BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25489_g1_i4 len=1542 path=[6902:0-258 1180:259-295 7512:296-320
1242:321-378 7324:379-399 1321:400-449 4923:450-479 1401:480-503
4976:504-783 5256:784-794 1716:795-891 9268:892-929 1851:930-973
7440:974-1017 1939:1018-1043 7746:1044-1048 1970:1049-1089
5770:1090-1158 2080:1159-1238 7608:1239-1284 2206:1285-1310
2232:1311-1541]

Length=1542
                                                                      Score     E

ref|XP_009781147.1|  PREDICTED: cellulose synthase-like protein H...    556   0.0      
ref|XP_009588345.1|  PREDICTED: cellulose synthase-like protein H1      555   0.0      
ref|XP_006364167.1|  PREDICTED: cellulose synthase-like protein H...    513   2e-171   
ref|XP_006364166.1|  PREDICTED: cellulose synthase-like protein H...    513   6e-171   
emb|CDP19391.1|  unnamed protein product                                509   2e-169   
ref|XP_004243487.1|  PREDICTED: cellulose synthase-like protein H1      508   5e-169   
ref|XP_010035547.1|  PREDICTED: cellulose synthase-like protein H...    498   5e-166   
ref|XP_010035546.1|  PREDICTED: cellulose synthase-like protein H...    498   5e-165   
emb|CBI28826.3|  unnamed protein product                                497   9e-165   
ref|XP_002302868.1|  cellulose synthase family protein                  497   2e-164   Populus trichocarpa [western balsam poplar]
ref|XP_002269831.2|  PREDICTED: cellulose synthase-like protein H1      497   2e-164   Vitis vinifera
ref|XP_006387031.1|  hypothetical protein POPTR_2114s00200g             485   8e-164   
ref|XP_007049091.1|  Cellulose synthase-like B3, putative               494   2e-163   
ref|XP_011007182.1|  PREDICTED: cellulose synthase-like protein H1      493   3e-163   
ref|XP_010035545.1|  PREDICTED: cellulose synthase-like protein B4      490   8e-162   
ref|XP_002529325.1|  transferase, putative                              489   2e-161   Ricinus communis
ref|XP_010657214.1|  PREDICTED: cellulose synthase-like protein H1      489   2e-161   
emb|CBI28829.3|  unnamed protein product                                489   2e-161   
ref|XP_010035551.1|  PREDICTED: cellulose synthase-like protein B4      487   1e-160   
gb|KCW46974.1|  hypothetical protein EUGRSUZ_K00782                     486   1e-159   
ref|XP_011047235.1|  PREDICTED: cellulose synthase-like protein H1      484   1e-159   
ref|XP_008229979.1|  PREDICTED: cellulose synthase-like protein B...    481   1e-158   
ref|XP_010657215.1|  PREDICTED: cellulose synthase-like protein H1      481   3e-158   
ref|XP_010657216.1|  PREDICTED: cellulose synthase-like protein H1      479   9e-158   
ref|XP_009347136.1|  PREDICTED: cellulose synthase-like protein H1      477   7e-157   
ref|XP_009353304.1|  PREDICTED: cellulose synthase-like protein H...    477   9e-157   
ref|XP_009353303.1|  PREDICTED: cellulose synthase-like protein H...    477   1e-156   
ref|XP_007217027.1|  hypothetical protein PRUPE_ppa001909mg             475   3e-156   
ref|XP_010089469.1|  Cellulose synthase-like protein H1                 476   4e-156   
ref|XP_008229978.1|  PREDICTED: cellulose synthase-like protein B...    473   3e-155   
gb|AFZ78580.1|  cellulose synthase-like protein                         473   3e-155   
ref|XP_007217825.1|  hypothetical protein PRUPE_ppa026099mg             472   4e-155   
gb|KDP30772.1|  hypothetical protein JCGZ_13715                         470   9e-155   
ref|XP_010244466.1|  PREDICTED: cellulose synthase-like protein H...    470   4e-154   
ref|XP_007049092.1|  Cellulose synthase-like B3, putative isoform 1     468   2e-153   
ref|XP_009347146.1|  PREDICTED: cellulose synthase-like protein H1      467   3e-153   
emb|CAN72832.1|  hypothetical protein VITISV_017982                     481   2e-152   Vitis vinifera
ref|XP_010930913.1|  PREDICTED: cellulose synthase-like protein H...    459   3e-152   
ref|XP_009416905.1|  PREDICTED: cellulose synthase-like protein H1      464   6e-152   
ref|XP_008229980.1|  PREDICTED: cellulose synthase-like protein B...    464   8e-152   
emb|CBI28833.3|  unnamed protein product                                484   9e-152   
ref|XP_003633282.1|  PREDICTED: cellulose synthase-like protein H1      464   1e-151   
ref|XP_010244467.1|  PREDICTED: cellulose synthase-like protein H...    462   3e-151   
ref|XP_010930912.1|  PREDICTED: cellulose synthase-like protein H...    458   2e-149   
ref|XP_004287960.1|  PREDICTED: cellulose synthase-like protein H...    457   5e-149   
ref|XP_008229981.1|  PREDICTED: cellulose synthase-like protein B...    456   1e-148   
ref|XP_010252472.1|  PREDICTED: cellulose synthase-like protein H...    456   1e-148   
ref|XP_006582368.1|  PREDICTED: cellulose synthase-like protein H...    455   3e-148   
ref|XP_006582367.1|  PREDICTED: cellulose synthase-like protein H...    452   5e-147   
ref|XP_006592369.1|  PREDICTED: uncharacterized LOC100500469 isof...    449   1e-146   
ref|XP_006592368.1|  PREDICTED: uncharacterized LOC100500469 isof...    449   5e-146   
gb|KHN21212.1|  Cellulose synthase-like protein H1                      449   5e-146   
ref|XP_004287961.1|  PREDICTED: cellulose synthase-like protein H...    442   3e-143   
ref|XP_004953420.1|  PREDICTED: cellulose synthase-like protein H...    437   4e-142   
gb|KGN63228.1|  hypothetical protein Csa_2G416190                       439   4e-142   
ref|XP_004151939.1|  PREDICTED: cellulose synthase-like protein H...    439   5e-142   
gb|KHG07611.1|  Cellulose synthase-like protein H1                      429   5e-142   
ref|XP_004953419.1|  PREDICTED: cellulose synthase-like protein H...    437   6e-142   
ref|XP_004953418.1|  PREDICTED: cellulose synthase-like protein H...    438   1e-141   
ref|XP_008455914.1|  PREDICTED: cellulose synthase-like protein H...    437   2e-141   
gb|KDO39591.1|  hypothetical protein CISIN_1g006357mg                   434   3e-141   
ref|XP_008781463.1|  PREDICTED: cellulose synthase-like protein H...    436   4e-141   
ref|XP_008229982.1|  PREDICTED: cellulose synthase-like protein B...    435   5e-141   
ref|XP_006447593.1|  hypothetical protein CICLE_v10014586mg             428   6e-141   
ref|XP_004487427.1|  PREDICTED: cellulose synthase-like protein H...    435   2e-140   
ref|XP_004158578.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    432   2e-140   
ref|XP_004151940.1|  PREDICTED: cellulose synthase-like protein H...    432   6e-140   
ref|XP_006447594.1|  hypothetical protein CICLE_v10014586mg             429   2e-139   
ref|XP_007132522.1|  hypothetical protein PHAVU_011G101500g             432   2e-139   
gb|KGN63226.1|  hypothetical protein Csa_2G416170                       432   2e-139   
ref|XP_006447592.1|  hypothetical protein CICLE_v10014586mg             422   2e-139   
ref|XP_003596942.1|  Cellulose synthase-like protein H1                 431   4e-139   
ref|XP_004487428.1|  PREDICTED: cellulose synthase-like protein H...    431   5e-139   
gb|KHN18006.1|  Cellulose synthase-like protein H1                      430   7e-139   
gb|EEE50784.1|  hypothetical protein OsJ_31143                          427   7e-139   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003540275.1|  PREDICTED: cellulose synthase-like protein H...    430   1e-138   
ref|XP_003539497.1|  PREDICTED: cellulose synthase-like protein H...    430   1e-138   
gb|KHN44862.1|  Cellulose synthase-like protein H1                      430   1e-138   
ref|XP_006469656.1|  PREDICTED: cellulose synthase-like protein B...    427   4e-138   
gb|ADO34997.1|  cellulose synthase-like protein H1                      429   4e-138   
ref|XP_004487429.1|  PREDICTED: cellulose synthase-like protein H...    428   5e-138   
ref|XP_006469655.1|  PREDICTED: cellulose synthase-like protein B...    428   5e-138   
ref|XP_008455913.1|  PREDICTED: cellulose synthase-like protein H1      428   7e-138   
gb|ACN67534.1|  cellulose synthase-like protein H1                      428   9e-138   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008342031.1|  PREDICTED: cellulose synthase-like protein H...    427   1e-137   
gb|KHN44861.1|  Cellulose synthase-like protein B3                      427   2e-137   
ref|XP_003539496.1|  PREDICTED: cellulose synthase-like protein H...    427   2e-137   
ref|XP_003579750.1|  PREDICTED: cellulose synthase-like protein H1      426   7e-137   
gb|AAL38531.1|AF435646_1  CSLH1                                         425   8e-137   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001064384.1|  Os10g0341700                                       425   1e-136   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004165439.1|  PREDICTED: cellulose synthase-like protein H...    422   1e-136   
ref|XP_008669411.1|  PREDICTED: cellulose synthase-like protein H...    426   2e-136   
ref|XP_004487424.1|  PREDICTED: cellulose synthase-like protein B...    424   3e-136   
ref|XP_004151937.1|  PREDICTED: cellulose synthase-like protein H...    423   4e-136   
ref|XP_008455907.1|  PREDICTED: cellulose synthase-like protein H...    423   5e-136   
ref|XP_004487423.1|  PREDICTED: cellulose synthase-like protein B...    423   6e-136   
gb|EMT26547.1|  Cellulose synthase-like protein H1                      422   6e-136   
ref|XP_007049096.1|  Cellulose synthase-like B4, putative isoform 2     422   7e-136   
ref|XP_008455906.1|  PREDICTED: cellulose synthase-like protein H...    423   8e-136   
gb|EAY78097.1|  hypothetical protein OsI_33141                          422   1e-135   Oryza sativa Indica Group [Indian rice]
ref|XP_008669412.1|  PREDICTED: cellulose synthase-like protein H...    423   1e-135   
ref|XP_004151897.1|  PREDICTED: cellulose synthase-like protein H...    422   1e-135   
gb|KEH29713.1|  cellulose synthase H1-like protein                      422   2e-135   
ref|XP_008669410.1|  PREDICTED: cellulose synthase-like protein H...    422   3e-135   
ref|XP_008781464.1|  PREDICTED: cellulose synthase-like protein H...    421   5e-135   
ref|XP_003540273.1|  PREDICTED: cellulose synthase-like protein H...    419   2e-134   
gb|AAN01252.1|  Unknown protein similar to putative cellulose syn...    422   6e-134   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008342032.1|  PREDICTED: cellulose synthase-like protein H...    417   7e-134   
ref|XP_006653400.1|  PREDICTED: cellulose synthase-like protein H...    418   8e-134   
gb|KHN18003.1|  Cellulose synthase-like protein H1                      416   1e-133   
ref|XP_007149986.1|  hypothetical protein PHAVU_005G1163000g            409   2e-133   
ref|XP_008455910.1|  PREDICTED: cellulose synthase-like protein H...    406   4e-133   
ref|XP_004975623.1|  PREDICTED: cellulose synthase-like protein H...    415   3e-132   
ref|XP_010089468.1|  Cellulose synthase-like protein H1                 413   4e-132   
gb|KHN36521.1|  Cellulose synthase-like protein B3                      413   4e-132   
ref|XP_006594901.1|  PREDICTED: cellulose synthase-like protein H...    412   1e-131   
gb|AES67197.2|  cellulose synthase H1-like protein                      410   5e-131   
ref|XP_008342030.1|  PREDICTED: cellulose synthase-like protein H1      410   6e-131   
gb|AES67199.2|  cellulose synthase H1-like protein                      410   6e-131   
ref|XP_003596945.1|  Cellulose synthase-like protein H1                 410   1e-130   
ref|XP_003596946.1|  Cellulose synthase-like protein H1                 410   2e-130   
ref|XP_004151936.1|  PREDICTED: cellulose synthase-like protein H...    409   2e-130   
ref|XP_003596948.1|  Cellulose synthase-like protein H1                 409   3e-130   
ref|XP_007217162.1|  hypothetical protein PRUPE_ppa001889mg             408   4e-130   
ref|XP_004506255.1|  PREDICTED: cellulose synthase-like protein H...    407   5e-130   
ref|XP_003540290.1|  PREDICTED: cellulose synthase-like protein H...    407   8e-130   
gb|KGN63235.1|  hypothetical protein Csa_2G416250                       407   8e-130   
ref|XP_004506254.1|  PREDICTED: cellulose synthase-like protein H...    406   1e-129   
ref|XP_007149989.1|  hypothetical protein PHAVU_005G116500g             419   4e-129   
gb|EAZ30773.1|  hypothetical protein OsJ_14837                          402   5e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007149991.1|  hypothetical protein PHAVU_005G116700g             405   7e-129   
ref|XP_004158577.1|  PREDICTED: cellulose synthase-like protein H...    404   1e-128   
ref|XP_007149988.1|  hypothetical protein PHAVU_005G1164000g            397   1e-128   
gb|EEC77287.1|  hypothetical protein OsI_15924                          404   2e-128   Oryza sativa Indica Group [Indian rice]
ref|XP_008455453.1|  PREDICTED: cellulose synthase-like protein B4      403   2e-128   
ref|NP_001052811.2|  Os04g0429500                                       401   3e-127   Oryza sativa Japonica Group [Japonica rice]
sp|Q7PC71.1|CSLH2_ORYSI  RecName: Full=Cellulose synthase-like pr...    401   3e-127   Oryza sativa Indica Group [Indian rice]
emb|CAH66410.1|  OSIGBa0093L02.6                                        401   5e-127   Oryza sativa Indica Group [Indian rice]
ref|XP_006847115.1|  hypothetical protein AMTR_s00017p00225060          399   2e-126   
ref|XP_007149984.1|  hypothetical protein PHAVU_005G116200g             397   4e-126   
ref|XP_004975624.1|  PREDICTED: cellulose synthase-like protein H...    399   5e-126   
ref|XP_004975622.1|  PREDICTED: cellulose synthase-like protein H...    400   5e-126   
ref|XP_006653401.1|  PREDICTED: putative cellulose synthase-like ...    396   2e-125   
ref|XP_006846949.1|  hypothetical protein AMTR_s00017p00025710          393   4e-125   
gb|EEC77288.1|  hypothetical protein OsI_15925                          388   1e-124   Oryza sativa Indica Group [Indian rice]
ref|XP_008455909.1|  PREDICTED: cellulose synthase-like protein H...    379   1e-122   
ref|NP_001052812.2|  Os04g0429600                                       387   1e-121   Oryza sativa Japonica Group [Japonica rice]
gb|KDO54722.1|  hypothetical protein CISIN_1g006639mg                   375   2e-121   
gb|KGN43505.1|  hypothetical protein Csa_7G041990                       382   5e-121   
gb|KGN43506.1|  hypothetical protein Csa_7G042990                       374   9e-121   
ref|XP_004144501.1|  PREDICTED: cellulose synthase-like protein H...    382   3e-120   
ref|XP_004144597.1|  PREDICTED: cellulose synthase-like protein H...    381   6e-120   
ref|XP_004171456.1|  PREDICTED: cellulose synthase-like protein H...    380   1e-119   
gb|KDO54721.1|  hypothetical protein CISIN_1g006639mg                   374   1e-118   
gb|KDO54720.1|  hypothetical protein CISIN_1g006639mg                   374   2e-118   
ref|XP_002529324.1|  conserved hypothetical protein                     369   5e-117   Ricinus communis
ref|XP_007049093.1|  Cellulose synthase-like B3, putative isoform 2     371   7e-117   
ref|XP_002447842.1|  hypothetical protein SORBIDRAFT_06g016750          375   1e-116   Sorghum bicolor [broomcorn]
ref|XP_002447843.1|  hypothetical protein SORBIDRAFT_06g016760          368   1e-114   Sorghum bicolor [broomcorn]
ref|XP_006582369.1|  PREDICTED: cellulose synthase-like protein H...    355   1e-110   
ref|XP_010522355.1|  PREDICTED: cellulose synthase-like protein B...    356   3e-110   
ref|XP_007049095.1|  Cellulose synthase-like B4, putative isoform 1     352   5e-109   
gb|ABR17468.1|  unknown                                                 342   2e-104   Picea sitchensis
ref|XP_010413985.1|  PREDICTED: cellulose synthase-like protein B...    341   2e-104   
emb|CDM80574.1|  unnamed protein product                                336   7e-104   
ref|XP_006592807.1|  PREDICTED: cellulose synthase-like protein H...    337   2e-103   
gb|KCW46973.1|  hypothetical protein EUGRSUZ_K00781                     330   2e-103   
ref|XP_010413984.1|  PREDICTED: cellulose synthase-like protein B...    338   5e-103   
ref|XP_010556995.1|  PREDICTED: cellulose synthase-like protein B...    337   6e-103   
emb|CBI28830.3|  unnamed protein product                                325   2e-102   
ref|XP_010510001.1|  PREDICTED: cellulose synthase-like protein B3      336   2e-102   
ref|XP_006410386.1|  hypothetical protein EUTSA_v10016289mg             334   1e-101   
ref|XP_010252474.1|  PREDICTED: cellulose synthase-like protein H...    328   2e-101   
ref|XP_008342033.1|  PREDICTED: cellulose synthase-like protein H...    330   5e-101   
ref|XP_010469575.1|  PREDICTED: cellulose synthase-like protein B3      332   6e-101   
ref|XP_009107681.1|  PREDICTED: cellulose synthase-like protein B6      332   8e-101   
ref|XP_002879394.1|  hypothetical protein ARALYDRAFT_902308             331   1e-100   
ref|XP_006427966.1|  hypothetical protein CICLE_v10027629mg             319   3e-100   
ref|XP_010469576.1|  PREDICTED: cellulose synthase-like protein B3      328   3e-99    
gb|AAC25935.1|  putative cellulose synthase                             326   4e-99    Arabidopsis thaliana [mouse-ear cress]
ref|NP_850190.1|  cellulose synthase-like protein B3                    327   5e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296344.1|  hypothetical protein CARUB_v10025516mg             327   6e-99    
ref|XP_010413973.1|  PREDICTED: cellulose synthase-like protein B2      327   6e-99    
ref|XP_006293362.1|  hypothetical protein CARUB_v10022674mg             325   6e-98    
ref|NP_180813.1|  cellulose synthase-like protein B4                    323   8e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002879400.1|  hypothetical protein ARALYDRAFT_320998             323   1e-97    
ref|XP_002879395.1|  hypothetical protein ARALYDRAFT_482180             322   3e-97    
ref|XP_010451508.1|  PREDICTED: cellulose synthase-like protein B6      322   6e-97    
ref|XP_002868214.1|  hypothetical protein ARALYDRAFT_329979             321   6e-97    
sp|O23386.2|CSLB6_ARATH  RecName: Full=Cellulose synthase-like pr...    321   8e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AAQ22621.1|  At4g15290                                               318   8e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141247.1|  PREDICTED: cellulose synthase-like protein B3      320   2e-96    
gb|ABB47240.2|  Cellulose synthase family protein, expressed            315   3e-96    Oryza sativa Japonica Group [Japonica rice]
gb|ABB47241.1|  Cellulose synthase family protein, expressed            314   4e-96    Oryza sativa Japonica Group [Japonica rice]
dbj|BAE99708.1|  cellulose synthase like protein                        319   4e-96    Arabidopsis thaliana [mouse-ear cress]
ref|NP_193264.3|  cellulose synthase-like protein B5                    319   4e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007049094.1|  Cellulose synthase-like B3, putative isoform 3     313   1e-95    
ref|NP_180821.1|  cellulose synthase-like protein B2                    317   4e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009141249.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    317   4e-95    
ref|XP_006293730.1|  hypothetical protein CARUB_v10022692mg             316   7e-95    
ref|XP_007132524.1|  hypothetical protein PHAVU_011G101700g             302   2e-94    
tpg|DAA37783.1|  TPA: hypothetical protein ZEAMMB73_545753              308   2e-94    
ref|XP_006410388.1|  hypothetical protein EUTSA_v10017940mg             310   2e-94    
gb|KEH39000.1|  cellulose synthase H1-like protein                      307   3e-93    
gb|KGN63232.1|  hypothetical protein Csa_2G416220                       303   6e-93    
emb|CDY52052.1|  BnaCnng21680D                                          311   6e-93    
tpg|DAA37782.1|  TPA: hypothetical protein ZEAMMB73_545753              310   6e-92    
ref|NP_180820.2|  cellulose synthase-like protein B1                    308   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455908.1|  PREDICTED: cellulose synthase-like protein H...    303   1e-91    
ref|XP_009141248.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    306   4e-91    
emb|CBI28828.3|  unnamed protein product                                299   4e-90    
ref|XP_006285915.1|  hypothetical protein CARUB_v10007426mg             303   4e-90    
ref|XP_010930911.1|  PREDICTED: cellulose synthase-like protein H2      289   5e-90    
ref|XP_007049097.1|  Cellulose synthase-like B3, putative isoform 3     297   2e-89    
tpg|DAA37784.1|  TPA: hypothetical protein ZEAMMB73_545753              290   3e-89    
ref|XP_010657349.1|  PREDICTED: putative cellulose synthase-like ...    284   5e-88    
ref|XP_004165438.1|  PREDICTED: cellulose synthase-like protein H...    288   3e-87    
emb|CAN60146.1|  hypothetical protein VITISV_041923                     299   1e-86    Vitis vinifera
emb|CDY19146.1|  BnaA04g18860D                                          290   2e-85    
emb|CAB10308.1|  cellulose synthase like protein                        287   2e-84    Arabidopsis thaliana [mouse-ear cress]
emb|CDY34543.1|  BnaA08g04980D                                          289   6e-84    
ref|XP_004151938.1|  PREDICTED: cellulose synthase-like protein B...    281   5e-83    
gb|AAC25943.1|  putative cellulose synthase                             284   8e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010522356.1|  PREDICTED: cellulose synthase-like protein B...    276   3e-81    
gb|KEH39004.1|  cellulose synthase H1-like protein                      275   6e-81    
ref|XP_006427963.1|  hypothetical protein CICLE_v10027629mg             263   7e-80    
ref|XP_010510006.1|  PREDICTED: cellulose synthase-like protein B...    267   3e-78    
ref|XP_010510003.1|  PREDICTED: cellulose synthase-like protein B...    268   1e-77    
ref|XP_010510005.1|  PREDICTED: cellulose synthase-like protein B...    268   1e-77    
emb|CDY15319.1|  BnaC04g43040D                                          259   4e-76    
ref|NP_193267.1|  cellulose synthase-like protein B6                    267   5e-76    Arabidopsis thaliana [mouse-ear cress]
gb|KFK31116.1|  hypothetical protein AALP_AA6G070100                    262   1e-75    
gb|KFK31114.1|  hypothetical protein AALP_AA6G069800                    263   1e-74    
emb|CDY68738.1|  BnaA04g28960D                                          254   1e-74    
gb|ABR16035.1|  unknown                                                 257   6e-73    Picea sitchensis
ref|XP_010556996.1|  PREDICTED: cellulose synthase-like protein B...    253   7e-73    
gb|ACD64451.1|  cellulose synthase-like protein                         232   5e-69    Bahiopsis lanata
ref|XP_004288455.1|  PREDICTED: cellulose synthase-like protein G...    246   9e-69    
gb|ACD64419.1|  cellulose synthase-like protein                         230   3e-68    Helianthus petiolaris
gb|ACD64436.1|  cellulose synthase-like protein                         229   5e-68    Helianthus petiolaris
gb|ACD64421.1|  cellulose synthase-like protein                         229   5e-68    Helianthus petiolaris
ref|XP_006408795.1|  hypothetical protein EUTSA_v10001915mg             244   5e-68    
