQ PG IEAEFA +G    +++F +YR P PL
Sbjct  130  VQFMPRNPQRKVIESLQAAYGDDYYICRFQEPGVIEAEFAQMGTTRVIKEFLTYRNPGPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF   TD    LP+WL E++++Y+V++++KTGFTGG+NYYR   ++WELTAPW+
Sbjct  190  FLPKGKGFGHPTDTPIVLPSWLSEDEVNYYVAKFDKTGFTGGINYYRNXDINWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KF+VGD DLVY+  GA ++I  GGFK  VPLLE+VVVL+GVAHF+ QE  +E
Sbjct  250  GAQVKVPVKFVVGDQDLVYNSLGAXDFIXKGGFKKFVPLLEEVVVLEGVAHFLQQEKPDE  309

Query  415  VNNHIYN  395
            ++ HI++
Sbjct  310  ISKHIHD  316



>ref|XP_002314371.1| hypothetical protein POPTR_0010s01440g [Populus trichocarpa]
 gb|ABK94011.1| unknown [Populus trichocarpa]
 gb|EEF00542.1| hypothetical protein POPTR_0010s01440g [Populus trichocarpa]
Length=323

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 141/188 (75%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P   ++  ++A+YGDD+YI+RFQ PGEIEAEFA +G +  L++F +YR P PL
Sbjct  131  VLFNPRNPSRKVIATLKAVYGDDYYIIRFQEPGEIEAEFAEIGTEKVLKEFLTYRTPAPL  190

Query  775  YFPKGKGFSAN-TDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
            + PKG+GF+    D    LP+WL EED+ Y+ S+YE+ GFTGG+NYYR L  +WELTAPW
Sbjct  191  FLPKGQGFNGKPLDTPVVLPSWLSEEDVKYYTSKYEQKGFTGGLNYYRNLDRNWELTAPW  250

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + A++ VP KFIVGD DL Y+  GAK++I  GGFK DVP L D+VV++GV HFIN+E  E
Sbjct  251  TGAQIKVPVKFIVGDQDLTYNSLGAKDHIDKGGFKRDVPFLHDLVVMEGVGHFINEEKPE  310

Query  418  EVNNHIYN  395
            E++ HIY+
Sbjct  311  EISKHIYD  318



>ref|XP_011006450.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=323

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 142/188 (76%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P   ++  ++A+YGDD+YI+RFQ PGEIEAEFA +G +  L++F +YR P P+
Sbjct  131  VLFNPRNPSRKVIATLKAVYGDDYYIIRFQEPGEIEAEFAEIGTEKVLKEFLTYRTPAPI  190

Query  775  YFPKGKGFSAN-TDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
            + PKG+GF+    D    LP+WL EED+ Y+ S++E+ GFTGG+NYYR L  +WELTAPW
Sbjct  191  FLPKGQGFNGKPLDTPVVLPSWLAEEDVKYYTSKFEQKGFTGGLNYYRNLDRNWELTAPW  250

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + A++ VP KFIVGD DL Y+  GAK+Y+  GGFK DVP L+D+VV++GV HFIN+E  E
Sbjct  251  TGAQIKVPVKFIVGDQDLTYNSLGAKDYLAKGGFKRDVPFLQDLVVMEGVGHFINEEKPE  310

Query  418  EVNNHIYN  395
            E++ HIY+
Sbjct  311  EISKHIYD  318



>ref|XP_009622181.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=333

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 140/187 (75%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +E +RA+YGDD+Y+VRFQ  G IEAEF  +GVK  L+ FF+YR+P PL
Sbjct  132  VAFNPRNPMKKPLETLRAVYGDDYYVVRFQEAGVIEAEFEEIGVKNVLKKFFTYREPAPL  191

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            YF KGK F  N      LP WL EE+LD++ ++YE+TGFTG +N+YRA+  +WELT  W+
Sbjct  192  YFKKGKSFGDNP--QVELPCWLSEEELDFYATKYEQTGFTGALNFYRAIDRNWELTGAWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVG+LDL Y+  G K+Y+H GGFK  VPLLE+VVVL+GV HFI++E  +E
Sbjct  250  GAKIQVPVKFIVGELDLTYNAPGTKDYLHKGGFKKQVPLLEEVVVLEGVGHFIHEEKPKE  309

Query  415  VNNHIYN  395
            +N+HIYN
Sbjct  310  INDHIYN  316



>ref|XP_010911257.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=317

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 135/186 (73%), Gaps = 0/186 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    V+ ++A++GDDHYI RFQ PG  EAEFA +     L+ F +YRKP PL
Sbjct  126  VAFSPRHPARRPVDSLKALFGDDHYICRFQEPGAAEAEFARINTALLLKKFLTYRKPAPL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
               K KGF  + +    LP+WL EED++Y+ S++EK+GFTGG+NYYR L L+WELTAPW+
Sbjct  186  LISKEKGFGGSPNTEITLPSWLTEEDVNYYTSKFEKSGFTGGLNYYRCLNLNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLDL YH  G +++IH GGFK +VP L+DV+V+QGV HFINQE   E
Sbjct  246  GVQIKVPVKFIVGDLDLTYHTPGIQDHIHKGGFKREVPFLQDVIVMQGVGHFINQERPHE  305

Query  415  VNNHIY  398
            +++HIY
Sbjct  306  ISDHIY  311



>ref|XP_004229258.2| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=325

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 140/186 (75%), Gaps = 3/186 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR+P    +E +RA+YGD++YI++FQ PG+IEAEFA +G KT L    + R P PL
Sbjct  129  VPYFPRNPIIRPIEALRAIYGDEYYIIKFQEPGKIEAEFAQIGTKTVLEKILTMRDPDPL  188

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKGK F    D    LP WL EED+DY+ ++YE TGFTGG+NYYRA+ L+WELTAPW+
Sbjct  189  KMPKGKPFD---DSPVILPPWLTEEDVDYYATKYEHTGFTGGLNYYRAIDLNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVGDLDL Y++ G K+YI+ GGFK +VPLLEDVV+L+GVAHF+ QE  +E
Sbjct  246  GAKIEVPVKFIVGDLDLTYNLVGVKDYINKGGFKKNVPLLEDVVILKGVAHFLQQEEPDE  305

Query  415  VNNHIY  398
            VN HI+
Sbjct  306  VNQHIH  311



>ref|XP_008340789.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P+  ++E ++A YGDD+YI RFQ PG IEAEFA +G    +++F +YR P PL
Sbjct  130  VQFMPRNPQRKVIESLQAAYGDDYYICRFQEPGVIEAEFAQMGTTRVIKEFLTYRNPGPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF   T+    LP+WL E++++Y+ ++++KTGFTGG+NYYR   ++WELTAPW+
Sbjct  190  FLPKGKGFGHPTBTPIVLPSWLSEDEVNYYXAKFDKTGFTGGINYYRNXDINWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KF+VGD DLVY+  GA ++I  GGFK  VPLLE+VVVL+GVAHF+ QE  +E
Sbjct  250  GAQVKVPVKFVVGDQDLVYNSXGAXDFIXKGGFKKFVPLLEEVVVLEGVAHFLQQEKPDE  309

Query  415  VNNHIYN  395
            ++ HI++
Sbjct  310  ISKHIHD  316



>ref|XP_008361962.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=322

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 143/187 (76%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P+  ++E ++A YGDD+YI RFQ PG IEAEFA +G    +++F +YR P PL
Sbjct  130  VQFMPRNPQRKVIESLQAAYGDDYYICRFQEPGVIEAEFAQMGTTRVIKEFLTYRNPGPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF   T+    LP+WL E++++Y+ ++++KTGFTGG+NYYR   ++WELTAPW+
Sbjct  190  FLPKGKGFGHPTBTPIVLPSWLSEDEVNYYXAKFDKTGFTGGINYYRNXDINWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KF+VGD DLVY+  GA ++I  GGFK  VPLLE+VVVL+GVAHF+ QE  +E
Sbjct  250  GAQVKVPVKFVVGDQDLVYNSLGAXDFIXKGGFKKFVPLLEEVVVLEGVAHFLQQEKPDE  309

Query  415  VNNHIYN  395
            ++ HI++
Sbjct  310  ISKHIHD  316



>ref|XP_009411662.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=319

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 135/186 (73%), Gaps = 0/186 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    ++ +RA++GDDHY+ RFQ  G  EAEFA +     ++ F +YRKP P+
Sbjct  128  VPFSPRNPHRRTLDSLRAIFGDDHYMCRFQEHGATEAEFAQIETSLLIKKFLTYRKPEPI  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK KGF    +   ALP WL EED++YF S++EK+GFTGG+NYYR L L+WELTAPW+
Sbjct  188  IVPKEKGFDGTLETPIALPTWLSEEDINYFASKFEKSGFTGGLNYYRCLDLNWELTAPWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KFIVGDLDL YH  G ++YIH GGFK  VP L+DVVV++GV HFINQE   +
Sbjct  248  GAQIKVPVKFIVGDLDLTYHSPGVQDYIHKGGFKKLVPFLQDVVVMEGVGHFINQERAHD  307

Query  415  VNNHIY  398
            +++HIY
Sbjct  308  ISDHIY  313



>emb|CDP10752.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 148/188 (79%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FIPR+P   LVE +R+ YG+D+Y+ RFQ PGEIEAEFA +GVK  ++   +YR P PL
Sbjct  130  VAFIPRNPSCSLVESLRSAYGNDYYMCRFQEPGEIEAEFAQIGVKNFIKKMLTYRTPGPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRAL-KLDWELTAPW  599
            +FP+GKGF  + D    LP+WL +ED+DYFVS++EKTGFTGGVNYYRAL  + WELTAPW
Sbjct  190  FFPQGKGFGDSPDTPVVLPSWLTDEDVDYFVSKFEKTGFTGGVNYYRALNNVTWELTAPW  249

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + A+V VP KF++G+LDL YH+ G +EYIH GGFK DVPLLE+VVV++  AHFINQE  +
Sbjct  250  TGAQVKVPAKFVIGELDLTYHMPGVQEYIHKGGFKRDVPLLEEVVVVKDAAHFINQERPD  309

Query  418  EVNNHIYN  395
            EV+ HI++
Sbjct  310  EVSKHIHD  317



>emb|CAZ86692.1| epoxide hydrolase 1 [Prunus persica]
Length=323

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   +E ++A+YGDD+Y+ RFQ PG IEAEFA +G    +++F +YR P PL
Sbjct  131  VAFRPRNPQRKNLESLKAVYGDDYYMCRFQEPGVIEAEFAKIGTARVMKEFLTYRNPGPL  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK K F  + D    LP+WL E++++Y+ S++EKTGFTGG+NYYR L L+WELTA W+
Sbjct  191  FLPKDKMFGHSLDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLDLNWELTAAWT  250

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVGD DL Y+  G K++IH GGFK  VPLLE+VVV++GVAHFINQE  +E
Sbjct  251  GAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKYVPLLEEVVVMEGVAHFINQERPDE  310

Query  415  VNNHIYN  395
            +N HI++
Sbjct  311  INKHIHD  317



>ref|XP_007222764.1| hypothetical protein PRUPE_ppa008756mg [Prunus persica]
 gb|EMJ23963.1| hypothetical protein PRUPE_ppa008756mg [Prunus persica]
Length=320

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   +E ++A+YGDD+Y+ RFQ PG IEAEFA +G    +++F +YR P PL
Sbjct  128  VAFRPRNPQRKNLESLKAVYGDDYYMCRFQEPGVIEAEFAKIGTARVMKEFLTYRNPGPL  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK K F  + D    LP+WL E++++Y+ S++EKTGFTGG+NYYR L L+WELTA W+
Sbjct  188  FLPKDKMFGHSLDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLDLNWELTAAWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVGD DL Y+  G K++IH GGFK  VPLLE+VVV++GVAHFINQE  +E
Sbjct  248  GAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKYVPLLEEVVVMEGVAHFINQERPDE  307

Query  415  VNNHIYN  395
            +N HI++
Sbjct  308  INKHIHD  314



>ref|XP_007221833.1| hypothetical protein PRUPE_ppa020197mg [Prunus persica]
 gb|EMJ23032.1| hypothetical protein PRUPE_ppa020197mg [Prunus persica]
Length=320

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P+   +E ++A+YGDD+Y+ RFQ PG +EAEFA LG    +++F +YR P PL
Sbjct  128  VAFMPRNPQRKFIESVKAVYGDDYYMCRFQEPGVMEAEFAKLGTARVMKEFLTYRNPGPL  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK K F    D    LP+WL E++++Y+ S++EKTGFTG +NYYR L L+WELTA W+
Sbjct  188  FLPKDKMFGHAPDAPIVLPSWLSEDEVNYYASKFEKTGFTGALNYYRNLDLNWELTAAWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            E +V VP KFIVGD DLVY+   AK++IH GGFK  VPLLE+VVV++GVAHFINQE  +E
Sbjct  248  EVQVKVPVKFIVGDQDLVYNSLHAKDFIHKGGFKKYVPLLEEVVVMEGVAHFINQERPDE  307

Query  415  VNNHIYN  395
            +N HI++
Sbjct  308  INKHIHD  314



>ref|XP_009788447.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=323

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 135/186 (73%), Gaps = 3/186 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F  R+P+   +E + A+YG+D+YIVRFQ PGEIEAEFA +G K  L  F SYR P PL
Sbjct  131  VAFSLRNPKRKPLETLCAVYGEDYYIVRFQEPGEIEAEFAKIGTKKVLEKFLSYRNPGPL  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y PKGK F    D    LP+WLPE+D+DY  S+YEK+GFTGGVNYYRA+ L+WELTA W+
Sbjct  191  YLPKGKPFD---DNPVILPSWLPEKDVDYIASKYEKSGFTGGVNYYRAIDLNWELTAAWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              KV VP KFIVGDLDL Y+  G K+Y+H G  K DVPLLE+VV+L+ V HF+ QE  + 
Sbjct  248  GGKVKVPVKFIVGDLDLTYNAPGVKDYVHKGRMKKDVPLLEEVVILENVGHFLQQEKPDV  307

Query  415  VNNHIY  398
            +N HI+
Sbjct  308  INKHIH  313



>ref|XP_010921626.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=318

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 134/186 (72%), Gaps = 0/186 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    VE +RA+YGDD+YI  FQ PG  EAEFA +     ++ F +Y  P P+
Sbjct  127  VAFRPRSPDRKPVETLRAVYGDDYYICTFQEPGRTEAEFACIPTALVIKKFLTYHDPSPV  186

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF+A+ D    LP+WL EED++YF S+++K+GFTGG+NYYRAL L+WELTAPW+
Sbjct  187  IVPKENGFAASPDKEITLPSWLSEEDINYFASKFDKSGFTGGLNYYRALDLNWELTAPWT  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVG+ DL+Y+I G K+YIH GGFK DVP LEDVVV++G  HFINQE  +E
Sbjct  247  GMQIKVPVKFIVGNQDLMYNIPGVKDYIHKGGFKKDVPFLEDVVVIEGAGHFINQEKPQE  306

Query  415  VNNHIY  398
              +HIY
Sbjct  307  TTDHIY  312



>ref|XP_007222693.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica]
 gb|EMJ23892.1| hypothetical protein PRUPE_ppa008676mg [Prunus persica]
Length=323

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 140/187 (75%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P+   +E ++A+YGDD+YI RFQ PG IEAEFA +G    +++F +YR   PL
Sbjct  131  VAFLPRNPQRKSLESLKAVYGDDYYICRFQEPGVIEAEFAKIGTARVMKEFLTYRNSGPL  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK K F    D    LP+WL E++++Y+ S++EKTGFTGG+NYYR L L+WELTA W+
Sbjct  191  FLPKDKMFGHPLDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLDLNWELTAAWT  250

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVGD DL Y+  G K++IH GGFK  VPLLE+VVV++GVAHFINQE  +E
Sbjct  251  GAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKYVPLLEEVVVMEGVAHFINQERPDE  310

Query  415  VNNHIYN  395
            +N HI++
Sbjct  311  INKHIHD  317



>ref|XP_008223225.1| PREDICTED: bifunctional epoxide hydrolase 2-like, partial [Prunus 
mume]
Length=263

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P+   +E ++A+YGDD+Y+ RFQ PG +EAEFA LG    +++F +YR P PL
Sbjct  71   VAFMPRNPQRKFIESVKAVYGDDYYMCRFQEPGVMEAEFAKLGTARVMKEFLTYRNPGPL  130

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + P+ K F    D    LP+WL E++++Y+ S++EKTGFTGG+NYYR   L+WELTA W+
Sbjct  131  FLPEDKMFGHPPDAPIVLPSWLSEDEVNYYASKFEKTGFTGGLNYYRNFDLNWELTAAWT  190

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            E +V VP KFIVGD DLVY+   AK++IH GGFK  VPLLE+VVV++GVAHFINQE  +E
Sbjct  191  EVQVKVPVKFIVGDQDLVYNSLDAKDFIHKGGFKKYVPLLEEVVVMEGVAHFINQEKPDE  250

Query  415  VNNHIYN  395
            ++ HI++
Sbjct  251  ISKHIHD  257



>ref|XP_008246047.1| PREDICTED: bifunctional epoxide hydrolase 2-like, partial [Prunus 
mume]
Length=277

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 141/187 (75%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P+   +E ++A+YGDD+Y+ RFQ PG +EAEFA LG    +++F +YR P PL
Sbjct  85   VAFMPRNPQRKFIESVKAVYGDDYYMCRFQEPGVMEAEFAKLGTARVMKEFLTYRNPGPL  144

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + P+ K F    D    LP+WL E++++Y+ S++EKTGFTGG+NYYR   L+WELTA W+
Sbjct  145  FLPEDKMFGHPPDAPIVLPSWLSEDEVNYYASKFEKTGFTGGLNYYRNFDLNWELTAAWT  204

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            E +V VP KFIVGD DLVY+   AK++IH GGFK  VPLLE+VVV++GVAHFINQE  +E
Sbjct  205  EVQVKVPVKFIVGDQDLVYNSLDAKDFIHKGGFKKYVPLLEEVVVMEGVAHFINQEKPDE  264

Query  415  VNNHIYN  395
            ++ HI++
Sbjct  265  ISKHIHD  271



>gb|KDP27828.1| hypothetical protein JCGZ_18908 [Jatropha curcas]
Length=321

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 137/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F  R+P    V+  RA YGDD Y+ RFQ  G+IEAEFA LG +  +++F +YR P P 
Sbjct  130  VPFFRRNPEMKFVDAFRAAYGDDFYMCRFQEYGDIEAEFAELGTERVMKEFLTYRNPGPF  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
             FPKGK FS        LP+WL EE++ Y+ ++++KTG TGGVNYYR +  +WELTAPW+
Sbjct  190  IFPKGKVFSQPAGDPIILPSWLSEEEVHYYTTKFDKTGLTGGVNYYRNIDRNWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            EA+V VP+KFIVGD DLVY   G K+YI  GGFK DVPLLE+VVV++GVAHF+NQE  +E
Sbjct  250  EAQVKVPSKFIVGDEDLVYRFVGMKDYIEKGGFKRDVPLLEEVVVMEGVAHFLNQERPDE  309

Query  415  VNNHIYN  395
            +NNHIY+
Sbjct  310  INNHIYD  316



>ref|XP_009757467.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=340

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 134/187 (72%), Gaps = 3/187 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +  +RA YGD++YI+RFQ PGEIE EFA +G KT L    + R P PL
Sbjct  133  VPFAPRNPIIRPIARLRATYGDEYYIIRFQEPGEIEEEFAKIGTKTVLEKLLTNRNPEPL  192

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKGK F    +    LP WL E+D+DY+ S+Y++TGFTGG+NYYRAL L+WELTAPW+
Sbjct  193  MLPKGKPFD---ESPVKLPPWLTEKDVDYYASKYQQTGFTGGLNYYRALDLNWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AKV VP KFIVGDLD+ Y   G K+YIH GGFK DVPLLEDVV+ +GVAHF+ QE  +E
Sbjct  250  GAKVKVPVKFIVGDLDITYSAAGVKDYIHKGGFKKDVPLLEDVVIFKGVAHFLPQEKPDE  309

Query  415  VNNHIYN  395
            VN  I +
Sbjct  310  VNKQILD  316



>emb|CDY09722.1| BnaC07g33390D [Brassica napus]
Length=329

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 140/188 (74%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +  +R  +GDD+YI RFQ PGEIEAEF  LG +  L++F +Y+ P PL
Sbjct  136  VLFSPRNPDRVPIPTLRRFFGDDYYICRFQKPGEIEAEFKKLGTEKVLKEFLTYKTPGPL  195

Query  775  YFPKGKGFSANTDG-STALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
            Y PKGK F ++ +G S+ALP WL +EDLDY+V+ Y   GFTG +NYYR +  +WELTAPW
Sbjct  196  YLPKGKLFKSSENGASSALPPWLTQEDLDYYVTNYNNKGFTGPINYYRNIDRNWELTAPW  255

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + AK+ VP KFIVGD DL Y+  GAKEYI+ GGFK DVPLL++ VVL+GV HF+++E+ E
Sbjct  256  TGAKISVPVKFIVGDQDLTYNSPGAKEYINGGGFKKDVPLLDETVVLKGVGHFLHEESPE  315

Query  418  EVNNHIYN  395
            E+N HI++
Sbjct  316  EINQHIHS  323



>gb|AFK34299.1| unknown [Lotus japonicus]
Length=318

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P    V+ MR  YGDD+YI RFQ PGE+EA+ A +G +  L++  + RKP P 
Sbjct  126  VPFLPRNPEIRTVDGMRHAYGDDYYICRFQEPGEMEAQMAEVGTEYVLKNILTTRKPGPP  185

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N D    LP+WL +EDL YFVS++EKTGFTGG+NYYR L L+WELTAPW
Sbjct  186  IFPKGEYGTGFNPDTPNTLPSWLTQEDLAYFVSKFEKTGFTGGLNYYRNLNLNWELTAPW  245

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            S  K+ VP KFI G+LD+VY     KEYIHDGGFK DVP LE+V+V +GVAHF NQE  +
Sbjct  246  SGRKINVPVKFITGELDMVYTSLNMKEYIHDGGFKEDVPDLEEVIVQKGVAHFNNQETPD  305

Query  418  EVNNHIYN  395
            E++NHIY+
Sbjct  306  EISNHIYD  313



>ref|XP_009622179.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=325

 Score =   227 bits (578),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 136/186 (73%), Gaps = 3/186 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F P++P    +  +RA YGD++YI+RFQ PGEIE EFA +G KT L    + R P PL
Sbjct  133  VPFTPQNPIIRPIARLRATYGDEYYIIRFQEPGEIEEEFAQIGTKTVLEKLLTNRNPEPL  192

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKGK F  +      LP WL E+++DY+ ++YE+TGFTGG+NYYRAL L+WELTAPW+
Sbjct  193  KVPKGKPFDKS---PVKLPPWLTEKEVDYYATKYEQTGFTGGLNYYRALDLNWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVGDLD+ Y+  G K+YIH GG K DVPLLEDVV+L+GVAHF+ QE  +E
Sbjct  250  GAKIKVPVKFIVGDLDITYNAAGVKDYIHKGGLKKDVPLLEDVVILKGVAHFLQQEKPDE  309

Query  415  VNNHIY  398
            VN HI+
Sbjct  310  VNKHIH  315



>ref|XP_010094462.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB56095.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   226 bits (577),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 135/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   VE MRA +GDD+Y+ RFQ PGEIEAE A +G    L+   + RKP P 
Sbjct  127  VPFRPRNPKMKPVESMRAFFGDDYYMCRFQEPGEIEAEMAQVGASAVLKKILTTRKPGPP  186

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGK F A+ D S  LP+WL EEDL+Y+ ++++  GFTGG+NYYR L ++WEL A W 
Sbjct  187  FLPKGKAFRADPDASVTLPSWLSEEDLNYYATKFKLKGFTGGLNYYRNLDINWELMAAWD  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVGDLD+VY   G KEY+H+GGFK DVP L++VVV++   HFI+QE  EE
Sbjct  247  GAEVKVPVKFIVGDLDMVYTTPGTKEYVHNGGFKKDVPYLQEVVVIEDAGHFISQERAEE  306

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  307  ISTHIYD  313



>gb|KDP27825.1| hypothetical protein JCGZ_18905 [Jatropha curcas]
Length=321

 Score =   226 bits (577),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 137/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+    E MRA+YGDD+Y+ R Q PG+IEAEFA LG +  +++F +YR P PL
Sbjct  130  VAFAPRNPKRKPTEGMRAVYGDDYYVCRIQEPGDIEAEFAELGTEKIMKEFLTYRNPGPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKGK FS  ++    LP+W  EED+ Y+++++EK GFTGG+NYYR +  +WELTAPW+
Sbjct  190  LLPKGKAFSRPSETPLVLPSWFSEEDVQYYINKFEKKGFTGGLNYYRIVDRNWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVGD DL Y+  G K++I  GGFK  VP LE+VV+++GV HF+N+E  EE
Sbjct  250  GAEVKVPVKFIVGDQDLTYNTFGTKDFIEKGGFKKAVPFLEEVVIMEGVGHFLNEEKPEE  309

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  310  INKHIYD  316



>gb|KHN43502.1| Epoxide hydrolase 2 [Glycine soja]
Length=194

 Score =   222 bits (565),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 135/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    ++ +RA+ GDD+YI RFQ PGE+E EFA  G    ++ F + R PRP 
Sbjct  3    VVFRPRNPNRKPIQSLRAIMGDDYYICRFQKPGEVEEEFARAGAARIIKTFIASRDPRPP  62

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF  + D    LP+WL EED++Y+ S++E+ GFTGG+NYYRA+ L WELTA W+
Sbjct  63   CVPKEIGFGGSPDLRIDLPSWLTEEDVNYYASKFEQKGFTGGLNYYRAMDLTWELTAAWT  122

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ Y+  G KEYIH+GGFK DVP L+++VV++GVAHFINQE  +E
Sbjct  123  GVQIKVPVKFIVGDLDITYNTPGVKEYIHNGGFKRDVPFLQELVVMEGVAHFINQERPQE  182

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  183  ISAHIYD  189



>gb|AFK41660.1| unknown [Lotus japonicus]
Length=318

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P    V+ MR  YGDD+YI RF+ PGE+EA+ A +G +  L++  + RKP P 
Sbjct  126  VPFLPRNPEIRTVDGMRHAYGDDYYICRFREPGEMEAQMAEVGTEYVLKNILTTRKPGPP  185

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N D    LP+WL +EDL YFVS++EKTGFTGG+NYYR L L+WELTAPW
Sbjct  186  IFPKGEYGTGFNPDTPNTLPSWLTQEDLAYFVSKFEKTGFTGGLNYYRNLNLNWELTAPW  245

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            S  K+ VP KFI G+LD+VY     KEYIHDGGFK DVP LE+V+V +GVAHF NQE  +
Sbjct  246  SGGKINVPVKFITGELDMVYTSLNMKEYIHDGGFKEDVPNLEEVIVQKGVAHFNNQETPD  305

Query  418  EVNNHIYN  395
            E++NHIY+
Sbjct  306  EISNHIYD  313



>ref|XP_008223222.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Prunus mume]
Length=323

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+PR   +E ++A+YGDD+YI RFQ PG IEAEFA +G    +++F +YR P PL
Sbjct  131  VVFPPRNPRRKTLESLKAVYGDDYYICRFQEPGVIEAEFAKIGTARVMKEFLTYRNPGPL  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK   F    D    LP+WL E++++Y+ S++EKTGFTGG+NYYR L L+WEL A W+
Sbjct  191  FLPKDIMFGHPPDAPIVLPSWLSEDEVNYYASKFEKTGFTGGINYYRNLNLNWELIAAWT  250