gb|ACD64439.1|  cellulose synthase-like protein                         229   7e-68    Helianthus petiolaris
gb|ACD64422.1|  cellulose synthase-like protein                         229   8e-68    Helianthus petiolaris
gb|ACD64426.1|  cellulose synthase-like protein                         229   9e-68    Helianthus petiolaris
gb|ACD64423.1|  cellulose synthase-like protein                         229   1e-67    Helianthus petiolaris
gb|ACD64452.1|  cellulose synthase-like protein                         228   1e-67    Bahiopsis lanata
gb|ADE21152.1|  cellulose synthase-like protein                         228   2e-67    
ref|XP_006857764.1|  hypothetical protein AMTR_s00061p00199750          237   2e-67    
gb|ACD64453.1|  cellulose synthase-like protein                         228   2e-67    Bahiopsis reticulata
gb|ACD64437.1|  cellulose synthase-like protein                         228   3e-67    Helianthus petiolaris
gb|ACD64389.1|  cellulose synthase-like protein                         228   3e-67    Helianthus annuus
ref|XP_004171879.1|  PREDICTED: cellulose synthase-like protein B...    236   4e-67    
gb|ACD64374.1|  cellulose synthase-like protein                         227   4e-67    Helianthus annuus
ref|XP_004288456.1|  PREDICTED: cellulose synthase-like protein G...    241   4e-67    
gb|ACD64440.1|  cellulose synthase-like protein                         227   5e-67    Helianthus petiolaris
gb|ACD64420.1|  cellulose synthase-like protein                         227   5e-67    Helianthus petiolaris
gb|ACD64400.1|  cellulose synthase-like protein                         227   7e-67    Helianthus annuus
gb|ACD64449.1|  cellulose synthase-like protein                         226   8e-67    Helianthus petiolaris
gb|ACD64381.1|  cellulose synthase-like protein                         226   9e-67    Helianthus annuus
gb|ACD64450.1|  cellulose synthase-like protein                         225   2e-66    Helianthus petiolaris
gb|ACD64403.1|  cellulose synthase-like protein                         225   2e-66    Helianthus annuus
gb|ACD64414.1|  cellulose synthase-like protein                         225   3e-66    Helianthus annuus
gb|ACD64401.1|  cellulose synthase-like protein                         225   3e-66    Helianthus annuus
gb|ACD64412.1|  cellulose synthase-like protein                         225   4e-66    Helianthus annuus
gb|ACD64434.1|  cellulose synthase-like protein                         224   4e-66    Helianthus petiolaris
gb|ACD64390.1|  cellulose synthase-like protein                         224   4e-66    Helianthus annuus
gb|KDO59155.1|  hypothetical protein CISIN_1g009753mg                   231   6e-66    
gb|ACD64399.1|  cellulose synthase-like protein                         224   7e-66    Helianthus annuus
gb|ACD64427.1|  cellulose synthase-like protein                         224   8e-66    Helianthus petiolaris
gb|ACD64396.1|  cellulose synthase-like protein                         224   8e-66    Helianthus annuus
ref|XP_006594902.1|  PREDICTED: cellulose synthase-like protein H...    234   9e-66    
gb|ACD64378.1|  cellulose synthase-like protein                         224   9e-66    Helianthus annuus
gb|ACD64431.1|  cellulose synthase-like protein                         224   1e-65    Helianthus petiolaris
gb|ADE21153.1|  cellulose synthase-like protein                         223   1e-65    
gb|ACD64428.1|  cellulose synthase-like protein                         223   1e-65    Helianthus petiolaris
gb|ACD64432.1|  cellulose synthase-like protein                         223   2e-65    Helianthus petiolaris
gb|KDO59154.1|  hypothetical protein CISIN_1g009753mg                   231   3e-65    
ref|XP_004173590.1|  PREDICTED: cellulose synthase-like protein H...    225   3e-65    
gb|ACD64446.1|  cellulose synthase-like protein                         222   4e-65    
gb|ACD64377.1|  cellulose synthase-like protein                         222   4e-65    
gb|ACD64386.1|  cellulose synthase-like protein                         221   9e-65    
gb|ACD64411.1|  cellulose synthase-like protein                         221   1e-64    
ref|XP_006452623.1|  hypothetical protein CICLE_v10007586mg             228   5e-64    
gb|EYU35355.1|  hypothetical protein MIMGU_mgv1a000638mg                234   7e-64    
dbj|BAJ85551.1|  predicted protein                                      231   1e-63    
ref|XP_010265522.1|  PREDICTED: cellulose synthase A catalytic su...    234   1e-63    
gb|EMS61952.1|  Cellulose synthase-like protein E6                      230   2e-63    
ref|XP_010091161.1|  OsCesA7 protein                                    233   2e-63    
gb|ACD64430.1|  cellulose synthase-like protein                         218   2e-63    
gb|ACD64383.1|  cellulose synthase-like protein                         218   2e-63    
gb|ACD64429.1|  cellulose synthase-like protein                         218   2e-63    
gb|EMT18146.1|  Cellulose synthase-like protein E6                      228   3e-63    
ref|XP_006474852.1|  PREDICTED: cellulose synthase-like protein E...    229   5e-63    
ref|XP_006474851.1|  PREDICTED: cellulose synthase-like protein E...    229   6e-63    
gb|EMT33244.1|  Cellulose synthase-like protein E6                      228   9e-63    
gb|ACD64373.1|  cellulose synthase-like protein                         215   2e-62    
ref|XP_006452624.1|  hypothetical protein CICLE_v10007586mg             228   2e-62    
gb|KFK35563.1|  hypothetical protein AALP_AA4G007100                    227   3e-62    
gb|AHX74221.1|  cellulose synthase                                      228   4e-62    
ref|XP_008337189.1|  PREDICTED: cellulose synthase A catalytic su...    228   4e-62    
ref|XP_008794369.1|  PREDICTED: cellulose synthase A catalytic su...    229   4e-62    
ref|XP_010929171.1|  PREDICTED: cellulose synthase A catalytic su...    229   5e-62    
gb|EMT13900.1|  Cellulose synthase-like protein E6                      227   9e-62    
ref|XP_004287144.1|  PREDICTED: cellulose synthase A catalytic su...    228   1e-61    
ref|XP_004498142.1|  PREDICTED: cellulose synthase-like protein E...    226   1e-61    
ref|XP_002522779.1|  cellulose synthase, putative                       226   1e-61    
ref|XP_002960761.1|  cellulose synthase 4-1                             228   2e-61    
ref|XP_002960719.1|  hypothetical protein SELMODRAFT_73698              228   2e-61    
gb|AFR58756.2|  cellulose synthase 3                                    228   2e-61    
gb|AAX18647.1|  cellulose synthase catalytic subunit                    227   2e-61    
ref|XP_009617948.1|  PREDICTED: cellulose synthase-like protein G2      225   2e-61    
ref|XP_008344149.1|  PREDICTED: cellulose synthase-like protein E1      221   3e-61    
gb|KGN53429.1|  hypothetical protein Csa_4G053280                       221   3e-61    
ref|XP_009761629.1|  PREDICTED: cellulose synthase-like protein G2      224   3e-61    
ref|NP_001289644.1|  cellulose synthase A catalytic subunit 7           227   3e-61    
tpg|DAA39507.1|  TPA: hypothetical protein ZEAMMB73_844715              222   3e-61    
gb|KFK31113.1|  hypothetical protein AALP_AA6G069700                    221   4e-61    
gb|AGE09566.1|  cellulose synthase-like protein                         227   4e-61    
ref|XP_006857766.1|  hypothetical protein AMTR_s00061p00200560          224   4e-61    
gb|AFB18636.1|  CESA7                                                   226   5e-61    
ref|XP_003576648.2|  PREDICTED: cellulose synthase-like protein E6      223   5e-61    
gb|AEK31217.1|  cellulose synthase A                                    226   5e-61    
ref|XP_010687624.1|  PREDICTED: cellulose synthase A catalytic su...    226   6e-61    
ref|XP_011016137.1|  PREDICTED: cellulose synthase-like protein H1      218   8e-61    
ref|XP_009386450.1|  PREDICTED: probable cellulose synthase A cat...    226   8e-61    
ref|XP_009622822.1|  PREDICTED: cellulose synthase A catalytic su...    226   9e-61    
ref|XP_006489546.1|  PREDICTED: cellulose synthase A catalytic su...    223   9e-61    
ref|XP_010089466.1|  Cellulose synthase-like protein H1                 221   9e-61    
ref|XP_006489545.1|  PREDICTED: cellulose synthase A catalytic su...    223   9e-61    
ref|XP_009777624.1|  PREDICTED: cellulose synthase A catalytic su...    226   1e-60    
ref|XP_002983910.1|  family 2 glycosyltransferase                       226   1e-60    
ref|XP_009407595.1|  PREDICTED: probable cellulose synthase A cat...    226   1e-60    
ref|XP_009407580.1|  PREDICTED: probable cellulose synthase A cat...    226   1e-60    
ref|XP_009419218.1|  PREDICTED: cellulose synthase-like protein E6      223   1e-60    
ref|XP_007154868.1|  hypothetical protein PHAVU_003G154600g             225   1e-60    
ref|XP_010906116.1|  PREDICTED: probable cellulose synthase A cat...    225   2e-60    
gb|KHG19749.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    225   2e-60    
ref|XP_009796259.1|  PREDICTED: cellulose synthase-like protein E6      223   2e-60    
ref|XP_010087673.1|  Cellulose synthase-like protein E6                 221   3e-60    
ref|XP_007013859.1|  Cellulose synthase family protein isoform 1        224   3e-60    
ref|XP_002529320.1|  cellulose synthase, putative                       221   4e-60    
gb|KDO41735.1|  hypothetical protein CISIN_1g0045622mg                  218   4e-60    
ref|XP_003578137.1|  PREDICTED: cellulose synthase A catalytic su...    224   4e-60    
ref|XP_007035030.1|  Cellulose synthase, putative isoform 3             221   4e-60    
ref|XP_004149009.1|  PREDICTED: cellulose synthase-like protein G...    221   5e-60    
ref|XP_004165319.1|  PREDICTED: cellulose synthase-like protein G...    221   5e-60    
ref|XP_002983952.1|  family 2 glycosyltransferase                       224   5e-60    
gb|KDO41734.1|  hypothetical protein CISIN_1g0045622mg                  218   6e-60    
gb|KDP39303.1|  hypothetical protein JCGZ_01060                         221   6e-60    
ref|XP_003576649.1|  PREDICTED: cellulose synthase-like protein E6      221   7e-60    
gb|EMT33243.1|  Cellulose synthase-like protein E6                      221   7e-60    
ref|XP_004234035.1|  PREDICTED: cellulose synthase-like protein G2      221   8e-60    
gb|KDO41737.1|  hypothetical protein CISIN_1g0045621mg                  221   9e-60    
ref|XP_010228019.1|  PREDICTED: probable cellulose synthase A cat...    222   1e-59    
ref|XP_002460229.1|  hypothetical protein SORBIDRAFT_02g025020          223   1e-59    
gb|EPS65651.1|  hypothetical protein M569_09122                         223   1e-59    
ref|XP_008651867.1|  PREDICTED: cellulose synthase-4 isoform X1         221   1e-59    
emb|CBI34513.3|  unnamed protein product                                218   1e-59    
gb|KEH19939.1|  cellulose synthase-like protein                         221   1e-59    
ref|XP_004956855.1|  PREDICTED: cellulose synthase A catalytic su...    223   1e-59    
ref|XP_004495306.1|  PREDICTED: cellulose synthase-like protein E...    220   1e-59    
ref|XP_007035028.1|  Cellulose synthase like G2, putative isoform 1     220   1e-59    
ref|XP_004957117.1|  PREDICTED: cellulose synthase-like protein E...    220   1e-59    
ref|XP_008670200.1|  PREDICTED: cellulose synthase A catalytic su...    223   1e-59    
ref|XP_004957121.1|  PREDICTED: cellulose synthase-like protein E...    220   1e-59    
ref|XP_004957118.1|  PREDICTED: cellulose synthase-like protein E...    219   2e-59    
ref|XP_008391262.1|  PREDICTED: cellulose synthase-like protein E1      220   2e-59    
gb|KHN17507.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    222   2e-59    
ref|XP_003549532.1|  PREDICTED: cellulose synthase A catalytic su...    222   2e-59    
ref|XP_006600535.1|  PREDICTED: cellulose synthase A catalytic su...    222   2e-59    
gb|KHN14136.1|  Cellulose synthase A catalytic subunit 7 [UDP-for...    222   2e-59    
ref|XP_003519160.1|  PREDICTED: cellulose synthase A catalytic su...    221   2e-59    
ref|NP_001104955.1|  cellulose synthase5                                222   2e-59    
tpg|DAA61529.1|  TPA: putative cellulose synthase family protein        222   2e-59    
ref|NP_001105532.1|  cellulose synthase catalytic subunit 12            222   3e-59    
tpg|DAA52080.1|  TPA: cellulose synthase5                               222   3e-59    
ref|XP_008239160.1|  PREDICTED: cellulose synthase-like protein G3      219   3e-59    
ref|XP_009624029.1|  PREDICTED: cellulose synthase-like protein E6      219   3e-59    
ref|XP_010650022.1|  PREDICTED: cellulose synthase-like protein G2      219   3e-59    
gb|AAZ32787.1|  cellulose synthase-like protein CslE                    219   3e-59    
ref|XP_010313950.1|  PREDICTED: cellulose synthase-like protein E...    217   4e-59    
ref|XP_002867245.1|  hypothetical protein ARALYDRAFT_491486             221   4e-59    
gb|KDO41739.1|  hypothetical protein CISIN_1g0045621mg                  215   4e-59    
ref|XP_010433826.1|  PREDICTED: cellulose synthase-like protein G2      219   4e-59    
gb|AET04269.2|  cellulose synthase-like protein                         220   5e-59    
gb|AAR29963.1|  putative cellulose synthase catalytic subunit           221   5e-59    
ref|XP_008790520.1|  PREDICTED: probable cellulose synthase A cat...    221   5e-59    
ref|XP_010228016.1|  PREDICTED: probable cellulose synthase A cat...    221   5e-59    
ref|XP_004296325.1|  PREDICTED: cellulose synthase-like protein E...    219   5e-59    
ref|XP_010228012.1|  PREDICTED: probable cellulose synthase A cat...    221   7e-59    
ref|XP_008224397.1|  PREDICTED: cellulose synthase-like protein G2      218   7e-59    
dbj|BAF93202.1|  cellulose synthase catalytic subunit                   220   8e-59    
ref|XP_003628669.1|  Cellulose synthase                                 219   8e-59    
emb|CDX68844.1|  BnaC01g06090D                                          220   9e-59    
ref|XP_006660635.1|  PREDICTED: cellulose synthase A catalytic su...    220   1e-58    
ref|XP_008668614.1|  PREDICTED: cellulose synthase-9 isoform X1         220   1e-58    
sp|Q651X6.1|CSLE6_ORYSJ  RecName: Full=Cellulose synthase-like pr...    218   1e-58    
ref|XP_002265085.3|  PREDICTED: cellulose synthase-like protein G3      218   1e-58    
ref|XP_010313949.1|  PREDICTED: cellulose synthase-like protein E...    218   1e-58    
ref|XP_006412477.1|  hypothetical protein EUTSA_v10024278mg             220   1e-58    
ref|XP_006489550.1|  PREDICTED: cellulose synthase-like protein E...    218   1e-58    
ref|XP_006489547.1|  PREDICTED: cellulose synthase A catalytic su...    217   1e-58    
ref|XP_003631403.2|  PREDICTED: cellulose synthase-like protein G3      214   1e-58    
ref|XP_006489549.1|  PREDICTED: cellulose synthase-like protein E...    217   2e-58    
gb|ACC59196.1|  cellulose synthase                                      219   2e-58    
gb|ACJ38665.1|  cellulose synthase                                      219   2e-58    
emb|CAN71761.1|  hypothetical protein VITISV_000324                     217   2e-58    
gb|KDO41731.1|  hypothetical protein CISIN_1g0045622mg                  217   2e-58    
gb|KDO41733.1|  hypothetical protein CISIN_1g0045622mg                  217   2e-58    
gb|EMS61953.1|  Cellulose synthase-like protein E6                      217   2e-58    
ref|XP_010448628.1|  PREDICTED: cellulose synthase-like protein G2      217   2e-58    
ref|XP_004296326.1|  PREDICTED: cellulose synthase-like protein E...    216   2e-58    
gb|EAZ09494.1|  hypothetical protein OsI_31767                          216   3e-58    
dbj|BAJ96780.1|  predicted protein                                      219   3e-58    
ref|XP_006344955.1|  PREDICTED: cellulose synthase-like protein E...    217   3e-58    
ref|XP_002967423.1|  hypothetical protein SELMODRAFT_86720              219   3e-58    
ref|XP_003635361.2|  PREDICTED: cellulose synthase-like protein E6      216   3e-58    
ref|XP_003522926.1|  PREDICTED: cellulose synthase A catalytic su...    218   3e-58    
ref|XP_007159799.1|  hypothetical protein PHAVU_002G268200g             219   4e-58    
ref|XP_009126053.1|  PREDICTED: cellulose synthase A catalytic su...    219   4e-58    
ref|XP_003527198.1|  PREDICTED: cellulose synthase A catalytic su...    218   4e-58    
ref|XP_006420147.1|  hypothetical protein CICLE_v10004394mg             216   4e-58    
dbj|BAJ85785.1|  predicted protein                                      213   5e-58    
ref|XP_004502891.1|  PREDICTED: cellulose synthase A catalytic su...    218   5e-58    
ref|NP_194967.1|  cellulose synthase A catalytic subunit 1 [UDP-f...    218   5e-58    
emb|CDX75242.1|  BnaA01g04600D                                          218   5e-58    
ref|XP_004507755.1|  PREDICTED: cellulose synthase A catalytic su...    218   6e-58    
ref|XP_010670651.1|  PREDICTED: cellulose synthase A catalytic su...    218   6e-58    
ref|XP_010689561.1|  PREDICTED: cellulose synthase A catalytic su...    218   6e-58    
ref|XP_002960291.1|  family 2 glycosyltransferase                       218   6e-58    
ref|XP_002274290.2|  PREDICTED: cellulose synthase-like protein E6      216   6e-58    
gb|KFK35562.1|  hypothetical protein AALP_AA4G007000                    215   7e-58    
ref|XP_003629793.1|  Cellulose synthase                                 219   7e-58    
ref|XP_010432725.1|  PREDICTED: cellulose synthase A catalytic su...    218   8e-58    
ref|XP_010676068.1|  PREDICTED: uncharacterized protein LOC104891977    219   8e-58    
ref|XP_011002349.1|  PREDICTED: cellulose synthase-like protein E6      215   9e-58    
ref|XP_008451920.1|  PREDICTED: cellulose synthase-like protein G...    215   1e-57    
ref|XP_006285557.1|  hypothetical protein CARUB_v10006999mg             217   1e-57    
gb|KDO41736.1|  hypothetical protein CISIN_1g0045621mg                  215   1e-57    
gb|KHN11156.1|  Cellulose synthase-like protein E1                      214   1e-57    
ref|XP_007209078.1|  hypothetical protein PRUPE_ppa001971mg             215   1e-57    
ref|XP_007138395.1|  hypothetical protein PHAVU_009G205100g             217   1e-57    
ref|XP_002463687.1|  hypothetical protein SORBIDRAFT_01g004210          217   1e-57    
gb|KDO41738.1|  hypothetical protein CISIN_1g0045621mg                  214   1e-57    
ref|XP_010672126.1|  PREDICTED: cellulose synthase-like protein E6      215   1e-57    
ref|XP_007211294.1|  hypothetical protein PRUPE_ppa001978mg             214   2e-57    
ref|XP_006489544.1|  PREDICTED: cellulose synthase-like protein G...    214   2e-57    
ref|XP_010646988.1|  PREDICTED: cellulose synthase-like protein E6      214   2e-57    
ref|XP_003635328.1|  PREDICTED: cellulose synthase-like protein E6      214   2e-57    
ref|XP_010445007.1|  PREDICTED: cellulose synthase A catalytic su...    218   2e-57    
ref|XP_008239158.1|  PREDICTED: cellulose synthase-like protein G3      214   2e-57    
gb|KEH42689.1|  cellulose synthase-like protein D3                      214   2e-57    
emb|CDY65414.1|  BnaCnng46970D                                          215   2e-57    
gb|EMT00418.1|  Putative cellulose synthase A catalytic subunit 2...    217   2e-57    
gb|AHL38838.1|  glycosyltransferase                                     216   2e-57    
gb|KCW75080.1|  hypothetical protein EUGRSUZ_E038461                    209   2e-57    
ref|XP_004149011.1|  PREDICTED: cellulose synthase-like protein G...    214   2e-57    
ref|XP_002264764.1|  PREDICTED: cellulose synthase-like protein G3      214   2e-57    
ref|NP_180124.1|  cellulose synthase 10                                 216   3e-57    
ref|XP_004253345.2|  PREDICTED: cellulose synthase-like protein G1      209   3e-57    
ref|XP_003532180.1|  PREDICTED: cellulose synthase-like protein E...    214   3e-57    
ref|XP_008378760.1|  PREDICTED: cellulose synthase-like protein G2      210   3e-57    
ref|XP_003610282.1|  Cellulose synthase catalytic subunit               216   3e-57    
gb|KEH32618.1|  cellulose synthase-like protein                         216   4e-57    
ref|XP_009345033.1|  PREDICTED: cellulose synthase-like protein G2      213   4e-57    
ref|XP_002880684.1|  CESA10                                             215   5e-57    
dbj|BAJ98234.1|  predicted protein                                      212   5e-57    
ref|XP_008777728.1|  PREDICTED: cellulose synthase-like protein G...    213   5e-57    
ref|XP_010447394.1|  PREDICTED: cellulose synthase A catalytic su...    215   5e-57    
ref|XP_008777721.1|  PREDICTED: cellulose synthase-like protein G...    213   6e-57    
emb|CBI34520.3|  unnamed protein product                                213   6e-57    
ref|XP_004505391.1|  PREDICTED: cellulose synthase-like protein G...    213   6e-57    
ref|XP_010659563.1|  PREDICTED: cellulose synthase-like protein G3      213   6e-57    
gb|KDP39304.1|  hypothetical protein JCGZ_01061                         213   6e-57    
gb|KGN63230.1|  hypothetical protein Csa_2G416200                       201   6e-57    
ref|XP_010057782.1|  PREDICTED: cellulose synthase-like protein E1      209   7e-57    
ref|XP_008342116.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    202   8e-57    
ref|XP_002462534.1|  hypothetical protein SORBIDRAFT_02g027570          212   8e-57    
ref|XP_006344956.1|  PREDICTED: cellulose synthase-like protein E...    213   9e-57    
ref|XP_010429548.1|  PREDICTED: LOW QUALITY PROTEIN: probable cel...    214   9e-57    
ref|XP_008392524.1|  PREDICTED: LOW QUALITY PROTEIN: cellulose sy...    212   9e-57    
ref|XP_008777723.1|  PREDICTED: cellulose synthase-like protein G...    212   9e-57    
ref|XP_004965873.1|  PREDICTED: probable cellulose synthase A cat...    214   1e-56    
ref|XP_007156492.1|  hypothetical protein PHAVU_003G290600g             212   1e-56    
gb|ACS88359.1|  cellulose synthase catalytic subunit                    211   1e-56    
ref|XP_007208168.1|  hypothetical protein PRUPE_ppa001941mg             212   1e-56    
ref|XP_002307850.1|  hypothetical protein POPTR_0006s00620g             212   1e-56    
ref|XP_002440694.1|  hypothetical protein SORBIDRAFT_09g005280          214   1e-56    
gb|ACN32031.1|  unknown                                                 212   1e-56    
ref|XP_004960820.1|  PREDICTED: probable cellulose synthase A cat...    214   1e-56    
ref|XP_006413487.1|  hypothetical protein EUTSA_v10024521mg             212   1e-56    
gb|KCW75079.1|  hypothetical protein EUGRSUZ_E038461                    209   1e-56    
ref|XP_008226731.1|  PREDICTED: cellulose synthase-like protein G2      212   1e-56    
ref|XP_006586145.1|  PREDICTED: cellulose synthase-like protein E...    212   1e-56    
ref|XP_004960821.1|  PREDICTED: probable cellulose synthase A cat...    214   1e-56    
ref|NP_001104954.1|  cellulose synthase-1                               214   1e-56    
gb|AFW81388.1|  cellulose synthase1                                     214   2e-56    
gb|ACQ99194.1|  cellulose synthase                                      214   2e-56    
gb|AFW81389.1|  cellulose synthase1                                     214   2e-56    