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVGD DL Y+  G K++IH GGFK  VPLLE+VVV++GVAHFINQE  +E
Sbjct  251  GAQVKVPVKFIVGDQDLTYNSVGTKDFIHKGGFKKCVPLLEEVVVMEGVAHFINQERPDE  310

Query  415  VNNHIYN  395
            +N HI++
Sbjct  311  INKHIHD  317



>ref|XP_010104146.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB98711.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 134/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   VE MRA +GDD+Y+ RFQ PGEIEAE A +G    L+   + RKP P 
Sbjct  127  VPFRPRNPKMKPVESMRAFFGDDYYMCRFQEPGEIEAEMAQVGASAVLKKILTTRKPGPP  186

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGK F A+ D S  LP+WL EEDL+Y+ ++++  GFTGG+NYYR L ++WEL A W 
Sbjct  187  FLPKGKAFRADPDASVTLPSWLSEEDLNYYATKFKLKGFTGGLNYYRNLDINWELMAAWD  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVGDLD+VY   G KEY+H+GGFK DVP L++VVV++   HFI QE  EE
Sbjct  247  GAEVKVPVKFIVGDLDMVYTTPGTKEYVHNGGFKKDVPYLQEVVVIEDAGHFIGQERAEE  306

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  307  ISTHIYD  313



>emb|CDX90550.1| BnaA03g42310D [Brassica napus]
Length=330

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    +  +R  +GDD+YI RFQ PGEIE EF  LG +  L++F +Y+ P PL
Sbjct  136  VLFSPRSPDRVPIPTLRRFFGDDYYICRFQKPGEIELEFKKLGTEKVLKEFLTYKTPGPL  195

Query  775  YFPKGKGFSANTDG--STALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAP  602
            Y PKGK F ++ +G  S+ALP WL +EDLDY+V++Y+  GFTG +NYYR +  +WELTAP
Sbjct  196  YLPKGKLFKSSENGGASSALPPWLTQEDLDYYVTKYDNKGFTGPINYYRNIDRNWELTAP  255

Query  601  WSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAH  422
            W+ AK+ VP KFIVGD DL Y+  GAKEYI+ GGFK DVPLL++ VVL+GV HF+++E+ 
Sbjct  256  WTGAKIRVPVKFIVGDQDLTYNSPGAKEYINGGGFKKDVPLLDETVVLKGVGHFLHEESP  315

Query  421  EEVNNHIYN  395
            EE+N HI++
Sbjct  316  EEINQHIHS  324



>ref|XP_006414412.1| hypothetical protein EUTSA_v10025488mg [Eutrema salsugineum]
 gb|ESQ55865.1| hypothetical protein EUTSA_v10025488mg [Eutrema salsugineum]
Length=374

 Score =   227 bits (579),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    V  +R ++GDD+YI RFQ PGEIEAEF  LG +  L+ F +Y+ P PL
Sbjct  180  VVFSPRYPDRVPVPTLRHVFGDDYYICRFQKPGEIEAEFKKLGTENVLKKFLTYKTPGPL  239

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y PK K F  + + ++ALP WL +EDLDY+V++Y+K GFTG +NYYR +  +WELTAPW+
Sbjct  240  YLPKPKLFKRSENAASALPPWLTQEDLDYYVNKYDKKGFTGPINYYRNIDRNWELTAPWT  299

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVGD DL Y+  GAKEYIH GGFK DVPLL++ VVL G+ HF+++E+ +E
Sbjct  300  GAKISVPVKFIVGDQDLTYNSPGAKEYIHGGGFKRDVPLLDETVVLNGLGHFLHEESPDE  359

Query  415  VNNHIYN  395
            +N HI+N
Sbjct  360  INQHIHN  366



>ref|XP_009757465.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=331

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 139/187 (74%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    ++ +RA+YGDD+Y+VRFQ  G IEAEF  +GVK  L+ FF+YR+P PL
Sbjct  130  VAFNPRNPIKKPLDTLRAVYGDDYYVVRFQEAGVIEAEFEEMGVKNVLKKFFTYREPAPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y  KGK F  N      LP WL EE+LD++  ++E+TGFTG +N+YRA+  +WELTA W+
Sbjct  190  YLKKGKPFGDNP--QVELPCWLSEEELDFYAIKFEQTGFTGPLNFYRAIHRNWELTAAWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVGDLDL Y+  G K+Y+H GGFK  VPLLE+VVVL+GV HFI++E  +E
Sbjct  248  GAKIQVPVKFIVGDLDLTYNAPGTKDYLHKGGFKKQVPLLEEVVVLEGVGHFIHEEKPKE  307

Query  415  VNNHIYN  395
            +N+HIYN
Sbjct  308  INDHIYN  314



>ref|XP_010649574.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
 emb|CBI22972.3| unnamed protein product [Vitis vinifera]
Length=317

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 137/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR+P H  +EI R +YGDD Y+ RFQ PG+IE E A +G  T L+  F+ R P P 
Sbjct  126  VAYFPRNPMHKPLEIYRHLYGDDFYVCRFQEPGQIEIEIAEVGTATALKSIFANRDPSPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKGK F   +     LP WLPEE+++++V+++E+TGFTGG+NYYR    +WELTAPW+
Sbjct  186  CLPKGKAFQDVSGAPIVLPPWLPEEEVNFYVTKFEETGFTGGINYYRNFDRNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             +++ VPTKF+VGD+DL YH  GAKEYIH G FK +VPLLE+VVV++GV HF+++E  +E
Sbjct  246  GSQIKVPTKFMVGDMDLTYHFAGAKEYIHSGEFKKNVPLLEEVVVMEGVGHFLHEEKADE  305

Query  415  VNNHIYN  395
            +N HI++
Sbjct  306  INKHIHD  312



>ref|XP_006342824.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=325

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 134/186 (72%), Gaps = 3/186 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +  +RA+YGD++YI+RFQ PGEIE EFA +G KT L    + R P PL
Sbjct  129  VPFFPRNPIIRPIVALRAIYGDEYYIIRFQEPGEIEEEFAQIGTKTVLEKMLTIRDPEPL  188

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKGK F    D    LP WL E D+DY+ ++YE TGFTGG+NYYRAL L+WELTAPW+
Sbjct  189  KLPKGKPFD---DSPVILPPWLTETDVDYYATKYEHTGFTGGLNYYRALDLNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVGDLDL Y+  G K YI+ GG K +VPLLEDVV+L+GVAHF+ QE  +E
Sbjct  246  GAKIEVPVKFIVGDLDLTYNSAGVKFYINKGGLKKNVPLLEDVVILKGVAHFLQQEKPDE  305

Query  415  VNNHIY  398
            VN HI+
Sbjct  306  VNEHIH  311



>ref|XP_008775993.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Phoenix 
dactylifera]
Length=318

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 134/187 (72%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR P    ++  RA+YGDD YI RFQ PG  EAEFA LG  T LR FF+YR P P+
Sbjct  129  VAFMPRKPAAKPLDDFRALYGDDSYISRFQEPGAAEAEFARLGTATVLRKFFTYRNPGPI  188

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK    S N      LP+WL EED++YF S++EK+GFTG +NYYR   L+WEL APW+
Sbjct  189  FIPKDGWGSPNE--HITLPSWLSEEDINYFKSKFEKSGFTGPINYYRCFDLNWELAAPWT  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KFI+GDLDL YH    ++YIH GGFK DVP L++VVV++GVAHFINQE  +E
Sbjct  247  GAQIKVPAKFIIGDLDLTYHFPRMQDYIHKGGFKKDVPFLQEVVVMEGVAHFINQEKAQE  306

Query  415  VNNHIYN  395
            + +HIY+
Sbjct  307  ITDHIYD  313



>ref|XP_006414587.1| hypothetical protein EUTSA_v10025505mg [Eutrema salsugineum]
 gb|ESQ56040.1| hypothetical protein EUTSA_v10025505mg [Eutrema salsugineum]
Length=371

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 138/187 (74%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V  +R ++GDD+YI RFQ PGEIEAEF  LG +  L+ F +Y+ P PL
Sbjct  177  VVFSPRNPDRVPVPTLRHVFGDDYYICRFQKPGEIEAEFKKLGTENVLKKFLTYKTPGPL  236

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y PK K F  + + ++ALP WL +EDL Y+V++Y+K GFTG +NYYR +  +WELTAPW+
Sbjct  237  YLPKPKLFKRSENAASALPPWLAQEDLHYYVNKYDKKGFTGPINYYRNIDRNWELTAPWT  296

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVGD DL Y+  GAKEYIH GGFK DVPLL++ VVL G+ HF+++E+ +E
Sbjct  297  GAKISVPVKFIVGDQDLTYNSPGAKEYIHGGGFKRDVPLLDETVVLNGLGHFLHEESPDE  356

Query  415  VNNHIYN  395
            +N HI+N
Sbjct  357  INQHIHN  363



>ref|XP_008784769.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=322

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 133/186 (72%), Gaps = 0/186 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    VE  RA+YGDD+YI  FQ PG  EAEFA +     ++ F +Y  P P+
Sbjct  131  VAFRPRSPDRKPVETFRALYGDDYYICTFQEPGRTEAEFARIPTALVIKKFLTYHDPGPV  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
               K  GF+A+ D    LP+WL EED+DYF S+++K+GFTGG+NYYRAL L+WELTAPW+
Sbjct  191  IVSKENGFAASPDKEITLPSWLSEEDVDYFASKFDKSGFTGGLNYYRALDLNWELTAPWT  250

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVG+ DL+Y+I G K+YIH GGF+ DVP LEDVVV++G  HFINQE  +E
Sbjct  251  GMQIKVPVKFIVGNQDLIYNIPGVKDYIHKGGFERDVPFLEDVVVIEGAGHFINQEKPQE  310

Query  415  VNNHIY  398
            + +HIY
Sbjct  311  ITDHIY  316



>ref|XP_011006451.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=322

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 135/188 (72%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FIPR+P    VE +RA+YGDD+Y+ RFQ PG IEAE+A  G +  L++  +YR   PL
Sbjct  130  VLFIPRNPERKFVETLRALYGDDYYMCRFQEPGVIEAEYAERGTERVLKELLTYRVAGPL  189

Query  775  YFPKGKGFSAN-TDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
            + PKGKG +    D    LP+WL EED  Y+ +++E+ GFTGG+NYYR L  +WELTAPW
Sbjct  190  FLPKGKGLNGTPLDAPIVLPSWLSEEDFKYYTNKFEQKGFTGGLNYYRNLDRNWELTAPW  249

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + A+V VP KFIVGD DL Y+  G K+YI  GGFK DVP LE++VV++GV HF+NQE  +
Sbjct  250  TGAQVTVPVKFIVGDEDLTYNSLGGKDYIDSGGFKRDVPFLEELVVMEGVGHFLNQEKAD  309

Query  418  EVNNHIYN  395
            E+N HIY+
Sbjct  310  EINKHIYD  317



>ref|XP_004494384.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=317

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 134/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V+ MRA+ GDD+YI RFQ PGE E EFA  G    ++ F + R PR L
Sbjct  126  VVFRPRNPIRKPVQTMRALMGDDYYICRFQKPGEAEEEFARAGANRIIKSFLTLRDPRAL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF  + +    LP+WL EED++Y+ ++YE+ GFTGG+NYYRAL L WEL APW+
Sbjct  186  CVPKEIGFGGSPNTPITLPSWLSEEDVNYYATKYEQKGFTGGLNYYRALDLTWELMAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLDL Y+  G KEYIH+GGF+ +VP L+++VV++GVAHFINQE  EE
Sbjct  246  GEQIKVPVKFIVGDLDLTYNTPGVKEYIHNGGFRREVPYLQEMVVMEGVAHFINQERPEE  305

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  306  INAHIYD  312



>ref|XP_009136735.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=362

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 140/189 (74%), Gaps = 2/189 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    +  +R  +GDD+YI RFQ PGEIE EF  LG +  L++F +Y+ P PL
Sbjct  168  VLFSPRSPDRVPIPTLRRFFGDDYYICRFQKPGEIELEFKKLGTEKVLKEFLTYKTPGPL  227

Query  775  YFPKGKGFSANTDG--STALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAP  602
            Y PKGK F ++ +G  S+ALP WL +EDLDY+V++Y+  GFTG +NYYR +  +WELTAP
Sbjct  228  YLPKGKLFKSSENGGASSALPPWLTQEDLDYYVTKYDNKGFTGPINYYRNIDRNWELTAP  287

Query  601  WSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAH  422
            W+ AK+ VP KFIVGD DL Y+  GAKEYI+ GGFK DVPLL++ VVL+GV HF+++E+ 
Sbjct  288  WTGAKIRVPVKFIVGDQDLTYNSPGAKEYINGGGFKKDVPLLDETVVLKGVGHFLHEESP  347

Query  421  EEVNNHIYN  395
            EE+N HI++
Sbjct  348  EEINQHIHS  356



>ref|XP_006378063.1| hypothetical protein POPTR_0010s01420g [Populus trichocarpa]
 gb|ERP55860.1| hypothetical protein POPTR_0010s01420g [Populus trichocarpa]
Length=306

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FIPR+P+   VE +RA+YGDD+Y+ RFQ PG IEAE+A  G +  L++  ++R   PL
Sbjct  114  VLFIPRNPKRKFVETLRALYGDDYYMCRFQEPGVIEAEYAERGTERVLKELLTHRVAGPL  173

Query  775  YFPKGKGFS-ANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
            + PKGKG + A  D    LP+WL EED  Y+ +++E+ GFTGG+NYYR L  +WELTAPW
Sbjct  174  FLPKGKGLNGAPLDAPIVLPSWLSEEDFKYYTNKFEQKGFTGGLNYYRNLDRNWELTAPW  233

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + A+V VP KFI+GD DL Y+  G K+YI  GGFK DVP LE++VV++GV HF+NQE  +
Sbjct  234  TGAQVTVPVKFIIGDEDLTYNSLGGKDYIDSGGFKRDVPFLEELVVMEGVGHFLNQEKAD  293

Query  418  EVNNHIYN  395
            E+N HIY+
Sbjct  294  EINKHIYD  301



>ref|XP_006342825.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=334

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 137/187 (73%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +E +R +YGDD+Y+VRFQ PG IE EF  LG+K  ++ F +YR P PL
Sbjct  131  VAFNPRNPVKKPLETLRKVYGDDYYVVRFQEPGVIEGEFEELGIKNVVKKFLTYRTPGPL  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y  KGK F  +   +  LP WL +ED+D++ ++Y++ GFTG +NYYR++  +WE+TA W+
Sbjct  191  YLKKGKPFE-DASSTDELPGWLSDEDIDFYANKYKQIGFTGALNYYRSIDRNWEVTAAWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVGDLD+ Y+  GAK+Y+H GGFK  VPLLEDVVVLQGV HFI+QE  +E
Sbjct  250  GAKIQVPVKFIVGDLDITYNAPGAKDYLHKGGFKKLVPLLEDVVVLQGVGHFIHQEKPKE  309

Query  415  VNNHIYN  395
            +N HIYN
Sbjct  310  INEHIYN  316



>ref|XP_010039619.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW84772.1| hypothetical protein EUGRSUZ_B015792 [Eucalyptus grandis]
Length=317

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 136/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V ++PR+P    ++  RA YGDD+Y+ RFQ PGEIEA+FA +G +  +  F +YR P PL
Sbjct  126  VPWMPRNPGMKPLDGYRAAYGDDYYMCRFQEPGEIEAQFAEMGTRRVIEGFLTYRIPGPL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            +F KGKGF    D    LP+WL +ED+DY+V ++E+ GFTGG+NYYR L  +WEL APW 
Sbjct  186  FFVKGKGFGHPVDDPVVLPSWLTQEDIDYYVDKFEEKGFTGGINYYRNLNRNWELMAPWD  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +V VP KFIVG+LDLVYH+ G K++IH GG K  VPLLE+VVV++GVAHF+NQE  ++
Sbjct  246  GVQVKVPVKFIVGELDLVYHMPGVKDFIHKGGLKKTVPLLEEVVVMEGVAHFLNQERPQD  305

Query  415  VNNHIYN  395
               HIY+
Sbjct  306  TTQHIYD  312



>ref|XP_009386486.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   224 bits (570),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 134/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR+P    V+  R ++GDDHYI RFQ  G +EAE A +G    ++ F +YRKP  +
Sbjct  126  VAYAPRNPGRRPVDACRTIFGDDHYICRFQEHGAMEAEIAQIGTTLFMKKFLTYRKPAAI  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK KG   + +    LP+WL EED++YF S++EK+GFTGG+NYYR L L+WEL+APW+
Sbjct  186  NIPKDKGLEVSLETPVTLPSWLSEEDINYFASKFEKSGFTGGLNYYRCLNLNWELSAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            E +V VP KFI+GDLDL YH  G ++YIH GGFKS VP LEDVVV++GV HFINQE   E
Sbjct  246  EVQVDVPVKFIIGDLDLTYHTPGIQDYIHKGGFKSAVPFLEDVVVMEGVGHFINQERPHE  305

Query  415  VNNHIYN  395
            V++ IY+
Sbjct  306  VSDLIYH  312



>ref|XP_004298141.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=322

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 141/189 (75%), Gaps = 2/189 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQ--VPGEIEAEFAPLGVKTCLRDFFSYRKPR  782
            V + PR+P+  ++E M+A YG+D++  +F   +PGEIEAEFA +G    +R+F +YR P 
Sbjct  128  VQYFPRNPQRKILESMKAAYGEDYHFCKFSEFLPGEIEAEFAQIGTARVIREFLTYRHPG  187

Query  781  PLYFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAP  602
            PL+ PKGKGF   +D   ALP+WL E D++Y+V ++EK GFTGG+NYYR    +WEL AP
Sbjct  188  PLFLPKGKGFGHPSDSPIALPSWLSEADVNYYVGKFEKKGFTGGINYYRNSDRNWELLAP  247

Query  601  WSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAH  422
            W+ A+V VP K+IVGD DLVY+  GAK+YIH+G FK  VP LE+VV+++GVAHFINQE  
Sbjct  248  WTGAQVKVPVKYIVGDQDLVYNSLGAKDYIHNGEFKKYVPFLEEVVIMEGVAHFINQEKG  307

Query  421  EEVNNHIYN  395
            +E++ HI++
Sbjct  308  DEISKHIHD  316



>ref|XP_011091000.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=327

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 137/187 (73%), Gaps = 3/187 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F  R+P    +E++RA+YGDD+YI RFQ PG IE EFA +G KT L+ F +YR P PL
Sbjct  131  VVFTRRNPSRKPLEMLRAVYGDDYYICRFQEPGAIEHEFAQIGTKTVLKHFLTYRTPGPL  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKGK F    D   +LP WL EED+DY+ S+Y  TGFT  +NYYRAL ++WELTA W+
Sbjct  191  NIPKGKPFP---DTPISLPPWLSEEDVDYYTSKYNLTGFTAALNYYRALDINWELTAAWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KFIVGD+DL Y+  G KEYIH GGFK DVPLL++VVV++GV HFI++E  ++
Sbjct  248  GAQITVPVKFIVGDVDLTYNAPGCKEYIHKGGFKRDVPLLKEVVVMEGVGHFIHEEKPDD  307

Query  415  VNNHIYN  395
            VN HI++
Sbjct  308  VNAHIHS  314



>gb|KGN66047.1| hypothetical protein Csa_1G569240 [Cucumis sativus]
Length=317

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 131/187 (70%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    VE MR ++GDD+YI RFQ PGEIE E A +G K  LR   + R+  P 
Sbjct  126  VPFRPRHPNRKPVETMRMVFGDDYYICRFQNPGEIEEEMAQVGAKDVLRGILTTRRQGPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
             +PK + F A     + LP+WL EEDL YF S+YE+ GFTG +NYYR++ L+WELTAPW+
Sbjct  186  IYPKKQAFRARAGPPSPLPSWLSEEDLSYFASKYEQKGFTGPLNYYRSMDLNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +V VP KFIVGD+D+VY   G KEY++ GGFK DVP L+DVVV+ GV HF+NQE  EE
Sbjct  246  GVQVKVPVKFIVGDVDMVYTTPGVKEYVNGGGFKKDVPFLQDVVVMDGVGHFLNQEKPEE  305

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  306  INTHIYD  312



>ref|XP_009391487.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=317

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 131/185 (71%), Gaps = 0/185 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    VE +R  YGDD+Y+ RFQ PG  EAEF  +G    ++ F +Y  P P+
Sbjct  126  VVFRPRNPTGKPVETLRTAYGDDYYVCRFQEPGRTEAEFGRVGTSLIIKKFLTYHDPGPV  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK KGF    D   ALP+WL E+DL+YF  ++EK+GFTGG+NYYRAL L+WELTAPW+
Sbjct  186  IVPKEKGFGDAPDKENALPSWLSEDDLNYFAGKFEKSGFTGGLNYYRALDLNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGD DL YH  G ++YI  GGFK DVPLLED+VV++GV HFINQE  +E
Sbjct  246  GVQIKVPVKFIVGDQDLAYHFPGVQDYISKGGFKRDVPLLEDMVVMEGVGHFINQERPQE  305

Query  415  VNNHI  401
            ++N I
Sbjct  306  ISNII  310



>ref|XP_004290776.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=321

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   V  ++A+YG D+Y+ RFQ  G+IE E A LG    +++F S R P PL
Sbjct  128  VAFTPRNPQFKPVPALKAVYGGDYYMCRFQEEGDIEDELASLGCDRVMKEFLSNRNPGPL  187

Query  775  YFPKGKGF-SANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
              PKGKGF +A+ D    LP+WL E+D+ Y+ S +EK GFTG +NY+R L  +WELTAPW
Sbjct  188  MLPKGKGFGNASPDAPVTLPSWLSEDDIHYYASNFEKKGFTGALNYFRNLDRNWELTAPW  247

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + +K++VP KFIVGD DLVY+  GAK+YIH GGFK  VPLLE+VVV++GVAHFIN+E  E
Sbjct  248  TGSKILVPVKFIVGDQDLVYNSMGAKDYIHKGGFKKYVPLLEEVVVMEGVAHFINEERPE  307

Query  418  EVNNHIYN  395
            E+N HIY+
Sbjct  308  EINQHIYD  315



>ref|XP_010039627.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW84775.1| hypothetical protein EUGRSUZ_B015791 [Eucalyptus grandis]
Length=320

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 135/185 (73%), Gaps = 0/185 (0%)
 Frame = -2

Query  949  FIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYF  770
            ++PR+P    ++  RA YGDD+Y+ RFQ PGEIEA+FA +G +  L    +YR P PL+ 
Sbjct  131  WVPRNPGMKPLDGYRAAYGDDYYMCRFQEPGEIEAQFAEMGTRRVLEGVLTYRIPGPLFL  190

Query  769  PKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEA  590
             KGKGF    D    LP+WL ++D+DY+V ++EK GFTGG+NYYR +  +WEL APW  A
Sbjct  191  VKGKGFGHPVDDPVVLPSWLTQKDVDYYVDKFEKKGFTGGINYYRNMNRNWELMAPWDGA  250

Query  589  KVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVN  410
            +V VP KFIVG+LDLVYH+ G K++IH GGFK  VPLLE+VVV++GVAHF+NQE  ++  
Sbjct  251  QVKVPVKFIVGELDLVYHMPGVKDFIHKGGFKKMVPLLEEVVVMEGVAHFLNQERPQDTT  310

Query  409  NHIYN  395
             HIY+
Sbjct  311  QHIYD  315



>ref|XP_007147004.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
 gb|ESW18998.1| hypothetical protein PHAVU_006G088600g [Phaseolus vulgaris]
Length=318

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  + R+P    V+ MRAMYGDD+YI RFQ PGE+EA+ A +G +  L++  + RKP P 
Sbjct  126  VPLLHRNPEIRTVDAMRAMYGDDYYICRFQKPGEMEAQMAEVGTEYVLKNILTTRKPGPP  185

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N D + +LP+WL + DL Y+VS+++KTGFTG +NYYR +  +WELTAPW
Sbjct  186  IFPKGEYGTGFNPDMTNSLPSWLSQHDLAYYVSKFQKTGFTGPLNYYRNMNPNWELTAPW  245

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            S AK+ VP KFI GDLD+VY     KEYIH GGFK DVP LE+V+V +GVAHF NQEA E
Sbjct  246  SGAKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIVQKGVAHFNNQEAAE  305

Query  418  EVNNHIYN  395
            E+N HIY+
Sbjct  306  EINTHIYD  313



>ref|XP_006433457.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
 gb|ESR46697.1| hypothetical protein CICLE_v10001881mg [Citrus clementina]
Length=317

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 135/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P    VE MRA++GDD+YI RFQ PG+IEA+ A +G    L++  + RKP P 
Sbjct  126  VPFLPRNPNIKPVESMRALFGDDYYICRFQEPGKIEAQIAQVGTAEVLKNILANRKPGPS  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
             FP+   F  + +    LP+W  E+DL ++ +++ +TGFTG +NYYRA+ L+WE+TA W+
Sbjct  186  CFPEENAFGIDPENRVTLPSWFSEQDLSFYATKFNQTGFTGALNYYRAMNLNWEMTAAWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            E +V VP KFIVG+LD+VY   G KEY+H+GGFK DVPLLE++VV++   HFINQE  EE
Sbjct  246  EVQVKVPVKFIVGELDMVYTTPGIKEYVHNGGFKKDVPLLEEIVVIEDAGHFINQERAEE  305

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  306  INAHIYD  312



>emb|CBI22970.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   219 bits (557),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 134/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +E +RA  GDD+YI RFQ PG IE EFA +GV   L+ F +YR P PL
Sbjct  21   VPFSPRNPMRKPLESLRAQLGDDYYICRFQEPGVIETEFAEIGVDRVLKHFLTYRNPAPL  80

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKG  F  +      LP+WL EE++ Y+ ++Y+KTGFTGG+NYYR+L  +WELTAP++
Sbjct  81   FLPKGNAFGDDPATPIVLPSWLSEEEVHYYTTKYQKTGFTGGLNYYRSLNRNWELTAPFT  140

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +  VPTKFIVGD D+ YH  G+K++IH GG K  VPLLEDV+V++GV HFI++E  +E
Sbjct  141  GYQSKVPTKFIVGDHDMTYHAPGSKDFIHGGGLKKYVPLLEDVIVMEGVGHFIHEEKSDE  200

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  201  INKHIYD  207



>ref|XP_008784772.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X3 [Phoenix 
dactylifera]
Length=322

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 134/187 (72%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    VE +R++YGDDHY+ RFQ PG  EAEFA LG    L  F++Y  P PL
Sbjct  133  VAFTPRNPARKSVEYLRSLYGDDHYVCRFQEPGAAEAEFARLGTALVLEKFYTYHSPDPL  192

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK    S +T+    LP+WL ++D+ Y+ S++EKTGFTGG+NYYR L L+WELTAPW+
Sbjct  193  FIPKEGWGSPDTE--IPLPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWELTAPWT  250

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A + VP KFIVGD+DL YH  G ++YIH  GFKS VPLLE+VVV++GV HFIN+E   E
Sbjct  251  GAHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGFKSYVPLLEEVVVMKGVGHFINEEKPHE  310

Query  415  VNNHIYN  395
            +  HIYN
Sbjct  311  ITVHIYN  317



>ref|XP_004229259.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=335

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 137/188 (73%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P +  ++ +R +YGDD+Y+VRFQ  G IE EF  LG+K  L+ F +YR P PL
Sbjct  131  VAFNPRNPLNKPLDTLRKVYGDDYYVVRFQEAGVIEGEFEELGIKNVLKKFLTYRTPGPL  190

Query  775  YFPKGKGFS-ANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
            Y  KGK F   ++     LPAWL  ED+D++ ++Y++ GFTG +NYYR++  +WE+TA W
Sbjct  191  YLKKGKPFEDTSSTNDDELPAWLSHEDIDFYANKYKQIGFTGALNYYRSIDRNWEVTAAW  250

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + AK+ VP KFIVGDLD+ Y+  GAK+Y+H GGFK  VPLLEDVVVLQGV HFI+QE  +
Sbjct  251  TGAKIQVPVKFIVGDLDITYNAPGAKDYLHKGGFKKLVPLLEDVVVLQGVGHFIHQEKPK  310

Query  418  EVNNHIYN  395
            E+N HIYN
Sbjct  311  EINEHIYN  318



>ref|XP_008784771.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X2 [Phoenix 
dactylifera]
Length=338

 Score =   223 bits (567),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 134/187 (72%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    VE +R++YGDDHY+ RFQ PG  EAEFA LG    L  F++Y  P PL
Sbjct  149  VAFTPRNPARKSVEYLRSLYGDDHYVCRFQEPGAAEAEFARLGTALVLEKFYTYHSPDPL  208

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK    S +T+    LP+WL ++D+ Y+ S++EKTGFTGG+NYYR L L+WELTAPW+
Sbjct  209  FIPKEGWGSPDTE--IPLPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWELTAPWT  266

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A + VP KFIVGD+DL YH  G ++YIH  GFKS VPLLE+VVV++GV HFIN+E   E
Sbjct  267  GAHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGFKSYVPLLEEVVVMKGVGHFINEEKPHE  326

Query  415  VNNHIYN  395
            +  HIYN
Sbjct  327  ITVHIYN  333



>ref|XP_006489255.1| PREDICTED: bifunctional epoxide hydrolase 2-like, partial [Citrus 
sinensis]
Length=257

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 136/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F P     +L+E +RA YGD++Y+ RFQ PGEIEAEFA +G +T +++FF++     +
Sbjct  66   VVFNPFGSNDNLIEALRAYYGDNYYMCRFQKPGEIEAEFAQIGTETVIKEFFTFWTRDRI  125

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF    +   ALP+WL EED+ YF ++++K GFTG +NYYR + L  EL APW+
Sbjct  126  FLPKGKGFGRPPNTPIALPSWLSEEDVKYFTTKFDKKGFTGAMNYYRNINLSLELLAPWA  185

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             +++ +PTKFI+GDLD+ YH+ G +EYIH GGFK DVPLLE VV+++GV HFINQ    E
Sbjct  186  GSQIQIPTKFIIGDLDMTYHMPGVQEYIHKGGFKRDVPLLEKVVIMEGVGHFINQGKSNE  245

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  246  ISKHIYD  252



>ref|XP_007035641.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY06567.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=396

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 133/185 (72%), Gaps = 0/185 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   +E +RA YGDD+YI RFQ PGEIEAEFA LG +  L+ F +YR P PL
Sbjct  201  VVFSPRNPKRKPLESLRAFYGDDYYICRFQAPGEIEAEFAELGFERVLKGFLTYRNPGPL  260

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKGK F       +  P WL EED+ Y++S+YEK GFTGG+NYYR + L+WELTAPW+
Sbjct  261  LLPKGKYFGQPDTPISLPPNWLSEEDVKYYISQYEKKGFTGGLNYYRNIDLNWELTAPWT  320

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             ++V VP KFIVGD DL Y+  G K+YI  GG K DVP LE VVV++GVAHF+++E  +E
Sbjct  321  GSQVKVPVKFIVGDQDLTYNAPGTKDYIQKGGLKRDVPFLEQVVVMEGVAHFLHEEKPDE  380

Query  415  VNNHI  401
            +N H+
Sbjct  381  INKHM  385



>ref|XP_008784770.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Phoenix 
dactylifera]
Length=359

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 134/187 (72%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    VE +R++YGDDHY+ RFQ PG  EAEFA LG    L  F++Y  P PL
Sbjct  170  VAFTPRNPARKSVEYLRSLYGDDHYVCRFQEPGAAEAEFARLGTALVLEKFYTYHSPDPL  229

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK    S +T+    LP+WL ++D+ Y+ S++EKTGFTGG+NYYR L L+WELTAPW+
Sbjct  230  FIPKEGWGSPDTE--IPLPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWELTAPWT  287

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A + VP KFIVGD+DL YH  G ++YIH  GFKS VPLLE+VVV++GV HFIN+E   E
Sbjct  288  GAHIKVPAKFIVGDVDLTYHTPGIQDYIHKVGFKSYVPLLEEVVVMKGVGHFINEEKPHE  347

Query  415  VNNHIYN  395
            +  HIYN
Sbjct  348  ITVHIYN  354



>ref|XP_003554527.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
Length=317

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 135/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    ++ +RA+ GDD+YI RFQ PGE+E EFA  G    ++ F + R PRP 
Sbjct  126  VVFRPRNPNRKPIQSLRAIMGDDYYICRFQKPGEVEEEFARAGAARIIKTFIASRDPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF  + D    LP+WL EED++Y+ S++E+ GFTGG+NYYRA+ L WELTA W+
Sbjct  186  CVPKEIGFGGSPDLRIDLPSWLTEEDVNYYASKFEQKGFTGGLNYYRAMDLTWELTAAWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ Y+  G KEYIH+GGFK DVP L+++VV++GVAHFINQE  +E
Sbjct  246  GVQIKVPVKFIVGDLDITYNTPGVKEYIHNGGFKRDVPFLQELVVMEGVAHFINQERPQE  305

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  306  ISAHIYD  312



>ref|XP_007163124.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris]
 gb|ESW35118.1| hypothetical protein PHAVU_001G208300g [Phaseolus vulgaris]
Length=317

 Score =   221 bits (563),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 136/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   ++ +RAM GDD+YI RFQ PGE+E +FA  G    ++ F + R PRP 
Sbjct  126  VVFRPRNPKRKPIQSLRAMMGDDYYICRFQKPGEVEEDFARAGAARIIKKFLASRDPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
               K  GF  + D   ALP+WL EED++Y+ S++E+ GFTGG+NYYRA+ L WELTA W+
Sbjct  186  RASKEIGFGGSPDLHVALPSWLSEEDVNYYASKFEQKGFTGGLNYYRAMDLTWELTAAWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ Y+  G KEYIH+GGFK DVP L++++V++GVAHFIN+E  EE
Sbjct  246  GVQIKVPVKFIVGDLDITYNTPGVKEYIHNGGFKRDVPFLQELIVMEGVAHFINEERPEE  305

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  306  ISAHIYD  312



>ref|XP_010914487.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=318

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 134/187 (72%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P    V+  R++YGD++YI RFQ P   EAEFA LG  T L+ FF+YR P P+
Sbjct  129  VAFLPRNPAMKPVDYFRSIYGDEYYICRFQEPDAAEAEFARLGAATVLKKFFTYRDPGPI  188

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y PK    S N      LP+WL E D++Y+ S++EK+GFTG +NYYR   L+WELT PW+
Sbjct  189  YIPKDGWGSPNE--QITLPSWLSEADINYYTSKFEKSGFTGPINYYRCFDLNWELTEPWN  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+  VP KFIVGDLDL YH    ++YIH GGFK DVPLL++VVV++GVAHFINQE  +E
Sbjct  247  GAQANVPAKFIVGDLDLTYHYPNMQDYIHKGGFKKDVPLLQEVVVMEGVAHFINQEKAQE  306

Query  415  VNNHIYN  395
            + +HIY+
Sbjct  307  IADHIYD  313



>ref|XP_006644009.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Oryza brachyantha]
Length=321

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 128/185 (69%), Gaps = 0/185 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR+P    V+ +RA+ GD+HYI  FQ PG  EAEF    +K  L+ F+  RKP PL
Sbjct  130  VEYHPRNPSRSPVQTLRAICGDEHYICFFQKPGVAEAEFGRCDIKCALKKFYGMRKPEPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              P+GK    + D     PAWL EED+ Y+  ++EKTGFT G+NYYR + L+WELTAPW+
Sbjct  190  IIPQGKTLFDSIDSDGTCPAWLTEEDIAYYAEKFEKTGFTAGLNYYRCIDLNWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
               + VPTKFIVGD DL Y+I G K+YIH GG K+ VP LEDVVV++GVAHFINQE   E
Sbjct  250  GVPIKVPTKFIVGDQDLTYNIPGVKDYIHKGGLKASVPNLEDVVVMEGVAHFINQEKPNE  309

Query  415  VNNHI  401
            V+NHI
Sbjct  310  VSNHI  314



>ref|XP_011079631.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Sesamum indicum]
Length=317

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 131/187 (70%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+PR   VE MRA+ GDD+YI RFQ PGE E EFA +     ++ F   R P PL
Sbjct  126  VVFQPRNPRRKPVESMRAILGDDYYICRFQKPGEAEEEFARVDTAQLIKKFLISRNPTPL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF   TD    LP+WL E+D+ Y+ +++ K GFTGG+NYYRA+ L WELTA W+
Sbjct  186  RVPKEVGFGGRTDKPIILPSWLSEDDVQYYATKFNKKGFTGGLNYYRAMDLTWELTAAWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLDL Y+  G KEYIH+GGF+  VP L+++V+++GVAHF+NQE  EE
Sbjct  246  GVQIKVPVKFIVGDLDLTYNTPGVKEYIHNGGFRKQVPFLQELVIMEGVAHFLNQEKPEE  305

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  306  ISQHIYD  312



>gb|EPS69728.1| epoxide hydrolase [Genlisea aurea]
Length=318

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 134/182 (74%), Gaps = 5/182 (3%)
 Frame = -2

Query  940  RDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYFPKG  761
            R+P   +V+ +R  YGDD+Y++RFQ PGEIEAEFA +G K   ++ F+YR P PLY PKG
Sbjct  135  RNPDRSIVDALRKAYGDDYYVIRFQEPGEIEAEFAEIGFKQVFKNIFAYRTPGPLYLPKG  194

Query  760  KGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEAKVM  581
            KGF  + D     P+WL EEDLDYFV++++++GFTGGVNYYRA  L WEL A W++AKV 
Sbjct  195  KGFGYSAD----RPSWLTEEDLDYFVTKFQQSGFTGGVNYYRAWPLSWELDAAWADAKVN  250

Query  580  VPTKFIVGDLDLVYHIKGAKEYIH-DGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVNNH  404
            VPTKFIVGDLDL YH  G KE IH D GFK  VP L++VVV++   HFINQE  + ++ H
Sbjct  251  VPTKFIVGDLDLTYHNPGVKELIHGDDGFKGRVPSLKEVVVVEDAGHFINQEKPDLISQH  310

Query  403  IY  398
            IY
Sbjct  311  IY  312



>ref|XP_003632381.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 130/187 (70%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +E MR ++GDD+Y+ RFQ PG  E EFA LG +T ++ F   R PRP 
Sbjct  126  VVFRPRNPTRKPIESMRVLFGDDYYMCRFQEPGLAENEFARLGTETVMKIFLGSRNPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK   +S      TALP WL +ED+DYF S++ + GFTGG+NYYRAL L WE  APW+
Sbjct  186  RMPKESWYSGALKTPTALPPWLSQEDIDYFASKFNQNGFTGGLNYYRALDLSWEALAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
               + VP KFIVGDLD  Y+  G KEYIH+GGFK +VP L+++V+++GVAHFINQE  EE
Sbjct  246  GVPIKVPVKFIVGDLDTTYNTPGVKEYIHNGGFKREVPFLQELVIMEGVAHFINQERPEE  305

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  306  INAHIYD  312



>gb|AAM28292.1| epoxide hydrolase [Ananas comosus]
Length=318

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 132/187 (71%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  +PR+P    V  ++ +YGD+ Y+ RFQ PG  EAEFA +G K  LR   + R PRP 
Sbjct  129  VAHMPRNPSVSPVHQIKHLYGDNIYVCRFQEPGVAEAEFAEVGTKNVLRKILTMRDPRPS  188

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
                    S  T    ALP+WL EEDLDY+ S++EKTGFTGG+NYYR + L+WELTAPW+
Sbjct  189  SLTHKDWGS--TGEEIALPSWLSEEDLDYYASKFEKTGFTGGMNYYRCMNLNWELTAPWA  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VPTKFIVGDLDL YH    ++YIH GGFK++VPLLE+VVVL+GV HFI QE  EE
Sbjct  247  GAKIQVPTKFIVGDLDLTYHYPNIQDYIHKGGFKNEVPLLEEVVVLEGVGHFIQQERAEE  306

Query  415  VNNHIYN  395
            V +HIYN
Sbjct  307  VTDHIYN  313



>emb|CDO98837.1| unnamed protein product [Coffea canephora]
Length=329

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 136/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   +E +RA+ G D+Y+ RFQ PGEIE EFA +G K  L +F SYR P PL
Sbjct  130  VSFGPRNPKRKPIETLRAVCGPDYYVCRFQEPGEIEEEFAKVGTKRVLENFLSYRAPGPL  189

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKG  F  + D  T LP+WL EED+ Y+V++Y ++GFTG +NYYRAL ++WELTAPW+
Sbjct  190  FLPKGILFGDSPDAPTTLPSWLSEEDVAYYVNQYAQSGFTGALNYYRALDINWELTAPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KF+VGDLDL Y+  G K+Y+H GG K DVP L+ VVV++ V HF+++E  +E
Sbjct  250  GAQVKVPVKFVVGDLDLTYNAPGTKDYLHKGGLKKDVPFLDQVVVMKEVGHFLHEEKPDE  309

Query  415  VNNHIYN  395
            +N +I+ 
Sbjct  310  INKYIHQ  316



>ref|XP_007050977.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOX95134.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=316

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 133/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR      VE  RA++GDD+YI RFQ PGEIE +FA +     ++ F + R PRP 
Sbjct  126  VAYRPRHRSMKPVEGFRALFGDDYYICRFQEPGEIEEDFAQMDTAKIMKIFLTSRNPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    D    LP+WL EED++YF S++ + GFTGG+NYYRAL L WEL APW+
Sbjct  186  CIPKEIGFRGYPD-PPPLPSWLSEEDINYFASKFNEKGFTGGLNYYRALDLSWELMAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ YHI GAKEYIH+GGFK DVP L++VVV++GVAHFINQE  EE
Sbjct  245  GLQIKVPVKFIVGDLDITYHIPGAKEYIHNGGFKKDVPFLQEVVVMEGVAHFINQEKSEE  304

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  305  ISKHIYD  311



>ref|XP_008454327.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=315

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VH+ PR+P    + + R   GDD YI +FQ PG  EA+F  +   T ++ F + R PRP 
Sbjct  126  VHYTPRNPAGSPLAVTRRYLGDDFYICKFQEPGVAEADFGSVDTATMMKKFLTMRDPRPA  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              P G  F    +    LP+WL EED++YF S++ KTGFTGG NYYRAL + WELT PWS
Sbjct  186  IIPNG--FKTLLETPEILPSWLTEEDIEYFASKFSKTGFTGGFNYYRALDITWELTGPWS  243

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VPTKFIVGDLDLVY+  GAKEYIH GGFK DVPLLEDVVV++G AHFINQE  +E
Sbjct  244  RAQIKVPTKFIVGDLDLVYNFPGAKEYIHGGGFKKDVPLLEDVVVIEGAAHFINQEKPDE  303

Query  415  VNNHIYN  395
            +++ IY+
Sbjct  304  ISSLIYD  310



>ref|XP_006654297.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Oryza brachyantha]
Length=245

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    V+ +R +YGDD+Y+ R Q PG IEAEFA LG +  LR F +YR P PL
Sbjct  52   VAFTPRSPARKPVDGLRTIYGDDYYVCRIQEPGAIEAEFARLGTELVLRKFLAYRTPGPL  111

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK      + D    LP+W+ E+D+ Y+ S ++KTGFTGG+NYYRAL   WELTAPW+
Sbjct  112  MMPKSGW--GSPDDEVPLPSWITEDDIKYYTSMFDKTGFTGGLNYYRALNKTWELTAPWT  169

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KFIVGDLDL YH  G +++IH GGFK  VPLL+DVVV++GV HFIN+E  EE
Sbjct  170  GAQIKVPAKFIVGDLDLTYHTPGIQDFIHKGGFKKYVPLLDDVVVMEGVGHFINEEKPEE  229

Query  415  VNNHIYN  395
            V+ HI +
Sbjct  230  VSEHIIS  236



>ref|XP_010921625.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=211

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 134/185 (72%), Gaps = 2/185 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    VE +R++YG+D+Y+  FQ PG  EAEFA LG    L+ F++Y  P PL
Sbjct  22   VTFTPRNPARKSVEYLRSLYGEDYYVCGFQEPGAAEAEFARLGAVLVLKKFYTYHSPDPL  81

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK +G+  + D    LP+WL ++D+ Y+ S++EKTGFTGG+NYYR L L+WELTAPW+
Sbjct  82   FIPK-EGW-GSPDSEIPLPSWLSKDDIKYYASKFEKTGFTGGLNYYRCLDLNWELTAPWT  139

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A + VP KFIVGD+DL YH  G ++YI  GGFK+DVPLLE+VVV++GV HFIN+E   E
Sbjct  140  GAHIKVPAKFIVGDVDLTYHAPGVQDYIQKGGFKNDVPLLEEVVVMKGVGHFINEEKPHE  199

Query  415  VNNHI  401
            V  HI
Sbjct  200  VTEHI  204



>ref|XP_010434902.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=379

 Score =   221 bits (564),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 137/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+ +   V  +R  +GDD+YI RFQ PGEIEAEF  LG +  L++F +Y+ P PL
Sbjct  187  VLFSPRNSQRVPVTTLRHTFGDDYYICRFQKPGEIEAEFKKLGTEKVLKEFLTYKTPGPL  246

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGK F    + + ALP WL +EDLDY+V++Y+K GFTG +NYYR +  +WELTAPW+
Sbjct  247  HLPKGKCFERLENDACALPPWLTQEDLDYYVTKYDKKGFTGPINYYRNIDRNWELTAPWT  306

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVG  DL Y+  GAKEYI+DGGFK DVPLL++ VVL+G+ HF+++E  + 
Sbjct  307  GAKIHVPVKFIVGGQDLTYNFPGAKEYINDGGFKRDVPLLDETVVLKGLGHFLHEEDPDV  366

Query  415  VNNHIYN  395
            +N HI+N
Sbjct  367  INQHIHN  373



>ref|XP_006419517.1| hypothetical protein CICLE_v10005451mg [Citrus clementina]
 gb|ESR32757.1| hypothetical protein CICLE_v10005451mg [Citrus clementina]
Length=319

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 137/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F P     +L+E +RA YGD++Y+ RFQ PGEIEAEFA +G +T +++FF++     +
Sbjct  128  VVFNPFGSNDNLIEALRAYYGDNYYMCRFQKPGEIEAEFAQIGTETVIKEFFTFWTGDRI  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGKGF    +   ALP+WL EED+ YF ++++K GFTG +NYYR + L+ EL APW+
Sbjct  188  FLPKGKGFGRPPNTPIALPSWLSEEDVKYFTTKFDKKGFTGAMNYYRNINLNHELLAPWA  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             +++ +PTKFI+GDLD+ YH+ G +EYIH GGFK DVPLLE VV+++GV HFINQ    E
Sbjct  248  GSQIQIPTKFIIGDLDMTYHMPGVQEYIHKGGFKRDVPLLEKVVIMEGVGHFINQGKSNE  307

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  308  ISKHIYD  314



>emb|CAD31713.1| epoxide hydrolase [Cicer arietinum]
Length=275

 Score =   218 bits (555),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 132/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  + R+P+   V+ MRA YGDD+YI RFQ PG++EA+ A +G    L++  + RK  P 
Sbjct  83   VPLLHRNPKIKTVDAMRAAYGDDYYICRFQEPGKMEAQMAEVGTAYVLKNILTTRKTGPP  142

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
              PKG+ G   N D    LP+WL E DL YFVS++EKTGFTGG+NYYR L L+WEL APW
Sbjct  143  ILPKGEYGTGFNPDTPDTLPSWLTEADLAYFVSKFEKTGFTGGLNYYRNLNLNWELMAPW  202

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
              AKV VP KFI G+LD+VY     KEYIH GGFK DVP LE+V+V +GVAHF NQEA E
Sbjct  203  RGAKVYVPVKFITGELDMVYTSLNMKEYIHGGGFKEDVPNLEEVIVQKGVAHFNNQEAAE  262

Query  418  EVNNHIY  398
            E++NHIY
Sbjct  263  EISNHIY  269



>gb|EYU46741.1| hypothetical protein MIMGU_mgv1a009984mg [Erythranthe guttata]
Length=325

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 131/187 (70%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   VE MRA+ G+D+YI RFQ PGE E+EFA +     ++ F + R P PL
Sbjct  126  VVFHPRNPKRKPVESMRAILGNDYYICRFQEPGEAESEFARVDTARLIKKFLTSRNPAPL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF  +      +P+WL EED+ Y+ S++   GFTGG+NYYRA+ L+WELTAPWS
Sbjct  186  IVPKEVGFGGSPHKPITMPSWLSEEDVQYYASKFSLKGFTGGLNYYRAMDLNWELTAPWS  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLDL Y+  G KEYIH GGFK  VP L+++V+++GVAHFINQE  EE
Sbjct  246  SVQIKVPVKFIVGDLDLTYNTPGVKEYIHGGGFKRQVPFLQELVIMEGVAHFINQEKPEE  305

Query  415  VNNHIYN  395
             + HIY+
Sbjct  306  TSQHIYD  312



>ref|XP_006604802.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|KHN43315.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 134/188 (71%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+ RDP    V+ MRA+YGDD+Y+ RFQ PGE+EA+ A +G    L++  + RK  P 
Sbjct  126  VPFLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTGYVLKNILTSRKTGPP  185

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
            + P G+ G   N D S +LP+WL E+DL Y+VS++EKTGFTGG+NYYR   LDWELTAPW
Sbjct  186  FLPHGEFGTGFNPDMSDSLPSWLTEDDLAYYVSKFEKTGFTGGLNYYRNFNLDWELTAPW  245

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            +  ++ VP KFI G+LD VY     KEYIH GGFK DVP LE V+V +GVAHF NQEA E
Sbjct  246  TGVQIKVPVKFITGELDSVYTSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFNNQEAAE  305

Query  418  EVNNHIYN  395
            E+N HIY+
Sbjct  306  EINTHIYD  313



>emb|CDP17111.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   219 bits (557),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 133/187 (71%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   +E MRA +GDD+YI RFQ PGE E EFA +     ++ F + R+P PL
Sbjct  126  VVFTPRNPKRKPLEAMRARFGDDYYICRFQEPGEAEEEFARVDTARIIKKFLTSRRPGPL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF  +      LP+WL E+D++YF S++ + GFTGG+NYYRA+ L+WELTAPW+
Sbjct  186  CVPKEVGFGGSPHNPIQLPSWLSEDDVNYFASKFSQKGFTGGLNYYRAMDLNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ +   G KEYI  GGFK DVP L+++VV++GVAHF+NQE  EE
Sbjct  246  GLQIKVPVKFIVGDLDVTFTTPGVKEYIQKGGFKRDVPFLQELVVMEGVAHFVNQEKPEE  305

Query  415  VNNHIYN  395
            V+ HIY+
Sbjct  306  VSAHIYD  312



>gb|EYU43974.1| hypothetical protein MIMGU_mgv1a009814mg [Erythranthe guttata]
Length=331

 Score =   219 bits (558),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 137/185 (74%), Gaps = 3/185 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F  R+P    +E +R++YG+++YI RFQ PG+IE EF+ +G K  L++F +YR P PL
Sbjct  134  VPFSRRNPNRKPIETLRSVYGNEYYICRFQEPGKIEQEFSQIGTKNVLKNFLTYRNPGPL  193

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK K FS   D  T+LP WL +ED++Y+ S+Y+ TGFTG +NYYRAL ++WELT  WS
Sbjct  194  HLPKSKAFS---DTETSLPPWLSDEDVNYYASKYDATGFTGALNYYRALDINWELTGAWS  250

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ V  KF+VGDLDL Y+  G KEYIH+GGFK DVPLL++VVV++ VAHFI+QE  +E
Sbjct  251  RGEIKVAVKFMVGDLDLTYNSPGTKEYIHNGGFKKDVPLLKEVVVMKDVAHFIHQEKPDE  310

Query  415  VNNHI  401
            VN +I
Sbjct  311  VNANI  315



>ref|XP_002271210.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   218 bits (556),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 134/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +E +RA  GDD+YI RFQ PG IE EFA +GV   L+ F +YR P PL
Sbjct  126  VPFSPRNPMRKPLESLRAQLGDDYYICRFQEPGVIETEFAEIGVDRVLKHFLTYRNPAPL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKG  F  +      LP+WL EE++ Y+ ++Y+KTGFTGG+NYYR+L  +WELTAP++
Sbjct  186  FLPKGNAFGDDPATPIVLPSWLSEEEVHYYTTKYQKTGFTGGLNYYRSLNRNWELTAPFT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +  VPTKFIVGD D+ YH  G+K++IH GG K  VPLLEDV+V++GV HFI++E  +E
Sbjct  246  GYQSKVPTKFIVGDHDMTYHAPGSKDFIHGGGLKKYVPLLEDVIVMEGVGHFIHEEKSDE  305

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  306  INKHIYD  312



>gb|AES82420.2| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+ R+P+   V+ MRA+YGDD+YI RFQ PGE+EA+ A +G    +++  + RK  P 
Sbjct  127  VPFLHRNPKIRTVDGMRAVYGDDYYICRFQEPGEMEAQMAEVGTTYVMKNILTTRKTGPP  186

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N D    LP+WL E+DL YFVS++EKTGFTGG+NYYR   L+WELTAPW
Sbjct  187  IFPKGEYGTGFNPDTPDNLPSWLTEDDLAYFVSKFEKTGFTGGLNYYRNFNLNWELTAPW  246

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            +  K+ VP KFI G+LD+VY     KEYIH GGFK DVP LE+V++ +GVAHF NQEA E
Sbjct  247  TGVKIKVPVKFITGELDMVYTSFNLKEYIHGGGFKEDVPNLEEVIIQKGVAHFNNQEAEE  306

Query  418  EVNNHIY  398
            E++N+IY
Sbjct  307  EISNYIY  313



>ref|XP_007031041.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY11543.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=317

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 130/187 (70%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR P+   VE MR ++G+D+YI RFQ PG+IEAE A +G    L+   S R+P P 
Sbjct  126  VPFMPRKPKMKPVESMRLLFGEDYYICRFQEPGKIEAEIAHVGTSEVLKKVLSTREPGPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK   F    D    LP+W  EEDL Y+ +++ + GFTGG+NYYRAL L+WELTAPW+
Sbjct  186  RLPKDDAFGIKPDTPVTLPSWFSEEDLSYYANKFNQKGFTGGLNYYRALDLNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +V +P KFIVGDLD VY   G KEY+  GGFK DVPLL++VVV++GV HFINQE  EE
Sbjct  246  NVQVKLPVKFIVGDLDTVYTTPGIKEYVQSGGFKRDVPLLDEVVVMEGVGHFINQERAEE  305

Query  415  VNNHIYN  395
            +N+ IY+
Sbjct  306  INSLIYD  312



>gb|KHG21329.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=386

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 135/187 (72%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +E +RA+YGDD+YI RFQ PG IEAEF  +G +  L+ FF+YR P PL
Sbjct  196  VAFNPRNPNMKPLEGLRALYGDDYYICRFQEPGVIEAEFREMGYERVLKGFFTYRDPCPL  255