>ref|XP_009781147.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Nicotiana 
sylvestris]
Length=749

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/467 (60%), Positives = 344/467 (74%), Gaps = 8/467 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD   N+P+VV HAMC+ LG KDEKD  FVQFPQ FY GLKDDPY
Sbjct  282   VSGLMTNAPFMLNVDCDMFANNPQVVQHAMCYFLGAKDEKDCGFVQFPQYFYDGLKDDPY  341

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ K++ +Y  RG AGIQGPFY GTGCFHRRK+IYG+ P+   N  +  D+   +T+GK
Sbjct  342   GNQFKLLHEYFGRGIAGIQGPFYQGTGCFHRRKIIYGLSPNDKINTGELRDEYLQKTYGK  401

Query  362   SKTFALSTTQILS-GSLYPE---IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             S+    S  Q LS GS   E        +++E A+++ SC YEFGTAWGQK+G LYGSA 
Sbjct  402   SQKLLASVAQTLSAGSNIIEQLNSDSLSSTIEEAQQIGSCGYEFGTAWGQKLGWLYGSAT  461

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG+SIHG+GW+S YC P+PP FLG +P+GGPA + QQKRW T   +I+   KSPII
Sbjct  462   EDIHTGLSIHGRGWRSAYCTPDPPAFLGCAPSGGPAIMIQQKRWATGLFEIIFFSKSPII  521

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               LFG+L  RQC+AYL+I  W +R  FE+CY++LPAYC+I NS+F PK NE ++ IPASI
Sbjct  522   GTLFGKLQLRQCMAYLYIQLWALRSIFEVCYAILPAYCLITNSNFLPKANEPSMTIPASI  581

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             FIIYNLYGL EY+   ES++AW NNQRM RV A  +WLFG LS   K+ G+SE  FEVTK
Sbjct  582   FIIYNLYGLSEYVRANESIKAWLNNQRMWRVNAMTAWLFGILSATTKLLGISETAFEVTK  641

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNK--SWSLG  1243
             KD  +D   D  ++S  GRFTFD+SP+FVPGT ILL+NL++LFIG LDFKQ +   W LG
Sbjct  642   KDQGNDG--DDTNNSNSGRFTFDDSPIFVPGTAILLLNLSSLFIGILDFKQGRDFEWGLG  699

Query  1244  EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
             E IC +WV+ ++W FLKGLF KGK+GIP +T+LKSG LALL  H  K
Sbjct  700   EVICIMWVLFIFWPFLKGLFAKGKYGIPATTILKSGALALLLVHLFK  746



>ref|XP_009588345.1| PREDICTED: cellulose synthase-like protein H1 [Nicotiana tomentosiformis]
Length=751

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/467 (59%), Positives = 343/467 (73%), Gaps = 8/467 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD + N+P+VV HAMC+ LG KDEKD  FVQFPQ FY GLKDDPY
Sbjct  282   VSGLMTNAPFMLNVDCDMYANNPQVVQHAMCYFLGAKDEKDCGFVQFPQYFYDGLKDDPY  341

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ+K++ +YL RG AGIQGPFY GTGCFHRRK+IYG+ P+   N  +  D+   +T+GK
Sbjct  342   GNQLKVLHEYLGRGFAGIQGPFYQGTGCFHRRKIIYGLSPNEKINTGELRDEYLQKTYGK  401

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSL----EAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             S+    S  Q LS        +  +SL    E A+++ SC YEFGTAWGQK+G LYG A 
Sbjct  402   SQKLLASVAQTLSAGSNNIEQVNSDSLSSFIEEAQQIGSCGYEFGTAWGQKLGWLYGCAT  461

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG+ I GKGW+S YC P+PP FLG++P+GGPA++TQQKRW     +IL   KSPII
Sbjct  462   EDVLTGLLIQGKGWRSAYCAPDPPAFLGTAPSGGPASMTQQKRWANGLFEILFFSKSPII  521

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               LFG+L  RQC+AYL+I  W +R  FE+CY++LP YC+I NS F PK NE ++VIPASI
Sbjct  522   GTLFGKLQLRQCMAYLYIQLWALRSIFEVCYAILPPYCLITNSSFLPKANEPSMVIPASI  581

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             FIIYNLYGL EY+   E ++AW NNQRM RV A  +WLFG L    K+ G+SE  FEVTK
Sbjct  582   FIIYNLYGLSEYVRANEPIKAWLNNQRMWRVNAMTAWLFGILGATTKLLGISETAFEVTK  641

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNK--SWSLG  1243
             KD  +D   D  ++S +GRFTFD+SP+FVPGT ILL+NL++LFIG LDFKQ K   W LG
Sbjct  642   KDQGNDG--DDTNNSNIGRFTFDDSPIFVPGTAILLLNLSSLFIGMLDFKQGKDCEWGLG  699

Query  1244  EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
             E IC +WV+ ++W+FLKGLF KGK+GIP +T+LKSG LALL  H  K
Sbjct  700   EVICIMWVLFIFWSFLKGLFAKGKYGIPATTILKSGALALLLVHLFK  746



>ref|XP_006364167.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Solanum tuberosum]
Length=700

 Score =   513 bits (1320),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 260/454 (57%), Positives = 326/454 (72%), Gaps = 17/454 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD + N+P+VVLHAMC+ LG KDE D  FVQFPQ FY GLK+DPY
Sbjct  238   VSGVMTNAPFMLNVDCDMYANNPQVVLHAMCYFLGAKDEIDCGFVQFPQFFYDGLKEDPY  297

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ+K++ +Y  RG +GIQGPFY G+GCFHRRKVIYG  P+      +  D+   +T+G 
Sbjct  298   GNQLKVLHEYFGRGISGIQGPFYQGSGCFHRRKVIYGSSPYEKITAGELKDEYIQKTYGM  357

Query  362   SKTFALSTTQ-ILSGS-----LYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
             S+  + S  + +L GS        + P   +S+E A +V SC +EFGTAWGQK+G LYGS
Sbjct  358   SEKLSTSIAKTLLEGSNIIEQFNSDSP--SSSIEIAHQVGSCGFEFGTAWGQKLGWLYGS  415

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG+ I  +GWKS YC P+PP FLG +P  GPA++ QQKRW T   ++L+  KSP
Sbjct  416   VAEDILTGLFIQSRGWKSAYCLPDPPAFLGCAPAAGPASMIQQKRWATGLFEVLLNSKSP  475

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             II  LFG+L  RQC+AYL I  W +R  FE+CY++LPAYC+I NSHF P+ NE +IVIPA
Sbjct  476   IIGTLFGKLQLRQCMAYLQIQLWGLRSIFEVCYAILPAYCLITNSHFLPQANELSIVIPA  535

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             SIFIIYNLY L EYI   E + AW NNQRM RV A  +WLFG LS   K+ G SE  FE+
Sbjct  536   SIFIIYNLYVLSEYIRANEPIIAWMNNQRMWRVNAMSAWLFGILSATTKLLGFSETAFEI  595

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ--NKSWS  1237
             TKKD +       D +S +GRFTFD+SP+FVPGT +LL+NL+ALFIG LDFK+  N  W 
Sbjct  596   TKKDQN-------DTNSDIGRFTFDDSPIFVPGTAVLLLNLSALFIGVLDFKKGNNIEWG  648

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTV  1339
             LGE IC +W++ ++WAFLKGLF KGK+GIP S++
Sbjct  649   LGEVICIMWIVFVFWAFLKGLFAKGKYGIPTSSI  682



>ref|XP_006364166.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Solanum tuberosum]
Length=739

 Score =   513 bits (1320),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 260/454 (57%), Positives = 326/454 (72%), Gaps = 17/454 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD + N+P+VVLHAMC+ LG KDE D  FVQFPQ FY GLK+DPY
Sbjct  277   VSGVMTNAPFMLNVDCDMYANNPQVVLHAMCYFLGAKDEIDCGFVQFPQFFYDGLKEDPY  336

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ+K++ +Y  RG +GIQGPFY G+GCFHRRKVIYG  P+      +  D+   +T+G 
Sbjct  337   GNQLKVLHEYFGRGISGIQGPFYQGSGCFHRRKVIYGSSPYEKITAGELKDEYIQKTYGM  396

Query  362   SKTFALSTTQ-ILSGS-----LYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
             S+  + S  + +L GS        + P   +S+E A +V SC +EFGTAWGQK+G LYGS
Sbjct  397   SEKLSTSIAKTLLEGSNIIEQFNSDSP--SSSIEIAHQVGSCGFEFGTAWGQKLGWLYGS  454

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG+ I  +GWKS YC P+PP FLG +P  GPA++ QQKRW T   ++L+  KSP
Sbjct  455   VAEDILTGLFIQSRGWKSAYCLPDPPAFLGCAPAAGPASMIQQKRWATGLFEVLLNSKSP  514

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             II  LFG+L  RQC+AYL I  W +R  FE+CY++LPAYC+I NSHF P+ NE +IVIPA
Sbjct  515   IIGTLFGKLQLRQCMAYLQIQLWGLRSIFEVCYAILPAYCLITNSHFLPQANELSIVIPA  574

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             SIFIIYNLY L EYI   E + AW NNQRM RV A  +WLFG LS   K+ G SE  FE+
Sbjct  575   SIFIIYNLYVLSEYIRANEPIIAWMNNQRMWRVNAMSAWLFGILSATTKLLGFSETAFEI  634

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ--NKSWS  1237
             TKKD +       D +S +GRFTFD+SP+FVPGT +LL+NL+ALFIG LDFK+  N  W 
Sbjct  635   TKKDQN-------DTNSDIGRFTFDDSPIFVPGTAVLLLNLSALFIGVLDFKKGNNIEWG  687

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTV  1339
             LGE IC +W++ ++WAFLKGLF KGK+GIP S++
Sbjct  688   LGEVICIMWIVFVFWAFLKGLFAKGKYGIPTSSI  721



>emb|CDP19391.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   509 bits (1311),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 264/469 (56%), Positives = 329/469 (70%), Gaps = 13/469 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD   N+P+VVLHAMC LLGVKDE D  FVQFPQ FY GLKDDP+
Sbjct  278   VSGVMTNAPFMLNVDCDMFANNPQVVLHAMCLLLGVKDETDCGFVQFPQQFYDGLKDDPF  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQM +++KYL RG AG QGP Y GTGCFHRRKVIYG  P   ++       +  E FGK
Sbjct  338   GNQMVVMIKYLGRGLAGHQGPLYGGTGCFHRRKVIYGSSP---EDKSGHGKMNTGEAFGK  394

Query  362   SKTFALSTTQILSGS-LYPEIP-IFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGED  535
             S  F     Q LS S    E P     S++ A +VASC YE+GTAWG+++G +YGS  ED
Sbjct  395   STKFNKFVAQALSSSSRTAECPESISKSIDEACQVASCGYEYGTAWGKEIGWIYGSTTED  454

Query  536   TKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWA  715
               TG++IH +GW++++   NP GFLGS+P+ GP  L QQKRW T  L++L   KSP    
Sbjct  455   VLTGLNIHWRGWRTMWLRTNPNGFLGSAPSCGPNTLIQQKRWSTGLLEVLFAPKSPFFGT  514

Query  716   LFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFI  895
             LFG+L FRQCL YL+ + W  R  FEICY+ LPA CI  N++F PK+NE AI+IP SIF+
Sbjct  515   LFGKLEFRQCLNYLFFLLWGPRSIFEICYAALPACCIFTNTNFLPKVNEPAILIPISIFV  574

Query  896   IYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKD  1075
             ++N Y + EYI+T +S+++WWNN RM R+ A  +WL GFLS + K+  LS  VFEVTKK+
Sbjct  575   VFNTYCVSEYIQTNQSIKSWWNNHRMARIIAMTAWLCGFLSAIFKILRLSVTVFEVTKKE  634

Query  1076  HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNK-----SWSL  1240
              SS      + + K+GRFTFD SP+FVPGTTIL+VNL AL IGFLDF Q        W +
Sbjct  635   QSSS---TDESEEKLGRFTFDNSPVFVPGTTILMVNLTALGIGFLDFMQGNGGKIIEWGI  691

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             GE +CS+WV+L +W+FLKGL GKGK+GIP STV KS  LA +F   C+S
Sbjct  692   GELVCSIWVVLCFWSFLKGLLGKGKYGIPSSTVCKSAALAFVFVQICRS  740



>ref|XP_004243487.1| PREDICTED: cellulose synthase-like protein H1 [Solanum lycopersicum]
Length=743

 Score =   508 bits (1308),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 258/452 (57%), Positives = 322/452 (71%), Gaps = 13/452 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD + N+P+V+LHAMC+ LG KDE D  FVQFPQ FY GLK+DPY
Sbjct  281   VSGVMTNAPFMLNVDCDMYANNPQVILHAMCYFLGAKDEIDCGFVQFPQFFYDGLKEDPY  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ+K++ +Y  RG  GIQGPFY G+GCFHRRKVIYG+ PH         D+   +T+GK
Sbjct  341   GNQLKVLHEYFGRGIGGIQGPFYQGSGCFHRRKVIYGLSPHEKITAGGLKDEYIKKTYGK  400

Query  362   SKTFALSTTQ-ILSGSLYPEI--PIFPNS-LEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             S+  + S  + +L GS   E      P+S ++ A +V SC +E+GTAWGQK+G LYGS  
Sbjct  401   SEKLSTSIAKTLLEGSHIIEQFNSDSPSSFIDIAHQVGSCGFEYGTAWGQKLGWLYGSVT  460

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG+ I  +GWKS YC P+P  FLG +PT GPA + QQKRW T   ++L   KSPII
Sbjct  461   EDVLTGLFIQSRGWKSAYCLPDPAAFLGCAPTAGPATMIQQKRWATGLFEVLFNTKSPII  520

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               LFG+L  RQC+AYL++  W +R  FE+CY++LPAYC+I NS+F PK NE +IVIP SI
Sbjct  521   GTLFGKLQLRQCMAYLYVQLWALRSIFEVCYAILPAYCLITNSYFLPKANEVSIVIPTSI  580

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             FIIYNLYGL EYI   E + AW NNQRM RV A  +WLFG LS  +K+ G  E  FE+TK
Sbjct  581   FIIYNLYGLSEYIRANEPIIAWMNNQRMWRVNAMSAWLFGILSATIKLLGFCETAFEITK  640

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ--NKSWSLG  1243
             KD         D +S +GRFTFD+SP+FVPG  ILL+NL ALFIG LDFK+  N  W LG
Sbjct  641   KDQD-------DTNSDIGRFTFDDSPIFVPGIAILLLNLGALFIGVLDFKKGINIEWGLG  693

Query  1244  EAICSVWVILMYWAflkglfgkgkfgIPLSTV  1339
             E IC +W++ ++WAFLKGLF KGK+GIP S++
Sbjct  694   EVICIMWIVFVFWAFLKGLFAKGKYGIPTSSI  725



>ref|XP_010035547.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Eucalyptus 
grandis]
 gb|KCW46970.1| hypothetical protein EUGRSUZ_K00778 [Eucalyptus grandis]
Length=667

 Score =   498 bits (1281),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 254/472 (54%), Positives = 327/472 (69%), Gaps = 15/472 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD H N+P++VLHA+C LLG K E+D  +VQ PQ FY GLKDDP+
Sbjct  195   VSGLMTNAPFMLNVDCDMHANNPQIVLHALCLLLGTKRERDCAYVQCPQIFYDGLKDDPF  254

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVD-------NNEKSTDKD  340
             GNQM ++ +Y+ RG  GIQGPFY GTGCFHRRKVIYG WP  +        +N + T ++
Sbjct  255   GNQMVVLFEYMGRGIVGIQGPFYSGTGCFHRRKVIYGSWPDDMKTENSGLTSNGELTKEN  314

Query  341   QWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYG  520
                 FG SK F  S  Q L G+    +    +SLE   +VASC YE+ T WGQK+G +YG
Sbjct  315   LLNEFGSSKQFINSAAQALQGN-SNHLEDLSSSLETVHQVASCTYEYDTDWGQKIGWMYG  373

Query  521   SAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKS  700
             S  ED  TG++I  KGWKSVYC PNPP FLG +P+GGPA++TQQKRW T  L++L+ KK+
Sbjct  374   STTEDILTGLAIQTKGWKSVYCSPNPPAFLGCAPSGGPASMTQQKRWATGLLEVLVSKKN  433

Query  701   PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP  880
             PI   LF +LHFRQCLAYLW++   +R   E  Y+L+PAYCI+ NSHF PK  E A VIP
Sbjct  434   PIYGTLFVQLHFRQCLAYLWLLIRALRSIPEFLYALIPAYCIMTNSHFLPKGQEPASVIP  493

Query  881   ASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFE  1060
             A+IF+IYNLY L EY  T  S+  WWNN RM ++ ++ +W FGFLS V+K+ GLSE VFE
Sbjct  494   AAIFVIYNLYCLHEYFMTNLSILEWWNNHRMQQITSTCAWSFGFLSVVLKLLGLSETVFE  553

Query  1061  VTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKS---  1231
             VTKK+ S+       +   +GRFTFD SP+FVPGTT+LLV+L A+    L  +   S   
Sbjct  554   VTKKEQSASSDSSSAE---LGRFTFDGSPVFVPGTTLLLVHLTAVLTMLLGLRPQASNDN  610

Query  1232  -WSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
                LGE +C+VW +L +W F +GLFGKGK+GIP +T++K   LA +  + C+
Sbjct  611   GSGLGEVVCTVWQVLCFWPFFRGLFGKGKYGIPSTTIMKGAILASVVVYLCR  662



>ref|XP_010035546.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Eucalyptus 
grandis]
Length=753

 Score =   498 bits (1282),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 254/472 (54%), Positives = 327/472 (69%), Gaps = 15/472 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD H N+P++VLHA+C LLG K E+D  +VQ PQ FY GLKDDP+
Sbjct  281   VSGLMTNAPFMLNVDCDMHANNPQIVLHALCLLLGTKRERDCAYVQCPQIFYDGLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVD-------NNEKSTDKD  340
             GNQM ++ +Y+ RG  GIQGPFY GTGCFHRRKVIYG WP  +        +N + T ++
Sbjct  341   GNQMVVLFEYMGRGIVGIQGPFYSGTGCFHRRKVIYGSWPDDMKTENSGLTSNGELTKEN  400

Query  341   QWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYG  520
                 FG SK F  S  Q L G+    +    +SLE   +VASC YE+ T WGQK+G +YG
Sbjct  401   LLNEFGSSKQFINSAAQALQGN-SNHLEDLSSSLETVHQVASCTYEYDTDWGQKIGWMYG  459

Query  521   SAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKS  700
             S  ED  TG++I  KGWKSVYC PNPP FLG +P+GGPA++TQQKRW T  L++L+ KK+
Sbjct  460   STTEDILTGLAIQTKGWKSVYCSPNPPAFLGCAPSGGPASMTQQKRWATGLLEVLVSKKN  519

Query  701   PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP  880
             PI   LF +LHFRQCLAYLW++   +R   E  Y+L+PAYCI+ NSHF PK  E A VIP
Sbjct  520   PIYGTLFVQLHFRQCLAYLWLLIRALRSIPEFLYALIPAYCIMTNSHFLPKGQEPASVIP  579

Query  881   ASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFE  1060
             A+IF+IYNLY L EY  T  S+  WWNN RM ++ ++ +W FGFLS V+K+ GLSE VFE
Sbjct  580   AAIFVIYNLYCLHEYFMTNLSILEWWNNHRMQQITSTCAWSFGFLSVVLKLLGLSETVFE  639

Query  1061  VTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKS---  1231
             VTKK+ S+       +   +GRFTFD SP+FVPGTT+LLV+L A+    L  +   S   
Sbjct  640   VTKKEQSASSDSSSAE---LGRFTFDGSPVFVPGTTLLLVHLTAVLTMLLGLRPQASNDN  696

Query  1232  -WSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
                LGE +C+VW +L +W F +GLFGKGK+GIP +T++K   LA +  + C+
Sbjct  697   GSGLGEVVCTVWQVLCFWPFFRGLFGKGKYGIPSTTIMKGAILASVVVYLCR  748



>emb|CBI28826.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   497 bits (1280),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 265/473 (56%), Positives = 327/473 (69%), Gaps = 12/473 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG MTNAPFMLN+DCD + N+P++  HAMC LLG K+E+D  FVQ PQ FY GLKDDP+
Sbjct  281   VSGAMTNAPFMLNVDCDMYANNPQIFHHAMCLLLGSKNEQDCGFVQSPQCFYDGLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP----HVVDNNEKSTDKDQWE  349
             GNQ+ ++ KYL  G AG+QGP Y+GTGCFHRRKVIYG+WP     +   + K TD+   +
Sbjct  341   GNQLVVLYKYLGSGIAGLQGPTYIGTGCFHRRKVIYGLWPDGRMEIKGRSGKLTDERIQK  400

Query  350   TFGKSKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
             TFG SK F  +  +ILSG S     P    N +EAA+EVA+C YE+GT+WG K+G LYGS
Sbjct  401   TFGNSKEFTKTAARILSGLSGISHCPYDLLNRVEAAQEVATCSYEYGTSWGTKIGCLYGS  460

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG+ I  +GWKS  C P+PP FLG +P+GGPAALTQQKRW T  L+IL  K SP
Sbjct  461   TTEDVLTGMRIQARGWKSTDCRPDPPAFLGCAPSGGPAALTQQKRWATGLLEILFSKNSP  520

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
              I A   +L FRQCLAYLW + W +R   E+CY  LPAYCI+  SHF PK+ E A++IP 
Sbjct  521   FIAAFTAKLQFRQCLAYLWFISWALRSIPELCYLALPAYCIMAGSHFLPKVQEPAVLIPI  580

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             S+F+ YN Y LFEY   G S+RA WNN RM R+ A  +WLFGF S ++K+ GLSE VFEV
Sbjct  581   SLFVSYNFYTLFEYYGAGFSIRACWNNLRMGRITAVTAWLFGFFSVILKLLGLSETVFEV  640

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAAL---FIGFLDFKQNKSW  1234
             TKKD S+      D D+  GRFTFD S +FVP TT+LLV+L AL    +G  D    +S 
Sbjct  641   TKKDQSTTPGEGSDKDA--GRFTFDGSLIFVPATTLLLVHLMALVTALLGLFDHVGIES-  697

Query  1235  SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSVH  1393
              +GE ICSVWV+L +  FLKGLFGKGK+GIP S++ KS  LALLF     +V 
Sbjct  698   RIGEIICSVWVVLCFSPFLKGLFGKGKYGIPTSSISKSVALALLFLACTTTVR  750



>ref|XP_002302868.1| cellulose synthase family protein [Populus trichocarpa]
 gb|EEE82141.1| cellulose synthase family protein [Populus trichocarpa]
Length=749

 Score =   497 bits (1279),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 262/474 (55%), Positives = 325/474 (69%), Gaps = 17/474 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLNLDCD  VN+PK+V HAMC LLG ++E ++ FVQFPQ FY GLKDDPY
Sbjct  277   VSGMMTNAPFMLNLDCDMFVNNPKIVCHAMCLLLGSRNEMESGFVQFPQYFYDGLKDDPY  336

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS--------TDK  337
             GNQ ++  KY+  G  GIQGPFY GTGCFHRRKVIYG  P  V    KS        T  
Sbjct  337   GNQFEVWHKYIGNGIVGIQGPFYGGTGCFHRRKVIYGSCPRDVGIQAKSLTPVHAVATSF  396

Query  338   DQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
                + FG SK F  S    L G       I PN +EAA EVA C YE+GT+WG++VG  Y
Sbjct  397   LLLKIFGNSKEFVRSAAHALQGKANMSPKILPNLIEAAHEVAGCGYEYGTSWGKEVGWQY  456

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GSA ED  TG+ IH +GW+SV C P+P  FLG +P  GP ++TQQKRW T  L+IL+ ++
Sbjct  457   GSATEDILTGLKIHARGWRSVLCTPDPRAFLGCAPRVGPISMTQQKRWATGLLEILMSER  516

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             +PII  L  RL FRQCLAYLWI+ W +R   EICY++LPAYCII NS F PK +E A+ I
Sbjct  517   NPIIATLTARLQFRQCLAYLWILIWGLRSIPEICYAVLPAYCIITNSSFLPKAHEPAMYI  576

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
               ++F+ Y +YGL EY+ETG S+RAWWNNQRM RV A+ +WLFG +S  +K+  +S  VF
Sbjct  577   HVALFLSYVIYGLLEYLETGLSIRAWWNNQRMARVNATNAWLFGVISVFLKILRISGTVF  636

Query  1058  EVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK---QNK  1228
             EVT+KD SS+   D+      GRFTFD SP+FVPGTTILL+ L A  +GF   +    N 
Sbjct  637   EVTQKDQSSNNGGDE------GRFTFDASPIFVPGTTILLLQLTAFVMGFGGMQLPSVND  690

Query  1229  SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
             +  LGE +CSV V++ +W F+KGLFGKGK+GIPLST+ KS  L+L F +   S 
Sbjct  691   ASGLGEILCSVLVVMCFWPFVKGLFGKGKYGIPLSTICKSSLLSLSFVYLVTST  744



>ref|XP_002269831.2| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
 emb|CBI28824.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   497 bits (1279),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 262/473 (55%), Positives = 329/473 (70%), Gaps = 12/473 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG MTNAPFMLN+DCD + N+P +  HAMC LLG K+E+D  FVQ PQ FY GLKDDP+
Sbjct  281   VSGAMTNAPFMLNVDCDMYANNPLIFHHAMCLLLGSKNEQDCGFVQSPQCFYDGLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP----HVVDNNEKSTDKDQWE  349
             GNQ+ ++ KYL  G AG+QGP Y GTGCFHRRKVIYG+WP     +   + K TD+   +
Sbjct  341   GNQLVVLYKYLGSGIAGLQGPTYSGTGCFHRRKVIYGLWPDGRMEIKGRSGKLTDERIQK  400

Query  350   TFGKSKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
             TFG SK F  +  ++LSG S     P    N +EAA+EVA+C YE+GT+WG K+G LYG+
Sbjct  401   TFGNSKEFTTTAARLLSGLSGISHCPYDLLNRVEAAQEVATCSYEYGTSWGTKIGWLYGT  460

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG+ IH +GWKS  C P+PP FLG +P+GGPAALTQQKRW T  L+IL  K SP
Sbjct  461   TTEDVLTGMRIHARGWKSTDCRPDPPAFLGCAPSGGPAALTQQKRWATGFLEILFSKNSP  520

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
              I +   +L FRQCLAY+W++ W +R   E+CY  LPAYCI+  SHF PK+ E A++IP 
Sbjct  521   FIASFTAKLQFRQCLAYVWLISWALRSIPELCYLALPAYCIMAGSHFLPKVQEPAVLIPI  580

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             S+F+ YN Y LFEY   G S+RA WNN RM R+ A  +WLFGF S ++K+ GLSE VFEV
Sbjct  581   SLFVSYNFYNLFEYYGAGFSIRACWNNLRMGRITAVTAWLFGFFSVILKLLGLSETVFEV  640

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALF---IGFLDFKQNKSW  1234
             TKKD S+      D+D+  GRFTFD S +FVP TT+LLV+L ALF   +G  D    +S 
Sbjct  641   TKKDQSTTPGEGSDNDA--GRFTFDGSLIFVPATTLLLVHLMALFTALLGLFDHVGIES-  697

Query  1235  SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSVH  1393
              +GE ICSVWV+L +  FL+GLFGKGK+GIP S++ KS  LALLF     +V 
Sbjct  698   RIGEIICSVWVVLCFSPFLEGLFGKGKYGIPTSSISKSVALALLFLACTTTVR  750



>ref|XP_006387031.1| hypothetical protein POPTR_2114s00200g, partial [Populus trichocarpa]
 gb|ERP45945.1| hypothetical protein POPTR_2114s00200g, partial [Populus trichocarpa]
Length=469

 Score =   485 bits (1248),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 249/466 (53%), Positives = 321/466 (69%), Gaps = 16/466 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  VN+P++ LHAMC LLG K+E+++ FVQ PQ FY GLKDDP+
Sbjct  3     VSGLITNAPFMLNVDCDMFVNNPQIFLHAMCLLLGSKNERESGFVQCPQYFYDGLKDDPF  62

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS--------TDK  337
             GNQ  ++ K++  G AGIQGPFY GTGCFHRRKVIYG  P  + N  K         + K
Sbjct  63    GNQFVVVHKFMGNGVAGIQGPFYGGTGCFHRRKVIYGSCPDDIGNQAKRLTPVHGGLSYK  122

Query  338   DQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
             +Q   FG SK F  S    L G         PN +EAA +VA C YE+GT+WG +VG  Y
Sbjct  123   EQLRIFGDSKEFIRSAAHALQGKENISPKNLPNLVEAAHQVAGCGYEYGTSWGTEVGWQY  182

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GSA ED  TG+ IH +GW+S+ C P+P  FLG +P GGP ++TQQKRW T  L+ILI ++
Sbjct  183   GSATEDVLTGLMIHARGWRSLLCTPDPRAFLGCAPRGGPISMTQQKRWATGFLEILISRR  242

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             SPII  +  +L FRQCLAYL ++ W +R   E+C ++LPAYC I +S F P+++E AI I
Sbjct  243   SPIIATVTAKLQFRQCLAYLSLLTWGLRSIPELCSAVLPAYCTITDSSFLPEVHEPAIYI  302

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
               ++F+ Y +Y L EY+ETG S+RAWWNNQRM R+ A  +WLFGF+S ++KV  +S+ VF
Sbjct  303   YMALFLSYVIYTLIEYLETGLSIRAWWNNQRMARINAMNAWLFGFISVILKVLRISDTVF  362

Query  1058  EVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGF--LDFKQNKS  1231
             EVT+KD SS       +D   GRFTFD S LFVPGTT+LL+ L AL +GF  +    N  
Sbjct  363   EVTQKDQSS------SNDGDEGRFTFDASLLFVPGTTVLLLQLTALIMGFRGMQLSVNDG  416

Query  1232  WSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
               LGE +CS+ V++ +W FLKGLF KGK+GIPLST+ KS  LAL F
Sbjct  417   SGLGERLCSIMVVICFWPFLKGLFAKGKYGIPLSTIFKSAFLALCF  462



>ref|XP_007049091.1| Cellulose synthase-like B3, putative [Theobroma cacao]
 gb|EOX93248.1| Cellulose synthase-like B3, putative [Theobroma cacao]
Length=750

 Score =   494 bits (1272),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 262/475 (55%), Positives = 328/475 (69%), Gaps = 18/475 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAP+MLN+DCD  VN+P+VV  AMC LL  K E++  FVQ+PQ FY G KDDPY
Sbjct  280   VSGLITNAPYMLNVDCDMFVNNPQVVRQAMCQLLDSKSEREIAFVQYPQCFYDGPKDDPY  339

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDN--------NEKSTDK  337
             GNQ+ ++M+YL RG AGIQGP Y GTGCFHRRKVIYG+WP   +N        N K TD 
Sbjct  340   GNQLVVLMEYLGRGIAGIQGPCYSGTGCFHRRKVIYGLWPDDSENQGRNHTSINGKLTDN  399

Query  338   DQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
             +  + FGKSK F+ S T  L G       I   SLEAA +V+ C YEFGT+WG KVG +Y
Sbjct  400   EPLKEFGKSKEFSESVTYALKGKKGFSNNI-SGSLEAAFQVSRCGYEFGTSWGTKVGWIY  458

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GS  ED  TG++IH KGWKS +  PNPP FLG +P+GGPAA+TQQKRW T  L+IL+  K
Sbjct  459   GSMTEDVITGLTIHKKGWKSTFPMPNPPAFLGCAPSGGPAAMTQQKRWATGLLEILVSDK  518

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             SPI   L  RL FR  LAY WI+ W +    E+CY+ LPAYCII NSHF PK+ + AI+I
Sbjct  519   SPIFATLTDRLQFRMFLAYFWILSWGLGSIPELCYAALPAYCIIANSHFLPKVQDPAILI  578

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
             P +IF+IYNL  L EY++TG S+RAWWNN RM R+ A+ ++LFG LS V+K+ GLS+ VF
Sbjct  579   PLAIFVIYNLLTLREYLKTGISIRAWWNNMRMGRINAASAYLFGTLSVVLKLLGLSDTVF  638

Query  1058  EVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ-----  1222
             EVT+KD SS    D D  +    FTFD SP+FVPGTT++LV+L AL    L  +      
Sbjct  639   EVTQKDQSS----DGDQTNDTTNFTFDASPIFVPGTTLMLVHLTALLALSLKLRPLVHDV  694

Query  1223  NKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
                  LGE +CS+WV+L +  FLKGLF  GK+GIP ST+ KS  LAL+F + C++
Sbjct  695   GHVVGLGEVLCSIWVVLCFLPFLKGLFRTGKYGIPSSTIFKSTSLALVFVYLCRT  749



>ref|XP_011007182.1| PREDICTED: cellulose synthase-like protein H1 [Populus euphratica]
Length=750

 Score =   493 bits (1270),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 256/469 (55%), Positives = 324/469 (69%), Gaps = 17/469 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLNLDCD  VN+PK+V HAMC LLG ++E+++ FVQ PQ FY GLKDDP+
Sbjct  277   VSGMMTNAPFMLNLDCDMFVNNPKIVCHAMCLLLGSRNERESGFVQCPQYFYDGLKDDPF  336

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS--------TDK  337
             GNQ +++ KY+  G  GIQGPFY GTGCFHRRKVIYG  P  V    +S        T+K
Sbjct  337   GNQFEVLHKYIGSGIVGIQGPFYGGTGCFHRRKVIYGSCPRDVGIPAESLTPVHGGLTEK  396

Query  338   DQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
             +Q   FG SK F  S    L G       I P  +EAA +VA C YE+GT+WG++VG  Y
Sbjct  397   EQLRVFGNSKEFVRSAAHALQGKANTSPEILPKLIEAAHQVAGCGYEYGTSWGKEVGWQY  456

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             G A ED  TG+ IH +GW+SV C P+P  FLG +P  GP ++TQQKRW T  L+ILI ++
Sbjct  457   GPATEDILTGLKIHARGWRSVLCSPDPRAFLGCAPRVGPISMTQQKRWATGLLEILISER  516

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             +PII  L  RL FRQCLAYLWI+ W +R   EICY++LPAYCII NS F PK +E A+ I
Sbjct  517   NPIIATLTARLQFRQCLAYLWILIWGLRSIPEICYAVLPAYCIITNSSFLPKFHEPAMYI  576

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
               ++F+ Y +Y L EY+ETG S+RAWWNNQRM R+ A+ +WLFG +S  +K+  +S  VF
Sbjct  577   HVALFLSYVIYSLLEYLETGLSIRAWWNNQRMARMNATNAWLFGVISVFLKILRISGTVF  636

Query  1058  EVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK---QNK  1228
             EVT+KD SS    D+      GRFTFD SP+FVPGTTILL+ L A  +GF   +    + 
Sbjct  637   EVTQKDQSSSNVGDE------GRFTFDASPIFVPGTTILLLQLTAFVMGFGGMQLPSVDD  690

Query  1229  SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
             +  LGE +CSV V++ +W F+KGLFGKGK+GIPLSTV KS  L+L F +
Sbjct  691   ASGLGEILCSVLVVMCFWPFVKGLFGKGKYGIPLSTVCKSSLLSLSFVY  739



>ref|XP_010035545.1| PREDICTED: cellulose synthase-like protein B4 [Eucalyptus grandis]
 gb|KCW46971.1| hypothetical protein EUGRSUZ_K00779 [Eucalyptus grandis]
Length=754

 Score =   490 bits (1261),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 255/467 (55%), Positives = 329/467 (70%), Gaps = 15/467 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAP MLN+DCD + N+P++V HA+C LLG K E+D  FVQ PQ FY G KDDP+
Sbjct  281   VSGLMTNAPLMLNVDCDMYANNPQIVYHALCLLLGTKYERDCAFVQCPQYFYDGAKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS-------TDKD  340
             GNQ+ ++ +YL RG  GIQGP Y GTGCFHRRKVIYG W   +   +KS       T  +
Sbjct  341   GNQLVVLFEYLGRGIVGIQGPVYGGTGCFHRRKVIYGSWAKDMKTEKKSLTSNGELTMVE  400

Query  341   QWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYG  520
               + FG SK F  S    L G+      ++ +SLEAA +V +C YE+ T WG++VG +YG
Sbjct  401   SLKGFGSSKQFINSVAYALQGNSDNPKDLW-SSLEAAYQVTNCTYEYNTDWGKEVGWMYG  459

Query  521   SAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKS  700
             S  ED  TG++IH KGW+S+YC P+PP FLG +P+GGPA++TQQKRW T  L++L+ K+S
Sbjct  460   STTEDVLTGLAIHSKGWRSLYCSPDPPAFLGCAPSGGPASMTQQKRWATGLLEVLMSKRS  519

Query  701   PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP  880
             PI   LF  LHFRQCLAYLWI+ W +R   E  Y+LLPAYCI+ NSHF PK  E AI+IP
Sbjct  520   PIYGTLFMHLHFRQCLAYLWIVIWALRSIPEFLYALLPAYCIMTNSHFLPKGKEPAIIIP  579

Query  881   ASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFE  1060
             A+IF+IYNLY L+EY+  G S+RAWWNNQRM R+ ++ +W FG LS V+K+ GLSE VFE
Sbjct  580   ATIFVIYNLYCLYEYLAVGLSIRAWWNNQRMQRMTSACAWSFGVLSVVLKLLGLSETVFE  639

Query  1061  VTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNK----  1228
             VTKKD S+         +++GRFTFDESP+FVPGTT+LLV+L ALF   L  +       
Sbjct  640   VTKKDQSTSSDSTS---AELGRFTFDESPVFVPGTTLLLVHLIALFTMSLGLRPQASGSS  696

Query  1229  SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
                LGE IC+VWV++ +W F +GLFG+GK+GIP +T++K   LA  F
Sbjct  697   GSGLGEVICTVWVVMYFWPFFRGLFGRGKYGIPSTTIMKGAILATFF  743



>ref|XP_002529325.1| transferase, putative [Ricinus communis]
 gb|EEF33042.1| transferase, putative [Ricinus communis]
Length=749

 Score =   489 bits (1258),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 249/472 (53%), Positives = 322/472 (68%), Gaps = 17/472 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD +VNDP+VV  AMCFLLG  +E++  FVQFPQ FY  LKDDP+
Sbjct  279   VSGLVTNAPFMLNVDCDMYVNDPQVVRRAMCFLLGSSNEREFAFVQFPQVFYDELKDDPF  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS-----------  328
             G+ + ++ +Y+ RG AG+QGPFY GTGCFHRRKVIYG+ P  V   + +           
Sbjct  339   GSTLAVVYEYMGRGIAGLQGPFYGGTGCFHRRKVIYGLCPDDVGTEKNNATPVSSTYFVH  398

Query  329   TDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVG  508
             +DK+    FG S  F  S  Q L G       +  N +E   +VA C YE+GTAWG +VG
Sbjct  399   SDKELLNIFGNSMEFIKSAAQALQGKTTSPRNL-SNLVETEYQVAGCGYEYGTAWGTEVG  457

Query  509   LLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILI  688
               YGS  ED  TG+ IH +GW+S YC P PP FLG SP+ GP  LTQQKRW T  ++IL+
Sbjct  458   WQYGSTTEDVLTGLMIHSRGWRSAYCTPEPPAFLGCSPSSGPTLLTQQKRWATGLVEILV  517

Query  689   CKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAA  868
             C+KSPI+ A+  +L FRQCL YL+I+ W +R   E+CY LLPAYCII+NS+F PK NE  
Sbjct  518   CRKSPIVTAITAKLQFRQCLVYLFILTWGLRSIPELCYMLLPAYCIISNSNFLPKFNEPP  577

Query  869   IVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSE  1048
             I    ++ I+Y+LY + EY++TG S+RAWWN Q+M RV  + +WL G LS V+K+ G+SE
Sbjct  578   IYGYIALIIVYSLYTILEYLQTGLSIRAWWNKQKMARVITTSAWLIGVLSVVLKILGISE  637

Query  1049  AVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNK  1228
              VFEVT+KD  +    D D DS V +FTFDESPLF+PGTTILL+ LAAL +GF      +
Sbjct  638   TVFEVTQKDQLN----DNDSDSNVCKFTFDESPLFIPGTTILLIELAALIMGFFSGGLLQ  693

Query  1229  SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
             S  +GE +CS+ V++ +W F KGLF K K+GIPL T+ KS  LA  F + CK
Sbjct  694   S-QIGEILCSILVVMFFWLFFKGLFRKDKYGIPLPTICKSVVLASSFVYFCK  744



>ref|XP_010657214.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
Length=747

 Score =   489 bits (1258),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 257/469 (55%), Positives = 321/469 (68%), Gaps = 8/469 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG MTNAPFMLN+DCD + N+P++  H+MC LLG K+E+D  FVQ PQ+FY GLKDDP+
Sbjct  281   VSGAMTNAPFMLNVDCDMYANNPQIFHHSMCLLLGSKNEQDCGFVQTPQSFYDGLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ  ++ KY+  G AG+QGP Y GTGCFHRRKVIYG+WP      +   D+   +TFG 
Sbjct  341   GNQFGVLYKYVVSGIAGLQGPNYSGTGCFHRRKVIYGLWPDGRMEFKGRIDERLEKTFGN  400

Query  362   SKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGED  535
             SK F  +  +ILSG S   + P    N +EAA ++ASC YE+GT WG K+G LYG+  ED
Sbjct  401   SKEFTKTAARILSGLSGISDCPYDLSNRVEAAHQIASCSYEYGTNWGTKIGWLYGTTTED  460

Query  536   TKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWA  715
               TG+ IH +GWKS  C P+PP FLG +P+GGPAAL QQKRW T  L++L  K SP I  
Sbjct  461   ILTGMRIHARGWKSTDCRPDPPAFLGCAPSGGPAALIQQKRWATGLLEVLFSKNSPFIVT  520

Query  716   LFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFI  895
                +L FRQCLAY+WI+ W +RP  E+CY  LPAYCI+  SHF P + + A++IP S+F+
Sbjct  521   FTAKLQFRQCLAYMWIISWGLRPIPELCYLALPAYCIMAGSHFLPNVQDPAVLIPISLFV  580

Query  896   IYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKD  1075
              YN + L EY   G S+RA WNN RM R+ A  SWLFGFLS ++K+ GLSE VFEVTKKD
Sbjct  581   SYNFHTLLEYWGAGYSIRACWNNLRMWRITAVTSWLFGFLSVILKLLGLSETVFEVTKKD  640

Query  1076  HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAAL---FIGFLDFKQNKSWSLGE  1246
              S+      D DS  GRFTFD S +FVP TT+LLV+L AL    +G  D    +S  +GE
Sbjct  641   QSTTPGEGSDKDS--GRFTFDGSLIFVPATTLLLVHLMALVTALLGLFDLVGIES-RIGE  697

Query  1247  AICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSVH  1393
              ICSVWV+L +  FLKGLFGKGK+GIP ST+ KS  LA LF     +V 
Sbjct  698   IICSVWVVLCFSPFLKGLFGKGKYGIPKSTICKSAALAFLFLACTITVR  746



>emb|CBI28829.3| unnamed protein product [Vitis vinifera]
Length=765

 Score =   489 bits (1259),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 258/465 (55%), Positives = 321/465 (69%), Gaps = 9/465 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG MTNAPFMLN+DCD + N+P++  H+MC LLG K+E+D  FVQ PQ+FY GLKDDP+
Sbjct  299   VSGAMTNAPFMLNVDCDMYANNPQIFHHSMCLLLGSKNEQDCGFVQTPQSFYDGLKDDPF  358

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ  ++ KY+  G AG+QGP Y GTGCFHRRKVIYG+WP      +   D+   +TFG 
Sbjct  359   GNQFGVLYKYVVSGIAGLQGPNYSGTGCFHRRKVIYGLWPDGRMEFKGRIDERLEKTFGN  418

Query  362   SKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGED  535
             SK F  +  +ILSG S   + P    N +EAA ++ASC YE+GT WG K+G LYG+  ED
Sbjct  419   SKEFTKTAARILSGLSGISDCPYDLSNRVEAAHQIASCSYEYGTNWGTKIGWLYGTTTED  478

Query  536   TKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWA  715
               TG+ IH +GWKS  C P+PP FLG +P+GGPAAL QQKRW T  L++L  K SP I  
Sbjct  479   ILTGMRIHARGWKSTDCRPDPPAFLGCAPSGGPAALIQQKRWATGLLEVLFSKNSPFIVT  538

Query  716   LFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFI  895
                +L FRQCLAY+WI+ W +RP  E+CY  LPAYCI+  SHF P + + A++IP S+F+
Sbjct  539   FTAKLQFRQCLAYMWIISWGLRPIPELCYLALPAYCIMAGSHFLPNVQDPAVLIPISLFV  598