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKGK F    D   +LP+W  EED  Y++S+YEK GFTG +NYYR + L+W+LTAPW+
Sbjct  256  LIPKGKYF-GQPDTPISLPSWFSEEDCKYYLSQYEKKGFTGALNYYRNINLNWQLTAPWT  314

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             +KV VP KFIVGD DL Y+  G K+Y+H GG K +VPLLE VVV++GVAHF+ +E  +E
Sbjct  315  GSKVKVPVKFIVGDQDLTYNGPGIKDYLHKGGLKKNVPLLEQVVVMEGVAHFLQEENPDE  374

Query  415  VNNHIYN  395
            VN HI++
Sbjct  375  VNKHIHD  381



>ref|XP_004240550.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum lycopersicum]
Length=318

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 134/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   +E MRA+ GDD+YI RFQ  GE E EFA +     +  F + R P PL
Sbjct  127  VVFHPRNPKRKPIESMRAVLGDDYYICRFQEYGEAEEEFARVDTARLIAKFLTSRNPAPL  186

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK KGF  +      LP+WL EED++Y+ +++ ++GFTGG+NYYRA+ L+WELTAPW+
Sbjct  187  RVPKEKGFGGSPHTPITLPSWLSEEDVNYYANKFRQSGFTGGLNYYRAMDLNWELTAPWT  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGD+DL Y+  G KEYIH GGF+  VP L++VV+++GVAHFINQE  EE
Sbjct  247  GVQIKVPVKFIVGDVDLTYNTPGVKEYIHKGGFQKVVPFLQEVVIMEGVAHFINQERPEE  306

Query  415  VNNHIYN  395
            +N+HIY+
Sbjct  307  INDHIYD  313



>gb|KEH24395.1| epoxide hydrolase [Medicago truncatula]
Length=317

 Score =   218 bits (554),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 132/187 (71%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F  R+P    V+ MRA+ GDD+Y+ RFQ PGE E EFA  G    ++ F + R PR L
Sbjct  126  VVFRSRNPVRKPVQTMRALMGDDYYMCRFQKPGEAEEEFARAGATRIIKSFLTLRDPRAL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF  + +    LP WL EED++Y+ +++E+ GFTGG+NYYRAL L WEL APW+
Sbjct  186  CVPKEIGFGGSPNTHITLPKWLSEEDVNYYATKFEQKGFTGGLNYYRALDLTWELMAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLDL Y+  G KEYIH+GGFK +VP L+++VV++GVAHFINQE  EE
Sbjct  246  GEQIKVPAKFIVGDLDLTYNTPGVKEYIHNGGFKREVPYLQEMVVMEGVAHFINQERPEE  305

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  306  ISAHIYD  312



>ref|XP_006355815.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=318

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 134/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   +E MRA+ GDD+YI RFQ  GE E EFA +     +  F + R P PL
Sbjct  127  VVFHPRNPKRKPIESMRAVLGDDYYICRFQEYGEAEEEFARVDTARLIAKFLTSRNPAPL  186

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK KGF  +      LP+WL EED++Y+ +++ ++GFTGG+NYYRA+ L+WELTAPW+
Sbjct  187  RVPKEKGFGGSPHTPITLPSWLSEEDVNYYANKFRQSGFTGGLNYYRAMDLNWELTAPWT  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFI+GD+DL Y+  G KEYIH GGF+  VP L++VV+++GVAHFINQE  EE
Sbjct  247  GVQIKVPVKFIIGDVDLTYNTPGVKEYIHKGGFQKMVPFLQEVVIMEGVAHFINQERPEE  306

Query  415  VNNHIYN  395
            +N+HIY+
Sbjct  307  INDHIYD  313



>ref|XP_010693594.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=362

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 135/188 (72%), Gaps = 5/188 (3%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLG-VKTCLRDFFSYRKPRP  779
            V F PR+P   L++++ A YG D+YI RFQVPGEIE+E A  G     LR  FS+R P P
Sbjct  174  VAFSPRNPNMKLLDMLCAAYGPDYYICRFQVPGEIESEIAEAGGADKLLRKIFSFRDPGP  233

Query  778  LYFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
            L  PKGK F+       + P WL +E+  Y+V ++ K+GFTGG+NYYRAL L+WELTAPW
Sbjct  234  LMLPKGKAFT----DMASYPNWLSQEESSYYVDKFTKSGFTGGLNYYRALNLNWELTAPW  289

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + A+V VP KF+VGDLDL YH+ G KEYI+ GG K DVPLLE+VV+L+GVAHF+ QE  +
Sbjct  290  TGAQVEVPVKFVVGDLDLAYHMPGVKEYINQGGMKKDVPLLEEVVILEGVAHFLQQEKPD  349

Query  418  EVNNHIYN  395
             V +HIY+
Sbjct  350  VVTDHIYD  357



>ref|XP_010038230.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50053.1| hypothetical protein EUGRSUZ_K03494 [Eucalyptus grandis]
Length=319

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 132/187 (71%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   ++ +RA++GDD+YI RFQ PGE E +FA   +   ++ F + R P+P 
Sbjct  128  VVFQPRNPKRKPIDSLRALFGDDYYICRFQEPGEAEEDFARADITKLMKLFLTSRNPKPP  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  G+S   +    LP WL EED++Y+ S++ + GFTGG+NYYRAL L WEL APW+
Sbjct  188  CIPKEIGYSGLANSRDKLPPWLSEEDVNYYASKFSQKGFTGGLNYYRALNLTWELAAPWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ YH+ G KEYIH+GG K  VP L++VVV++GVAHF+ QE  EE
Sbjct  248  GVQIKVPVKFIVGDLDITYHVPGVKEYIHNGGLKKLVPFLQEVVVMEGVAHFLQQEKPEE  307

Query  415  VNNHIYN  395
            V NHIY+
Sbjct  308  VTNHIYD  314



>ref|XP_004494576.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cicer arietinum]
Length=319

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 136/188 (72%), Gaps = 3/188 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P+   V+ MRA+YGDD+YI RFQ PG+ E EFA +G +  L+   + R+  P 
Sbjct  127  VPFMPRNPKFKTVDAMRALYGDDYYICRFQEPGKAEGEFAKVGAELLLKGMLTSRRTGPP  186

Query  775  YFPKGKGFSANTDGSTA--LPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAP  602
              PK +G  +N D S+   LP+WL +EDL Y+ S+++K+GFTG +NYYR L L+WELTA 
Sbjct  187  ILPK-EGMGSNLDPSSPHPLPSWLSQEDLSYYASKFDKSGFTGPLNYYRNLNLNWELTAA  245

Query  601  WSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAH  422
            W+ AKV VP KFI GDLDLVY+  G K+YI  GGFK DVP LE+VV+ +GVAHF NQEA 
Sbjct  246  WTRAKVKVPVKFITGDLDLVYNSLGTKQYIESGGFKRDVPNLEEVVIQEGVAHFNNQEAA  305

Query  421  EEVNNHIY  398
            E++ NHIY
Sbjct  306  EDITNHIY  313



>gb|ACU23321.1| unknown [Glycine max]
Length=318

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FIPR+P    V+ +RAMYG+D+YI RFQ PGE+EA+ A +G +  L++  + RK  P 
Sbjct  126  VPFIPRNPNVRTVDGLRAMYGEDYYISRFQKPGEMEAQMAEVGTEYVLKNLLTTRKTGPP  185

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N + +  LP+WL EEDL Y+VS++EKTGFTGG+NYYR +  +WELT PW
Sbjct  186  TFPKGEYGTGFNPNMTDILPSWLTEEDLAYYVSKFEKTGFTGGLNYYRNINSNWELTTPW  245

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            +  ++ VP KFI G+LD+VY   G KEYIH GGFK DVP LE V+V +GVAHF NQEA E
Sbjct  246  TRVQIKVPVKFIAGELDMVYTSLGIKEYIHGGGFKEDVPNLEQVIVQKGVAHFNNQEAAE  305

Query  418  EVNNHIYN  395
            +++N+I++
Sbjct  306  DISNYIHD  313



>ref|XP_003554635.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|KHN43313.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 138/188 (73%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FIPR+P    V+ +RAMYG+D+YI RFQ PGE+EA+ A +G +  L++  + RK  P 
Sbjct  126  VPFIPRNPNVRTVDGLRAMYGEDYYISRFQKPGEMEAQMAEVGTEYVLKNLLTTRKTGPP  185

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N + +  LP+WL EEDL Y+VS++EKTGFTGG+NYYR +  +WELT PW
Sbjct  186  TFPKGEYGTGFNPNMTDILPSWLTEEDLAYYVSKFEKTGFTGGLNYYRNINSNWELTTPW  245

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            +  ++ VP KFI G+LD+VY   G KEYIH GGFK DVP LE V+V +GVAHF NQEA E
Sbjct  246  TRVQIKVPVKFIAGELDMVYTSLGIKEYIHGGGFKEDVPNLEQVIVQKGVAHFNNQEAAE  305

Query  418  EVNNHIYN  395
            +++N+I++
Sbjct  306  DISNYIHD  313



>ref|XP_008355493.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Malus domestica]
Length=316

 Score =   216 bits (551),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   ++  RA++GDD+YI RFQ PGEIE +F  +     ++ F + R P+P 
Sbjct  126  VAFSPRNPKRKPIDTFRALFGDDYYICRFQEPGEIEQDFDSIDTAAVMKCFLTGRSPKPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK +G  +       LPAWL EED++YF S++ KTGFTGG+NYYRAL L WELT PW+
Sbjct  186  CIPKDQGLKSWA-APVTLPAWLTEEDVNYFASKFSKTGFTGGLNYYRALNLTWELTGPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ YHI G + YIH GGFK DVP L++VVV++  AHFINQE  +E
Sbjct  245  GLQIKVPVKFIVGDLDITYHIPGIQNYIHKGGFKRDVPFLQEVVVMEDAAHFINQEKPDE  304

Query  415  VNNHIYN  395
            V+ H+Y+
Sbjct  305  VSQHVYD  311



>ref|XP_002283462.1| PREDICTED: bifunctional epoxide hydrolase 2 [Vitis vinifera]
Length=317

 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 130/187 (70%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   +E MRA +GDD+Y+ RFQ PGEIEAE A LG K  L+   + RKP P 
Sbjct  126  VPFRPRNPKIRPIEGMRAFFGDDYYMCRFQKPGEIEAEIARLGSKEVLKRILTDRKPGPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK   F       + LP+W  EEDL+Y+  +Y++ GFTGG+NYYRAL L+WELTAPW+
Sbjct  186  CLPKENPFGIKAIPPSPLPSWFSEEDLNYYARKYDEKGFTGGLNYYRALDLNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +V VP KF+VGDLD+VY   G KEY+  G FK DVP LED+V+++G  HFINQE  EE
Sbjct  246  GEQVRVPVKFVVGDLDMVYTTPGVKEYVDSGAFKKDVPCLEDIVIIEGAGHFINQEKAEE  305

Query  415  VNNHIYN  395
            +NN+I +
Sbjct  306  INNYIVD  312



>ref|XP_007200440.1| hypothetical protein PRUPE_ppa008875mg [Prunus persica]
 emb|CAZ86693.1| epoxide hydrolase 2 [Prunus persica]
 gb|EMJ01639.1| hypothetical protein PRUPE_ppa008875mg [Prunus persica]
Length=316

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   V+  RA++GDD+YI RFQ PGEIE EFA     + ++ F + R P+P 
Sbjct  126  VAFSPRNPKRKPVDGFRALFGDDYYICRFQEPGEIEKEFAGYDTTSIMKKFLTGRSPKPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  G  A     T LP WL EEDL+YF S++ KTGF GG+NYYRAL L WELT PW+
Sbjct  186  CLPKELGLRAWKTPET-LPPWLSEEDLNYFASKFSKTGFVGGLNYYRALNLTWELTGPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +V VP KFIVGDLD+ YHI G K YIH+GGFK DVP L++VVV++  AHFINQE  +E
Sbjct  245  GLQVKVPVKFIVGDLDITYHIPGVKNYIHNGGFKRDVPFLQEVVVIEDGAHFINQERPDE  304

Query  415  VNNHIYN  395
            ++ H+Y+
Sbjct  305  ISRHVYD  311



>ref|XP_003626243.1| Epoxide hydrolase [Medicago truncatula]
 gb|ABN08020.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82461.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 130/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F  R+P    ++  RA YGDD+YI RFQ PG+IEAE A +G    L++  + RK  P 
Sbjct  127  VPFNHRNPTVKPIDGRRAAYGDDYYICRFQEPGKIEAEIAEVGTAYVLKNVLTTRKTGPP  186

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
              PKG+ G   N D    LP WL E+DL YFVS+YEKTGFTGG+NYYR   L+WELTAPW
Sbjct  187  ILPKGEFGTGFNPDTPETLPTWLTEDDLAYFVSKYEKTGFTGGLNYYRNFNLNWELTAPW  246

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            S  K+ VP KFI GDLD+VY     KEYIH GGFK DVP LE+V+V +GVAHF NQEA E
Sbjct  247  SGVKIKVPVKFITGDLDMVYTSPHVKEYIHGGGFKEDVPNLEEVIVQKGVAHFNNQEAAE  306

Query  418  EVNNHIY  398
            E++NHIY
Sbjct  307  EISNHIY  313



>ref|XP_009414133.1| PREDICTED: bifunctional epoxide hydrolase 2 [Musa acuminata subsp. 
malaccensis]
Length=349

 Score =   216 bits (551),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 135/183 (74%), Gaps = 1/183 (1%)
 Frame = -2

Query  949  FIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYF  770
            F PR+P    +E +R ++GDD+Y+ RFQ PG+IEAEFA LG    L+ F +YR P PLY 
Sbjct  161  FTPRNPTRKSLEYLRTVFGDDYYMCRFQEPGKIEAEFARLGTAWVLKKFLTYRNPGPLYI  220

Query  769  PKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEA  590
             + +G+  ++D    LP+WL E D++Y+ S+YEK GFTGG+NYYR+L L+WELTAPW+ A
Sbjct  221  TEDQGW-GSSDSKILLPSWLSEVDINYYTSKYEKAGFTGGLNYYRSLDLNWELTAPWTGA  279

Query  589  KVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVN  410
            ++ VP KFIVGDLDL YH  GA+++IH GG K+ VPLL++VVV++ V HFIN+E   E+ 
Sbjct  280  RIKVPAKFIVGDLDLTYHSPGAQDFIHKGGLKNYVPLLDEVVVMKEVGHFINEEKPTEIT  339

Query  409  NHI  401
             +I
Sbjct  340  ENI  342



>ref|XP_008235117.1| PREDICTED: bifunctional epoxide hydrolase 2 [Prunus mume]
Length=316

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   V+  RA++GDD+YI RFQ PGEIE EFA     + ++ F + R P+P 
Sbjct  126  VAFSPRNPKRKPVDGFRALFGDDYYICRFQEPGEIEKEFAGFDAASIMKKFLTGRSPKPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  G  A     T LP WL EED++YF S++ KTGF GG+NYYRAL L WELT PW+
Sbjct  186  CLPKELGLRAWKTPET-LPPWLLEEDVNYFASKFSKTGFVGGLNYYRALNLTWELTGPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ YHI G KEYIH+GGFK DVP L++VVV++  AHFINQE   E
Sbjct  245  GLQIKVPVKFIVGDLDITYHIPGMKEYIHNGGFKRDVPFLQEVVVIEDGAHFINQEKPHE  304

Query  415  VNNHIYN  395
            ++ H+Y+
Sbjct  305  ISQHVYD  311



>ref|NP_001055069.1| Os05g0273800 [Oryza sativa Japonica Group]
 dbj|BAF16983.1| Os05g0273800 [Oryza sativa Japonica Group]
 gb|EAY97338.1| hypothetical protein OsI_19261 [Oryza sativa Indica Group]
 dbj|BAG87495.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63064.1| hypothetical protein OsJ_17872 [Oryza sativa Japonica Group]
Length=331

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 134/187 (72%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    V+ +RA+YGDD+YI R Q PG IEAEFA LG +  LR F +YR P PL
Sbjct  138  VAFTPRSPARRPVDGLRALYGDDYYICRIQEPGAIEAEFARLGTELVLRKFLAYRTPGPL  197

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  G+  + D    LP+W+ EED+ Y+ S+++KT FTGG+NYYRAL   WELTAPW+
Sbjct  198  MMPK-SGWG-SPDDEVPLPSWITEEDIKYYASKFDKTNFTGGLNYYRALNKTWELTAPWT  255

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KFIVGDLDL YH  G +++IH GGFK  VPLL+DVVV++GV HFI++E  +E
Sbjct  256  GAEIKVPVKFIVGDLDLTYHTPGIQDFIHKGGFKKYVPLLDDVVVMKGVGHFISEEKPKE  315

Query  415  VNNHIYN  395
            V+ H+ +
Sbjct  316  VSEHVIS  322



>ref|XP_003626245.1| Epoxide hydrolase [Medicago truncatula]
 gb|ABN08024.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82463.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 132/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  + R+P+   V+ MRA YGDD+YI RFQ PG++EAE A +G    +++  + R+  P 
Sbjct  127  VPLLRRNPKIKTVDAMRAAYGDDYYISRFQEPGKMEAEMAEVGTAYVMKNILTTRQTGPP  186

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N D    LP+WL EEDL YFVS++EKTGFTG +NYYR   ++WEL APW
Sbjct  187  IFPKGEYGTGFNPDTPDTLPSWLTEEDLAYFVSKFEKTGFTGALNYYRNFNVNWELMAPW  246

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            +  K+ VP KFI GDLD+VY     KEYIH GGFK DVP LE+V++ +GVAHF NQEA E
Sbjct  247  NGVKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIIQKGVAHFNNQEAAE  306

Query  418  EVNNHIY  398
            E++NHIY
Sbjct  307  EISNHIY  313



>emb|CBI36880.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   211 bits (536),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 0/172 (0%)
 Frame = -2

Query  910  MRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYFPKGKGFSANTDGS  731
            MR ++GDD+Y+ RFQ PG  E EFA LG +T ++ F   R PRP   PK   +S      
Sbjct  1    MRVLFGDDYYMCRFQEPGLAENEFARLGTETVMKIFLGSRNPRPPRMPKESWYSGALKTP  60

Query  730  TALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEAKVMVPTKFIVGDL  551
            TALP WL +ED+DYF S++ + GFTGG+NYYRAL L WE  APW+   + VP KFIVGDL
Sbjct  61   TALPPWLSQEDIDYFASKFNQNGFTGGLNYYRALDLSWEALAPWTGVPIKVPVKFIVGDL  120

Query  550  DLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVNNHIYN  395
            D  Y+  G KEYIH+GGFK +VP L+++V+++GVAHFINQE  EE+N HIY+
Sbjct  121  DTTYNTPGVKEYIHNGGFKREVPFLQELVIMEGVAHFINQERPEEINAHIYD  172



>gb|ACJ84958.1| unknown [Medicago truncatula]
 gb|AFK43465.1| unknown [Medicago truncatula]
Length=319

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 132/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  + R+P+   V+ MRA YGDD+YI RFQ PG++EAE A +G    +++  + R+  P 
Sbjct  127  VPLLRRNPKIKTVDAMRAAYGDDYYISRFQEPGKMEAEMAEVGTAYVMKNILTTRQTGPP  186

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N D    LP+WL EEDL YFVS++EKTGFTG +NYYR   ++WEL APW
Sbjct  187  IFPKGEYGTGFNPDTPDTLPSWLTEEDLAYFVSKFEKTGFTGALNYYRNFNVNWELMAPW  246

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            +  K+ VP KFI GDLD+VY     KEYIH GGFK DVP LE+V++ +GVAHF NQEA E
Sbjct  247  NGVKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIIQKGVAHFNNQEAAE  306

Query  418  EVNNHIY  398
            E++NHIY
Sbjct  307  EISNHIY  313



>gb|KEH24503.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 132/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F  R+P+   V+ MRA YGDD+YI RFQ PG++EA+ A +G    ++   + RK  P 
Sbjct  127  VPFTRRNPKIRTVDGMRAAYGDDYYISRFQEPGKMEAQMAEVGTAYVMKSTLTTRKTGPP  186

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N D    LP+WL E+DL YFVS++EKTGF GG+NYYR L L+WEL APW
Sbjct  187  IFPKGEFGTGFNPDTPDKLPSWLTEDDLAYFVSKFEKTGFVGGLNYYRNLNLNWELMAPW  246

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            +  K+ VP KFI GDLD+VY     KEYIH GGFK DVP LE+V+V +GVAHF NQEA E
Sbjct  247  NGVKIKVPVKFITGDLDIVYTSPKVKEYIHGGGFKEDVPNLEEVIVQKGVAHFNNQEAAE  306

Query  418  EVNNHIY  398
            E++NHIY
Sbjct  307  EISNHIY  313



>ref|XP_006472971.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=571

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 135/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P    VE MRA++GDD+YI RFQ PG+IEA+ A +G    L++  + RKP P 
Sbjct  126  VPFLPRNPNIKPVESMRALFGDDYYICRFQEPGKIEAQIAQVGTAEVLKNILANRKPGPS  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
             FP+   F  + +    LP+W  E+DL ++ +++ +TGFTG +NYYRA+ L+WE+TA W+
Sbjct  186  CFPEENAFGIDPENRVTLPSWFSEQDLSFYATKFNQTGFTGALNYYRAMNLNWEMTAAWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            E +V VP KFIVG+LD+VY   G KEY+H+GGFK DVPLLE++VV++   HFINQE  EE
Sbjct  246  EVQVKVPVKFIVGELDMVYTTPGIKEYVHNGGFKKDVPLLEEIVVIEDAGHFINQERAEE  305

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  306  INAHIYD  312


 Score = 96.7 bits (239),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = -2

Query  949  FIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYF  770
            ++P DP    VE +RAMYGD+ YI +FQ PG +EA  A +G K  L    + R+P P   
Sbjct  449  YLPTDPNLKPVETLRAMYGDNFYICKFQEPGVLEAGIAHIGSKLMLASSLTTRRPGPPII  508

Query  769  PKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLD  620
             +    +     +  LP WL EE+ +Y+V+++++TGFTGG+NYYRA+ L+
Sbjct  509  SE-DAIAHLARETINLPFWLSEEEFNYYVTKFDQTGFTGGLNYYRAIDLN  557



>ref|XP_010449872.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Camelina sativa]
Length=379

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 137/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+     V  +R ++GDD+YI RFQ PGEIEAEF  LG +  L++F +Y+ P PL
Sbjct  187  VLFSPRNSERVPVPTLRHIFGDDYYICRFQKPGEIEAEFMKLGTEKVLKEFLTYKTPGPL  246

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PKGK F  + + + ALP WL +EDLDY+V++Y+K GFTG +NYYR +  +WELTAPW+
Sbjct  247  HLPKGKCFECSENDACALPPWLTQEDLDYYVTKYDKKGFTGPINYYRNIDRNWELTAPWT  306

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVGD DL Y+  GAKEYI+ G FK +VPLL++ VVL+G+ HF+++E  + 
Sbjct  307  GAKIHVPVKFIVGDQDLTYNFPGAKEYINGGCFKREVPLLDETVVLKGLGHFLHEEDPDV  366

Query  415  VNNHIYN  395
            +N HI++
Sbjct  367  INQHIHS  373



>ref|XP_009775353.1| PREDICTED: LOW QUALITY PROTEIN: bifunctional epoxide hydrolase 
2-like [Nicotiana sylvestris]
Length=318

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 134/188 (71%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    V+ +R ++GDD+Y+ RFQ PGE+E EFA +   T ++ F S R PRP 
Sbjct  126  VVFRPRHPSRKPVDSLRELFGDDYYVCRFQKPGEVEEEFASVDTATVVKGFLSSRDPRPP  185

Query  775  YFPKGKGFSANTDGSTA-LPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
              PK  GF      S A LP+W+ EED+ YF  + ++TGFTGG+NYYR L  +WELTAP+
Sbjct  186  CIPKEIGFHQALAKSPATLPSWITEEDVHYFAEKLKETGFTGGLNYYRNLDKNWELTAPF  245

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            S  K+ VPTKF+VGDLD  YH+ G KEYIH+GGFK +VP L++VVV++GV HFINQE  +
Sbjct  246  SGCKIQVPTKFVVGDLDXTYHVPGTKEYIHNGGFKKEVPNLQEVVVMEGVGHFINQEKPD  305

Query  418  EVNNHIYN  395
            E+N+HIY+
Sbjct  306  EINSHIYD  313



>gb|ACU19478.1| unknown [Glycine max]
 gb|KHN43316.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   V+ MRA+YGDD+YI RFQ PG+ E E A    +  +++ F  RKP P 
Sbjct  126  VPFWPRNPKVKPVDAMRAIYGDDYYICRFQEPGKAEGELAKNSTEQVIKNVFISRKPGPP  185

Query  775  YFPK-GKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
               K G GF+ NT  S  LP WL +EDL Y+ S++EKTGFTGG+NYYR   L+WELTAPW
Sbjct  186  ILEKEGMGFNPNT--SMPLPTWLSQEDLTYYASKFEKTGFTGGLNYYRNFNLNWELTAPW  243

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + A+V VP KFI GDLDLVY   G K YI  G FK DVP LE+VVV +GVAHF NQEA E
Sbjct  244  TGAQVKVPVKFITGDLDLVYTSLGTKNYIESGAFKKDVPNLEEVVVQEGVAHFNNQEAAE  303

Query  418  EVNNHIYN  395
            +V+NHIY+
Sbjct  304  DVSNHIYD  311



>ref|XP_009629123.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=318

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 132/188 (70%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    V+ +R ++GDD+Y+ RFQ PGE+E EFA +   T ++ F S R PRP 
Sbjct  126  VVFRPRHPSRKPVDSLRELFGDDYYMCRFQKPGEVEEEFASVDTATVIKGFLSSRDPRPP  185

Query  775  YFPKGKGFSANTDGSTA-LPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
              PK  GF      S A LP+W+ EED+ YF  + +KTGFTGG+NYYR L  +WELTAP+
Sbjct  186  CIPKEIGFHQALAKSPATLPSWITEEDVHYFAEKLKKTGFTGGLNYYRNLDKNWELTAPF  245

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            S  K+ VPTKF+VGDLD  YH+ G KEYIH+GGFK +VP L++VVV++G  HFINQE   
Sbjct  246  SGCKIQVPTKFVVGDLDATYHVPGTKEYIHNGGFKKEVPNLQEVVVMEGAGHFINQEKPA  305

Query  418  EVNNHIYN  395
            E+N+HIY+
Sbjct  306  EINSHIYD  313



>ref|XP_006444386.1| hypothetical protein CICLE_v10023691mg [Citrus clementina]
 ref|XP_006479994.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
 dbj|BAD13534.1| soluble epoxide hydrolase [Citrus jambhiri]
 gb|ESR57626.1| hypothetical protein CICLE_v10023691mg [Citrus clementina]
 gb|KDO87173.1| hypothetical protein CISIN_1g021158mg [Citrus sinensis]
Length=316

 Score =   214 bits (546),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 130/186 (70%), Gaps = 1/186 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +   RA+YGDD+YI RFQ PGEIE EFA +     ++ F   R P+PL
Sbjct  126  VPFPPRNPAVRPLNNFRAVYGDDYYICRFQEPGEIEEEFAQIDTARLMKKFLCLRIPKPL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  G S   D S ALP+WL EED++Y+ S++ + GFTG VNYYR   L+WEL APW+
Sbjct  186  CIPKDTGLSTLPDPS-ALPSWLSEEDVNYYASKFNQKGFTGPVNYYRCWDLNWELMAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP K+IVGD DLVY+ KG KEYIH+GGFK  VP L+DVVV++GVAHFINQE  EE
Sbjct  245  GVQIKVPVKYIVGDQDLVYNNKGTKEYIHNGGFKKYVPYLQDVVVMEGVAHFINQEKAEE  304