Query  896   IYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKD  1075
              YN + L EY   G S+RA WNN RM R+ A  SWLFGFLS ++K+ GLSE VFEVTKKD
Sbjct  599   SYNFHTLLEYWGAGYSIRACWNNLRMWRITAVTSWLFGFLSVILKLLGLSETVFEVTKKD  658

Query  1076  HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAAL---FIGFLDFKQNKSWSLGE  1246
              S+      D DS  GRFTFD S +FVP TT+LLV+L AL    +G  D    +S  +GE
Sbjct  659   QSTTPGEGSDKDS--GRFTFDGSLIFVPATTLLLVHLMALVTALLGLFDLVGIES-RIGE  715

Query  1247  AICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
              ICSVWV+L +  FLKGLFGKGK+GIP ST+ KS  LA LF  AC
Sbjct  716   IICSVWVVLCFSPFLKGLFGKGKYGIPKSTICKSAALAFLFL-AC  759



>ref|XP_010035551.1| PREDICTED: cellulose synthase-like protein B4 [Eucalyptus grandis]
Length=754

 Score =   487 bits (1254),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 255/467 (55%), Positives = 329/467 (70%), Gaps = 17/467 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             +SG+MTNAP MLN+DCD + N+P++VLHA+C LLG K E+   FVQ PQ FY G KDDP+
Sbjct  281   ISGLMTNAPLMLNVDCDMYANNPQIVLHALCLLLGTKYERYCAFVQCPQYFYDGAKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH-------VVDNNEKSTDKD  340
             GNQ+ ++ +YL RG  GIQGP Y GTGCFHRRKVIYG WP        ++ +N + T + 
Sbjct  341   GNQLVVLQEYLVRGIVGIQGPVYGGTGCFHRRKVIYGSWPEDMKTEKKILTSNGELTKEK  400

Query  341   QWETFGKSKTFALSTTQILSGSLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
                 FG SK F  S    L G+  P+ P    +SLE A +VASC YE+ T WG+KVG +Y
Sbjct  401   SLNGFGSSKQFIDSAAHALQGN--PDHPKDLSSSLEVACQVASCTYEYNTDWGKKVGWMY  458

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GS  ED  TGV+IH KGW+S+YC PNPP FLG +P+GGPA++TQQKRW T  L++L+ K+
Sbjct  459   GSTAEDILTGVAIHTKGWRSLYCSPNPPAFLGCAPSGGPASMTQQKRWATGLLEVLLSKR  518

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             SPI   LF  LHFRQCLAYLW++ W +R   E  Y+LLPAYCI+ NSHF PK  E AI+I
Sbjct  519   SPIYGTLFMHLHFRQCLAYLWVLIWALRSIPEFLYALLPAYCIMTNSHFLPKGQEPAIII  578

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
              A+IFIIYNLY L+EY   G S+ AWWNNQR+ R+ ++ +W FG LS V+K+ GLSE VF
Sbjct  579   SAAIFIIYNLYCLYEYFAIGLSIHAWWNNQRIQRITSTCAWSFGVLSVVLKLLGLSETVF  638

Query  1058  EVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS  1237
             EVTKKD S+        ++++GRFTFDESP+FVPGT +LLV+L A F   L  +   S S
Sbjct  639   EVTKKDQSTS---SDSTNAELGRFTFDESPIFVPGTALLLVHLIATFTMLLGLRPQASRS  695

Query  1238  ----LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALL  1366
                 +GE IC++WV+L +W F +GLFGKGK+GIP +T++K   +A +
Sbjct  696   SGSGMGEVICTMWVVLCFWPFFRGLFGKGKYGIPSTTIMKGAIVATI  742



>gb|KCW46974.1| hypothetical protein EUGRSUZ_K00782 [Eucalyptus grandis]
Length=816

 Score =   486 bits (1252),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 255/467 (55%), Positives = 329/467 (70%), Gaps = 17/467 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             +SG+MTNAP MLN+DCD + N+P++VLHA+C LLG K E+   FVQ PQ FY G KDDP+
Sbjct  281   ISGLMTNAPLMLNVDCDMYANNPQIVLHALCLLLGTKYERYCAFVQCPQYFYDGAKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH-------VVDNNEKSTDKD  340
             GNQ+ ++ +YL RG  GIQGP Y GTGCFHRRKVIYG WP        ++ +N + T + 
Sbjct  341   GNQLVVLQEYLVRGIVGIQGPVYGGTGCFHRRKVIYGSWPEDMKTEKKILTSNGELTKEK  400

Query  341   QWETFGKSKTFALSTTQILSGSLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
                 FG SK F  S    L G+  P+ P    +SLE A +VASC YE+ T WG+KVG +Y
Sbjct  401   SLNGFGSSKQFIDSAAHALQGN--PDHPKDLSSSLEVACQVASCTYEYNTDWGKKVGWMY  458

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GS  ED  TGV+IH KGW+S+YC PNPP FLG +P+GGPA++TQQKRW T  L++L+ K+
Sbjct  459   GSTAEDILTGVAIHTKGWRSLYCSPNPPAFLGCAPSGGPASMTQQKRWATGLLEVLLSKR  518

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             SPI   LF  LHFRQCLAYLW++ W +R   E  Y+LLPAYCI+ NSHF PK  E AI+I
Sbjct  519   SPIYGTLFMHLHFRQCLAYLWVLIWALRSIPEFLYALLPAYCIMTNSHFLPKGQEPAIII  578

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
              A+IFIIYNLY L+EY   G S+ AWWNNQR+ R+ ++ +W FG LS V+K+ GLSE VF
Sbjct  579   SAAIFIIYNLYCLYEYFAIGLSIHAWWNNQRIQRITSTCAWSFGVLSVVLKLLGLSETVF  638

Query  1058  EVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS  1237
             EVTKKD S+        ++++GRFTFDESP+FVPGT +LLV+L A F   L  +   S S
Sbjct  639   EVTKKDQSTS---SDSTNAELGRFTFDESPIFVPGTALLLVHLIATFTMLLGLRPQASRS  695

Query  1238  ----LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALL  1366
                 +GE IC++WV+L +W F +GLFGKGK+GIP +T++K   +A +
Sbjct  696   SGSGMGEVICTMWVVLCFWPFFRGLFGKGKYGIPSTTIMKGAIVATI  742



>ref|XP_011047235.1| PREDICTED: cellulose synthase-like protein H1 [Populus euphratica]
Length=747

 Score =   484 bits (1246),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 251/471 (53%), Positives = 319/471 (68%), Gaps = 16/471 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  VN+P++ LHAMC LLG  DE+++ FVQ PQ FY GLKDDP+
Sbjct  281   VSGLITNAPFMLNVDCDMFVNNPQIFLHAMCLLLGSNDERESGFVQCPQCFYDGLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS--------TDK  337
             GNQ  +  KY+ +G AGIQGPFY GTGCFHRRKVIYG  P  + N  K         + K
Sbjct  341   GNQFVVEHKYMGKGAAGIQGPFYGGTGCFHRRKVIYGSCPDDIGNQAKRLTPVHGGLSYK  400

Query  338   DQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
             +Q   FG SK F  S    L G         P  +EAA +VA C YE+GT+WG +VG  Y
Sbjct  401   EQLRIFGGSKEFIRSAAHALQGKENISPQNLPTLVEAAHQVAGCGYEYGTSWGIEVGWQY  460

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GSA ED  TG+ I  +GW+S++C P+P  FLG +P GGP ++TQQKRW T  L+ILI ++
Sbjct  461   GSATEDILTGLMIQARGWRSLFCTPDPRAFLGCAPPGGPISMTQQKRWATGLLEILISRR  520

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             SPI+  +  RL FRQCL YL  + W +R   E+CY++LPAYC I +S F PK++E AI I
Sbjct  521   SPIVATVTARLQFRQCLVYLSFLTWGLRSIPELCYAVLPAYCTITDSSFLPKVHEPAIYI  580

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
               ++F+ Y +Y L EY+ETG S+RAWWNNQRM R+ A  +WLFGF+S ++KV  +S+AVF
Sbjct  581   YMALFLSYVIYTLIEYLETGLSIRAWWNNQRMARINAMNAWLFGFISVILKVLRISDAVF  640

Query  1058  EVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGF--LDFKQNKS  1231
             EVT KD SS       +D   GRFTFD S +FVPGTT+LL+ L AL +GF  +    N  
Sbjct  641   EVTPKDQSS------SNDGDEGRFTFDASLIFVPGTTVLLLQLTALIMGFRGMQLSVNDG  694

Query  1232  WSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
               LGE +CS+ V+L +W FLKGLF KGK+GIPLST+ KS  LAL F    K
Sbjct  695   SGLGEILCSLMVVLCFWPFLKGLFAKGKYGIPLSTIFKSASLALCFVLVAK  745



>ref|XP_008229979.1| PREDICTED: cellulose synthase-like protein B4 isoform X2 [Prunus 
mume]
Length=747

 Score =   481 bits (1239),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 247/471 (52%), Positives = 318/471 (68%), Gaps = 19/471 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+M NAPFMLN+DCD  VN+P ++ HAMC LLG K+E +  FVQFPQ FY GLKDDP+
Sbjct  281   VSGLMRNAPFMLNVDCDMLVNNPNMMFHAMCMLLGSKNETENAFVQFPQTFYDGLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQM ++ KY  RG +GIQGPFY+GTGC HRRKVIYG+ P     N+     D  +TFG 
Sbjct  341   GNQMTVLWKYAGRGISGIQGPFYLGTGCVHRRKVIYGLSP-----NDVKMTNDLLKTFGN  395

Query  362   SKTFALSTTQILSG-SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             SK F  S    L G + YP++     S+EAA +V  C YE+GT WG+KVG +YGS  ED 
Sbjct  396   SKEFTKSVDDALQGKTEYPDM--LSKSMEAAHQVGDCGYEYGTNWGKKVGWMYGSTTEDI  453

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+SIH +GW+S+ C P+PP F G +PTGGPA++TQQKRW T  L+IL+ K  P+   +
Sbjct  454   LTGLSIHKRGWRSIICSPDPPAFQGCAPTGGPASMTQQKRWATGLLEILLSKNCPVFHTI  513

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F  L FR  LAY W+  W +R   E+CY+ LPAY II N+HF PK  E    IP ++F++
Sbjct  514   FANLKFRMFLAYFWVFSWALRSVPELCYAALPAYSIITNTHFLPKGQEPTYYIPIALFVL  573

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVF---GLSEAVFEVTK  1069
             Y++Y L EY++TG S+RAWWNNQRM R+    +WLFG +  ++K+    G SE VFEVT+
Sbjct  574   YHVYTLSEYLQTGLSIRAWWNNQRMGRITPMSAWLFGVIGVILKLCKLSGRSETVFEVTR  633

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSLG--  1243
             KD S+      D+ ++ G FTFD+SP+FVP TTILLV L AL       +      LG  
Sbjct  634   KDQST----STDEGTEAGTFTFDKSPIFVPPTTILLVQLTALATALFGLQPPAHDGLGSG  689

Query  1244  --EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
               E +CSVW++L  W FLKGLFG GK+GIPLST+LKS G  LLF+  C ++
Sbjct  690   PLEVVCSVWLVLCLWPFLKGLFGAGKYGIPLSTILKSAGFTLLFYTLCTNM  740



>ref|XP_010657215.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
 emb|CBI28832.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   481 bits (1237),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 256/469 (55%), Positives = 321/469 (68%), Gaps = 13/469 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG MTNAPFMLN+DCD + N+P++  H+MC LL  K+E+D  FVQ PQ+FY GLKDDP+
Sbjct  281   VSGAMTNAPFMLNVDCDMYANNPQIFHHSMCLLLSSKNEQDCGFVQTPQSFYDGLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP----HVVDNNEKSTDKDQWE  349
             GNQ  ++ KY+  G AG+QGP Y GTGCFHRRKVIYG+WP           K TD+   +
Sbjct  341   GNQFGVLYKYVASGIAGLQGPHYSGTGCFHRRKVIYGLWPDGRMEFKGRIGKLTDERLEK  400

Query  350   TFGKSKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
             TFG SK F  +  +ILSG S   + P    N +EAA ++ASC YE+G  WG K+G LYG+
Sbjct  401   TFGNSKEFTKTAARILSGLSGVSDCPYDLSNRVEAAHQIASCSYEYGANWGTKIGWLYGT  460

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG+ IH +GWKS  C P+PP FLG +P+GGPAAL QQKRW T  L++L  K SP
Sbjct  461   TTEDILTGMRIHARGWKSTDCRPDPPAFLGCAPSGGPAALIQQKRWATGLLEVLFSKNSP  520

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
              I     +L FRQCLAY+WI+ W +RP  E+ Y  LPAYCI+  SHF P + + A++IP 
Sbjct  521   FIITFTAKLQFRQCLAYMWILSWGLRPIPELYYLALPAYCIMAGSHFLPNVQDPAVLIPI  580

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             S+F+ YN + L EY   G S+RA WNN RM R+ A  +WLFGFLS ++K+ GLSE VFEV
Sbjct  581   SLFVSYNFHTLLEYWGAGYSIRACWNNLRMWRITAVTAWLFGFLSVILKLLGLSETVFEV  640

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAAL---FIGFLDFKQNKSW  1234
             TKKD S+      D D+  GRFTFD S +FVP TT+LLV+L AL    +G  D  + +S 
Sbjct  641   TKKDQSTTPGEGSDKDA--GRFTFDGSLIFVPATTLLLVHLMALVTALLGLFDHVEIES-  697

Query  1235  SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
              +GE ICSVWV+L +  FLKGLFGKGK+GIP ST+ KS  LA LFF AC
Sbjct  698   RIGEIICSVWVVLCFSPFLKGLFGKGKYGIPKSTICKSAALAFLFF-AC  745



>ref|XP_010657216.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
Length=754

 Score =   479 bits (1234),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 248/475 (52%), Positives = 324/475 (68%), Gaps = 14/475 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG MTNAPF+LN+DCD + N+ ++V HAMC LLG K  +D  F Q PQ FY GLKDDP 
Sbjct  279   VSGAMTNAPFILNVDCDMYANNSQIVFHAMCLLLGCKKGQDFAFAQSPQIFYDGLKDDPL  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH-VVDNNEKS--------TD  334
             GNQ+    KY+  G +G+QGP+Y GTGCFHRRKV+YG+WP   ++   +S        TD
Sbjct  339   GNQLVATQKYIGEGISGLQGPYYSGTGCFHRRKVLYGLWPDGCMETGGRSPNCVAGKLTD  398

Query  335   KDQWETFGKSKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVG  508
             +   ++FG S+ F+ +  +ILSG S   + P    +S EAA +VA C YE GT+WG K+G
Sbjct  399   EGLRQSFGHSREFSKTVERILSGLSGKADCPYDLSSSAEAANQVADCGYECGTSWGTKIG  458

Query  509   LLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILI  688
              +YGS  ED  TG+ IH +GW+S  C P+PP FLG +P+GGPA+LTQQKRW T  L+IL 
Sbjct  459   WIYGSTSEDVLTGLKIHARGWRSAECKPDPPAFLGCAPSGGPASLTQQKRWVTGLLEILF  518

Query  689   CKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAA  868
              K +P I  L  +L FRQCLAY++I+ W +R   E+CY  LPAYCII NSHF PK+ E A
Sbjct  519   SKNNPFIATLTAKLQFRQCLAYMYILSWGLRWIPELCYIALPAYCIIANSHFLPKVEEPA  578

Query  869   IVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSE  1048
              +I A++F IYNL+ L EY   G S+R WWNNQRM R+    +W FGFL+ ++K+ GL E
Sbjct  579   FLILAALFAIYNLHSLLEYCRIGLSIRTWWNNQRMGRIITMTAWFFGFLNVILKLLGLFE  638

Query  1049  AVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNK  1228
             AVFEVT+K+ SS    D   D+  GRFTF+ESP+FVP TT++LV+L A+    L+    +
Sbjct  639   AVFEVTQKNQSSASGDDNHKDA--GRFTFNESPIFVPATTLVLVHLVAMVKALLNLTHGR  696

Query  1229  SWS-LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
               S +GE IC+VWV+L +  FLKGLF KGK+GIP ST+ KS  LA +F H C+ V
Sbjct  697   HESRIGEVICNVWVLLCFLPFLKGLFKKGKYGIPSSTICKSAALAAVFVHLCERV  751



>ref|XP_009347136.1| PREDICTED: cellulose synthase-like protein H1 [Pyrus x bretschneideri]
Length=749

 Score =   477 bits (1227),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 250/473 (53%), Positives = 315/473 (67%), Gaps = 15/473 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+P ++L AMC LLG ++E    F QFPQ FY GLKDDPY
Sbjct  281   VSGLMTNAPFMLNVDCDMFVNNPNIMLQAMCALLGSENETKNAFAQFPQIFYDGLKDDPY  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEK-----STDKDQW  346
             GNQM ++ K++  G AGIQGP Y GTGC HRRKVIYG+ P      E+     S   +  
Sbjct  341   GNQMVVLWKFVGHGIAGIQGPIYAGTGCVHRRKVIYGLSPSDAKTGERYPNIASGKVEML  400

Query  347   ETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSA  526
              TFG S+ F  S    L G+    + +   S++AA  V  C YE+GT WG KVG  YGS 
Sbjct  401   NTFGTSEEFTKSAGDALQGNT-ECVNMSSKSIDAAHRVGGCEYEYGTNWGIKVGWRYGST  459

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG+SIH KGWKS+ C P+PPGFLG +PTGGP ++TQQKRW T  L+IL+ K  PI
Sbjct  460   TEDILTGLSIHNKGWKSIICTPDPPGFLGCAPTGGPDSMTQQKRWATGLLEILLSKNCPI  519

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
                LF  L FR  L Y W + W +R   E+CY+ LPAY II N++F PK  E    IP +
Sbjct  520   FGTLFANLQFRMFLCYFWALTWGLRCIPELCYAALPAYSIITNTYFLPKGQEPTYYIPVA  579

Query  887   IFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
             +F++Y++Y L E+++TG S+RAWWNNQRM R+    +WLFGF+  ++K+ G+SE VFEVT
Sbjct  580   LFVLYHIYTLLEHLQTGLSIRAWWNNQRMGRITVMSAWLFGFIGVILKLLGISETVFEVT  639

Query  1067  KKDH--SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSL  1240
             +KD   SSDE     +D++ GRFTFD SP+FVP TTILLV L AL   FL  +      L
Sbjct  640   RKDQSTSSDEG---SEDNEAGRFTFDTSPIFVPPTTILLVQLTALATAFLGLRPQDQDEL  696

Query  1241  G----EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             G    E I SVW++L  W FLKGLFG GK+GIPLST+ KS GL LLF+  C++
Sbjct  697   GSGPLEVISSVWLVLCLWPFLKGLFGTGKYGIPLSTIFKSVGLTLLFYTLCRN  749



>ref|XP_009353304.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Pyrus 
x bretschneideri]
Length=747

 Score =   477 bits (1227),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 247/470 (53%), Positives = 314/470 (67%), Gaps = 13/470 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+P ++LHAMC LLG ++E    F QFPQ FY GLKDDP+
Sbjct  281   VSGLMTNAPFMLNVDCDMFVNNPNIMLHAMCTLLGSENETKNAFAQFPQIFYDGLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWE---T  352
             GNQM ++ K++  G AGIQGP Y GTGC HRRKVIYG+ P      E+  +  + E    
Sbjct  341   GNQMVVLWKFVGHGIAGIQGPIYAGTGCVHRRKVIYGLSPTDTKTGERYPNIGKVEMLKN  400

Query  353   FGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             FG S+ F  S    L G+    + +   S+EAA  V  C YE+GT WG KVG  YGS  E
Sbjct  401   FGTSEEFTKSAGDALQGNT-ECVNMSSKSIEAAHRVGECEYEYGTNWGIKVGWRYGSTTE  459

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  TG+SIH KGW S++C P+PP FLG +PTGGP ++TQQKRW T  L+IL+ K  PI  
Sbjct  460   DILTGLSIHNKGWNSIFCTPDPPAFLGCAPTGGPDSMTQQKRWATGLLEILLSKNCPIFG  519

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIF  892
              LF  L FR  L Y W++ W +R   E+CY+ LPAY II N+HF PK  E    IP ++F
Sbjct  520   TLFANLQFRMFLCYFWVLSWGLRCIPELCYAALPAYSIITNTHFLPKGQEPTYYIPIALF  579

Query  893   IIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKK  1072
             ++Y++Y L E+++TG S+RAWWNNQRM R+    +WLFGF+  ++K+ G++E VFEVT+K
Sbjct  580   VLYHIYTLLEHLQTGLSIRAWWNNQRMGRITVMSAWLFGFIGVILKLLGITETVFEVTRK  639

Query  1073  DH--SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSLG-  1243
             D   SSDE     +DS+ GRFTFD SP+FVP TTILLV L AL   FL  +      LG 
Sbjct  640   DQSTSSDEG---SEDSEAGRFTFDTSPIFVPPTTILLVQLTALATAFLGLRPQDQDKLGS  696

Query  1244  ---EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
                E I SVW++L  W FLKGLFG GK+G+PLST+ KS G  LLF+  C+
Sbjct  697   GPLEVISSVWLVLCLWPFLKGLFGTGKYGLPLSTIFKSVGFTLLFYTLCR  746



>ref|XP_009353303.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Pyrus 
x bretschneideri]
Length=749

 Score =   477 bits (1227),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 247/472 (52%), Positives = 314/472 (67%), Gaps = 15/472 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+P ++LHAMC LLG ++E    F QFPQ FY GLKDDP+
Sbjct  281   VSGLMTNAPFMLNVDCDMFVNNPNIMLHAMCTLLGSENETKNAFAQFPQIFYDGLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEK-----STDKDQW  346
             GNQM ++ K++  G AGIQGP Y GTGC HRRKVIYG+ P      E+     S   +  
Sbjct  341   GNQMVVLWKFVGHGIAGIQGPIYAGTGCVHRRKVIYGLSPTDTKTGERYPNIGSGKVEML  400

Query  347   ETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSA  526
             + FG S+ F  S    L G+    + +   S+EAA  V  C YE+GT WG KVG  YGS 
Sbjct  401   KNFGTSEEFTKSAGDALQGNT-ECVNMSSKSIEAAHRVGECEYEYGTNWGIKVGWRYGST  459

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG+SIH KGW S++C P+PP FLG +PTGGP ++TQQKRW T  L+IL+ K  PI
Sbjct  460   TEDILTGLSIHNKGWNSIFCTPDPPAFLGCAPTGGPDSMTQQKRWATGLLEILLSKNCPI  519

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
                LF  L FR  L Y W++ W +R   E+CY+ LPAY II N+HF PK  E    IP +
Sbjct  520   FGTLFANLQFRMFLCYFWVLSWGLRCIPELCYAALPAYSIITNTHFLPKGQEPTYYIPIA  579

Query  887   IFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
             +F++Y++Y L E+++TG S+RAWWNNQRM R+    +WLFGF+  ++K+ G++E VFEVT
Sbjct  580   LFVLYHIYTLLEHLQTGLSIRAWWNNQRMGRITVMSAWLFGFIGVILKLLGITETVFEVT  639