Query  415  VNNHIY  398
            V  HIY
Sbjct  305  VGAHIY  310



>ref|XP_003626244.1| Epoxide hydrolase [Medicago truncatula]
 gb|ABN08021.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES82462.1| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  + R+P+   V+ M A YGDD+YI RFQ PG++EAE A +G    ++   + RK  P 
Sbjct  127  VPLLRRNPKIRTVDAMHAAYGDDYYICRFQEPGKMEAEMAEVGTAYVMKSTLTTRKTGPP  186

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N+D    LP+WL E+DL YFVS++EKTGFTG +NYYR   L+WEL APW
Sbjct  187  IFPKGEFGTGFNSDTPDTLPSWLTEDDLTYFVSKFEKTGFTGALNYYRNFNLNWELMAPW  246

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            +  K+ VP KFI GDLD+VY     KEYIH GGFK DVP LE+V++ +GVAHF NQEA E
Sbjct  247  NGVKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIIQKGVAHFNNQEAAE  306

Query  418  EVNNHIY  398
            E++NHIY
Sbjct  307  EISNHIY  313



>gb|EMS45147.1| Epoxide hydrolase 2 [Triticum urartu]
Length=212

 Score =   211 bits (536),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 134/187 (72%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    V+ ++A+YGD++YI R Q PG IEAEFA LG +  LR FF+YR P PL
Sbjct  22   VPFSPRSPARKPVDGLKALYGDEYYICRIQEPGAIEAEFARLGTELVLRKFFTYRTPGPL  81

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK      + D    LP+W+ EED+ Y+ S+++K+GFTG +NYYRAL   WELT+PW+
Sbjct  82   FIPKSGW--GSPDDEVPLPSWITEEDIKYYASQFDKSGFTGALNYYRALNKTWELTSPWT  139

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VPTKFIVGD+DL YH+ GA ++++ GG K  VPLL+DVVV++ V HFIN+E  EE
Sbjct  140  GAEIKVPTKFIVGDVDLSYHVAGAHDFVNKGGLKKFVPLLDDVVVMKDVGHFINEEKPEE  199

Query  415  VNNHIYN  395
            ++ HI +
Sbjct  200  ISAHIIS  206



>ref|XP_003554633.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Glycine max]
Length=341

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   V+ MRA+YGDD+YI RFQ PG+ E E A    +  +++ F  RKP P 
Sbjct  151  VPFWPRNPKVKPVDAMRAIYGDDYYICRFQEPGKAEGELAKNSTEQVIKNVFISRKPGPP  210

Query  775  YFPK-GKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
               K G GF+ NT  S  LP WL +EDL Y+ S++EKTGFTGG+NYYR   L+WELTAPW
Sbjct  211  ILEKEGMGFNPNT--SMPLPTWLSQEDLTYYASKFEKTGFTGGLNYYRNFNLNWELTAPW  268

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + A+V VP KFI GDLDLVY   G K YI  G FK DVP LE+VVV +GVAHF NQEA E
Sbjct  269  TGAQVKVPVKFITGDLDLVYTSLGTKNYIESGAFKKDVPNLEEVVVQEGVAHFNNQEAAE  328

Query  418  EVNNHIYN  395
            +V+NHIY+
Sbjct  329  DVSNHIYD  336



>ref|XP_009335707.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
 ref|XP_009335715.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Pyrus x bretschneideri]
Length=316

 Score =   214 bits (544),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 130/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   ++  RA++GDD+YI RFQ PGEIE +F  +     ++ F + R P+P 
Sbjct  126  VAFSPRNPKRKPIDTFRALFGDDYYICRFQEPGEIEQDFDSIDTAAVMKRFLTGRSPKPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK +G  +       LPAWL EED++YF S++ KTGFTGG+NYYRAL L WELT PW+
Sbjct  186  CIPKDQGLKSWA-APVTLPAWLTEEDVNYFASKFSKTGFTGGLNYYRALNLTWELTGPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ YHI G + YIH GGFK DV  L++VVV++  AHFINQE  +E
Sbjct  245  GLQIKVPVKFIVGDLDITYHIPGIQNYIHKGGFKRDVAFLQEVVVMEDAAHFINQEKPDE  304

Query  415  VNNHIYN  395
            V+ H+Y+
Sbjct  305  VSQHVYD  311



>ref|NP_001240943.1| uncharacterized protein LOC100803974 [Glycine max]
 gb|ACU18288.1| unknown [Glycine max]
 gb|KHN03960.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 132/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P+   V+ MRA+YGDD+YI RFQ PG+ EAEFA   ++  +++  + R+P P 
Sbjct  126  VPFMPRNPKVKPVDAMRALYGDDYYICRFQEPGKAEAEFANNSIEQVIKNILTSRRPGPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
               K +G  +N+D S  LP WL +ED+ Y+ S++ KTG TGG+NYYR L L+WELTAPW+
Sbjct  186  ILRK-EGAGSNSDPSRPLPTWLSQEDVTYYASKFTKTGLTGGLNYYRNLNLNWELTAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +V VP KFI GDLD VY   G K YI  G FK DVP LE+VVV +GVAHF NQEA E+
Sbjct  245  GVQVKVPVKFITGDLDAVYTSLGMKNYIESGAFKKDVPCLEEVVVQEGVAHFNNQEAAED  304

Query  415  VNNHIYN  395
            V NHIY+
Sbjct  305  VTNHIYD  311



>ref|NP_193331.6| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AEE83674.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=375

 Score =   215 bits (548),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 135/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V  +R ++GDD+Y+ RFQ  GEIE EF  LG +  L++F +Y+ P PL
Sbjct  183  VLFSPRNPVRVPVPTLRHVFGDDYYVCRFQKAGEIETEFKKLGTENVLKEFLTYKTPGPL  242

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK K F  + + ++ALP WL +EDLDY+V++YE  GFTG +NYYR +  +WELTAPW+
Sbjct  243  NLPKDKYFKRSENAASALPLWLTQEDLDYYVTKYENKGFTGPINYYRNIDRNWELTAPWT  302

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFI+GD DL Y+  GAKEYI+ GGFK DVPLL++ VVL+G+ HF+++E  + 
Sbjct  303  GAKIRVPVKFIIGDQDLTYNFPGAKEYINGGGFKRDVPLLDETVVLKGLGHFLHEENPDV  362

Query  415  VNNHIYN  395
            +N HI+N
Sbjct  363  INQHIHN  369



>emb|CDP17206.1| unnamed protein product [Coffea canephora]
Length=317

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 131/185 (71%), Gaps = 0/185 (0%)
 Frame = -2

Query  949  FIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYF  770
            F PR+P+   +  +RA +G+++Y+ RFQ PGEIEAE A  G K  L+   + RKP P   
Sbjct  128  FRPRNPKMKPIAGLRAFFGEEYYMCRFQEPGEIEAEIAKYGSKAVLKKILTDRKPGPPCL  187

Query  769  PKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEA  590
            PKG  F  + D    LPAWL EEDL Y+ ++Y + GFTGG+NYYRAL L+WELTA W+ A
Sbjct  188  PKGNPFGISPDTDIKLPAWLSEEDLKYYANKYAQKGFTGGLNYYRALDLNWELTAAWTGA  247

Query  589  KVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVN  410
            +V VP KFIVGDLD+VY   G +EY+H GGFK DVP LE+ V+++G  HF++QE  EE+N
Sbjct  248  QVKVPVKFIVGDLDMVYTTPGTQEYVHGGGFKRDVPFLEEPVIMKGTGHFLHQERAEEIN  307

Query  409  NHIYN  395
            +HI++
Sbjct  308  HHIHH  312



>ref|XP_007015353.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32972.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=320

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 135/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V +I    + + ++  RA YG+D+YI RFQ PGEIEAEFA +G +  +++F +YR P P+
Sbjct  128  VPYIQLGRQMNPIDGWRAFYGNDYYICRFQEPGEIEAEFAEIGTERVVKEFLTYRVPGPI  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              P+GK F  + D    LP+WL +E+++Y+V++++K GFTGG+NYYR    +WEL APW 
Sbjct  188  LLPEGKLFGHSADTPITLPSWLTQEEVNYYVTQFDKKGFTGGINYYRNFNRNWELLAPWG  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGD DLVYH+ G KEYIH+GGFK DVP L+ VVV++GV HFIN E  ++
Sbjct  248  GCEIKVPAKFIVGDQDLVYHMPGIKEYIHNGGFKKDVPHLQQVVVMEGVGHFINMEKADD  307

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  308  INKHIYD  314



>gb|KHG07158.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=316

 Score =   213 bits (543),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 134/187 (72%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR+P+   V+  RA++GDD YI RFQVPGE EA FA +     L+ F + R P P 
Sbjct  126  VPYHPRNPKVKTVDGYRALFGDDFYICRFQVPGEAEAHFAQMDTAKVLKKFLTTRDPNPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  G  A  D   ALP+WL E++++YF +++ + GFTGG+NYYRA+ L+WEL APW+
Sbjct  186  CIPKETGLKALPD-PPALPSWLSEDEINYFATKFNQKGFTGGLNYYRAMNLNWELMAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ YHI G KEY+ +GGFK +VP L+++VV++GVAHFINQE  +E
Sbjct  245  GLQIQVPVKFIVGDLDITYHIPGVKEYLQNGGFKKNVPFLQELVVMEGVAHFINQEKPQE  304

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  305  ISMHIYD  311



>ref|XP_006645722.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Oryza brachyantha]
Length=234

 Score =   211 bits (536),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 122/173 (71%), Gaps = 0/173 (0%)
 Frame = -2

Query  919  VEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYFPKGKGFSANT  740
            +  +RA+ GDDHY+ RFQ PG  EAEFA L +K   +  F  R+P  L  PK K F    
Sbjct  53   LSAVRALCGDDHYMCRFQKPGVAEAEFARLDLKHLFKIVFGMRRPATLILPKDKTFFDAI  112

Query  739  DGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEAKVMVPTKFIV  560
            D     P+WL EED+ Y+  ++ KTGFTGG NYYR + LDWELTAPW+EA + VPTKFIV
Sbjct  113  DSDGTCPSWLSEEDISYYADKFSKTGFTGGFNYYRCIDLDWELTAPWTEAPINVPTKFIV  172

Query  559  GDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVNNHI  401
            GDLDL Y+  G K+YIH GGFK++VP LEDVVV++GV HFINQE  +EV+ HI
Sbjct  173  GDLDLTYNTPGVKDYIHRGGFKANVPNLEDVVVMEGVGHFINQEKPDEVSEHI  225



>gb|AFK45529.1| unknown [Medicago truncatula]
Length=319

 Score =   213 bits (543),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  + R+P+   V+ M A YGDD+YI RFQ PG++EAE A +G    ++   + RK  P 
Sbjct  127  VPLLRRNPKIRTVDAMHAAYGDDYYICRFQEPGKMEAEMAEVGTAYVMKSTLTTRKTGPP  186

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FP+G+ G   N+D    LP+WL E+DL YFVS++EKTGFTG +NYYR   L+WEL APW
Sbjct  187  IFPRGEFGTGFNSDTPDTLPSWLTEDDLTYFVSKFEKTGFTGALNYYRNFNLNWELMAPW  246

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            +  K+ VP KFI GDLD+VY     KEYIH GGFK DVP LE+V++ +GVAHF NQEA E
Sbjct  247  NGVKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIIQKGVAHFNNQEAAE  306

Query  418  EVNNHIY  398
            E++NHIY
Sbjct  307  EISNHIY  313



>ref|NP_001238563.1| epoxide hydrolase [Glycine max]
 dbj|BAA09852.1| Epoxide hydrolase [Glycine max]
 emb|CAA55293.1| epoxide hydrolase [Glycine max]
Length=341

 Score =   214 bits (545),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 134/187 (72%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  + RDP    V+ MRA+YGDD+Y+ RFQ PGE+EA+ A +G +  L++  + R P P 
Sbjct  151  VPLLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTEYVLKNILTTRNPGPP  210

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKG+ F  N +    LP+WL EEDL Y+VS++EKTGFTG +NYYR   L+WELTAPW+
Sbjct  211  ILPKGR-FQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNLNWELTAPWT  269

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP K+I G+LD+VY+    KEYIH GGFK DVP LE V+V +GVAHF NQEA EE
Sbjct  270  GGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFNNQEAAEE  329

Query  415  VNNHIYN  395
            ++N+IY+
Sbjct  330  IDNYIYD  336



>gb|ACU19450.1| unknown [Glycine max]
Length=315

 Score =   213 bits (542),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 133/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  + RDP    V+ MRA+YGDD+Y+ RFQ PGE+EA+ A +G +  L +  + R P P 
Sbjct  126  VPLLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTEYVLENILTTRNPGPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKG+ F  N +    LP+WL EEDL Y+VS++EKTGFTG +NYYR   L+WELTAPW+
Sbjct  186  ILPKGR-FQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNLNWELTAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP K+I G+LD+VY+    KEYIH GGFK DVP LE V+V +GVAHF NQEA EE
Sbjct  245  GGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFNNQEAAEE  304

Query  415  VNNHIYN  395
            ++N+IY+
Sbjct  305  IDNYIYD  311



>ref|XP_010914488.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=317

 Score =   213 bits (542),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 133/186 (72%), Gaps = 3/186 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P    V+  R +YGDD+Y+ RFQ PG IEA+FA +   +  R F   R P PL
Sbjct  129  VAFMPRNPAKKPVDYFRHLYGDDYYVCRFQEPGAIEAKFAQIETASIFRMFLPSRDPGPL  188

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK +G+  N      LP+WL EED+++F S+++K+GFTG VNYYR L L+WELTAPW+
Sbjct  189  LMPK-EGW--NVPEKIPLPSWLSEEDINFFASKFDKSGFTGPVNYYRCLNLNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KFIVGDLDL YH  G ++YIH GGFK +VPLL++VVV++GV HFINQE   E
Sbjct  246  GAQIKVPVKFIVGDLDLTYHYPGIQDYIHKGGFKQNVPLLQEVVVMEGVGHFINQEKAHE  305

Query  415  VNNHIY  398
            + +HIY
Sbjct  306  ITDHIY  311



>gb|KHN43314.1| Epoxide hydrolase 2 [Glycine soja]
Length=316

 Score =   213 bits (542),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 133/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  + RDP    V+ MRA+YGDD+Y+ RFQ PGE+EA+ A +G +  L +  + R P P 
Sbjct  126  VPLLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTEYVLENILTTRNPGPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKG+ F  N +    LP+WL EEDL Y+VS++EKTGFTG +NYYR   L+WELTAPW+
Sbjct  186  ILPKGR-FQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNLNWELTAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP K+I G+LD+VY+    KEYIH GGFK DVP LE V+V +GVAHF NQEA EE
Sbjct  245  GGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFNNQEAAEE  304

Query  415  VNNHIYN  395
            ++N+IY+
Sbjct  305  IDNYIYD  311



>ref|XP_010914485.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Elaeis guineensis]
Length=319

 Score =   213 bits (542),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 135/188 (72%), Gaps = 3/188 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+ R+P    ++ +RA YGD++YI+RFQ  G  EAEFA LG  T LR FF+YR P PL
Sbjct  129  VPFMSRNPAAKPLDRVRASYGDEYYIIRFQEHGAAEAEFARLGTATVLRKFFTYRNPGPL  188

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK    S N      LP WL EED++Y  S++EK+GFTG +NYYR L L+WEL APW+
Sbjct  189  FMPKEGWCSPNE--QIPLPFWLSEEDINYLTSKFEKSGFTGPINYYRCLDLNWELAAPWT  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKG-AKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
             A++ VPTKFI+GDLDL YH     ++YIH GGF+ DVPLL +VVV++GVAHFINQE  +
Sbjct  247  GAQIKVPTKFIIGDLDLNYHDPPLMQDYIHKGGFQKDVPLLREVVVMEGVAHFINQEKAQ  306

Query  418  EVNNHIYN  395
            E+ +HIY+
Sbjct  307  EITDHIYD  314



>ref|XP_010674075.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=317

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 131/185 (71%), Gaps = 0/185 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+    + +RA++GD +YI RFQ  G+IEAE    G+K  L+   + R P   
Sbjct  126  VPFRPRNPKLKPTQTLRAIFGDAYYICRFQEAGDIEAEITECGIKHVLKKILTSRDPGAP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKGK F  + +    LP+WL EED+DY+ ++YE+ GFTG +N+YR L  +WELTAPW+
Sbjct  186  MLPKGKSFDVSPESPIILPSWLSEEDIDYYAAKYEEKGFTGPLNHYRNLDWNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP K +VGDLD+VY++ G K+Y+H+GGFK DVPLLEDVVV++GV HFINQE  EE
Sbjct  246  GVELKVPAKLVVGDLDMVYNMFGVKDYVHNGGFKKDVPLLEDVVVMEGVGHFINQEKAEE  305

Query  415  VNNHI  401
            VN HI
Sbjct  306  VNQHI  310



>ref|XP_011010960.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=316

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P+ +L++  RA+ GDD+Y +RFQ PGE E +FA +  K  +  FF+   P P 
Sbjct  126  VPFLPRNPQGNLLQWFRALLGDDYYFLRFQEPGEAEDDFAQVDTKRLMIKFFTNFGPNPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKG G  A  D   +LP+WL EED++Y+  ++  TGFTGG+NYYRA  + WEL APW+
Sbjct  186  LMPKGIGVKAFPD-PPSLPSWLSEEDINYYAEKFNLTGFTGGLNYYRATAITWELMAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             + + VP KFIVGDLDL+Y+I G K++IH+GGFK DVPLLE+VVV++GVAHF+ QE  EE
Sbjct  245  GSPITVPAKFIVGDLDLLYNIPGLKDFIHNGGFKKDVPLLEEVVVMEGVAHFLQQEKPEE  304

Query  415  VNNHIYN  395
            V+ HIY+
Sbjct  305  VSKHIYD  311



>ref|XP_011010961.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Populus euphratica]
Length=316

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 137/187 (73%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P+ +L++  RA++GD++Y +RFQ PGE E +FA +  K  +  FF+   P P 
Sbjct  126  VPFLPRNPQGNLLQWFRALFGDNYYFLRFQEPGEAEDDFAQVDTKRLMIKFFTNFGPNPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKG G  A  D   +LP+WL EED++Y+  ++  TGFTGG+NYYRA  + WEL APW+
Sbjct  186  LMPKGIGVKAFPD-PPSLPSWLSEEDINYYAEKFNLTGFTGGLNYYRATAITWELMAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             + + VP KFIVGDLDL+Y+I G K++IH+GGFK DVPLLE+VVV++GVAHF+ QE  EE
Sbjct  245  GSPITVPAKFIVGDLDLLYNIPGLKDFIHNGGFKKDVPLLEEVVVMEGVAHFLQQEKPEE  304

Query  415  VNNHIYN  395
            V+ HIY+
Sbjct  305  VSKHIYD  311



>ref|XP_009771842.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana sylvestris]
Length=318

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 131/187 (70%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P+   +E MRA+ GDD+YI RFQ  G++E EFA +     +  F   R P PL
Sbjct  127  VVFHPRHPKRKPIESMRAVLGDDYYICRFQEYGQVEEEFARVDTARLIAKFLISRNPAPL  186

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
               K KGF  ++     LP+WL EED+DY+ +++ + GFTGG+NYYRA+ L+WELTAPW+
Sbjct  187  RVSKEKGFGGSSHTPIKLPSWLSEEDIDYYANKFSQKGFTGGLNYYRAMDLNWELTAPWT  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLDL Y+  G KEYIH GGF+  VP L++VV+++GV HFIN+E  EE
Sbjct  247  GMQIKVPVKFIVGDLDLTYNTPGVKEYIHKGGFQKMVPFLQEVVIMEGVGHFINEERPEE  306

Query  415  VNNHIYN  395
            +N+HIY+
Sbjct  307  INDHIYD  313



>ref|NP_001042621.1| Os01g0255000 [Oryza sativa Japonica Group]
 dbj|BAA84626.1| putative epoxide hydrolase [Oryza sativa Japonica Group]
 dbj|BAA85201.1| putative epoxide hydrolase [Oryza sativa Japonica Group]
 dbj|BAF04535.1| Os01g0255000 [Oryza sativa Japonica Group]
 dbj|BAG95508.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98766.1| unnamed protein product [Oryza sativa Japonica Group]
Length=322

 Score =   213 bits (541),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 127/185 (69%), Gaps = 0/185 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR+P    V+ +RA+ GD HYI  FQ PG  EAEF    +K  L+ F+  RK  PL
Sbjct  131  VEYHPRNPTRSPVQTLRAVCGDGHYICFFQKPGVAEAEFGRGDIKCLLKKFYGMRKAAPL  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              P GK    + D     PAWL EED+ Y+  ++EKTGFTGG+NYYR + L+WELTAPW+
Sbjct  191  IIPPGKTLFDSIDSDGTCPAWLSEEDISYYAEKFEKTGFTGGLNYYRCIDLNWELTAPWT  250

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
               + VPTKFIVGD DL Y+I G K+YIH GG K+ VP LEDVV+++GVAHFINQE  +E
Sbjct  251  GVPIKVPTKFIVGDQDLTYNIPGVKDYIHKGGLKACVPNLEDVVIMEGVAHFINQEKPDE  310

Query  415  VNNHI  401
            V++HI
Sbjct  311  VSDHI  315



>ref|XP_002318980.2| epoxide hydrolase family protein [Populus trichocarpa]
 gb|EEE94903.2| epoxide hydrolase family protein [Populus trichocarpa]
Length=317

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 133/187 (71%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR+P+   VE M+ ++G+D+Y+ RFQ PG IEAE A  G +  L+   + RKP P 
Sbjct  126  VPYRPRNPKMKPVESMKLVFGEDYYMCRFQEPGVIEAEIACAGTEEVLKKILTGRKPGPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK   F    + S  +P+WLPE DL ++ ++Y + GFTGG+NYYRAL L+WELTA W+
Sbjct  186  CLPKENPFGIYPEESVTMPSWLPEADLSFYATKYSQKGFTGGLNYYRALDLNWELTASWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A V+VP KF+VGDLD+VY   G KE+++ GGFK  VPLLE+VVV++GV HFINQE  EE
Sbjct  246  GAPVIVPVKFVVGDLDMVYTTPGMKEFVNSGGFKHYVPLLEEVVVMEGVGHFINQEKAEE  305

Query  415  VNNHIYN  395
            ++NHIY+
Sbjct  306  ISNHIYD  312



>emb|CAA55294.1| epoxide hydrolase [Glycine max]
Length=341

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 133/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  + RDP    V+ MRA+YGDD+Y+ RFQ PGE+EA+ A +G +  L +  + R P P 
Sbjct  151  VPLLRRDPNIRTVDGMRALYGDDYYVCRFQKPGEMEAQMAEVGTEYVLENILTTRNPGPP  210

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKG+ F  N +    LP+WL EEDL Y+VS++EKTGFTG +NYYR   L+WELTAPW+
Sbjct  211  ILPKGR-FQFNPEMPNTLPSWLTEEDLAYYVSKFEKTGFTGPLNYYRNFNLNWELTAPWT  269

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP K+I G+LD+VY+    KEYIH GGFK DVP LE V+V +GVAHF NQEA EE
Sbjct  270  GGQIKVPVKYITGELDMVYNSLNLKEYIHGGGFKQDVPNLEQVIVQKGVAHFNNQEAAEE  329

Query  415  VNNHIYN  395
            ++N+IY+
Sbjct  330  IDNYIYD  336



>dbj|BAK07144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=352

 Score =   213 bits (543),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 137/187 (73%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    V+ ++A+YGD++YI R Q PG IEAEFA LG +  LR FF+YR P PL
Sbjct  162  VPFTPRSPARKPVDGLKALYGDEYYICRIQEPGVIEAEFARLGTELVLRKFFTYRTPGPL  221

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK  G+  + D    LP+W+ EED+ Y+ ++++K+GFTGG+NYYRAL   WELT+PW+
Sbjct  222  FIPK-SGW-GSPDDEVPLPSWITEEDIKYYAAQFDKSGFTGGLNYYRALNKTWELTSPWT  279

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VPTKFIVGD+DL YH+ GA ++I+ GG K  VPLLEDVVV++ V HFIN+E  EE
Sbjct  280  GAEIKVPTKFIVGDVDLSYHVAGAYDFINKGGLKKFVPLLEDVVVMKDVGHFINEEKPEE  339

Query  415  VNNHIYN  395
            ++ HI +
Sbjct  340  ISAHIIS  346



>ref|XP_007147005.1| hypothetical protein PHAVU_006G088700g [Phaseolus vulgaris]
 gb|ESW18999.1| hypothetical protein PHAVU_006G088700g [Phaseolus vulgaris]
Length=318

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 133/182 (73%), Gaps = 1/182 (1%)
 Frame = -2

Query  940  RDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYFPKG  761
            RDP+   V++MRA+YGDD+YI RFQ PGE+EA+ A +G +  L++  + RKP P  FP G
Sbjct  131  RDPKVKPVDVMRAVYGDDYYICRFQKPGEMEAQMAEVGTEYVLKNILTTRKPGPPIFPMG  190

Query  760  K-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEAKV  584
            + G   N D + +LP+WL + DL Y+VS+++KTGFTG +NYYR L  +WELTAPWS  K+
Sbjct  191  EYGTGFNPDMTNSLPSWLSQHDLAYYVSKFQKTGFTGPLNYYRNLNPNWELTAPWSGVKI  250

Query  583  MVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVNNH  404
             VP KFI G+LD+VY     KEYIH GGFK  VP LE+V+V +GVAHF NQE  EE++N+
Sbjct  251  EVPVKFITGELDMVYTSLNMKEYIHGGGFKEHVPNLEEVIVQKGVAHFNNQETAEEISNY  310

Query  403  IY  398
            IY
Sbjct  311  IY  312



>ref|XP_010269590.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nelumbo nucifera]
Length=318

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 134/189 (71%), Gaps = 3/189 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P    V+ +RA +GD++YI RFQ PGEIEAEFA  G    ++ F +Y+K  PL
Sbjct  126  VSFMPRNPAGKTVQRLRAAFGDNYYICRFQEPGEIEAEFAQAGATKIMKYFLTYKKTGPL  185

Query  775  YFPKG--KGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAP  602
              PKG  +G   +      LP WL EED++Y+ +++E+ GFTGG+NYYRAL L WE+TAP
Sbjct  186  ILPKGSIRGLH-DAPQVDELPPWLTEEDVNYYATKFEQKGFTGGLNYYRALDLTWEITAP  244

Query  601  WSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAH  422
            W+  +V VP KFIVGD D+ Y   GAKEYIH GGFK DVP L++VVV++GV HFI QE  
Sbjct  245  WTNVQVKVPAKFIVGDQDVTYTTPGAKEYIHGGGFKRDVPFLQEVVVMEGVGHFITQERA  304

Query  421  EEVNNHIYN  395
            +E++ HI++
Sbjct  305  DEISAHIHD  313



>ref|XP_004290809.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Fragaria vesca 
subsp. vesca]
Length=316

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 133/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   V+  +A++GDD+YI RFQ PGE EA F  L   + ++ F + R P P 
Sbjct  126  VAFNPRNPKRKPVDGFKALFGDDYYICRFQEPGEAEAYFGGLDTASVMKMFLTGRNPAPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
               K  GF A+      +PAWL EED++YF +++ KTGFTGG+NYYRA+ L WELTAPW+
Sbjct  186  KISKELGF-ASWKPVEPMPAWLSEEDVNYFATKFSKTGFTGGLNYYRAINLTWELTAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ Y+I G KEYIH+GGFKS VP L++V++++G AHFINQE  EE
Sbjct  245  GVQIKVPVKFIVGDLDITYNIPGIKEYIHNGGFKSQVPFLQEVIIVEGAAHFINQEKAEE  304