Query  1067  KKDH--SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSL  1240
             +KD   SSDE     +DS+ GRFTFD SP+FVP TTILLV L AL   FL  +      L
Sbjct  640   RKDQSTSSDEG---SEDSEAGRFTFDTSPIFVPPTTILLVQLTALATAFLGLRPQDQDKL  696

Query  1241  G----EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
             G    E I SVW++L  W FLKGLFG GK+G+PLST+ KS G  LLF+  C+
Sbjct  697   GSGPLEVISSVWLVLCLWPFLKGLFGTGKYGLPLSTIFKSVGFTLLFYTLCR  748



>ref|XP_007217027.1| hypothetical protein PRUPE_ppa001909mg [Prunus persica]
 gb|EMJ18226.1| hypothetical protein PRUPE_ppa001909mg [Prunus persica]
Length=743

 Score =   475 bits (1223),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 243/468 (52%), Positives = 316/468 (68%), Gaps = 13/468 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+P ++ HAMC LLG K+E +  FVQFPQ FY GLKDDP+
Sbjct  281   VSGLMTNAPFMLNVDCDMLVNNPNMMFHAMCMLLGSKNETENAFVQFPQTFYDGLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQM ++ KY  RG +GIQGPFY+GTGC HRRKVIYG+ P+ V       +  +  TFG 
Sbjct  341   GNQMTVVWKYAGRGISGIQGPFYLGTGCVHRRKVIYGLSPNDVKGTNGKPELHK--TFGN  398

Query  362   SKTFALSTTQILSG-SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             S+ F  S    L G + YP++     S+EAA +V  C YE+ T WG+KVG +YGS  ED 
Sbjct  399   SQEFIKSADDALRGKTKYPDM--LSKSMEAAHQVGDCGYEYDTNWGKKVGWMYGSRTEDI  456

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+SIH +GW+S+ C P+PP F G +PTGGPA++TQQKRW T  L+IL+ K  PI   +
Sbjct  457   LTGLSIHKRGWRSIICSPDPPAFQGCAPTGGPASMTQQKRWATGLLEILLSKNCPIFHTI  516

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F  L FR  LAY W+  W +R   E+CY+ LPAY II N+HF PK  E    IP ++F++
Sbjct  517   FANLKFRMFLAYFWVFSWALRSVPELCYAALPAYSIITNTHFLPKGQEPTYYIPIALFVL  576

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             Y++Y L EY++TG S+RAWWNNQRM R+    +WLFG +  ++K+ G SE VFEVT+KD 
Sbjct  577   YHVYTLSEYLQTGLSIRAWWNNQRMGRIIPMSAWLFGVVGVILKLSGRSETVFEVTRKDQ  636

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSLG----E  1246
             S+      D+ ++ G FTFD+SP+FVP TTILLV+L AL       +      L     E
Sbjct  637   ST----STDEGTEAGTFTFDKSPVFVPPTTILLVHLTALATALFGLQPPAHDGLRSGPLE  692

Query  1247  AICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
              +CSVW++L  W FLKGLFG GK+GIP ST+ KS G  LLF+  C ++
Sbjct  693   VVCSVWLVLCLWPFLKGLFGAGKYGIPSSTIFKSAGFTLLFYTLCTNM  740



>ref|XP_010089469.1| Cellulose synthase-like protein H1 [Morus notabilis]
 gb|EXB37862.1| Cellulose synthase-like protein H1 [Morus notabilis]
Length=763

 Score =   476 bits (1224),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 254/472 (54%), Positives = 314/472 (67%), Gaps = 11/472 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK VLHAMC LLG K+EK+  F Q PQ FY GLKDDP+
Sbjct  287   VSGLMTNAPFMLNVDCDMFVNNPKTVLHAMCLLLGPKNEKEVAFCQCPQVFYDGLKDDPF  346

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEK---STDKDQWE-  349
             GNQ+ ++ +YL +G AGIQGPFY GTGCFHRRKVIYG+ P  ++NN     + D    + 
Sbjct  347   GNQLVVLFEYLAKGVAGIQGPFYSGTGCFHRRKVIYGLSPDDIENNTNGKLAKDHKLLQI  406

Query  350   TFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             +FG SK F  +      G          NSLEAA +VA+C YE GT WG+KVG +YGS  
Sbjct  407   SFGSSKDFVTAVADAFKGEKTEFAKSLENSLEAANQVAACGYESGTDWGKKVGWIYGSTT  466

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  T + IH KGW++V   P+PP FLG +PT GP A+TQQKRW T  L+IL+ K  PI 
Sbjct  467   EDINTSLIIHRKGWRTVLSWPDPPAFLGCAPTSGPTAMTQQKRWATGLLEILVSKNCPIF  526

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNS---HFQPKLNEAAIVIP  880
             + LFG+L  RQ LAYLWI+ W +R   E+CY+ L AY II NS    F PK  E A  IP
Sbjct  527   FTLFGKLQLRQGLAYLWILCWGLRSIPELCYAALLAYSIITNSPFLPFLPKSQEPAFYIP  586

Query  881   ASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFE  1060
              ++F+IYNLY L EY  TG+S+RAWWNNQ+M  V +  +W+ G +S  +K+ G+SE VFE
Sbjct  587   IALFVIYNLYTLSEYFATGQSIRAWWNNQKMRIVTSMSAWVLGVVSVALKILGISETVFE  646

Query  1061  VTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSL  1240
             VTKKD S+  +   D D   GRFTFDESP+FVP TT+LLV L AL +     +       
Sbjct  647   VTKKDQSTSSSSSNDTDGDAGRFTFDESPIFVPVTTLLLVQLMALAMVVFGMQPRARGGH  706

Query  1241  GEAI----CSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
             G  I    CS W++L  W  LKGLFGKGK+GIPLST+ KS  LALLF   C+
Sbjct  707   GSGILDVLCSAWLVLCLWPVLKGLFGKGKYGIPLSTLCKSTALALLFVVWCR  758



>ref|XP_008229978.1| PREDICTED: cellulose synthase-like protein B4 isoform X1 [Prunus 
mume]
Length=761

 Score =   473 bits (1218),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 247/485 (51%), Positives = 319/485 (66%), Gaps = 33/485 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+M NAPFMLN+DCD  VN+P ++ HAMC LLG K+E +  FVQFPQ FY GLKDDP+
Sbjct  281   VSGLMRNAPFMLNVDCDMLVNNPNMMFHAMCMLLGSKNETENAFVQFPQTFYDGLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQM ++ KY  RG +GIQGPFY+GTGC HRRKVIYG+ P     N+     D  +TFG 
Sbjct  341   GNQMTVLWKYAGRGISGIQGPFYLGTGCVHRRKVIYGLSP-----NDVKMTNDLLKTFGN  395

Query  362   SKTFALSTTQILSG-SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             SK F  S    L G + YP++     S+EAA +V  C YE+GT WG+KVG +YGS  ED 
Sbjct  396   SKEFTKSVDDALQGKTEYPDM--LSKSMEAAHQVGDCGYEYGTNWGKKVGWMYGSTTEDI  453

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+SIH +GW+S+ C P+PP F G +PTGGPA++TQQKRW T  L+IL+ K  P+   +
Sbjct  454   LTGLSIHKRGWRSIICSPDPPAFQGCAPTGGPASMTQQKRWATGLLEILLSKNCPVFHTI  513

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKL--------------  856
             F  L FR  LAY W+  W +R   E+CY+ LPAY II N+HF PK+              
Sbjct  514   FANLKFRMFLAYFWVFSWALRSVPELCYAALPAYSIITNTHFLPKVRAHPHPWTLGLMQG  573

Query  857   NEAAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVF  1036
              E    IP ++F++Y++Y L EY++TG S+RAWWNNQRM R+    +WLFG +  ++K+ 
Sbjct  574   QEPTYYIPIALFVLYHVYTLSEYLQTGLSIRAWWNNQRMGRITPMSAWLFGVIGVILKLC  633

Query  1037  ---GLSEAVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGF  1207
                G SE VFEVT+KD S+      D+ ++ G FTFD+SP+FVP TTILLV L AL    
Sbjct  634   KLSGRSETVFEVTRKDQST----STDEGTEAGTFTFDKSPIFVPPTTILLVQLTALATAL  689

Query  1208  LDFKQNKSWSLG----EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
                +      LG    E +CSVW++L  W FLKGLFG GK+GIPLST+LKS G  LLF+ 
Sbjct  690   FGLQPPAHDGLGSGPLEVVCSVWLVLCLWPFLKGLFGAGKYGIPLSTILKSAGFTLLFYT  749

Query  1376  ACKSV  1390
              C ++
Sbjct  750   LCTNM  754



>gb|AFZ78580.1| cellulose synthase-like protein [Populus tomentosa]
Length=746

 Score =   473 bits (1216),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 246/466 (53%), Positives = 316/466 (68%), Gaps = 16/466 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  VN+P++ LHAMC LLG K+E+++ FVQ PQ FY GLKDDP+
Sbjct  280   VSGLITNAPFMLNVDCDMFVNNPQIFLHAMCLLLGSKNERESGFVQCPQYFYDGLKDDPF  339

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS--------TDK  337
             GNQ  +  K++  G AGIQGPFY GTGCFHRRKVIYG  P  + N  K         + K
Sbjct  340   GNQFVVGHKFMGNGVAGIQGPFYGGTGCFHRRKVIYGSCPDDIGNQAKRLTPVHGGLSYK  399

Query  338   DQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
             +Q   FG SK F  S    L G         PN +EAA +VA C YE+GT+WG +VG  Y
Sbjct  400   EQLRIFGDSKEFIRSAAHALQGKENISPKNLPNLVEAAHQVAGCGYEYGTSWGTEVGWQY  459

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GSA ED  TG+ IH +G +S++C P+   FLG +P GGP ++TQQKRW T  L+ILI ++
Sbjct  460   GSATEDVLTGLMIHARGKRSLFCTPDRRAFLGCAPRGGPISMTQQKRWATGLLEILISRR  519

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             SPI+  +  RL FRQ L YL  + W +R   E+CY+ LPAYC I +S F P+++E AI I
Sbjct  520   SPIVATVTARLQFRQSLMYLLFLTWGLRSVPELCYAELPAYCTITDSSFLPEVHEPAIYI  579

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
               ++F+ Y +Y L EY+ETG S+RAWWNNQRM R+ A  +W FGF+S ++KV  +S+A F
Sbjct  580   YTALFLSYVIYTLMEYLETGLSIRAWWNNQRMARINAMNAWFFGFISVILKVLRISDAAF  639

Query  1058  EVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGF--LDFKQNKS  1231
             EVT+KD S    L  D D   GRFTFD SP+FVPGTT+LL+ L AL +GF  +    N  
Sbjct  640   EVTQKDQS----LSNDGDE--GRFTFDASPIFVPGTTVLLLQLTALSMGFRGMQLSVNDG  693

Query  1232  WSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
               LGE +CS+ V++ +W FLKGLF KGK+GIPLST+ KS  LAL F
Sbjct  694   SGLGERLCSIMVVICFWPFLKGLFAKGKYGIPLSTIFKSAFLALCF  739



>ref|XP_007217825.1| hypothetical protein PRUPE_ppa026099mg [Prunus persica]
 gb|EMJ19024.1| hypothetical protein PRUPE_ppa026099mg [Prunus persica]
Length=743

 Score =   472 bits (1215),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 248/468 (53%), Positives = 315/468 (67%), Gaps = 10/468 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGV-KDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP MLN+DCD   N+P VVLHAMC LLG  +++ +  F QFPQ FY GLKDDP
Sbjct  280   VSGLMTNAPLMLNVDCDMFANNPSVVLHAMCILLGSNENQNEIAFAQFPQIFYDGLKDDP  339

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFG  358
             +GNQM +I KYL  G  GIQG FY GTGCFHRR+VIYG+ P    NN K  +++  +TFG
Sbjct  340   FGNQMAVIWKYLGHGIQGIQGVFYAGTGCFHRRQVIYGLSP----NNGKLGNQELLKTFG  395

Query  359   KSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
              SK    S    L G       +  +   AA +VASC YE+GT WG+KVG +YGS  ED 
Sbjct  396   NSKELTNSAADALRGETKCPSMLLKSIEAAAYQVASCEYEYGTNWGRKVGWMYGSTTEDI  455

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+SIH +GWKS+ C P+ P FLG +PTGGPA++TQQKRW T  L++L+ K  PI   +
Sbjct  456   LTGLSIHNRGWKSIICTPDQPAFLGCTPTGGPASMTQQKRWATGLLEVLLSKNCPIFGTV  515

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F  L FRQCLAYLWI  W +R   E CY+ LPAY II N+H  PK  E A  IP ++F+ 
Sbjct  516   FAHLQFRQCLAYLWIFTWGLRSLPETCYAALPAYSIITNTHIFPKGQELAYYIPIALFVT  575

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
              N+Y + +YI++G S+RAWWNNQ+M R+ A  +WLFG    V+K+ G+SE VFEVTKKD 
Sbjct  576   TNIYNISQYIQSGLSIRAWWNNQKMGRITAMSAWLFGVFGIVLKLSGISETVFEVTKKDQ  635

Query  1079  SSD-EALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSLG----  1243
             SS  E   +++D++ GRFTFD+SP+FVP TT+LL++L AL       +      LG    
Sbjct  636   SSSTEKGTEEEDTEAGRFTFDKSPMFVPPTTVLLLHLTALASALFGLQPPAHDGLGSGRL  695

Query  1244  EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             E   SV ++L  W FLKGLFG GK+GIPLST+ KS GL L+F   C+S
Sbjct  696   EVAGSVCLVLCLWPFLKGLFGSGKYGIPLSTIFKSAGLTLMFCTLCRS  743



>gb|KDP30772.1| hypothetical protein JCGZ_13715 [Jatropha curcas]
Length=704

 Score =   470 bits (1210),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 249/473 (53%), Positives = 327/473 (69%), Gaps = 26/473 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  VN+P++V HAMCF LG K+E D  FVQ PQ FY GLKDDP+
Sbjct  241   VSGLITNAPFMLNVDCDMFVNNPQIVRHAMCFFLGSKNEGDTAFVQTPQIFYDGLKDDPF  300

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEK--------STDK  337
             GNQ+ ++ +Y+ RG  G+QGPFY GTGCF RRKVIYG+ P+ + +  K          DK
Sbjct  301   GNQLVVLYEYMGRGIVGLQGPFYGGTGCFRRRKVIYGLCPNDIGDFAKFLTPVTGNLDDK  360

Query  338   DQWETFGKSKTFALSTTQILSGSLYPEIPIFPN----SLEAAKEVASCVYEFGTAWGQKV  505
             +    FG SK F  S    L      E    PN    S+EAA  VA+C YE+GTAWG++V
Sbjct  361   ELLNIFGNSKEFITSAANALE-----EKTNRPNDLSDSMEAAYHVAACGYEYGTAWGKQV  415

Query  506   GLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDIL  685
             G  YGS  ED  TG+ IHG+GW+SVYC P+PP FLG +P+GGP ++TQQKRW T  L+IL
Sbjct  416   GWQYGSTTEDVLTGLKIHGRGWRSVYCKPDPPAFLGCAPSGGPTSMTQQKRWATGLLEIL  475

Query  686   ICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEA  865
             + K++PI   +FG+L  RQCLAYLWI  W +R   E+CY +LPAYCII NS+F PK+N+ 
Sbjct  476   VSKRNPIFATIFGKLQLRQCLAYLWIFLWGLRSIPELCYMVLPAYCIITNSNFLPKVNDP  535

Query  866   AIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLS  1045
             AI    ++ IIYN Y L EY++TG S+RAWWN QRM  + ++G+WLFG LS ++K+ G+S
Sbjct  536   AIHGYIALLIIYNTYTLLEYLQTGLSIRAWWNKQRMAIITSTGAWLFGVLSVILKILGIS  595

Query  1046  EAVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN  1225
             + VFEVT+K+ S+ +A         GRFTFD SP+FVPGTT+LL++LA+L +G    +  
Sbjct  596   DTVFEVTQKEQSTSDA---------GRFTFDGSPIFVPGTTLLLLHLASLVMGLFSIRDG  646

Query  1226  KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
             K    GE   S+ V++ +W FLKGLFG+GK+GIPLST+ KS  +   F + CK
Sbjct  647   KGLPFGEMSFSLLVLICFWPFLKGLFGRGKYGIPLSTICKSVIIVSSFVYLCK  699



>ref|XP_010244466.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Nelumbo 
nucifera]
Length=760

 Score =   470 bits (1210),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 246/475 (52%), Positives = 315/475 (66%), Gaps = 19/475 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTN+PFMLN+DCD   NDP+ VLHA+C L G + EK++ +VQFPQ FYG LKDDP+
Sbjct  280   VSGVMTNSPFMLNVDCDMFANDPQTVLHAVCLLFGFQQEKESAYVQFPQAFYGTLKDDPF  339

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS-------TDKD  340
             GNQ+ ++ ++  RG AGIQGP Y GTGCFHRRKVIYG+ P   D N           +K 
Sbjct  340   GNQLVVLQEFAGRGIAGIQGPLYAGTGCFHRRKVIYGLSPDEADINLGRKLSRLLLNEKS  399

Query  341   QWETFGKSKTFALSTTQILSG--SLYPEIPIFPNS--LEAAKEVASCVYEFGTAWGQKVG  508
                 FG S  F  S ++IL+G      + P   +S  LEAA +VASC YE  T WG KVG
Sbjct  400   LKANFGNSVEFMKSASEILAGVKEKMDDPPALDDSTTLEAAIQVASCGYERDTYWGTKVG  459

Query  509   LLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILI  688
              +YGS  ED  TG+ IH KGW SVY  P+PP FLGS+P+GGPA +TQQKRW T   ++L 
Sbjct  460   WVYGSTTEDVLTGLKIHSKGWNSVYMTPDPPAFLGSAPSGGPACMTQQKRWATGLFEVLF  519

Query  689   CKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAA  868
                SPI+     RL FRQ LAYL++  W IR   E+CY+LLP+Y I  N  F P ++EAA
Sbjct  520   NNYSPILPFRTTRLMFRQRLAYLYLNVWSIRSVPELCYALLPSYAIFANKQFLPTVSEAA  579

Query  869   IVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSE  1048
               +P ++FI +NLY L E++  G ++RAWWNNQRM R+ ++ +WLFG L  ++K+ GLSE
Sbjct  580   FFLPVALFITFNLYTLSEFLRCGLTIRAWWNNQRMARIISATAWLFGLLGVILKLLGLSE  639

Query  1049  AVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ--  1222
               FE+T+KD   D   D D +   G FTFDESP+FVPGT +LLV++ AL +G L  +   
Sbjct  640   TTFEITRKDQ--DTPNDSDTEVDAGVFTFDESPIFVPGTALLLVHMTALAVGLLRVQSWL  697

Query  1223  ----NKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
                 +  + LGE ICS+WV+L +  FLKGLF KG +GIP ST+ KS  LALLF H
Sbjct  698   NINGSAGYGLGEIICSIWVVLSFLPFLKGLFRKGIYGIPTSTIYKSAALALLFVH  752



>ref|XP_007049092.1| Cellulose synthase-like B3, putative isoform 1 [Theobroma cacao]
 gb|EOX93249.1| Cellulose synthase-like B3, putative isoform 1 [Theobroma cacao]
Length=747

 Score =   468 bits (1205),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 251/475 (53%), Positives = 317/475 (67%), Gaps = 20/475 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPF+LN+DCD  VN+P+V  HAMC LLG K+E++  FVQ+PQ FY GL+DDPY
Sbjct  280   VSGVMTNAPFILNVDCDMFVNNPQVFRHAMCQLLGSKNERETAFVQYPQVFYDGLRDDPY  339

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDN--------NEKSTDK  337
             GNQ  +  +Y+ RG AGIQGPFY GTGCFHRRKVIYG+WP   +N        N KS D 
Sbjct  340   GNQFVVPYQYMCRGIAGIQGPFYGGTGCFHRRKVIYGVWPRDRENEARNCTSINGKSVDD  399

Query  338   DQWETFGKSKTFALSTTQILSGSL-YPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLL  514
                  FG S+    S  Q L G   +P      NSLEAA +VASC YE+GT+WG K G +
Sbjct  400   TLLNEFGNSEELINSAVQALKGKKGFPNN--LSNSLEAACKVASCSYEYGTSWGTKCGWI  457

Query  515   YGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICK  694
             YG+  ED  TG+ IH KGW S    P  PGF+G +P+GGP A+ QQKRW T   +IL+ K
Sbjct  458   YGATAEDLLTGLKIHAKGWNSALHMPELPGFMGCTPSGGPEAMAQQKRWATGLAEILVGK  517

Query  695   KSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIV  874
               PII  L  +L FR CLAYLWI+ W +R   ++CY+ LPAYCI+ NSHF PK+ E AI 
Sbjct  518   NCPIIATLTAKLQFRMCLAYLWILFWGLRSIPQLCYAALPAYCILANSHFLPKVEEPAIW  577

Query  875   IPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAV  1054
             IP + F+ YNL+ L EY++ G S+RAWWNN RM  + A+ ++LFG  + ++K+  +SE V
Sbjct  578   IPIATFVTYNLHTLREYLKAGLSIRAWWNNLRMGSITATSAYLFGLFAAILKLLRISETV  637

Query  1055  FEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDF----KQ  1222
             FEVT+KD S D      DD  V +FTF+ES +FVPGTT+LLV+L +L             
Sbjct  638   FEVTQKDQSCD-----GDDPDVTKFTFNESAVFVPGTTLLLVHLISLLCLSSKLPTPVHD  692

Query  1223  NKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
                  LGE  CS+WV+L +W FL GLF +GK+GIPLST+LKS  LALLF H C++
Sbjct  693   MHGVGLGEVFCSLWVVLCFWPFLNGLFERGKYGIPLSTILKSAALALLFVHFCRT  747



>ref|XP_009347146.1| PREDICTED: cellulose synthase-like protein H1 [Pyrus x bretschneideri]
Length=740

 Score =   467 bits (1202),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 245/473 (52%), Positives = 313/473 (66%), Gaps = 24/473 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+P ++LHAMC LLG ++E    F QFPQ FY GLKDDP+
Sbjct  281   VSGLMTNAPFMLNVDCDMFVNNPDIMLHAMCTLLGSENETKNAFAQFPQIFYDGLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEK-----STDKDQW  346
             GNQM ++MK++  G AGIQGP Y GTGC HRRKVIYG+ P      E+     S   +  
Sbjct  341   GNQMVVLMKFVGHGIAGIQGPIYAGTGCVHRRKVIYGLSPTDTKTGERYPNIGSGKVEML  400

Query  347   ETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSA  526
             + FG S+ F  S    L G+    + +   S++AA  V  C YE+GT WG K+ LL    
Sbjct  401   KNFGTSEEFTKSAGDALQGNT-ECVNMSSKSIDAAHRVGGCEYEYGTNWGIKISLL----  455

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
                  TG+SIH KGW S++C P+PP FLG +PTGGP ++TQQKRW T  L+IL+ K  PI
Sbjct  456   -----TGLSIHNKGWNSIFCTPDPPAFLGCAPTGGPDSMTQQKRWATGLLEILLSKNCPI  510

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
                LF  L FR  L Y W++ W +R   E+CY+ LPAY II N+HF PK  E    IP +
Sbjct  511   FGTLFANLQFRMFLCYFWVLSWGLRCIPELCYAALPAYSIITNTHFLPKGQEPTYYIPIA  570