Query  415  VNNHIYN  395
             + HIY+
Sbjct  305  CSAHIYD  311



>gb|KHG24497.1| Epoxide hydrolase 2 [Gossypium arboreum]
Length=317

 Score =   212 bits (539),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 125/187 (67%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR P+   VE MR  +GDD+YI RFQ PG+IEAE A  G    L+   S RKP P 
Sbjct  126  VPFMPRKPQMKPVESMRLFFGDDYYICRFQEPGKIEAEIARYGASNVLKKIISSRKPGPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK   F    D    LP+W  EEDL Y+ +++ K GFTG +NYYRA  L+WE TAPW+
Sbjct  186  CMPKDNAFGIKPDTPITLPSWFSEEDLSYYANKFNKKGFTGALNYYRAFDLNWEQTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +V VP KFIVGDLD VY   G KEY++ G FK D P+LE+VV+++GV HFINQE  +E
Sbjct  246  NTQVKVPVKFIVGDLDSVYTTPGMKEYVNGGDFKRDAPMLEEVVIMKGVGHFINQERADE  305

Query  415  VNNHIYN  395
            +N+HI++
Sbjct  306  INSHIHD  312



>ref|XP_006480000.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Citrus sinensis]
Length=316

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 129/186 (69%), Gaps = 1/186 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    +   RA+YGDD+YI RFQ PGEIE EFA +     ++ F   R  +PL
Sbjct  126  VPFPPRNPAVRPLNNFRAVYGDDYYICRFQEPGEIEEEFAQIDTARLMKKFLCLRIAKPL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  G S   D S ALP+WL EED++Y+ S++ + GFTG VNYYR   L+WEL APW+
Sbjct  186  CIPKDTGLSTVPDPS-ALPSWLSEEDVNYYASKFNQKGFTGPVNYYRCSDLNWELMAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGD DLVY+ KG KEYIHDGGFK  VP L++VVV++GVAHFINQE  EE
Sbjct  245  GVQIEVPVKFIVGDQDLVYNNKGMKEYIHDGGFKKYVPYLQEVVVMEGVAHFINQEKAEE  304

Query  415  VNNHIY  398
            V  HIY
Sbjct  305  VGAHIY  310



>gb|EMT09897.1| hypothetical protein F775_52362 [Aegilops tauschii]
Length=337

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 137/187 (73%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    V+ ++A+YGD++YI R Q PG IEAEFA LG +  LR FF+YR P PL
Sbjct  147  VPFSPRSPARKPVDGLKALYGDEYYICRIQEPGAIEAEFARLGTELVLRKFFTYRTPGPL  206

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK  G+  + D    LP+W+ EED+ Y+ ++++K+GFTGG+NYYRAL   WELT+PW+
Sbjct  207  FIPK-SGW-GSPDDEVPLPSWITEEDIKYYAAQFDKSGFTGGLNYYRALNKTWELTSPWT  264

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VPTKFIVGD+DL YH+ GA ++I+ GG K  VPLL+DVVV++ V HFIN+E  EE
Sbjct  265  GAEIKVPTKFIVGDVDLSYHVAGAHDFINKGGLKKFVPLLDDVVVMKDVGHFINEEKPEE  324

Query  415  VNNHIYN  395
            ++ HI +
Sbjct  325  ISAHIIS  331



>ref|NP_001042622.1| Os01g0255100 [Oryza sativa Japonica Group]
 dbj|BAD81074.1| putative epoxide hydrolase [Oryza sativa Japonica Group]
 dbj|BAE95793.1| putative epoxide hydrolase [Oryza sativa Japonica Group]
 dbj|BAF04536.1| Os01g0255100 [Oryza sativa Japonica Group]
 gb|EAZ11287.1| hypothetical protein OsJ_01143 [Oryza sativa Japonica Group]
 dbj|BAG86722.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 125/185 (68%), Gaps = 0/185 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR PR  +++ +R + GDDHY+ RFQ PG  EAEFA L +    +  F  RKP  +
Sbjct  131  VEYQPRHPRMSVLQAVRVLCGDDHYVCRFQKPGVAEAEFARLDLNHLFKMVFGMRKPATI  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              P+ K F    D     P WL EED+ Y+  ++ KTGFTGG NYYR + LDWELTAPW+
Sbjct  191  ILPQDKTFFDAIDSDGTCPPWLSEEDISYYADKFGKTGFTGGFNYYRCIDLDWELTAPWT  250

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A + VP KFIVGDLDL Y+  G K+YIH GGFK++VP LEDVVVL+GV HFINQE  +E
Sbjct  251  GALINVPIKFIVGDLDLTYNTPGVKDYIHKGGFKANVPNLEDVVVLEGVGHFINQEKPDE  310

Query  415  VNNHI  401
            V+ HI
Sbjct  311  VSEHI  315



>gb|ACJ84799.1| unknown [Medicago truncatula]
Length=319

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 130/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  + R+P+   V+ M A YGDD+YI RFQ PG++EAE A +G    ++   + RK  P 
Sbjct  127  VPLLRRNPKIRTVDAMHAAYGDDYYICRFQEPGKMEAEMAEVGTAYVMKSTLTTRKTGPP  186

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N+D    LP+WL E+DL YFVS++EKTGFTG +NYYR   L+WEL APW
Sbjct  187  IFPKGEFGTGFNSDTPDTLPSWLTEDDLTYFVSKFEKTGFTGALNYYRNFNLNWELMAPW  246

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            +  K+ VP KFI GDLD+VY     KEYIH GGFK DVP LE+V++ +G AHF NQEA E
Sbjct  247  NGVKIKVPVKFITGDLDMVYTSLNMKEYIHGGGFKEDVPNLEEVIIQKGGAHFNNQEAAE  306

Query  418  EVNNHIY  398
            E++NHIY
Sbjct  307  EISNHIY  313



>ref|XP_009393199.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Musa acuminata 
subsp. malaccensis]
Length=320

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 132/187 (71%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FIPR+P   LVE  R++YGDD+Y+ RFQ PG +EA+F  LG ++ LR  F+ R P PL
Sbjct  131  VPFIPRNPAGKLVEYFRSLYGDDYYVCRFQEPGAVEADFDRLGTESLLRMVFASRNPGPL  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK + F    D    LP WL EED+ YF S+++++GFTG VNYYR L L+ EL APW 
Sbjct  191  LLPK-EAF-VPLDRQIPLPDWLSEEDISYFTSKFDESGFTGPVNYYRCLDLNRELGAPWC  248

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              K+ VP KFIVGD DL YH  G ++Y+H GGFK DVP+LE+VVV++GVAHFINQE   E
Sbjct  249  GVKIQVPVKFIVGDQDLTYHYPGIQDYLHGGGFKEDVPMLEEVVVMEGVAHFINQEKAHE  308

Query  415  VNNHIYN  395
            + +HIY+
Sbjct  309  ITDHIYH  315



>ref|XP_003604118.1| Epoxide hydrolase [Medicago truncatula]
 gb|AES86315.1| epoxide hydrolase [Medicago truncatula]
Length=322

 Score =   211 bits (538),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 134/187 (72%), Gaps = 2/187 (1%)
 Frame = -2

Query  949  FIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYF  770
            F+ RDP+ +  +   A YGDD+Y+ RFQ PG+ EAE A +GV   LR+  + RKP P  F
Sbjct  131  FLGRDPKINNYDAFHAKYGDDYYVCRFQEPGKAEAELAEVGVAYFLRNMMTTRKPGPPIF  190

Query  769  PKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSE  593
            PKG+ G   N D    LP+WL EEDLDY+V+++ KTGFTGG+NYYR L L+WELT+PWSE
Sbjct  191  PKGEYGTGFNPDMPDILPSWLSEEDLDYYVTKFNKTGFTGGLNYYRNLSLNWELTSPWSE  250

Query  592  AKVM-VPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              V+ VP K+I GD  LVY     KEYI DGGFK DVP LE+VVV +G+AHF NQEA ++
Sbjct  251  VGVVNVPVKYITGDCGLVYTTPSMKEYILDGGFKKDVPGLEEVVVQEGIAHFNNQEAAQD  310

Query  415  VNNHIYN  395
            ++NHIY+
Sbjct  311  ISNHIYD  317



>ref|XP_010556730.1| PREDICTED: bifunctional epoxide hydrolase 2 [Tarenaya hassleriana]
Length=316

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 129/187 (69%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V+  RA++GDD+YI RFQ  GEIE +FA  G K  +  F + R PRP 
Sbjct  126  VAFSPRNPAVKPVDGFRALFGDDYYICRFQERGEIEEDFAQAGAKKLITKFLTSRNPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    D   +LP WL E+D+DY+  ++ + GFTGG+NYYRA+ L WELTAPW+
Sbjct  186  CIPKALGFRGLPD-PPSLPDWLTEQDIDYYAEKFSQKGFTGGLNYYRAMNLSWELTAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KF+VGDLD+ YHI G KEYIH+GG K  VP L++VVVL+GV HF+ QE  EE
Sbjct  245  GAQIKVPVKFMVGDLDVTYHIPGVKEYIHEGGIKKQVPFLQEVVVLEGVGHFLQQEKPEE  304

Query  415  VNNHIYN  395
            +  HI++
Sbjct  305  ITAHIHD  311



>gb|KDP28184.1| hypothetical protein JCGZ_13955 [Jatropha curcas]
Length=315

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P H  +E  R + GDD YI RFQ PGEIE +FA  G    LR F + R P+P 
Sbjct  126  VVFTPRNPNHKPLEKYRELLGDDFYICRFQEPGEIEEDFAQAGAAKVLRRFLASRNPKPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    D + +LP WL EED++Y+VS++ + GFTGG+NYYR L L+WELTAPW+
Sbjct  186  CIPK-IGFRGLPD-NPSLPPWLSEEDINYYVSKFNQKGFTGGLNYYRCLDLNWELTAPWT  243

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ YH  G KEYIH+GG K  VP L++VV+++GV H++NQE  EE
Sbjct  244  GLQIKVPVKFIVGDLDVTYHFPGVKEYIHNGGLKKYVPFLQEVVIMEGVCHYLNQEKPEE  303

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  304  ISAHIYD  310



>ref|XP_004134492.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004162212.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN57130.1| hypothetical protein Csa_3G164490 [Cucumis sativus]
Length=324

 Score =   211 bits (538),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F  R P+   +E ++A+YGDD+YI RFQ PGEIEAEFA +G +  + +  SYR P+PL
Sbjct  131  VTFNRRSPKRKPIESLKALYGDDYYICRFQEPGEIEAEFAEIGTERIMTEILSYRTPKPL  190

Query  775  YFPKGKGFSAN--TDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAP  602
              PKG+G   +   D   +LP WL ++D+DY+VS+++K GFTG +NYYR L  +WEL A 
Sbjct  191  MMPKGRGKGKDHPLDTPISLPPWLAKQDMDYYVSKFDKNGFTGPINYYRNLDRNWELNAS  250

Query  601  WSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAH  422
            ++ A+V VPTKFIVGD DL YH  GAK+YI  G  K DVP LE+VVV++GV HF+ +E  
Sbjct  251  FTGAQVKVPTKFIVGDQDLTYHSFGAKQYIQSGEMKKDVPFLEEVVVMEGVGHFLQEEKP  310

Query  421  EEVNNHIY  398
             E++NHIY
Sbjct  311  HEISNHIY  318



>ref|XP_007015342.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY32961.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=320

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 131/187 (70%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FIP +PR   VE  +A +G+DHYIVRFQ PG IEAEF  +G+   + +  SYR P PL
Sbjct  128  VPFIPYNPRFKPVETWKAYFGNDHYIVRFQEPGVIEAEFEEIGLGRAVLELLSYRVPDPL  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y PKG  F    DG   LP WL  +D +Y+ +++EKTG T  +NYYR    +WEL+APWS
Sbjct  188  YLPKGNLFGHPLDGPVDLPPWLSHQDANYYATQFEKTGITPALNYYRNFDRNWELSAPWS  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             +++ VP KF++GDLDLVY + G KEYIH+GGFK DVP LE+ VV++GV H+INQE  ++
Sbjct  248  GSQIKVPVKFVMGDLDLVYTMPGMKEYIHNGGFKRDVPFLEEAVVMKGVTHWINQEKPDD  307

Query  415  VNNHIYN  395
            +N  +++
Sbjct  308  INKQMFD  314



>ref|XP_009620847.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Nicotiana tomentosiformis]
Length=318

 Score =   211 bits (537),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 130/187 (70%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P+   +E MRA+ GDD+YI RFQ  G++E EFA +     +  F   R P PL
Sbjct  127  VVFHPRHPKRKPIESMRAVLGDDYYICRFQEYGQVEEEFARVDTARLIAKFLISRNPAPL  186

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
               K KGF  ++     LP+WL EED++Y+ +++ + GFTGG+NYYRA+ L+WELTAPW+
Sbjct  187  RVSKEKGFGGSSHTPIKLPSWLSEEDINYYANKFSQKGFTGGLNYYRAMDLNWELTAPWT  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLDL Y+  G KEYIH GGF+  VP L++VV+++GV HFIN+E  EE
Sbjct  247  GQQIKVPVKFIVGDLDLTYNTPGVKEYIHKGGFQKMVPFLQEVVIMEGVGHFINEEKPEE  306

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  307  INGHIYD  313



>ref|XP_008386679.1| PREDICTED: bifunctional epoxide hydrolase 2 [Malus domestica]
Length=316

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            + F PR+P+   V+  RA++GDD+YI RFQ P EIE +F  +G    ++ F + R P+P 
Sbjct  126  IAFSPRNPKRKPVDGFRALFGDDYYICRFQEPEEIERDFDSIGTAAVMKRFLTSRSPKPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK +G  +       LPAWL EEDL+Y VS++ K+GFTGG+NYYRAL L WELT PW+
Sbjct  186  CIPKDQGLKSWA-APVTLPAWLTEEDLNYIVSKFSKSGFTGGLNYYRALNLTWELTGPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVG+LD+ Y+I G + YIH GGFK DVP L++VVV++G AHFI QE  +E
Sbjct  245  GLQIKVPVKFIVGELDVTYNIPGVQAYIHKGGFKRDVPFLQEVVVMEGAAHFIAQEKPDE  304

Query  415  VNNHIYN  395
            V+ H+Y+
Sbjct  305  VSQHVYD  311



>ref|XP_008450607.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=317

 Score =   210 bits (535),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 134/187 (72%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    VE MR ++GDD+YI RFQ PGEIE E A +G K  LR   + R+  P 
Sbjct  126  VPFRPRHPNRKPVETMRKVFGDDYYICRFQNPGEIEEEMAQVGAKEVLRGILTTRRQGPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
             +PK + F A  + S+ LP+WL EEDL YF S+YE+ GFTG +NYYR++ L+WELTAPW+
Sbjct  186  IYPKKQAFRARPESSSPLPSWLSEEDLSYFASKYEQKGFTGPLNYYRSMDLNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +V VP KFIVGD+D+VY   G KEY++ GGFK DVP L+DVV+++GV HF+NQE  EE
Sbjct  246  GVQVKVPVKFIVGDVDMVYTTPGVKEYVNGGGFKKDVPFLQDVVIMEGVGHFLNQEKPEE  305

Query  415  VNNHIYN  395
            +N HIY+
Sbjct  306  INTHIYD  312



>ref|XP_008775992.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=319

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 139/188 (74%), Gaps = 3/188 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P    +  +RA+ GD++YI RFQ  G +EAEFA LG  T LR F +YR P PL
Sbjct  129  VPFMPRNPAAKPLNHVRALNGDEYYISRFQEHGAVEAEFARLGTATVLRKFLTYRNPGPL  188

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK +G+ +  +  T LP+WL EED++YF S++EK+GFTG +NYYR L L+WEL A W+
Sbjct  189  FIPK-EGWGSPNEHIT-LPSWLSEEDINYFTSKFEKSGFTGPINYYRCLDLNWELAAAWT  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKE-YIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
             A++ VP KFI+GDLDL YH    ++ YIH GGFK DVPLL++VVV++GVAHFINQE  +
Sbjct  247  GAQIKVPAKFIIGDLDLNYHDPPRRQDYIHKGGFKKDVPLLQEVVVMEGVAHFINQEKAQ  306

Query  418  EVNNHIYN  395
            E+ +HI++
Sbjct  307  EITDHIFD  314



>ref|XP_010039280.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50058.1| hypothetical protein EUGRSUZ_K03499 [Eucalyptus grandis]
Length=331

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 131/187 (70%), Gaps = 4/187 (2%)
 Frame = -2

Query  943  PRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYFPK  764
            P DP    VE +RAMYGDD+Y+ RFQ PGEIE +FA       ++ F + R P P   PK
Sbjct  137  PSDPEKKPVESLRAMYGDDYYVCRFQEPGEIEEDFAKADPAKLIQLFLTTRNPGPPRVPK  196

Query  763  GKGFSANT----DGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              G+S  T    D    LP+WL EED++Y+ +++ +TGFTGG+NYYR L L+WEL+APW+
Sbjct  197  DLGYSGRTKLLEDSQVDLPSWLTEEDINYYATQFSRTGFTGGLNYYRCLDLNWELSAPWA  256

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KFIVGDLDL+YHI G KEYIHDGGFK  VP L++VVV++GVAH++  E   E
Sbjct  257  GARIEVPVKFIVGDLDLIYHIPGVKEYIHDGGFKQTVPNLKEVVVMEGVAHYLLLEKPHE  316

Query  415  VNNHIYN  395
            V +HI +
Sbjct  317  VTSHICD  323



>ref|NP_001132040.1| uncharacterized protein LOC100193450 [Zea mays]
 gb|ACF80720.1| unknown [Zea mays]
Length=369

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR      V+ +RA++GDD+YI R Q PGEIEAEFA LG +  L+ FFSYR P  L
Sbjct  178  VAYTPRSAARKPVDGLRALFGDDYYICRIQEPGEIEAEFARLGTELVLKKFFSYRSPGAL  237

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            +FPK    S   D    LP+W+ EEDL Y+ S +EKTGFTGG+NYYRAL   WELT+PW+
Sbjct  238  FFPKSGWGSP--DDEVPLPSWVTEEDLKYYTSMFEKTGFTGGLNYYRALNKTWELTSPWT  295

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLL-EDVVVLQGVAHFINQEAHE  419
             AK+ VP KFI+GDLDL YH  G +++IH GGFK  VPLL +D++V++ V HFIN+E   
Sbjct  296  LAKINVPVKFIIGDLDLTYHNPGIQDFIHKGGFKKFVPLLDDDIIVMKDVGHFINEEKPN  355

Query  418  EVNNHIYN  395
            EV+ HI N
Sbjct  356  EVSEHIIN  363



>ref|XP_006396441.1| hypothetical protein EUTSA_v10028814mg [Eutrema salsugineum]
 gb|ESQ37894.1| hypothetical protein EUTSA_v10028814mg [Eutrema salsugineum]
Length=316

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 129/186 (69%), Gaps = 1/186 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V+  RA++GDD+Y+ RFQ PGEIE +FA    K  +  FF+ R PRP 
Sbjct  126  VVFNPRNPSVKPVDAFRALFGDDYYVCRFQEPGEIEEDFAQADTKKLINRFFTSRNPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    D    LPAWL E+D+ ++  ++ + GFTGG+NYYRAL L WELTAPW+
Sbjct  186  CIPKTLGFRGLPD-PPPLPAWLTEQDVRFYADKFSQKGFTGGLNYYRALNLSWELTAPWA  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLDL YHI G KEYIH+GG K  VP L++VVV++GV HF++QE  +E
Sbjct  245  GLQIKVPVKFIVGDLDLTYHIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLHQEKPDE  304

Query  415  VNNHIY  398
            V +HIY
Sbjct  305  VTDHIY  310



>emb|CDY65636.1| BnaAnng20810D [Brassica napus]
Length=316

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V+  +A++G+D+YI RFQ PGEIE +FA +  K  +  FF+ R PRP 
Sbjct  126  VVFNPRNPSVKPVDAFKALFGEDYYICRFQEPGEIEEDFAQVDTKKLINRFFTSRNPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    D   ALPAWL EED+ ++  ++ + GFTGG+NYYRA+ L WELTAPW+
Sbjct  186  CIPKSLGFRGLPD-PPALPAWLTEEDVSFYAEKFSQKGFTGGLNYYRAMNLSWELTAPWA  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ Y+I G KEYIH+GG K  VP L++VVV++GV HF+ QE  +E
Sbjct  245  GLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQEKPDE  304

Query  415  VNNHIYN  395
            V +HIY+
Sbjct  305  VTDHIYS  311



>ref|XP_009111296.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Brassica rapa]
Length=316

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V+  +A++G+D+YI RFQ PGEIE +FA +  K  +  FF+ R PRP 
Sbjct  126  VVFNPRNPSVKPVDAFKALFGEDYYICRFQEPGEIEEDFAQVDTKKLINRFFTSRNPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    D   ALPAWL EED+ ++  ++ + GFTGG+NYYRA+ L WELTAPW+
Sbjct  186  CIPKSLGFRGLPD-PPALPAWLTEEDVSFYAEKFSQKGFTGGLNYYRAMNLSWELTAPWA  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ Y+I G KEYIH+GG K  VP L++VVV++GV HF+ QE  +E
Sbjct  245  GLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQEKPDE  304

Query  415  VNNHIYN  395
            V +HIY+
Sbjct  305  VTDHIYS  311



>gb|AFK39700.1| unknown [Lotus japonicus]
Length=322

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 133/187 (71%), Gaps = 2/187 (1%)
 Frame = -2

Query  949  FIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYF  770
            F+  D     V+  RA+YGDD Y+ RFQ PG++EAEFA +      ++  + RK  P  F
Sbjct  131  FLRIDSPVKTVDGFRAVYGDDFYVCRFQEPGKMEAEFAEVDTAYLFKNILTMRKTGPPIF  190

Query  769  PKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSE  593
            PKG+ G   N D    LP+WL EEDL+YF S+++KTGF+GG+NYYR L L+WELTAPW+ 
Sbjct  191  PKGEYGTGFNPDAPETLPSWLSEEDLEYFASKFKKTGFSGGLNYYRNLNLNWELTAPWTG  250

Query  592  AKVM-VPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +  VP KFIVGD+D+ Y+  G K+YIH GGFK DVP LE+VVV +GVAHFINQEA E+
Sbjct  251  VGITNVPVKFIVGDVDITYNFTGMKDYIHKGGFKKDVPTLEEVVVQEGVAHFINQEAAED  310

Query  415  VNNHIYN  395
            V+NHIY+
Sbjct  311  VSNHIYD  317



>emb|CDY50394.1| BnaCnng19260D [Brassica napus]
Length=316

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 130/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V+  +A++G+D+YI RFQ PGEIE +FA +  K  +  FF+ R PRP 
Sbjct  126  VVFNPRNPSVKPVDAFKALFGEDYYICRFQEPGEIEEDFAQVDTKKLINRFFTSRNPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    D   ALPAWL EED+ ++  ++ + GFTGG+NYYRA+ L WELTAPW+
Sbjct  186  CIPKSLGFRGLPD-PPALPAWLTEEDVSFYAEKFSQKGFTGGLNYYRAMNLSWELTAPWA  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ Y+I G KEYIH+GG K  VP L++VVV++GV HF+ QE  +E
Sbjct  245  GLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLQQEKPDE  304

Query  415  VNNHIYN  395
            V +HIY 
Sbjct  305  VTDHIYG  311



>gb|AFW56302.1| hypothetical protein ZEAMMB73_530848 [Zea mays]
Length=397

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 132/188 (70%), Gaps = 3/188 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR      V+ +RA++GDD+YI R Q PGEIEAEFA LG +  L+ FFSYR P  L
Sbjct  206  VAYTPRSAARKPVDGLRALFGDDYYICRIQEPGEIEAEFARLGTELVLKKFFSYRSPGAL  265

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            +FPK    S   D    LP+W+ EEDL Y+ S +EKTGFTGG+NYYRAL   WELT+PW+
Sbjct  266  FFPKSGWGSP--DDEVPLPSWVTEEDLKYYTSMFEKTGFTGGLNYYRALNKTWELTSPWT  323

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLL-EDVVVLQGVAHFINQEAHE  419
             AK+ VP KFI+GDLDL YH  G +++IH GGFK  VPLL +D++V++ V HFIN+E   
Sbjct  324  LAKINVPVKFIIGDLDLTYHNPGIQDFIHKGGFKKFVPLLDDDIIVMKDVGHFINEEKPN  383

Query  418  EVNNHIYN  395
            EV+ HI N
Sbjct  384  EVSEHIIN  391



>gb|KHN03961.1| Epoxide hydrolase 2 [Glycine soja]
Length=318

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/190 (55%), Positives = 137/190 (72%), Gaps = 5/190 (3%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FI R+P    V+ MRAMYG+D+YI RFQ PGE+EA+ A +G +  L++  + RKP P 
Sbjct  126  VPFIRRNPNVRTVDGMRAMYGEDYYICRFQKPGEMEAQMAQVGTEYVLKNILTIRKPGPP  185

Query  775  YFPKGK---GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTA  605
             FPKG+   G + N    T LP+WL ++DL Y+VS+YEK+GFTG +NYYR + L+WELTA
Sbjct  186  IFPKGEFGTGLNPNMSDDT-LPSWLTDDDLAYYVSKYEKSGFTGPLNYYRNMNLNWELTA  244

Query  604  PWSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEA  425
            PW+  ++ V  K+I G+LD+VY   G KEY+H GGFK DVP L+ VVV +GVAHF N EA
Sbjct  245  PWTGVQIQVAVKYITGELDMVYTSLGMKEYVHSGGFKQDVPNLQ-VVVQKGVAHFNNLEA  303

Query  424  HEEVNNHIYN  395
             EE+NNHIY+
Sbjct  304  AEEINNHIYD  313



>gb|KHN20253.1| Epoxide hydrolase 2 [Glycine soja]
Length=322

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 135/187 (72%), Gaps = 2/187 (1%)
 Frame = -2

Query  949  FIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYF  770
            F+ R+P+   V+   ++YGDD+YI RFQ PG++EAE A +     +++  + RK  P  F
Sbjct  131  FLGRNPKQKTVDFFHSLYGDDYYICRFQEPGKMEAEMAGVDTAYLMKNILTTRKTGPPTF  190

Query  769  PKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSE  593
            PKG+ G   N      LP+W+ +EDLDY+V+++ KTGF+GG+NYYR L L+WELTAPW+ 
Sbjct  191  PKGEYGTGFNPGTPDTLPSWISQEDLDYYVTKFNKTGFSGGLNYYRNLNLNWELTAPWTG  250

Query  592  AKVM-VPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            A ++ VP KFI G +DLVY   G KEYIH+GGFK DVP LE+VVV +GVAHF NQEA E+
Sbjct  251  AGIVDVPVKFITGGVDLVYTSPGMKEYIHNGGFKKDVPTLEEVVVQEGVAHFNNQEAAED  310

Query  415  VNNHIYN  395
            V+NHIY+
Sbjct  311  VSNHIYD  317



>ref|XP_002874922.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51181.1| hypothetical protein ARALYDRAFT_490337 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 130/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V+  RA++GDD+YI RFQ PGEIE +FA +  K  +  FF  R PRP 
Sbjct  126  VVFNPRNPSVKPVDAFRALFGDDYYICRFQEPGEIEEDFAQVDTKKLITRFFISRNPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    D   +LPAWL EED+ ++  ++ + GFTGG+NYYRAL L WELTAPW+
Sbjct  186  CIPKSVGFRGLPD-PPSLPAWLTEEDVSFYGDKFSQKGFTGGLNYYRALNLSWELTAPWA  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ Y+I G KEYIH+GG K  VP L++VVVL+GV HF++QE  +E
Sbjct  245  GLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVLEGVGHFLHQEKPDE  304

Query  415  VNNHIYN  395
            + +HIY 
Sbjct  305  ITDHIYG  311



>ref|XP_002443185.1| hypothetical protein SORBIDRAFT_08g014640 [Sorghum bicolor]
 gb|EES17023.1| hypothetical protein SORBIDRAFT_08g014640 [Sorghum bicolor]
Length=374

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 135/188 (72%), Gaps = 3/188 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR      V+ +RA++GDD+YI R Q  GEIEAEFA LG +  L+ FFSYR P PL
Sbjct  183  VAYTPRSAARKPVDGLRALFGDDYYICRIQEAGEIEAEFARLGTELVLKKFFSYRYPGPL  242

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            +FPK  G+  + D    LP+W+ EEDL Y+ +++EKTGFTGG+NYYRAL   WELT+PW+
Sbjct  243  FFPK-SGW-GSLDDEVPLPSWVTEEDLKYYTNKFEKTGFTGGLNYYRALNKTWELTSPWT  300

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLL-EDVVVLQGVAHFINQEAHE  419
             AK+ VP KFI+GDLDL YH  G ++++H GGFK  VPLL +D+VV++ V HFIN+E   
Sbjct  301  LAKINVPVKFIIGDLDLTYHSPGIQDFLHKGGFKKFVPLLDDDIVVMKDVGHFINEEKPN  360

Query  418  EVNNHIYN  395
            EV+ HI N
Sbjct  361  EVSEHIIN  368



>ref|XP_004494951.1| PREDICTED: uncharacterized protein LOC101500941 [Cicer arietinum]
Length=639

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 132/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V  + R+P+   V+ MRA YGDD+YI RFQ PG++EA+ A +G    L++  + RK  P 
Sbjct  127  VPLLHRNPKIKTVDAMRAAYGDDYYICRFQEPGKMEAQMAEVGTAYVLKNILTTRKTGPP  186

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
              PKG+ G   N D    LP+WL E DL YFVS++EKTGFTGG+NYYR L L+WEL APW
Sbjct  187  ILPKGEYGTGFNPDTPDTLPSWLTEADLAYFVSKFEKTGFTGGLNYYRNLNLNWELMAPW  246

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
              AKV VP KFI G+LD+VY     KEYIH GGFK DVP LE+V+V +GVAHF NQEA E
Sbjct  247  RGAKVYVPVKFITGELDMVYTSLNMKEYIHGGGFKEDVPNLEEVIVQKGVAHFNNQEAAE  306

Query  418  EVNNHIY  398
            E++NHIY
Sbjct  307  EISNHIY  313


 Score =   204 bits (518),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 131/188 (70%), Gaps = 3/188 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR+P    V  MR +YG+D YI RFQ PG+ EAEFA +G +  +R   + R P P 
Sbjct  447  VPYAPRNPILKPVTAMRLLYGNDFYICRFQEPGKAEAEFAKVGAELVIRGMLTTRTPGPP  506

Query  775  YFPKGKGFSANTDGSTA--LPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAP  602
              PK  GF ++ D +    LP+WL +EDL Y+VS+++K+GFTG +NYYR + L+W+LTA 
Sbjct  507  ILPK-DGFGSDLDPANPPPLPSWLSQEDLSYYVSKFDKSGFTGALNYYRNINLNWKLTAS  565

Query  601  WSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAH  422
            W+ A+V VP KFI G+LD+VY     KEYIH GGFK DVP LE+V+V +GVAHF NQ A 
Sbjct  566  WTGARVKVPVKFITGELDMVYTSLNMKEYIHGGGFKEDVPNLEEVIVQKGVAHFNNQRAA  625

Query  421  EEVNNHIY  398
            EE++NHIY
Sbjct  626  EEISNHIY  633



>ref|XP_008807392.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Phoenix dactylifera]
Length=317

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 132/187 (71%), Gaps = 3/187 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+P    V+  R +YGDD+YI RFQ PG IEA FA +G  +  R     R P P 
Sbjct  129  VAFMPRNPAMKTVDYFRKLYGDDYYICRFQEPGAIEARFAQIGTASIFRTILQSRDPGPF  188

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK +G+  +    + L +WL EED++Y+ S+++K+GFTG VNYYR + L+WELTAPW+
Sbjct  189  LIPK-EGW--DLPEKSPLCSWLSEEDINYYASKFDKSGFTGPVNYYRCMNLNWELTAPWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLDL YH  G ++YIH+GGFK +VPLL++VVV++GV HFINQE   E
Sbjct  246  GVQIKVPAKFIVGDLDLTYHYPGIQDYIHNGGFKQNVPLLQEVVVMEGVGHFINQEKGHE  305

Query  415  VNNHIYN  395
            + +HIY+
Sbjct  306  ITDHIYD  312



>ref|XP_003626202.1| Epoxide hydrolase [Medicago truncatula]
Length=697

 Score =   218 bits (555),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 136/187 (73%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+ R+P+   V+ MRA+YGDD+YI RFQ PGE+EA+ A +G    +++  + RK  P 
Sbjct  505  VPFLHRNPKIRTVDGMRAVYGDDYYICRFQEPGEMEAQMAEVGTTYVMKNILTTRKTGPP  564

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N D    LP+WL E+DL YFVS++EKTGFTGG+NYYR   L+WELTAPW
Sbjct  565  IFPKGEYGTGFNPDTPDNLPSWLTEDDLAYFVSKFEKTGFTGGLNYYRNFNLNWELTAPW  624

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            +  K+ VP KFI G+LD+VY     KEYIH GGFK DVP LE+V++ +GVAHF NQEA E
Sbjct  625  TGVKIKVPVKFITGELDMVYTSFNLKEYIHGGGFKEDVPNLEEVIIQKGVAHFNNQEAEE  684

Query  418  EVNNHIY  398
            E++N+IY
Sbjct  685  EISNYIY  691


 Score =   215 bits (547),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 132/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F  R+P+   V+ MRA YGDD+YI RFQ PG++EA+ A +G    ++   + RK  P 
Sbjct  127  VPFTRRNPKIRTVDGMRAAYGDDYYISRFQEPGKMEAQMAEVGTAYVMKSTLTTRKTGPP  186

Query  775  YFPKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
             FPKG+ G   N D    LP+WL E+DL YFVS++EKTGF GG+NYYR L L+WEL APW
Sbjct  187  IFPKGEFGTGFNPDTPDKLPSWLTEDDLAYFVSKFEKTGFVGGLNYYRNLNLNWELMAPW  246

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            +  K+ VP KFI GDLD+VY     KEYIH GGFK DVP LE+V+V +GVAHF NQEA E
Sbjct  247  NGVKIKVPVKFITGDLDIVYTSPKVKEYIHGGGFKEDVPNLEEVIVQKGVAHFNNQEAAE  306

Query  418  EVNNHIY  398
            E++NHIY
Sbjct  307  EISNHIY  313



>ref|NP_567228.1| putative epoxide hydrolase [Arabidopsis thaliana]
 gb|AAC19281.1| T14P8.15 [Arabidopsis thaliana]
 emb|CAB80727.1| AT4g02340 [Arabidopsis thaliana]
 gb|AAM26670.1| AT4g02340/T14P8_15 [Arabidopsis thaliana]
 gb|AAN18121.1| At4g02340/T14P8_15 [Arabidopsis thaliana]
 gb|AEE82157.1| putative epoxide hydrolase [Arabidopsis thaliana]
Length=324

 Score =   209 bits (533),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V+  RA++GDD+YI RFQ PGEIE +FA +  K  +  FF+ R PRP 
Sbjct  126  VVFNPRNPSVKPVDAFRALFGDDYYICRFQEPGEIEEDFAQVDTKKLITRFFTSRNPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    D   +LPAWL E+D+ ++  ++ + GFTGG+NYYRAL L WELTAPW+
Sbjct  186  CIPKSVGFRGLPD-PPSLPAWLTEQDVRFYGDKFSQKGFTGGLNYYRALNLSWELTAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ Y+I G KEYIH+GG K  VP L++VVV++GV HF++QE  +E
Sbjct  245  GLQIKVPVKFIVGDLDITYNIPGTKEYIHEGGLKKHVPFLQEVVVMEGVGHFLHQEKPDE  304

Query  415  VNNHIYN  395
            V +HIY 
Sbjct  305  VTDHIYG  311



>ref|XP_008454330.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=316

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 127/187 (68%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VHF+ R+P    V+  R  +GDD YI RFQVPGE E +F  +      + F   R P P 
Sbjct  126  VHFLRRNPTISFVQGFRIAFGDDFYICRFQVPGEAEKDFGSIDTAELFKKFLCGRSPDPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  G  +       LP+WL +ED++YF +++ +TGFTGG NYYRAL L WELTA W+
Sbjct  186  ILPKEFGIRS-IPSPQNLPSWLSQEDINYFATKFNRTGFTGGFNYYRALDLTWELTASWN  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            +A+V VP KFIVGDLDL YH  GAKEYIH+GGFK+DVP LE+VVV++  AHFINQE   E
Sbjct  245  KAQVQVPVKFIVGDLDLTYHFPGAKEYIHNGGFKTDVPFLEEVVVMEDTAHFINQERPHE  304

Query  415  VNNHIYN  395
            ++ HI++
Sbjct  305  ISAHIHD  311



>ref|XP_010693593.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=369

 Score =   211 bits (536),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 135/188 (72%), Gaps = 4/188 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLG-VKTCLRDFFSYRKPRP  779
            V F PR+P+   ++++RA YGD +YIVRFQVPG+IE E    G  +  LR  +S+  P P
Sbjct  180  VAFSPRNPKMKPLDMLRAAYGDSYYIVRFQVPGDIEEEIMEAGGAEIFLRKIYSHHSPGP  239

Query  778  LYFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
            L+ PKG+ F+   D   + P+W+ +E + Y+  ++ +TGFTGG+NYYRAL L+WE+TAPW
Sbjct  240  LFLPKGESFN---DVPASFPSWMSKEMIAYYCDKFSQTGFTGGLNYYRALNLNWEITAPW  296

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + A+V VPTKFIVGDLDL Y+  G K+YIH GG K DVPLLEDVV+L+GV HF+  E  +
Sbjct  297  TGAQVKVPTKFIVGDLDLTYNATGVKDYIHKGGMKRDVPLLEDVVILEGVHHFLQHEKPD  356

Query  418  EVNNHIYN  395
             ++ HIY+
Sbjct  357  MISKHIYD  364



>ref|XP_003556522.1| PREDICTED: bifunctional epoxide hydrolase 2 isoform X1 [Glycine 
max]
 ref|XP_006606541.1| PREDICTED: bifunctional epoxide hydrolase 2 isoform X2 [Glycine 
max]
Length=322

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 135/187 (72%), Gaps = 2/187 (1%)
 Frame = -2

Query  949  FIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYF  770
            F+ R+P+   V+   ++YGDD+YI RFQ PG++EAE A +     +++  + RK  P  F
Sbjct  131  FLGRNPKQKTVDFFHSLYGDDYYICRFQEPGKMEAEMAGVDTAYLMKNILTTRKTGPPTF  190

Query  769  PKGK-GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSE  593
            PKG+ G   N      LP+W+ +EDLDY+V+++ KTGF+GG+NYYR L L+WELTAPW+ 
Sbjct  191  PKGEYGTGFNPVTPDTLPSWISQEDLDYYVTKFNKTGFSGGLNYYRNLNLNWELTAPWTG  250

Query  592  AKVM-VPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            A ++ VP KFI G +DLVY   G KEYIH+GGFK DVP LE+VVV +GVAHF NQEA E+
Sbjct  251  AGIVDVPVKFITGGVDLVYTSPGMKEYIHNGGFKKDVPTLEEVVVQEGVAHFNNQEAAED  310

Query  415  VNNHIYN  395
            V+NHIY+
Sbjct  311  VSNHIYD  317



>gb|AES82458.2| epoxide hydrolase [Medicago truncatula]
Length=319

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 136/188 (72%), Gaps = 1/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V ++PR+P+   V+ MRA++GDD+YI RFQ PG++E+EFA  G +  +++  + R   P 
Sbjct  127  VPYLPRNPKMKPVDGMRALFGDDYYICRFQEPGKMESEFAKGGPELLIKNMLTSRNSGPP  186

Query  775  YFPK-GKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
              PK G   + +  G+ ALP+WL +ED+ Y+ S++EKTGF+G +NYYR L L+WELTA W
Sbjct  187  ILPKEGVIPNPHASGTKALPSWLSQEDITYYASKFEKTGFSGALNYYRNLNLNWELTAAW  246

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + AK+ VP KFI GDLD VY   G K+YI  GGFK DVP LE+VV+ +GVAHF NQEA E
Sbjct  247  TAAKIKVPVKFITGDLDAVYTSFGTKQYIESGGFKKDVPNLEEVVIQEGVAHFNNQEAAE  306

Query  418  EVNNHIYN  395
            +++NHIY+
Sbjct  307  DISNHIYD  314



>ref|XP_006288215.1| hypothetical protein CARUB_v10001452mg [Capsella rubella]
 gb|EOA21113.1| hypothetical protein CARUB_v10001452mg [Capsella rubella]
Length=324

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 129/187 (69%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V+  RA++GDD+YI RFQ  GEIE +FA +  K  +  FF  R PRP 
Sbjct  126  VVFNPRNPTLKPVDAFRALFGDDYYICRFQEAGEIEEDFAQVDTKKLITKFFVSRNPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    D   +LPAWL E+D+ ++  ++ + GFTGG+NYYRA+ L WELTAPW+
Sbjct  186  CIPKSVGFRGLPD-PPSLPAWLTEQDVSFYGDKFSQKGFTGGLNYYRAMNLSWELTAPWA  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+VY+I G KEYIHDGG K  VP L++VVV++GV HF+ QE  +E
Sbjct  245  GLQIKVPVKFIVGDLDIVYNIPGTKEYIHDGGLKKHVPFLQEVVVMEGVGHFLQQEKPDE  304

Query  415  VNNHIYN  395
            V +HIY 
Sbjct  305  VTDHIYG  311



>ref|XP_006359858.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=318

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 129/184 (70%), Gaps = 1/184 (1%)
 Frame = -2

Query  943  PRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYFPK  764
            PR+P    ++ +R + GDD+Y+ RFQ PGE+E EFA +     +  F + R  RP   PK
Sbjct  130  PRNPLRKPIDCLRELLGDDYYMCRFQKPGEVEEEFASIDTAKLMIGFLTSRDTRPPCIPK  189

Query  763  GKGF-SANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEAK  587
              GF  A       LP+WL +ED++Y+V +  KTGFTGG+NYYR +  +WELTAP+S  K
Sbjct  190  EIGFHQAFAQLPATLPSWLTQEDVNYYVEKLNKTGFTGGLNYYRNMDKNWELTAPFSGCK  249

Query  586  VMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVNN  407
            + VPTKF+VG+LDL YHI G KEYIH+GGFK +VP LE+VVV++G AHFINQE  +E+N 
Sbjct  250  IQVPTKFVVGELDLTYHIPGIKEYIHNGGFKKEVPSLEEVVVMEGAAHFINQEKPDEINA  309

Query  406  HIYN  395
            HIY+
Sbjct  310  HIYD  313



>ref|XP_003563920.2| PREDICTED: bifunctional epoxide hydrolase 2-like [Brachypodium 
distachyon]
Length=355

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 132/187 (71%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    V+ +RA++GD++Y+ R Q PG IEAEFA LG    LR FF+YR P PL
Sbjct  165  VAFTPRSPARKPVDGLRALFGDEYYVCRIQEPGAIEAEFARLGTDLVLRKFFTYRTPGPL  224

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK    S   D    LP+W+ EED+ Y+ ++++KTGFTGG+NYYRAL   WELT+PW+
Sbjct  225  FIPKSGWGSP--DDEVPLPSWITEEDVKYYATQFDKTGFTGGLNYYRALNKTWELTSPWT  282

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ VP KF++GDLDL YH  G +++I+ GG K  VPLL+DVV+++ V HFIN+E  EE
Sbjct  283  GAEIKVPVKFVIGDLDLTYHTPGIQDFINKGGLKKYVPLLDDVVIMKDVGHFINEEKPEE  342

Query  415  VNNHIYN  395
            V+ HI +
Sbjct  343  VSAHIIS  349



>ref|XP_008438903.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis melo]
Length=369

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F  R P+   +  ++A+YGDD+YI RFQ PGEIEAEFA +G +  + +  SYR P+PL
Sbjct  176  VTFNRRSPKRKPIPALKALYGDDYYICRFQEPGEIEAEFAEIGTERIMTEILSYRIPKPL  235

Query  775  YFPKGKGFSAN--TDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAP  602
              PKG+G   +   D   +LP WL ++D+DY+VS+++K GFTG +NYYR L  +WEL AP
Sbjct  236  MMPKGRGKGKDHPLDTPISLPPWLTKQDMDYYVSKFDKNGFTGPINYYRNLDRNWELNAP  295

Query  601  WSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAH  422
            ++ A+V VPTKFIVGD DL Y+  GAK+YI  G  K DVP LE+VVV++GV HF+ +E  
Sbjct  296  FTGAQVKVPTKFIVGDQDLTYNSFGAKQYIESGEMKKDVPFLEEVVVMEGVGHFLQEEKP  355

Query  421  EEVNNHIY  398
             E++NHIY
Sbjct  356  HEISNHIY  363



>gb|ACE82565.1| epoxide hydrolase [Nicotiana benthamiana]
Length=315

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 135/188 (72%), Gaps = 4/188 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P+   +  MRA +GDD+Y+ RFQ PG +E E A  G +  L+   + RKP P 
Sbjct  126  VPFRPRHPKMKPIPTMRAFFGDDYYMCRFQDPG-MEEEIAKYGSEVVLKKILTDRKPGPP  184

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKG  F  + D  + LP+WL ++DL+Y+ +++++ GFTGG+NYYRAL L+WELTA W+
Sbjct  185  CLPKGSPFGISPD--SKLPSWLSQDDLNYYSTKFDRKGFTGGLNYYRALDLNWELTAAWT  242

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLL-EDVVVLQGVAHFINQEAHE  419
             AKV VP KF+VG+LDLVY   G KEY+H GGFK DVP+L EDVVV++G AHFINQE  +
Sbjct  243  GAKVKVPVKFMVGELDLVYTTPGMKEYVHGGGFKKDVPMLDEDVVVMEGAAHFINQERAQ  302

Query  418  EVNNHIYN  395
            E+N+HIY+
Sbjct  303  EINSHIYD  310



>ref|XP_004152245.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156836.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52816.1| hypothetical protein Csa_4G001830 [Cucumis sativus]
Length=316

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 126/186 (68%), Gaps = 1/186 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            VHF+PR+P    V+  R  +GDD YI RFQVPGE E +F  +      +     R P P 
Sbjct  126  VHFLPRNPAISFVQGFRFAFGDDFYICRFQVPGEAEKDFGSIDTTELFKKILCGRTPDPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKG G  +       LP+WL +ED++YF +++  TGFTGG NYYRAL L WELTA W+
Sbjct  186  ILPKGLGIRS-IPSPHDLPSWLSQEDINYFATKFNHTGFTGGFNYYRALDLTWELTASWN  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            +A+V VP KFIVGDLDL Y+  GAKEYIH+GGFK+DVP LE+VVV++  AHFINQE   E
Sbjct  245  KAQVQVPVKFIVGDLDLTYYFPGAKEYIHNGGFKTDVPFLEEVVVMEDTAHFINQERPHE  304

Query  415  VNNHIY  398
            ++ HI+
Sbjct  305  ISVHIH  310



>ref|XP_004965308.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Setaria italica]
Length=361

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 132/187 (71%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR      V+ +RA+YGD++YI R Q PG IEAEF  LG +  LR FFSYR P PL
Sbjct  171  VAYTPRSAARRPVDGLRAIYGDEYYICRIQEPGAIEAEFKRLGTELVLRKFFSYRTPGPL  230

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  G+  + D    LP+W+ EEDL+Y+ S +E+TGFTGG+NYYRAL   WELT+ W+
Sbjct  231  IIPK-TGW-GSPDDQVLLPSWVTEEDLNYYTSEFERTGFTGGLNYYRALNRTWELTSSWT  288

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             +++ VP KFI+GDLDL YH  G +++IH GGFK  VPLL+DVVV++ V HFIN+E  +E
Sbjct  289  ASEINVPVKFIIGDLDLTYHTPGIQDFIHKGGFKKFVPLLDDVVVMKDVGHFINEEKPKE  348

Query  415  VNNHIYN  395
            V+ HI +
Sbjct  349  VSEHIIS  355



>ref|XP_004967831.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Setaria italica]
Length=325

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 122/181 (67%), Gaps = 0/181 (0%)
 Frame = -2

Query  943  PRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYFPK  764
            PR P    ++ ++A  G+DHY+ RFQ PG  EAEFA    K      F  RKP PL  PK
Sbjct  138  PRRPEGSPLQTIKAACGEDHYMCRFQEPGVAEAEFAQYDAKYIFNKTFGMRKPAPLILPK  197

Query  763  GKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEAKV  584
             K F  + D     P WL EED+ Y+  ++ KTGFTGG NYYR + L+WEL+APW+ A +
Sbjct  198  DKSFFDSLDSDGTCPPWLSEEDISYYAEKFSKTGFTGGFNYYRCMDLNWELSAPWTGAPI  257

Query  583  MVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVNNH  404
             VPTKFIVGDLD+ Y+  G ++YIH GGFK+ VP LEDVVV++GV+HFINQE   EV++H
Sbjct  258  KVPTKFIVGDLDITYNTPGVQDYIHKGGFKASVPKLEDVVVMEGVSHFINQEKPSEVSDH  317

Query  403  I  401
            I
Sbjct  318  I  318



>ref|XP_004152242.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 ref|XP_004156832.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Cucumis sativus]
 gb|KGN52825.1| hypothetical protein Csa_4G001920 [Cucumis sativus]
Length=316

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 127/187 (68%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    ++  RA YGDD Y+ RFQVPGE EA+FA +      +   S R     
Sbjct  126  VQFFPRNPAISFIQRFRAAYGDDFYMCRFQVPGEAEADFACIDTAQLFKTTLSTRSTEAP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF A       LP+WL EED++Y+ +++++TGFTG +NYYRA  L WELTAPW+
Sbjct  186  CLPKEYGFRA-IPPPENLPSWLTEEDINYYAAKFKETGFTGALNYYRAFDLTWELTAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ YH KGAKEYIHDGGFK DVPLLE+VV+++   HF+++E   E
Sbjct  245  GVQIQVPVKFIVGDLDITYHFKGAKEYIHDGGFKRDVPLLEEVVIVKNAGHFVHEEKPHE  304

Query  415  VNNHIYN  395
            +N HI++
Sbjct  305  INTHIHD  311



>ref|XP_010038231.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
 gb|KCW50055.1| hypothetical protein EUGRSUZ_K03496 [Eucalyptus grandis]
Length=322

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 129/187 (69%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+P   +   V+ +RA++GDD+YI RFQ PGE E +FA   +   ++ F + R P+P 
Sbjct  131  VAFLPGSRKRKPVDSLRALFGDDYYICRFQEPGEAEEDFARADITKLMKLFLTCRSPKPP  190

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  G S        LP WL EED++++ S++ + GFTGG+NYYRA+ L W+L APW+
Sbjct  191  CIPKEIGCSGLASSRDKLPPWLSEEDINFYASKFSQKGFTGGLNYYRAMNLTWKLAAPWT  250

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ YH+ GAK++IH+GG K  VP L++VVV++GVAHF+ QE  EE
Sbjct  251  GVQIKVPVKFIVGDLDITYHVPGAKQHIHNGGLKKLVPFLQEVVVMEGVAHFLQQEKPEE  310

Query  415  VNNHIYN  395
            V NHIY+
Sbjct  311  VTNHIYD  317



>gb|AFK46740.1| unknown [Lotus japonicus]
Length=323

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 133/183 (73%), Gaps = 2/183 (1%)
 Frame = -2

Query  937  DPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYFPKGK  758
            D +  +V+  RA+YGDD Y+ RFQ PG++EAE A +G +   ++  + RK  P  FPKG+
Sbjct  136  DSQVKIVDAFRALYGDDFYVCRFQEPGKMEAEIAEVGTEYMHKNILTMRKTGPPIFPKGE  195

Query  757  -GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEAKVM  581
             G   N D    LP+WL ++DLDY+VS++ KTGF+G +NYYR L L+WELTAPW+   + 
Sbjct  196  FGTGFNPDMPENLPSWLSQQDLDYYVSQFNKTGFSGALNYYRNLNLNWELTAPWTGVPIT  255

Query  580  -VPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVNNH  404
             VP KFIVGD+D+ Y+  G KEYIH+GGFK DVP LE+VVV +GVAHF NQEA E+V+NH
Sbjct  256  NVPVKFIVGDVDIAYNFSGMKEYIHNGGFKKDVPGLEEVVVQEGVAHFNNQEAAEDVSNH  315

Query  403  IYN  395
            IY+
Sbjct  316  IYD  318



>ref|XP_010544298.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Tarenaya hassleriana]
Length=326

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 133/185 (72%), Gaps = 2/185 (1%)
 Frame = -2

Query  943  PRDPRHDL--VEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYF  770
            P DP   +  VE++RA YGDD+YI RFQ PG IEAEFA +G +  L+ FF++R P PL  
Sbjct  137  PTDPSPAVKPVEMLRAFYGDDYYISRFQEPGAIEAEFAEVGTERVLKRFFTFRTPGPLII  196

Query  769  PKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEA  590
            P+ K F  + D    LP+WL EED+ Y+VS++EKTGF+G VN+YR L  ++EL  PW  +
Sbjct  197  PEDKSFWGHPDTPIPLPSWLSEEDVRYYVSKFEKTGFSGAVNFYRNLDRNYELLGPWIGS  256

Query  589  KVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVN  410
            K+ VPTKFIVGDLDLVYH  G KEYI+   FK DVPLLE  V+++GVAH+INQE  +E+ 
Sbjct  257  KITVPTKFIVGDLDLVYHRPGMKEYINGPQFKEDVPLLEPPVIMEGVAHWINQEKPDEIL  316

Query  409  NHIYN  395
            +HI +
Sbjct  317  HHITD  321



>gb|EMS55500.1| Epoxide hydrolase 2 [Triticum urartu]
Length=259

 Score =   205 bits (521),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 131/187 (70%), Gaps = 2/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    V+ +RA+YGDD YI  FQ PG IEAEF  LG +  LR FF+ R   PL
Sbjct  69   VPFTPRSPAVKPVDAVRALYGDDFYICSFQDPGAIEAEFKRLGTELVLRKFFADRSASPL  128

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK      + D    LP+W+ +ED+ Y+ ++++K+GFTGG NYYRAL   WELT+PW+
Sbjct  129  FIPKSGW--GSPDDEVPLPSWITDEDVKYYTTQFDKSGFTGGFNYYRALNKTWELTSPWT  186

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++MVPTKFIVGDLDL Y+I GAK++I+ GGFK  VPLL+ VV+++ V HFIN+E  EE
Sbjct  187  GAEIMVPTKFIVGDLDLTYNIAGAKDFINKGGFKKFVPLLDGVVIMKDVGHFINEEKPEE  246

Query  415  VNNHIYN  395
            ++  I +
Sbjct  247  ISALIIS  253



>gb|AFZ93648.1| epoxide hydrolase [Euphorbia lathyris]
 gb|AFZ93653.1| epoxide hydrolase [Euphorbia lathyris]
Length=315