Query  887   IFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
             +F++Y++Y L E+++TG S+RAWWNNQRM R+    +WLFGF+  ++K+ G++E VFEVT
Sbjct  571   LFVLYHIYTLLEHLQTGLSIRAWWNNQRMGRITVMSAWLFGFIGVILKLLGITETVFEVT  630

Query  1067  KKDH--SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSL  1240
             KKD   SSDE     +DS+ GRFTFD SP+FVP TTILLV L AL   FL  +      L
Sbjct  631   KKDQSTSSDEG---SEDSEAGRFTFDTSPIFVPPTTILLVQLTALATAFLGLRPQDQDKL  687

Query  1241  G----EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             G    E I SVW++L  W FLKGLFG GK+GIPLST+ KS GL LLF+  C++
Sbjct  688   GSGPLEVISSVWLVLCLWPFLKGLFGTGKYGIPLSTIFKSVGLTLLFYTLCRN  740



>emb|CAN72832.1| hypothetical protein VITISV_017982 [Vitis vinifera]
Length=1332

 Score =   481 bits (1238),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 256/469 (55%), Positives = 320/469 (68%), Gaps = 13/469 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG MTNAPFMLN+DCD + N+P++  H+MC LL  K+E+D  FVQ PQ+FY GLKDDP+
Sbjct  862   VSGAMTNAPFMLNVDCDMYANNPQIFHHSMCLLLXSKNEQDCGFVQTPQSFYDGLKDDPF  921

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP----HVVDNNEKSTDKDQWE  349
             GNQ  ++ KY+  G AG+QGP Y GTGCFHRRKVIYG+WP           K TD+   +
Sbjct  922   GNQFGVLYKYVASGIAGLQGPHYSGTGCFHRRKVIYGLWPDGRMEFKGRIGKLTDERLEK  981

Query  350   TFGKSKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
             TFG SK F  +  +ILSG S   + P    N +EAA ++ASC YE+G  WG K+G LYG+
Sbjct  982   TFGNSKEFTKTAARILSGLSGVSDCPYDLSNRVEAAHQIASCSYEYGANWGTKIGWLYGT  1041

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG+ IH +GWKS  C P+PP FLG +P+GGPAAL QQKRW T  L++L  K SP
Sbjct  1042  TTEDILTGMRIHARGWKSTDCRPDPPAFLGCAPSGGPAALIQQKRWATGLLEVLFSKNSP  1101

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
              I     +L FRQCLAY+WI+ W +RP  E  Y  LPAYCI+  SHF P + + A++IP 
Sbjct  1102  FIITFTAKLQFRQCLAYMWILSWGLRPIPEPYYLALPAYCIMAGSHFLPNVQDPAVLIPI  1161

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             S+F+ YN + L EY   G S+RA WNN RM R+ A  +WLFGFLS ++K+ GLSE VFEV
Sbjct  1162  SLFVSYNFHTLLEYWGAGYSIRACWNNLRMWRITAVTAWLFGFLSVILKLLGLSETVFEV  1221

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAAL---FIGFLDFKQNKSW  1234
             TKKD S+      D D+  GRFTFD S +FVP TT+LLV+L AL    +G  D  + +S 
Sbjct  1222  TKKDQSTTPGEGSDKDA--GRFTFDGSLIFVPATTLLLVHLMALVTALLGLFDHVEIES-  1278

Query  1235  SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
              +GE ICSVWV+L +  FLKGLFGKGK+GIP ST+ KS  LA LFF AC
Sbjct  1279  RIGEIICSVWVVLCFSPFLKGLFGKGKYGIPKSTICKSAALAFLFF-AC  1326



>ref|XP_010930913.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Elaeis 
guineensis]
Length=558

 Score =   459 bits (1180),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 235/468 (50%), Positives = 306/468 (65%), Gaps = 11/468 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD   N+P+V+LH MC LLG  +E    FVQ PQ FYG LKDDP+
Sbjct  88    VSGVMTNAPFMLNVDCDMFANNPEVILHGMCLLLGFDNEVSTGFVQAPQQFYGALKDDPF  147

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHV--VDNNEKSTDKDQWETF  355
             GNQ+ ++      G  GIQGPFY GTGCFHRRK++YG  P +  V  ++  +DK+    +
Sbjct  148   GNQLVVLQGITGVGFGGIQGPFYGGTGCFHRRKILYGSAPGLAGVSKHDDLSDKEPQRIY  207

Query  356   GKSKTFALSTTQILSGSLYPEI--PIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             G S+    S ++I+SG +          + +E AK VASC YEF T WG+++G  YGS  
Sbjct  208   GDSRELMESASRIISGKIRESSCNNNLSSRVEVAKRVASCSYEFNTCWGKQIGWAYGSMT  267

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG+ IH  GWKSVY   +PP FLGS+PTGGPA+LTQ KRW T  L+I   + SPI+
Sbjct  268   EDVLTGLRIHSMGWKSVYLILDPPAFLGSAPTGGPASLTQYKRWSTGLLEISWGRSSPIL  327

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
                  +L FR CLAYL    W +R   E+CY+LLPAYC++ N+ F PK +E   VIP + 
Sbjct  328   ATFTKQLKFRMCLAYLLASTWALRSMGELCYALLPAYCLLANTSFMPKASEPVFVIPLAP  387

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+I N++ + EY + G S+RA+WNNQRM R+YA  +WLFG L  ++K+ G+SE +FEVT+
Sbjct  388   FLISNIHSIIEYFQCGLSVRAYWNNQRMHRIYAMTAWLFGLLGVLLKILGISETIFEVTR  447

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ----NKSWS  1237
             KD  SD     D D   GRFTFD SP+FV GT +LLVNL AL +G L  ++      S  
Sbjct  448   KDQQSDT---NDTDKDPGRFTFDNSPMFVSGTAVLLVNLVALAVGLLRLRRPVDGGPSSG  504

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
             LGE  CSVWV+  +W F++GL G+G +GIP   +LK+  LA LF   C
Sbjct  505   LGEFACSVWVVFSFWPFVRGLVGRGSYGIPWPVILKAAVLASLFMQFC  552



>ref|XP_009416905.1| PREDICTED: cellulose synthase-like protein H1 [Musa acuminata 
subsp. malaccensis]
Length=740

 Score =   464 bits (1194),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 231/469 (49%), Positives = 309/469 (66%), Gaps = 9/469 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD   N+P+VVLH MC LLGV DE  + F Q PQ FYG LKDDP+
Sbjct  273   VSGVMTNAPFMLNVDCDMFANNPEVVLHGMCLLLGVDDEVFSGFAQAPQQFYGALKDDPF  332

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGM--WPHVVDNNEKSTDKDQWETF  355
             GNQ+ +++K +  G  G+QGPFY GTGCFHRRKVIYG    P  ++     + ++    +
Sbjct  333   GNQLVVLLKKILPGLQGLQGPFYTGTGCFHRRKVIYGSPPGPPSIEKRGNLSCEELEMIY  392

Query  356   GKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGED  535
             G S  F  S  QI SG          + +EAAK+VA C YE  T+WG+++G +YGS  ED
Sbjct  393   GNSLEFVESALQITSGYGKGLPANLSSRVEAAKKVADCAYEVNTSWGREIGWVYGSITED  452

Query  536   TKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWA  715
               TG+ IH  GW+S+   P PP FLG +PTGGPA+LTQ KRW T  L+IL+ ++SPI+  
Sbjct  453   ILTGLRIHSMGWRSISMTPEPPAFLGCAPTGGPASLTQFKRWATGLLEILLSRRSPILAV  512

Query  716   LFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFI  895
             +  +L  RQCLAYL I+ WP+R  FE+CY+LLPAYC++ +S F PK +E   ++P ++F+
Sbjct  513   MEEKLMLRQCLAYLLILVWPLRSVFELCYALLPAYCLLADSAFLPKASELGFLVPMALFL  572

Query  896   IYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKD  1075
             IYN+Y L EY + G S+RAWWNNQRM R+YA  SWL GF S ++K+ G SE +FEVT+KD
Sbjct  573   IYNVYTLTEYFQYGLSIRAWWNNQRMQRIYAQTSWLLGFFSALLKIMGFSETIFEVTRKD  632

Query  1076  HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW-----SL  1240
                   +   DD   GRFTFD SP+FV GT ++L+NL AL +G +              +
Sbjct  633   QPKPTDVTGADDP--GRFTFDSSPVFVSGTAVMLINLTALVVGSMRVLWQAEAGEIGPGI  690

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             GE +CS WV+L +W F++GL G+G +GIP S + K+      F   C++
Sbjct  691   GEFVCSAWVLLSFWPFVRGLVGRGSYGIPWSVICKAAVPVCFFLQMCRN  739



>ref|XP_008229980.1| PREDICTED: cellulose synthase-like protein B4 isoform X1 [Prunus 
mume]
Length=736

 Score =   464 bits (1193),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 242/467 (52%), Positives = 311/467 (67%), Gaps = 10/467 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGV-KDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAPFMLN+DCD   N+P VVLHAMC LLG  +++ +  F QFPQ FY GLKDDP
Sbjct  275   VSGLMTNAPFMLNVDCDMFANNPSVVLHAMCILLGSNENQNEIAFAQFPQIFYDGLKDDP  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFG  358
             +GNQM +I KY+  G  GIQG FY GTGCFHRR+VIYG+ P    NN K  +++  +TFG
Sbjct  335   FGNQMAVIWKYMGHGIQGIQGIFYAGTGCFHRRQVIYGLSP----NNGKLGNQELLKTFG  390

Query  359   KSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
              SK    S    L G       +  +   AA +VASC YE+GT WG+KVG +YGS  ED 
Sbjct  391   NSKELTKSAADALRGETKCPSLLLKSIDAAAYQVASCEYEYGTNWGRKVGWMYGSTTEDI  450

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+SIH +GWKS++C P+ P FLG +PTGGPA++TQQKRW T  L++L+ K  PI   +
Sbjct  451   LTGLSIHNRGWKSIFCTPDQPAFLGCTPTGGPASMTQQKRWATGLLEVLLSKNCPIFGTV  510

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F  L FRQCLAYLWI  W +R   E CY+ LPAY II N+H  PK  E A  IP ++F+ 
Sbjct  511   FAHLQFRQCLAYLWIFTWGLRSLPETCYAALPAYSIITNTHIFPKHQELAYYIPITLFVT  570

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
              N+Y + +YI++G S+RAWWNNQ+M R+    +WLFG    V+K+ G+SE VFEVTKKD 
Sbjct  571   TNMYNISQYIQSGLSIRAWWNNQKMGRITTMSAWLFGVFGIVLKLSGISETVFEVTKKDQ  630

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSLG----E  1246
             SS      +++ +  RFTFD+SP+FVP T +LL++L AL       +      +G    E
Sbjct  631   SSSTEKGTEEE-EASRFTFDKSPMFVPPTAVLLLHLTALASALFGLQPPAHDGVGSGRLE  689

Query  1247  AICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
                SV ++L  W FLKGLFG GK+GIPLST+ KS GL L+F   C+S
Sbjct  690   VAGSVCLVLCLWPFLKGLFGSGKYGIPLSTIFKSAGLTLMFCTLCRS  736



>emb|CBI28833.3| unnamed protein product [Vitis vinifera]
Length=1566

 Score =   484 bits (1245),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 248/469 (53%), Positives = 321/469 (68%), Gaps = 8/469 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG MTNAPF+LN+DCD + N+ ++V HAMC LLG K  +D  F Q PQ FY GLKDDP 
Sbjct  1097  VSGAMTNAPFILNVDCDMYANNSQIVFHAMCLLLGCKKGQDFAFAQSPQIFYDGLKDDPL  1156

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH---VVDNNEKSTDKDQWET  352
             GNQ+    KY+  G +G+QGP+Y GTGCFHRRKV+YG+WP          K TD+   ++
Sbjct  1157  GNQLVATQKYIGEGISGLQGPYYSGTGCFHRRKVLYGLWPDGCMETGGRSKLTDEGLRQS  1216

Query  353   FGKSKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSA  526
             FG S+ F+ +  +ILSG S   + P    +S EAA +VA C YE GT+WG K+G +YGS 
Sbjct  1217  FGHSREFSKTVERILSGLSGKADCPYDLSSSAEAANQVADCGYECGTSWGTKIGWIYGST  1276

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG+ IH +GW+S  C P+PP FLG +P+GGPA+LTQQKRW T  L+IL  K +P 
Sbjct  1277  SEDVLTGLKIHARGWRSAECKPDPPAFLGCAPSGGPASLTQQKRWVTGLLEILFSKNNPF  1336

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
             I  L  +L FRQCLAY++I+ W +R   E+CY  LPAYCII NSHF PK+ E A +I A+
Sbjct  1337  IATLTAKLQFRQCLAYMYILSWGLRWIPELCYIALPAYCIIANSHFLPKVEEPAFLILAA  1396

Query  887   IFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
             +F IYNL+ L EY   G S+R WWNNQRM R+    +W FGFL+ ++K+ GL EAVFEVT
Sbjct  1397  LFAIYNLHSLLEYCRIGLSIRTWWNNQRMGRIITMTAWFFGFLNVILKLLGLFEAVFEVT  1456

Query  1067  KKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS-LG  1243
             +K+ SS    D   D+  GRFTF+ESP+FVP TT++LV+L A+    L+    +  S +G
Sbjct  1457  QKNQSSASGDDNHKDA--GRFTFNESPIFVPATTLVLVHLVAMVKALLNLTHGRHESRIG  1514

Query  1244  EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
             E IC+VWV+L +  FLKGLF KGK+GIP ST+ KS  LA +F H C+ V
Sbjct  1515  EVICNVWVLLCFLPFLKGLFKKGKYGIPSSTICKSAALAAVFVHLCERV  1563


 Score =   464 bits (1193),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 250/458 (55%), Positives = 311/458 (68%), Gaps = 12/458 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG MTNAPFMLN+DCD + N+P++  HAMC LLG K E+D  FVQ PQ FY  +KDDP 
Sbjct  281   VSGAMTNAPFMLNVDCDMYANNPQIFHHAMCLLLGSKSEQDCGFVQSPQMFYDVVKDDPL  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP----HVVDNNEKSTDKDQWE  349
             GNQM ++ KY+  G AG+QGP Y GTGCFHRRKVIYG WP     +   N K TD+   +
Sbjct  341   GNQMVVLFKYVGSGIAGLQGPLYSGTGCFHRRKVIYGSWPDGRMEIKGRNGKLTDERLEK  400

Query  350   TFGKSKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
             TFG SK F  +  +ILSG S   + P    N +EAA ++ASC YE+GT+WG K+G LYG+
Sbjct  401   TFGNSKEFTKTAARILSGLSGISDCPYDLSNRVEAAYQIASCSYEYGTSWGTKIGWLYGT  460

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG+ IH +GWKS  C P+PP FLG +P+ GPAALTQQKRW T  L++L  K SP
Sbjct  461   TTEDILTGMRIHARGWKSTDCRPDPPAFLGCAPSDGPAALTQQKRWATGLLEVLFSKNSP  520

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
              I     +L FRQCLAY+WI+ W +RP  E+CY  LPAYCI+  SHF PK++E A++IP 
Sbjct  521   PIATFTAKLQFRQCLAYMWIISWGLRPIPELCYLALPAYCIMAGSHFLPKVHEPAVLIPI  580

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             S+F+ Y  + LFEY   G S+RA  NN  M R+    SWLFGFLS ++K+ GL E VFEV
Sbjct  581   SLFVSYKFHTLFEYYGAGFSIRACLNNLMMGRIITVTSWLFGFLSVILKLLGLLETVFEV  640

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAAL---FIGFLDFKQNKSW  1234
             TKKD  +      D D+  G FTFD S +FVP TT+LLV+L AL    +G  D    +S 
Sbjct  641   TKKDLYTTPGEGSDKDA--GGFTFDGSLIFVPATTLLLVHLMALVTALLGLFDHVGIES-  697

Query  1235  SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKS  1348
              +GE ICSVWV+L +  FLKGLFGKGK+GIP ST+ KS
Sbjct  698   RIGEIICSVWVVLCFSPFLKGLFGKGKYGIPTSTICKS  735



>ref|XP_003633282.1| PREDICTED: cellulose synthase-like protein H1 [Vitis vinifera]
Length=751

 Score =   464 bits (1193),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 250/458 (55%), Positives = 311/458 (68%), Gaps = 12/458 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG MTNAPFMLN+DCD + N+P++  HAMC LLG K E+D  FVQ PQ FY  +KDDP 
Sbjct  281   VSGAMTNAPFMLNVDCDMYANNPQIFHHAMCLLLGSKSEQDCGFVQSPQMFYDVVKDDPL  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP----HVVDNNEKSTDKDQWE  349
             GNQM ++ KY+  G AG+QGP Y GTGCFHRRKVIYG WP     +   N K TD+   +
Sbjct  341   GNQMVVLFKYVGSGIAGLQGPLYSGTGCFHRRKVIYGSWPDGRMEIKGRNGKLTDERLEK  400

Query  350   TFGKSKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
             TFG SK F  +  +ILSG S   + P    N +EAA ++ASC YE+GT+WG K+G LYG+
Sbjct  401   TFGNSKEFTKTAARILSGLSGISDCPYDLSNRVEAAYQIASCSYEYGTSWGTKIGWLYGT  460

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG+ IH +GWKS  C P+PP FLG +P+ GPAALTQQKRW T  L++L  K SP
Sbjct  461   TTEDILTGMRIHARGWKSTDCRPDPPAFLGCAPSDGPAALTQQKRWATGLLEVLFSKNSP  520

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
              I     +L FRQCLAY+WI+ W +RP  E+CY  LPAYCI+  SHF PK++E A++IP 
Sbjct  521   PIATFTAKLQFRQCLAYMWIISWGLRPIPELCYLALPAYCIMAGSHFLPKVHEPAVLIPI  580

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             S+F+ Y  + LFEY   G S+RA  NN  M R+    SWLFGFLS ++K+ GL E VFEV
Sbjct  581   SLFVSYKFHTLFEYYGAGFSIRACLNNLMMGRIITVTSWLFGFLSVILKLLGLLETVFEV  640

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAAL---FIGFLDFKQNKSW  1234
             TKKD  +      D D+  G FTFD S +FVP TT+LLV+L AL    +G  D    +S 
Sbjct  641   TKKDLYTTPGEGSDKDA--GGFTFDGSLIFVPATTLLLVHLMALVTALLGLFDHVGIES-  697

Query  1235  SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKS  1348
              +GE ICSVWV+L +  FLKGLFGKGK+GIP ST+ KS
Sbjct  698   RIGEIICSVWVVLCFSPFLKGLFGKGKYGIPTSTICKS  735



>ref|XP_010244467.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Nelumbo 
nucifera]
Length=749

 Score =   462 bits (1190),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 242/468 (52%), Positives = 312/468 (67%), Gaps = 16/468 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTN+PFMLN+DCD   NDP+ VLHA+C L G + EK++ +VQFPQ FYG LKDDP+
Sbjct  280   VSGVMTNSPFMLNVDCDMFANDPQTVLHAVCLLFGFQQEKESAYVQFPQAFYGTLKDDPF  339

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ+ ++ ++  RG AGIQGP Y GTGCFHRRKVIYG+ P   D N       +      
Sbjct  340   GNQLVVLQEFAGRGIAGIQGPLYAGTGCFHRRKVIYGLSPDEADINLGR----KLSRLLL  395

Query  362   SKTFALSTTQILSG--SLYPEIPIFPNS--LEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             +  F  S ++IL+G      + P   +S  LEAA +VASC YE  T WG KVG +YGS  
Sbjct  396   NVEFMKSASEILAGVKEKMDDPPALDDSTTLEAAIQVASCGYERDTYWGTKVGWVYGSTT  455

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG+ IH KGW SVY  P+PP FLGS+P+GGPA +TQQKRW T   ++L    SPI+
Sbjct  456   EDVLTGLKIHSKGWNSVYMTPDPPAFLGSAPSGGPACMTQQKRWATGLFEVLFNNYSPIL  515

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
                  RL FRQ LAYL++  W IR   E+CY+LLP+Y I  N  F P ++EAA  +P ++
Sbjct  516   PFRTTRLMFRQRLAYLYLNVWSIRSVPELCYALLPSYAIFANKQFLPTVSEAAFFLPVAL  575

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             FI +NLY L E++  G ++RAWWNNQRM R+ ++ +WLFG L  ++K+ GLSE  FE+T+
Sbjct  576   FITFNLYTLSEFLRCGLTIRAWWNNQRMARIISATAWLFGLLGVILKLLGLSETTFEITR  635

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ------NKS  1231
             KD   D   D D +   G FTFDESP+FVPGT +LLV++ AL +G L  +       +  
Sbjct  636   KDQ--DTPNDSDTEVDAGVFTFDESPIFVPGTALLLVHMTALAVGLLRVQSWLNINGSAG  693

Query  1232  WSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
             + LGE ICS+WV+L +  FLKGLF KG +GIP ST+ KS  LALLF H
Sbjct  694   YGLGEIICSIWVVLSFLPFLKGLFRKGIYGIPTSTIYKSAALALLFVH  741



>ref|XP_010930912.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Elaeis 
guineensis]
Length=745

 Score =   458 bits (1178),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 235/468 (50%), Positives = 306/468 (65%), Gaps = 11/468 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD   N+P+V+LH MC LLG  +E    FVQ PQ FYG LKDDP+
Sbjct  275   VSGVMTNAPFMLNVDCDMFANNPEVILHGMCLLLGFDNEVSTGFVQAPQQFYGALKDDPF  334

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHV--VDNNEKSTDKDQWETF  355
             GNQ+ ++      G  GIQGPFY GTGCFHRRK++YG  P +  V  ++  +DK+    +
Sbjct  335   GNQLVVLQGITGVGFGGIQGPFYGGTGCFHRRKILYGSAPGLAGVSKHDDLSDKEPQRIY  394

Query  356   GKSKTFALSTTQILSGSLYPEI--PIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             G S+    S ++I+SG +          + +E AK VASC YEF T WG+++G  YGS  
Sbjct  395   GDSRELMESASRIISGKIRESSCNNNLSSRVEVAKRVASCSYEFNTCWGKQIGWAYGSMT  454

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG+ IH  GWKSVY   +PP FLGS+PTGGPA+LTQ KRW T  L+I   + SPI+
Sbjct  455   EDVLTGLRIHSMGWKSVYLILDPPAFLGSAPTGGPASLTQYKRWSTGLLEISWGRSSPIL  514

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
                  +L FR CLAYL    W +R   E+CY+LLPAYC++ N+ F PK +E   VIP + 
Sbjct  515   ATFTKQLKFRMCLAYLLASTWALRSMGELCYALLPAYCLLANTSFMPKASEPVFVIPLAP  574

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+I N++ + EY + G S+RA+WNNQRM R+YA  +WLFG L  ++K+ G+SE +FEVT+
Sbjct  575   FLISNIHSIIEYFQCGLSVRAYWNNQRMHRIYAMTAWLFGLLGVLLKILGISETIFEVTR  634

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ----NKSWS  1237
             KD  SD     D D   GRFTFD SP+FV GT +LLVNL AL +G L  ++      S  
Sbjct  635   KDQQSDT---NDTDKDPGRFTFDNSPMFVSGTAVLLVNLVALAVGLLRLRRPVDGGPSSG  691

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
             LGE  CSVWV+  +W F++GL G+G +GIP   +LK+  LA LF   C
Sbjct  692   LGEFACSVWVVFSFWPFVRGLVGRGSYGIPWPVILKAAVLASLFMQFC  739