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 130/188 (69%), Gaps = 4/188 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRP-  779
            V F+PRDP    VE  R +YG+D+YIVR+Q PG  EAE+A +      R   + R P P 
Sbjct  126  VPFLPRDPTTPFVEFYRNLYGEDYYIVRYQKPGVAEAEYAKINSAKLFRIILTNRDPNPE  185

Query  778  LYFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPW  599
               PK  G     D ST LP WL E+D+DY+  ++ KTGFTGG+NYYR     WELTA W
Sbjct  186  ATLPKDIG--KQPDPST-LPCWLTEKDVDYYARKFHKTGFTGGINYYRNFDRTWELTAAW  242

Query  598  SEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHE  419
            + A+V VP KFIVGDLDLVY+I G KEYIH+GGFK DVP LE+VV+++GVAHF+NQE  +
Sbjct  243  TGAQVKVPVKFIVGDLDLVYNIPGMKEYIHNGGFKRDVPFLEEVVIMEGVAHFLNQEKAD  302

Query  418  EVNNHIYN  395
            E++ HIY+
Sbjct  303  EISKHIYD  310



>ref|XP_010088295.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB33520.1| Epoxide hydrolase 2 [Morus notabilis]
Length=316

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 135/187 (72%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+ + V+  RA  GDD YI RFQ PGE EA+F+   V    R   + R P+P 
Sbjct  126  VPFFPRNPKINFVDGFRAELGDDFYICRFQEPGESEADFSSDTV-AVFRRILANRDPKPP  184

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    +   ALP+WL E+D+++F +++ +TGFTGG+NYYRAL L WELTA W+
Sbjct  185  LIPKEIGFRGVYEDPVALPSWLTEDDINHFANKFNETGFTGGLNYYRALNLTWELTAAWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VPTKFI+GDLDLVY+  G KEYI +GGFK DVPLL+++V+++G AHFINQE  +E
Sbjct  245  GARVQVPTKFIMGDLDLVYYFPGMKEYILNGGFKRDVPLLQELVIIEGAAHFINQEKPDE  304

Query  415  VNNHIYN  395
            +++HI++
Sbjct  305  ISSHIHH  311



>gb|KDP28186.1| hypothetical protein JCGZ_13957 [Jatropha curcas]
Length=319

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/189 (52%), Positives = 137/189 (72%), Gaps = 2/189 (1%)
 Frame = -2

Query  955  VHFIPRDPRH-DLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRP  779
            V F PR P+  + VE +RA+ GDD+Y+ RFQ P E EA+FA +   + LR  ++ R P+P
Sbjct  126  VAFTPRFPQLLNPVENLRAIIGDDYYVCRFQGPIEHEAQFAGVNTASLLRSIYTARDPKP  185

Query  778  LYFPKGKGF-SANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAP  602
               PK   + S   D   +LP+WL EED+DYF +++++TGFTGG+NYYR LK  WEL AP
Sbjct  186  PRIPKNIAYESLFPDSLCSLPSWLSEEDIDYFATKFKQTGFTGGLNYYRNLKSTWELMAP  245

Query  601  WSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAH  422
            W+  +V VP KFIVGDLD  Y++ G KEY+++GGFK+DVPLLE+VV+++GVAHFI QE  
Sbjct  246  WTGQQVKVPVKFIVGDLDTAYNLPGVKEYVNNGGFKNDVPLLEEVVIMEGVAHFIIQEKA  305

Query  421  EEVNNHIYN  395
            +E++ HIY+
Sbjct  306  QEISQHIYD  314



>ref|XP_010088294.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB33519.1| Epoxide hydrolase 2 [Morus notabilis]
Length=318

 Score =   206 bits (523),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 128/187 (68%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    +E  RA+ G+D+YI RFQ PGE E +FA       L+ F+  R P P 
Sbjct  128  VAFSPRHPTRKPIEGFRALLGNDYYICRFQEPGEAEKDFARDDTTNLLKKFYLGRNPSPP  187

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GFS +      +P+WL EED+ ++  ++++ GFTGG+NYYRAL L WELTA WS
Sbjct  188  CIPKEIGFS-DLKAPQTMPSWLLEEDVKFYARKFDEKGFTGGLNYYRALDLTWELTAAWS  246

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +V VP KFI+GDLD+ YH+ GAKEYIH+GGFK DVP L++VVV++GVAH+INQE  EE
Sbjct  247  GTQVKVPVKFIIGDLDVTYHVPGAKEYIHNGGFKRDVPYLQEVVVMEGVAHYINQEKAEE  306

Query  415  VNNHIYN  395
               HIY+
Sbjct  307  TAAHIYD  313



>ref|XP_002523108.1| epoxide hydrolase, putative [Ricinus communis]
 gb|EEF39293.1| epoxide hydrolase, putative [Ricinus communis]
Length=316

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V ++ R+P+   +E+ R +YGDD+Y+ RFQ PG  E +FA +     +R  F+ R P P 
Sbjct  126  VAYMSRNPQLKSLELFRTVYGDDYYVCRFQEPGGAEEDFAQVDTAKLIRSVFTSRDPNPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF +  D   +LP+WL EED++Y+  ++ K GFTGG+NYYR +  +WELTAPW 
Sbjct  186  IVPKEIGFRSLPD-PPSLPSWLSEEDVNYYADKFNKKGFTGGLNYYRNIDQNWELTAPWD  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KF++GDLDL YH  G K+YIH+GGFK  VPLL++VVV++GVAHFINQE  EE
Sbjct  245  GLQIKVPVKFVIGDLDLTYHFPGIKDYIHNGGFKQVVPLLQEVVVMEGVAHFINQEKPEE  304

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  305  ISEHIYD  311



>ref|XP_007147001.1| hypothetical protein PHAVU_006G088400g [Phaseolus vulgaris]
 gb|ESW18995.1| hypothetical protein PHAVU_006G088400g [Phaseolus vulgaris]
Length=316

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 128/187 (68%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P+   V+ MRA+YGDD+YI RFQ  G+ E E A    +  L+   + R P P 
Sbjct  126  VPFWPRNPKVKPVDAMRALYGDDYYICRFQEAGKAEGELAKNSTEEVLKKLLTNRTPGPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
               K +G  +N + S  LP+WL  +DL Y+ S++EKTGFTGG+NYYR + L+WELTAPW+
Sbjct  186  ILQK-EGMGSNLNTSMPLPSWLSLQDLKYYASKFEKTGFTGGLNYYRNINLNWELTAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFI GDLD VY   G K YI  G FK DVP LE+V+V +GVAHF NQEA E+
Sbjct  245  GAQVKVPVKFITGDLDSVYTSLGMKNYIESGAFKKDVPNLEEVIVQEGVAHFNNQEAAED  304

Query  415  VNNHIYN  395
            V+NHIY+
Sbjct  305  VSNHIYD  311



>ref|XP_006283220.1| hypothetical protein CARUB_v10004250mg, partial [Capsella rubella]
 gb|EOA16118.1| hypothetical protein CARUB_v10004250mg, partial [Capsella rubella]
Length=715

 Score =   214 bits (545),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 137/187 (73%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+     V  +R ++GDD+YI RFQ PG+IEAEF  LG +  L++F +Y+ P PL
Sbjct  204  VLFSPRNRDRVPVPTLRYVFGDDYYICRFQKPGDIEAEFKNLGTEKVLKEFLTYKTPGPL  263

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK K F  + + + ALP WL +EDLDY+V++Y+K GFTG +NYYR +  +WELTAPW+
Sbjct  264  HLPKDKCFERSENAACALPPWLTQEDLDYYVTKYDKKGFTGPINYYRNIDRNWELTAPWT  323

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AK+ VP KFIVGD DL Y+  GAKEYI+ GGFK DVPLL++ VVL+G+ HF+++E  + 
Sbjct  324  GAKINVPVKFIVGDHDLTYNFPGAKEYINGGGFKRDVPLLDETVVLKGLGHFLHEEDPDV  383

Query  415  VNNHIYN  395
            +N HI++
Sbjct  384  INQHIHS  390


 Score =   206 bits (525),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 134/187 (72%), Gaps = 4/187 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F P +P+   + + R+ YGDD+YI RFQ  GEIEAEFA +GV+  L +F +YR P P+
Sbjct  528  VVFDPWNPKRKPISMFRSFYGDDYYICRFQECGEIEAEFAKVGVERSLLEFLTYRNPGPI  587

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PKGK +    D   +LP+WL E D++Y+VS+YEK GFTG VNYYR +   WEL    S
Sbjct  588  LLPKGKSY----DDPISLPSWLTEYDVNYYVSKYEKNGFTGPVNYYRNMDRTWELMGSLS  643

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
            +A+V VP KFI+GD DL YHI G K+YIHDG FKS VPLL++VVV++GV HF+++E  +E
Sbjct  644  KAQVKVPVKFIIGDQDLTYHIPGTKKYIHDGRFKSHVPLLDEVVVIEGVGHFLHEERPDE  703

Query  415  VNNHIYN  395
            ++ HI++
Sbjct  704  ISKHIHD  710



>ref|NP_001276233.1| bifunctional epoxide hydrolase 2-like [Glycine max]
 gb|ACU18052.1| unknown [Glycine max]
Length=318

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 136/190 (72%), Gaps = 5/190 (3%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FI R+P    V+ MRAMYG+D+YI RFQ PGE+EA+ A +G +  L++  + RKP P 
Sbjct  126  VPFIRRNPNVRTVDGMRAMYGEDYYICRFQKPGEMEAQMAQVGTEYVLKNILTIRKPGPP  185

Query  775  YFPKGK---GFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTA  605
             FPKG+   G + N    T LP+WL ++DL Y+VS+YEK+GFTG +NYYR + L+WELTA
Sbjct  186  IFPKGEFGTGLNPNMSDDT-LPSWLTDDDLAYYVSKYEKSGFTGPLNYYRNMNLNWELTA  244

Query  604  PWSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEA  425
            PW+  ++ V  K+I G+LD+VY   G KEY+H GGFK DVP L+ VVV +GV HF N EA
Sbjct  245  PWTGVQIQVVVKYITGELDMVYTSLGMKEYVHSGGFKQDVPNLQ-VVVQKGVTHFNNLEA  303

Query  424  HEEVNNHIYN  395
             EE+NNHI++
Sbjct  304  AEEINNHIHD  313



>gb|EMT04118.1| hypothetical protein F775_13984 [Aegilops tauschii]
Length=322

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 132/185 (71%), Gaps = 2/185 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V FIPR P    V+ +RA+YGDD YI  FQ PG IEAEF  LG +  LR FF+ R P PL
Sbjct  132  VPFIPRSPAVKPVDAVRALYGDDFYICSFQEPGAIEAEFKRLGTELVLRKFFADRTPGPL  191

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK  G+  + D    LP+W+ EED+ Y+ ++ +K+GFTGG+NYYRAL   WELT+PW+
Sbjct  192  FIPK-SGW-GSPDDEVPLPSWITEEDVKYYTTQLDKSGFTGGLNYYRALNKTWELTSPWT  249

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++MVPTKF VGDLDL Y+I GAK +I+ GG K  VPLL+DVV+++ V HFIN++  EE
Sbjct  250  GAEIMVPTKFTVGDLDLTYNIAGAKVFINKGGLKKFVPLLDDVVIMKDVGHFINEQKPEE  309

Query  415  VNNHI  401
            ++  I
Sbjct  310  ISALI  314



>ref|XP_011041992.1| PREDICTED: bifunctional epoxide hydrolase 2 [Populus euphratica]
Length=317

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 132/187 (71%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    V+I R ++GDD+YI RFQ PGE+E +FA +     +R F + R P+P 
Sbjct  126  VVFQPRNPDKSFVQISRDLFGDDYYICRFQEPGEVEEDFAQMDTARIIRKFLTSRNPKPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    D    LP+WL E+D++++  ++ KTGFTGG+NYYR L L+WELTA W+
Sbjct  186  RIPKEVGFRGLPDNPN-LPSWLSEKDINHYAGKFNKTGFTGGLNYYRCLDLNWELTAAWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ Y++ GA++YI +GG K  VP L++V +++GVAHF+NQE  EE
Sbjct  245  GLQIKVPVKFIVGDLDITYNMPGAQDYISEGGLKKYVPFLQEVAIMEGVAHFLNQEKPEE  304

Query  415  VNNHIYN  395
            V++HIY+
Sbjct  305  VSSHIYD  311



>ref|XP_008454322.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Cucumis 
melo]
Length=316

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 127/187 (68%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    ++  RA YGDD Y+ RFQVPGE EA+FA +      +   S R  +  
Sbjct  126  VQFFPRNPAISFIQRFRAAYGDDFYMCRFQVPGEAEADFACIDTAQLFKTTLSNRSTKAP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF A       LP+WL EED++Y+ +++++TGFTG +NYYRA  L WELTAPW+
Sbjct  186  CLPKEYGFRA-IPPPENLPSWLTEEDINYYAAKFKETGFTGALNYYRAFDLTWELTAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGD DL YH KGAKEYIH+GGFK DVPLLE+VV+++   HF+++E   E
Sbjct  245  GVQIQVPVKFIVGDSDLTYHFKGAKEYIHEGGFKRDVPLLEEVVIVENAGHFVHEEKPHE  304

Query  415  VNNHIYN  395
            +N HI++
Sbjct  305  INTHIHD  311



>ref|XP_006444387.1| hypothetical protein CICLE_v10021228mg [Citrus clementina]
 ref|XP_006479995.1| PREDICTED: bifunctional epoxide hydrolase 2-like isoform X1 [Citrus 
sinensis]
 gb|ESR57627.1| hypothetical protein CICLE_v10021228mg [Citrus clementina]
 gb|KDO87172.1| hypothetical protein CISIN_1g021184mg [Citrus sinensis]
Length=316

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 131/187 (70%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F  R+P    V+  RA++GDD YI RFQ PG  E +FA +     ++ F   R P+P 
Sbjct  126  VVFRSRNPATKPVDQYRALFGDDFYICRFQEPGVAEEDFAQIDTARLIKKFLGGRSPKPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF    D  T LP+WL EED++Y+ S++ + GFTGG+NYYR L L+WEL APW+
Sbjct  186  CVPKEIGFRGLPDLRT-LPSWLSEEDVNYYASKFSQKGFTGGLNYYRCLDLNWELLAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A++ +P KF+VGDLD+ YHI G +EYI +GGFK DVP L++V+V++GVAHFINQE  +E
Sbjct  245  GAQIKIPVKFMVGDLDITYHIPGIREYIQNGGFKKDVPGLQEVIVMEGVAHFINQEKADE  304

Query  415  VNNHIYN  395
            V++HIY+
Sbjct  305  VSSHIYD  311



>ref|XP_011092097.1| PREDICTED: bifunctional epoxide hydrolase 2 [Sesamum indicum]
Length=317

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 127/186 (68%), Gaps = 1/186 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    VE MRA +G+D+Y+ RFQ PG++E+E A  G +  ++   + R P P 
Sbjct  127  VPFRPRHPNVKPVEGMRAFFGEDYYMCRFQEPGKMESEIARYGAEAVIKKILTDRTPGPP  186

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            Y PK   F +N D    LP W  E+DL Y+   YEK GFTGG+NYYRAL L+WELTA W+
Sbjct  187  YLPKETPFGSNID-DIKLPPWFTEDDLKYYAENYEKRGFTGGLNYYRALDLNWELTAAWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             AKV VP KF+VGD+D+VY   G KEY+H GGFK+DVPLLE+ VV+  V HF+NQE  +E
Sbjct  246  GAKVRVPVKFVVGDVDMVYTTPGLKEYVHGGGFKNDVPLLEECVVMDNVGHFLNQEKADE  305

Query  415  VNNHIY  398
            VN +I+
Sbjct  306  VNAYIH  311



>ref|XP_006344695.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Solanum tuberosum]
Length=314

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/183 (54%), Positives = 128/183 (70%), Gaps = 3/183 (2%)
 Frame = -2

Query  943  PRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYFPK  764
            PR P+   +  MRA  GDD+Y+ RFQ PG +E E A  G +  L+     RKP P   PK
Sbjct  130  PRHPKMKPIPTMRAFLGDDYYMCRFQDPG-MEDEMAKYGSEAVLKKILIDRKPGPPCLPK  188

Query  763  GKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEAKV  584
               F  +TD    LP WL ++DL+Y+ +++++ GFTGG+NYYRAL L+WELTAPW+  KV
Sbjct  189  DNPFGISTDDK--LPLWLSQDDLNYYSTKFDQKGFTGGLNYYRALDLNWELTAPWTGVKV  246

Query  583  MVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVNNH  404
             VP KF+VGDLD+VY   G KEY+H GGFK DVP+L+DVVVL+G AHFINQE  +E N+H
Sbjct  247  NVPVKFVVGDLDVVYTTPGMKEYVHGGGFKKDVPMLDDVVVLEGAAHFINQERAQETNSH  306

Query  403  IYN  395
            IY+
Sbjct  307  IYD  309



>gb|KFK30821.1| hypothetical protein AALP_AA6G030400 [Arabis alpina]
Length=316

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 126/187 (67%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    ++  R+++GDD+YI RFQ PGEIE +FA    K  +  FF+ R PRP 
Sbjct  126  VVFNPRNPNVKPLDTFRSLFGDDYYICRFQEPGEIEEDFAQTDTKKLITRFFTSRNPRPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK  GF           AW  EED+ ++V ++ + GFTGG+NYYRA+ L WELTAPW+
Sbjct  186  CIPKTVGFRGLPAPPPLP-AWFTEEDVSFYVDKFNQKGFTGGLNYYRAMNLSWELTAPWA  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              ++ VP KFIVGDLD+ YHI G KEYIHDGG K  VP L++VV+++GV HF+ QE  EE
Sbjct  245  GLQIKVPVKFIVGDLDITYHIPGTKEYIHDGGLKKHVPFLQEVVIMEGVGHFLQQEKPEE  304

Query  415  VNNHIYN  395
            V +HIY+
Sbjct  305  VTDHIYS  311



>ref|XP_010102979.1| Epoxide hydrolase 2 [Morus notabilis]
 gb|EXB94546.1| Epoxide hydrolase 2 [Morus notabilis]
Length=316

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 127/187 (68%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F+PR+PR +LV+  RA +GDD Y  RFQ PGEIE +FA     T L+  ++      L
Sbjct  126  VAFMPRNPRINLVDGFRAFFGDDFYFCRFQEPGEIEKDFASDDTATVLKKLYTSFGATHL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
            + PK  GF       T LP+WL EED++Y  S++E+ GFTGG+NYYRA  L WEL APW+
Sbjct  186  FIPKELGFKGLKAPDT-LPSWLSEEDINYSASKFEQKGFTGGLNYYRAANLTWELLAPWT  244

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFIVGD D  YH  G K+YI  GGFK DVP LE+VV+++GVAHFINQ   EE
Sbjct  245  GAQVKVPAKFIVGDEDTTYHFPGVKQYIESGGFKKDVPSLEEVVIVEGVAHFINQAKPEE  304

Query  415  VNNHIYN  395
            ++ HIY+
Sbjct  305  ISTHIYD  311



>ref|XP_002455386.1| hypothetical protein SORBIDRAFT_03g009830 [Sorghum bicolor]
 gb|EES00506.1| hypothetical protein SORBIDRAFT_03g009830 [Sorghum bicolor]
Length=325

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 122/181 (67%), Gaps = 0/181 (0%)
 Frame = -2

Query  943  PRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPLYFPK  764
            PR P    ++ +RA  G+DHY+ RFQ PG  EAEFA    K   +  F  RKP PL  PK
Sbjct  138  PRRPEMSPLQTIRAACGEDHYMCRFQEPGVAEAEFALYDTKYVFKKTFGMRKPAPLVLPK  197

Query  763  GKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWSEAKV  584
             K F  + D     P WL EED+ Y+  ++ KTGFTGG+NYYR +   WEL+APW+ A++
Sbjct  198  DKSFFDSLDSDGTCPPWLSEEDISYYAEKFAKTGFTGGLNYYRCMDRSWELSAPWTGAQI  257

Query  583  MVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEEVNNH  404
             VP+KFIVGDLD+ Y+  G  +YIH GGFK+ VP LEDVV+++GV+HF+NQE   EV++H
Sbjct  258  KVPSKFIVGDLDITYNAPGVPDYIHKGGFKASVPNLEDVVIMEGVSHFLNQEKPNEVSDH  317

Query  403  I  401
            I
Sbjct  318  I  318



>gb|KDP23458.1| hypothetical protein JCGZ_23291 [Jatropha curcas]
Length=317

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 126/187 (67%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    VE MR ++GD++YI RFQ PGEIE E A +G +  L+  F+ RKP P 
Sbjct  126  VPFKPRHPNIKTVESMRLLFGDEYYICRFQKPGEIEEEIARVGTEEVLKKIFTDRKPGPP  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK   F +  +    LP+WL EEDL Y+V+++ + GFTGG+NYYRAL L+WELTA W+
Sbjct  186  CLPKENAFGSCKENPVTLPSWLTEEDLAYYVTKFNQKGFTGGLNYYRALDLNWELTAQWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
               + VP KF+VGD D+VY   G KEY+   GF   VP LEDVVV++GV HFI+QE  +E
Sbjct  246  GVAIKVPVKFVVGDADMVYTTPGMKEYVQGSGFSHYVPFLEDVVVMEGVGHFISQERPKE  305

Query  415  VNNHIYN  395
            ++N IY+
Sbjct  306  ISNLIYD  312



>gb|EYU46742.1| hypothetical protein MIMGU_mgv1a010264mg [Erythranthe guttata]
Length=317

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 123/186 (66%), Gaps = 0/186 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR P    +E+ + + GDD Y+ RFQ  GE E  F  +     ++  FS+R  +P+
Sbjct  126  VQFHPRHPEIKPIEMYKNLLGDDFYMCRFQKAGEAEKAFESVEASQVIKSLFSFRGGKPI  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              P+  G  A        P WL EEDLDYF  +++KTG+TGG+NYYRA+ L WEL APW 
Sbjct  186  IVPREIGLEALFQAPAESPPWLTEEDLDYFAGKFKKTGYTGGLNYYRAMDLTWELAAPWV  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A+V VP KFI+G+ D+ Y++ G KEYIHDGGFK DVP LE VVV++GVAHFINQE  EE
Sbjct  246  GAQVKVPVKFIIGEQDITYYVPGIKEYIHDGGFKKDVPNLEQVVVMEGVAHFINQEKPEE  305

Query  415  VNNHIY  398
            V+ HIY
Sbjct  306  VSQHIY  311



>ref|XP_011023717.1| PREDICTED: bifunctional epoxide hydrolase 2 [Populus euphratica]
Length=317

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/187 (50%), Positives = 130/187 (70%), Gaps = 0/187 (0%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR+P+   VE M+ ++G+D+Y+ RFQ PG +E E A  G +  L+   + RKP PL
Sbjct  126  VPYRPRNPKMKPVESMKLVFGEDYYMCRFQEPGVVEDEIARAGTEEVLKKILTDRKPGPL  185

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
              PK   F    +    +P+WL E DL ++ ++Y + GFTGG+NYYRAL L+WELTA W+
Sbjct  186  CLPKENPFGIYPEEPVTMPSWLSEADLSFYATKYSQKGFTGGLNYYRALDLNWELTASWT  245

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
             A V VP KF+VGDLD+VY   G KE+++ GGFK  VPLLE++VV++GV HFINQE  EE
Sbjct  246  GAPVNVPVKFVVGDLDMVYTNPGMKEFVNSGGFKHYVPLLEEIVVMEGVGHFINQEKAEE  305

Query  415  VNNHIYN  395
            ++NHIY+
Sbjct  306  ISNHIYD  312



>ref|XP_010038235.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=325

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 127/191 (66%), Gaps = 4/191 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PR+P    VE MRA +GDD+Y+ RFQ PG  E +FA   +   ++ F + R P P 
Sbjct  127  VAWFPRNPERKPVESMRATFGDDYYVCRFQEPGVAEEDFAKADIAKLIQLFLTGRDPSPP  186

Query  775  YFPKGKGFSANT----DGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELT  608
              PK  G S            LP+WL ++D+ Y+ +++ +TGFTGG NYYR L L+WEL+
Sbjct  187  IVPKDVGISGLIKLLDQQQVELPSWLTDDDISYYATQFSRTGFTGGFNYYRCLDLNWELS  246

Query  607  APWSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQE  428
            APW+ A++ VP KFIVGDLDL YH  G KEYIHDGGFK  VP LEDVVV++GVAHF+ QE
Sbjct  247  APWTGARIEVPVKFIVGDLDLTYHFPGVKEYIHDGGFKKAVPNLEDVVVMEGVAHFLQQE  306

Query  427  AHEEVNNHIYN  395
              +EV  HI++
Sbjct  307  KPQEVTAHIHD  317



>ref|XP_010684348.1| PREDICTED: bifunctional epoxide hydrolase 2 [Beta vulgaris subsp. 
vulgaris]
Length=319

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 126/187 (67%), Gaps = 1/187 (1%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V F PR+P    VE +R   GDD YI RFQ PGE+E E   +     ++ F   R P P 
Sbjct  129  VPFTPRNPTLKPVERLRNSLGDDFYICRFQEPGEMEKELDSIDTAKLMKKFLVSRDPEPP  188

Query  775  YFPKGKGFSANTDGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELTAPWS  596
             FPKGK  +A  +    LP+WL EED++YF  ++++TGFTGG+NYYR++ L WEL APW+
Sbjct  189  CFPKGK-LAAAAEKPVTLPSWLSEEDINYFADKFKQTGFTGGLNYYRSMDLTWELMAPWT  247

Query  595  EAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQEAHEE  416
              +V VPTKFI+G+LD+ Y     K YIH+GG K DVPLL+DVV+++G AHFINQE  EE
Sbjct  248  GMQVKVPTKFILGELDITYRFPLTKNYIHNGGMKRDVPLLDDVVIMEGAAHFINQERPEE  307

Query  415  VNNHIYN  395
            ++ HI +
Sbjct  308  ISKHILD  314



>ref|XP_010039296.1| PREDICTED: bifunctional epoxide hydrolase 2-like [Eucalyptus 
grandis]
Length=325

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/191 (52%), Positives = 128/191 (67%), Gaps = 4/191 (2%)
 Frame = -2

Query  955  VHFIPRDPRHDLVEIMRAMYGDDHYIVRFQVPGEIEAEFAPLGVKTCLRDFFSYRKPRPL  776
            V + PRDP    VE MRAM+GDD+Y+ RFQ PGE E +FA        + F + R P P 
Sbjct  127  VAWFPRDPERKPVEKMRAMFGDDYYVCRFQEPGEAEEDFAKADPAKLFKLFLAGRDPSPP  186

Query  775  YFPKGKGFSANT----DGSTALPAWLPEEDLDYFVSRYEKTGFTGGVNYYRALKLDWELT  608
               K  GFS  T    D    LP+WL E+D++++ +++ +TGFTGG+NYYR   L+WEL+
Sbjct  187  IVTKDVGFSGMTKLFEDHQVDLPSWLSEDDINFYAAQFSRTGFTGGLNYYRCWDLNWELS  246

Query  607  APWSEAKVMVPTKFIVGDLDLVYHIKGAKEYIHDGGFKSDVPLLEDVVVLQGVAHFINQE  428
            A W+   + VP KFIVGDLDL YHI G KEYIH GGFK  VP LE+VVV++GVAHF+ QE
Sbjct  247  ASWTGVPIEVPMKFIVGDLDLTYHIPGVKEYIHGGGFKQAVPNLEEVVVMEGVAHFLMQE  306

Query  427  AHEEVNNHIYN  395
              +EV +HI+N
Sbjct  307  KPQEVTSHIHN  317



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2070268854280