>ref|XP_004287960.1| PREDICTED: cellulose synthase-like protein H1-like [Fragaria 
vesca subsp. vesca]
Length=755

 Score =   457 bits (1176),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 246/477 (52%), Positives = 323/477 (68%), Gaps = 23/477 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTN+P+MLN+DCD  VN P ++LHAMC LLG K+E +  FVQ PQ FY GLKDDP+
Sbjct  285   VSGLMTNSPYMLNVDCDMFVNSPNIILHAMCMLLGPKNENENAFVQCPQVFYDGLKDDPF  344

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNE---------KSTD  334
             GNQM ++ KY+ +G +GIQGPFY GTGC HRRKVIYG++P+ V   E         KS D
Sbjct  345   GNQMIVLWKYVAQGISGIQGPFYSGTGCVHRRKVIYGLFPNFVKVGETNAKTMMKGKSAD  404

Query  335   KDQWETFGKSKTFALSTTQILSGSLYPEIP-IFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             ++ +  FGK   FA S    L+G    E P +   ++EAA +VA   YE+GT WG KVG 
Sbjct  405   EELFHMFGKE--FAKSAANALNGK--AECPDMLTTTIEAAYQVAGVDYEYGTHWGNKVGW  460

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             +YGS  ED  TG+SIH KGW+S+   P PP FLG +PTGGPA++TQQKRW T  L+ILI 
Sbjct  461   MYGSTTEDVLTGLSIHNKGWRSILYAPKPPAFLGCAPTGGPASMTQQKRWATGLLEILIS  520

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K  PI   LF  L FRQCL YLWI+ W +R   E+CY+ LPAY II NS+F PK  + A 
Sbjct  521   KNCPIFGTLFANLQFRQCLGYLWILSWGLRSVPELCYAALPAYSIITNSNFLPKDQDPAY  580

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
              IP ++F++Y++Y L EY+ TG S+RAWWNNQRM R+ A  ++ FG +  ++K+ G+SE 
Sbjct  581   YIPLAVFVVYSMYTLSEYLRTGLSIRAWWNNQRMGRITAMSAFFFGVVGVILKLLGISET  640

Query  1052  VFEVTKKDH--SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN  1225
             VFEVT+K+   SSDE     +D++ G+FTFD+SP+F+P T +LL+ L AL    L  +  
Sbjct  641   VFEVTRKEQSTSSDEG---TEDTEAGKFTFDQSPIFIPPTAVLLLQLTALATALLGLQLP  697

Query  1226  KSWSLG----EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
                 +G    E +CSV +++  W FLKGLFG GK+GIPLST+ KS GL L  +  C+
Sbjct  698   ARDGVGSGSLETMCSVLLVVCLWPFLKGLFGSGKYGIPLSTIFKSAGLVLFIYTLCR  754



>ref|XP_008229981.1| PREDICTED: cellulose synthase-like protein B4 isoform X2 [Prunus 
mume]
Length=730

 Score =   456 bits (1172),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 239/467 (51%), Positives = 307/467 (66%), Gaps = 16/467 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGV-KDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAPFMLN+DCD   N+P VVLHAMC LLG  +++ +  F QFPQ FY GLKDDP
Sbjct  275   VSGLMTNAPFMLNVDCDMFANNPSVVLHAMCILLGSNENQNEIAFAQFPQIFYDGLKDDP  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFG  358
             +GNQM +I KY+  G  GIQG FY GTGCFHRR+VIYG          K  +++  +TFG
Sbjct  335   FGNQMAVIWKYMGHGIQGIQGIFYAGTGCFHRRQVIYG----------KLGNQELLKTFG  384

Query  359   KSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
              SK    S    L G       +  +   AA +VASC YE+GT WG+KVG +YGS  ED 
Sbjct  385   NSKELTKSAADALRGETKCPSLLLKSIDAAAYQVASCEYEYGTNWGRKVGWMYGSTTEDI  444

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+SIH +GWKS++C P+ P FLG +PTGGPA++TQQKRW T  L++L+ K  PI   +
Sbjct  445   LTGLSIHNRGWKSIFCTPDQPAFLGCTPTGGPASMTQQKRWATGLLEVLLSKNCPIFGTV  504

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F  L FRQCLAYLWI  W +R   E CY+ LPAY II N+H  PK  E A  IP ++F+ 
Sbjct  505   FAHLQFRQCLAYLWIFTWGLRSLPETCYAALPAYSIITNTHIFPKHQELAYYIPITLFVT  564

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
              N+Y + +YI++G S+RAWWNNQ+M R+    +WLFG    V+K+ G+SE VFEVTKKD 
Sbjct  565   TNMYNISQYIQSGLSIRAWWNNQKMGRITTMSAWLFGVFGIVLKLSGISETVFEVTKKDQ  624

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSLG----E  1246
             SS      +++ +  RFTFD+SP+FVP T +LL++L AL       +      +G    E
Sbjct  625   SSSTEKGTEEE-EASRFTFDKSPMFVPPTAVLLLHLTALASALFGLQPPAHDGVGSGRLE  683

Query  1247  AICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
                SV ++L  W FLKGLFG GK+GIPLST+ KS GL L+F   C+S
Sbjct  684   VAGSVCLVLCLWPFLKGLFGSGKYGIPLSTIFKSAGLTLMFCTLCRS  730



>ref|XP_010252472.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Nelumbo 
nucifera]
Length=743

 Score =   456 bits (1172),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 240/469 (51%), Positives = 314/469 (67%), Gaps = 23/469 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTN+PF+LN+DCD  VN+P+ +LHAMC LLG + EK++ FVQFPQ FY  LKDDP+
Sbjct  279   VSGVMTNSPFILNVDCDMFVNNPQTILHAMCLLLGFEQEKESGFVQFPQIFYRSLKDDPF  338

Query  182   GNQMKIIM-KYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFG  358
             GN   I+  K++  G  GIQGPFY GTGCFHRRKVIYG+ P     +E +       TFG
Sbjct  339   GNNQFIVFWKFIMPGIVGIQGPFYGGTGCFHRRKVIYGLSP-----DEATIQGAMETTFG  393

Query  359   KSKTFALSTTQILSGSLYPEIPIFPNSL----EAAKEVASCVYEFGTAWGQKVGLLYGSA  526
              S  F  S  QILSG +  +    P  L    EAA EVASCVYE+ T+WG++VG +YGSA
Sbjct  394   NSVHFMKSVPQILSG-IKDKTDCQPADLSSTEEAANEVASCVYEYNTSWGERVGWVYGSA  452

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG+ IH KGW+S YC P+PP FLG +P+GGPA LTQQKRW T  L+IL+   +PI
Sbjct  453   TEDVLTGLRIHSKGWRSGYCTPDPPAFLGDTPSGGPAILTQQKRWATGLLEILVSNYNPI  512

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
             +  + G+L  RQCL YL ++ WP+R   E+CY+LLP YCI+  ++F P + E AI + ++
Sbjct  513   LGVIKGKLLIRQCLVYLSVIIWPLRALPELCYALLPPYCILTTTYFLPTVWEPAIFVSSA  572

Query  887   IFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
             +F+I +LY L  Y+  G S+R+WWNNQRM R+ ++ S LF  L  ++K  GLSE VFE+T
Sbjct  573   LFVILSLYNLSYYLRCGLSIRSWWNNQRMTRITSATSRLFSVLVVILKFLGLSETVFEIT  632

Query  1067  KKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDF-----KQNKS  1231
              K        D   D+  G  TFD+SP+FVPGTT+LL+++ AL +G L           S
Sbjct  633   PKHQ------DSSVDTSAGELTFDKSPIFVPGTTLLLLHMTALAVGLLRILLQPWAHAGS  686

Query  1232  W-SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
             W  LGE  CS+W++L +W F+KGLF KG +GIP ST+ KS  L+ LF H
Sbjct  687   WFGLGEICCSIWMVLSFWPFVKGLFKKGVYGIPSSTLYKSVALSSLFVH  735



>ref|XP_006582368.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Glycine max]
 gb|KHN41241.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=750

 Score =   455 bits (1170),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 237/470 (50%), Positives = 307/470 (65%), Gaps = 13/470 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  VN+PK+V HA+  LL  K EK+  FVQFPQ FY  LKDDP+
Sbjct  280   VSGLITNAPFMLNVDCDMIVNNPKIVHHALSILLDHKGEKEVAFVQFPQKFYATLKDDPF  339

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQM I+ KYL  G  G+QGPFY GT CFHRRKVIYG+ P  ++     ++++  + FG 
Sbjct  340   GNQMTILAKYLAAGIGGLQGPFYGGTNCFHRRKVIYGLSPENIEKGNSISEEELKQKFGT  399

Query  362   SKTFALSTTQILSGSLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             SK    S    L G  Y    I   N ++ A +VA C YE+GT WG+++  +YGS  ED 
Sbjct  400   SKEIMKSVACTLEGRTYSYNDINISNVVDVASQVAGCAYEYGTGWGKQMAWIYGSVTEDV  459

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG++IH KGW+S +C P+P GF G +P GGP ++ QQKRW T  L++  CK  PII  L
Sbjct  460   LTGLTIHKKGWRSEFCMPSPIGFTGFAPGGGPNSMAQQKRWATGLLEMFFCKHCPIISTL  519

Query  719   FGRLHFRQCLAYLWIMG-WPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFI  895
             F +L  RQCLAY+WI+  W +   FE+CY+ L AYCII NS+F P+  +  I IPA+  +
Sbjct  520   FHKLTLRQCLAYMWIINHWGLMSVFEVCYACLLAYCIITNSNFLPQ--DLGICIPAAFLV  577

Query  896   IYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKD  1075
             IY +Y   EY+  G S+RAWWNNQRM R+    +    FLS ++K+F +SE VF++TKKD
Sbjct  578   IYKIYTASEYLAEGLSIRAWWNNQRMSRITPMNAGFCAFLSVLLKLFRISETVFDITKKD  637

Query  1076  HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ-------NKSW  1234
               S  A D  DD   GR+TFDES +F+PGTTILLV L A+ I  L F+            
Sbjct  638   LPS--AKDVGDDKDAGRYTFDESVVFLPGTTILLVQLTAMVIKLLGFQPPVATQSGKHGC  695

Query  1235  SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
              LGE  CSV++I+ YW FL+GLF  GK+ IPLST+LKS  L  LF H C+
Sbjct  696   GLGEIFCSVYLIICYWPFLRGLFETGKYRIPLSTILKSAILTCLFVHLCQ  745



>ref|XP_006582367.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Glycine max]
Length=754

 Score =   452 bits (1162),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 238/474 (50%), Positives = 310/474 (65%), Gaps = 17/474 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  VN+PK+V HA+  LL  K EK+  FVQFPQ FY  LKDDP+
Sbjct  280   VSGLITNAPFMLNVDCDMIVNNPKIVHHALSILLDHKGEKEVAFVQFPQKFYATLKDDPF  339

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS----TDKDQWE  349
             GNQM I+ KYL  G  G+QGPFY GT CFHRRKVIYG+ P  ++ ++ S    ++++  +
Sbjct  340   GNQMTILAKYLAAGIGGLQGPFYGGTNCFHRRKVIYGLSPENIEKDKFSGNSISEEELKQ  399

Query  350   TFGKSKTFALSTTQILSGSLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSA  526
              FG SK    S    L G  Y    I   N ++ A +VA C YE+GT WG+++  +YGS 
Sbjct  400   KFGTSKEIMKSVACTLEGRTYSYNDINISNVVDVASQVAGCAYEYGTGWGKQMAWIYGSV  459

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG++IH KGW+S +C P+P GF G +P GGP ++ QQKRW T  L++  CK  PI
Sbjct  460   TEDVLTGLTIHKKGWRSEFCMPSPIGFTGFAPGGGPNSMAQQKRWATGLLEMFFCKHCPI  519

Query  707   IWALFGRLHFRQCLAYLWIMG-WPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             I  LF +L  RQCLAY+WI+  W +   FE+CY+ L AYCII NS+F P+  +  I IPA
Sbjct  520   ISTLFHKLTLRQCLAYMWIINHWGLMSVFEVCYACLLAYCIITNSNFLPQ--DLGICIPA  577

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             +  +IY +Y   EY+  G S+RAWWNNQRM R+    +    FLS ++K+F +SE VF++
Sbjct  578   AFLVIYKIYTASEYLAEGLSIRAWWNNQRMSRITPMNAGFCAFLSVLLKLFRISETVFDI  637

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ-------  1222
             TKKD  S  A D  DD   GR+TFDES +F+PGTTILLV L A+ I  L F+        
Sbjct  638   TKKDLPS--AKDVGDDKDAGRYTFDESVVFLPGTTILLVQLTAMVIKLLGFQPPVATQSG  695

Query  1223  NKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
                  LGE  CSV++I+ YW FL+GLF  GK+ IPLST+LKS  L  LF H C+
Sbjct  696   KHGCGLGEIFCSVYLIICYWPFLRGLFETGKYRIPLSTILKSAILTCLFVHLCQ  749



>ref|XP_006592369.1| PREDICTED: uncharacterized LOC100500469 isoform X2 [Glycine max]
Length=707

 Score =   449 bits (1156),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 235/471 (50%), Positives = 311/471 (66%), Gaps = 13/471 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  V++PK+VLHA+  LL  K EK+  FVQ PQ FY  LKDDP+
Sbjct  239   VSGLITNAPFMLNVDCDMIVSNPKIVLHALSILLDPKGEKEVAFVQCPQQFYATLKDDPF  298

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQM I+ K L  G AG+QGPFY GT CFHRRKVIYG  P  ++     +D++  E FG 
Sbjct  299   GNQMTILFKNLAPGLAGLQGPFYGGTNCFHRRKVIYGRSPDNIEKGSGISDEEFKEKFGA  358

Query  362   SKTFALSTTQILSGSLY-PEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             SK F  S    L G +Y P      N ++ A +VA C YE+GT WG++VG +YGS  ED 
Sbjct  359   SKDFLKSAAFALKGRIYSPNDINISNVVDVASQVAGCGYEYGTGWGKQVGWIYGSITEDV  418

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG++IH KGW+S  C P+P  F G +P GGP ++ QQKRW T  L+I ICK  PII +L
Sbjct  419   LTGLTIHEKGWRSELCTPSPIPFTGFAPGGGPTSMAQQKRWATGMLEIFICKHCPIISSL  478

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F +L  RQCLAY+WI+ W ++P FE+CY+ L AYCII NS+F P+  +  I IP + F I
Sbjct  479   FRKLTLRQCLAYMWIINWGLQPVFEVCYACLLAYCIITNSNFLPQ--DLGIRIPIAFFAI  536

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             Y +Y + EY+  G S+R WWNNQRM R+ +  +    FLS ++K+  +SE VF+VTKKD 
Sbjct  537   YKVYTVCEYLAAGLSVREWWNNQRMSRITSMNAGFCAFLSVLLKLLRISETVFDVTKKDL  596

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK-------QNKSWS  1237
                  +  D D+  GR+TFDES +F+PGTTILL+ L A+ I  L  +       +N S  
Sbjct  597   PPTGNVLDDKDA--GRYTFDESVVFLPGTTILLLQLTAMVIKLLGLQPPVPTPSRNGS-G  653

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
             LGE  CSV++++ YW FL+GLF  GK+ IP+ST+ K+  L  LF H C+ +
Sbjct  654   LGEIFCSVYLMICYWPFLRGLFETGKYRIPMSTICKAAILTCLFVHLCRRI  704



>ref|XP_006592368.1| PREDICTED: uncharacterized LOC100500469 isoform X1 [Glycine max]
Length=746

 Score =   449 bits (1155),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 235/471 (50%), Positives = 311/471 (66%), Gaps = 13/471 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  V++PK+VLHA+  LL  K EK+  FVQ PQ FY  LKDDP+
Sbjct  278   VSGLITNAPFMLNVDCDMIVSNPKIVLHALSILLDPKGEKEVAFVQCPQQFYATLKDDPF  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQM I+ K L  G AG+QGPFY GT CFHRRKVIYG  P  ++     +D++  E FG 
Sbjct  338   GNQMTILFKNLAPGLAGLQGPFYGGTNCFHRRKVIYGRSPDNIEKGSGISDEEFKEKFGA  397

Query  362   SKTFALSTTQILSGSLY-PEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             SK F  S    L G +Y P      N ++ A +VA C YE+GT WG++VG +YGS  ED 
Sbjct  398   SKDFLKSAAFALKGRIYSPNDINISNVVDVASQVAGCGYEYGTGWGKQVGWIYGSITEDV  457

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG++IH KGW+S  C P+P  F G +P GGP ++ QQKRW T  L+I ICK  PII +L
Sbjct  458   LTGLTIHEKGWRSELCTPSPIPFTGFAPGGGPTSMAQQKRWATGMLEIFICKHCPIISSL  517

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F +L  RQCLAY+WI+ W ++P FE+CY+ L AYCII NS+F P+  +  I IP + F I
Sbjct  518   FRKLTLRQCLAYMWIINWGLQPVFEVCYACLLAYCIITNSNFLPQ--DLGIRIPIAFFAI  575

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             Y +Y + EY+  G S+R WWNNQRM R+ +  +    FLS ++K+  +SE VF+VTKKD 
Sbjct  576   YKVYTVCEYLAAGLSVREWWNNQRMSRITSMNAGFCAFLSVLLKLLRISETVFDVTKKDL  635

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK-------QNKSWS  1237
                  +  D D+  GR+TFDES +F+PGTTILL+ L A+ I  L  +       +N S  
Sbjct  636   PPTGNVLDDKDA--GRYTFDESVVFLPGTTILLLQLTAMVIKLLGLQPPVPTPSRNGS-G  692

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
             LGE  CSV++++ YW FL+GLF  GK+ IP+ST+ K+  L  LF H C+ +
Sbjct  693   LGEIFCSVYLMICYWPFLRGLFETGKYRIPMSTICKAAILTCLFVHLCRRI  743



>gb|KHN21212.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=746

 Score =   449 bits (1155),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 235/471 (50%), Positives = 310/471 (66%), Gaps = 13/471 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  V++PK+VLHA+  LL  K EK+  FVQ PQ FY  LKDDP+
Sbjct  278   VSGLITNAPFMLNVDCDMIVSNPKIVLHALSILLDPKGEKEVAFVQCPQQFYATLKDDPF  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQM I+ K L  G AG+QGPFY GT CFHRRKVIYG  P  ++     +D++  E FG 
Sbjct  338   GNQMTILFKNLAPGLAGLQGPFYGGTNCFHRRKVIYGRSPDNIEKGSGISDEEFKEKFGA  397

Query  362   SKTFALSTTQILSGSLY-PEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             SK F  S    L G +Y P      N ++ A +VA C YE+GT WG++VG +YGS  ED 
Sbjct  398   SKDFLKSAAFALKGRIYSPNDINISNVVDVASQVAGCGYEYGTGWGKQVGWIYGSITEDV  457

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG++IH KGW+S  C P+P  F G +P GGP ++ QQKRW T  L I ICK  PII +L
Sbjct  458   LTGLTIHEKGWRSELCTPSPIPFTGFAPGGGPTSMAQQKRWATGMLKIFICKHCPIISSL  517

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F +L  RQCLAY+WI+ W ++P FE+CY+ L AYCII NS+F P+  +  I IP + F I
Sbjct  518   FRKLTLRQCLAYMWIINWGLQPVFEVCYACLLAYCIITNSNFLPQ--DLGICIPIAFFAI  575

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             Y +Y + EY+  G S+R WWNNQRM R+ +  +    FLS ++K+  +SE VF+VTKKD 
Sbjct  576   YKVYTVCEYLAAGLSVREWWNNQRMSRITSMNAGFCAFLSVLLKLLRISETVFDVTKKDL  635

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK-------QNKSWS  1237
                  +  D D+  GR+TFDES +F+PGTTILL+ L A+ I  L  +       +N S  
Sbjct  636   PPTGNVLDDKDA--GRYTFDESVVFLPGTTILLLQLTAMVIKLLGLQPPVPTPSRNGS-G  692

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
             LGE  CSV++++ YW FL+GLF  GK+ IP+ST+ K+  L  LF H C+ +
Sbjct  693   LGEIFCSVYLMICYWPFLRGLFETGKYRIPMSTICKAAILTCLFVHLCRRI  743



>ref|XP_004287961.1| PREDICTED: cellulose synthase-like protein H1-like [Fragaria 
vesca subsp. vesca]
Length=758

 Score =   442 bits (1137),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 245/476 (51%), Positives = 319/476 (67%), Gaps = 21/476 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD + ++ K+VLHAMC LLG K EK   FVQ PQ  Y  LKDDP+
Sbjct  281   VSGLMTNAPFMLNVDCDMYASNSKIVLHAMCLLLGFKHEKQGAFVQCPQICYDYLKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGM-----WPHVVDNNEKSTDKDQW  346
             GN M + +K  + G AGIQGP Y GTGCFHRRKVIYG+       HV  N +    KD+ 
Sbjct  341   GNSMSVTLKTFWPGIAGIQGPLYAGTGCFHRRKVIYGLSLQDSTGHVQGNLDVEALKDR-  399

Query  347   ETFGKSKTFALSTTQILSGSL-YPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
               FG S     S T IL+  + +P      +++E A +VA C +E  T+WG++VG +YGS
Sbjct  400   --FGNSMELLSSATNILAEKVDHPRD--LSSAVEEACKVACCGFEHNTSWGKQVGWIYGS  455

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG+ IH +GWKS+ C  +PPGF+GS+PT  P  LTQ+KRW T  L++L  K SP
Sbjct  456   ITEDLLTGMKIHARGWKSILCMLDPPGFVGSAPTSVPVMLTQRKRWITGLLEVLFSKNSP  515

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             I   L  +L FR CLAY+WI+ W +     +CYSLLPAYCI+ NSHF PK+ E A+++ A
Sbjct  516   IFSTLNAKLEFRMCLAYIWILIWGLHSIPALCYSLLPAYCIMTNSHFLPKIGEPALLMFA  575

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRM---LRVYASGSWLFGFLSGVVKVFGLSEAV  1054
             ++F+  NLY L+ Y+E+G S+ AWWN QRM     V ++ S LFG +S V+K+ G+SE V
Sbjct  576   ALFLGNNLYNLYFYLESGLSITAWWNYQRMGPRSTVLSTTSLLFGTISVVLKLVGISEVV  635

Query  1055  FEVTKKDH--SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK---  1219
             FEVT+KD   SS +     +D+  G+FTFDESP+FVP TT+L V+L AL   FL  K   
Sbjct  636   FEVTQKDEYSSSSDDDQNANDANAGKFTFDESPIFVPPTTLLFVHLTALAKSFLGLKLAS  695

Query  1220  --QNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
                  S  +GE +CSVWV++ +W FL+GLF KGK+GIPLST+LKSGGLA+LF   C
Sbjct  696   SAPQVSTGVGEIVCSVWVVISFWPFLRGLFEKGKYGIPLSTILKSGGLAVLFMVCC  751



>ref|XP_004953420.1| PREDICTED: cellulose synthase-like protein H1-like isoform X3 
[Setaria italica]
Length=685

 Score =   437 bits (1124),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 227/477 (48%), Positives = 299/477 (63%), Gaps = 19/477 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS V+TNAP MLN+DCD   N+P+V+LHAMC LLG  DE  + FVQ PQ FY  L+DDP+
Sbjct  212   VSAVLTNAPIMLNVDCDMFANNPQVILHAMCLLLGFDDEVHSGFVQAPQIFYNALQDDPF  271

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP----HVVDNNEKSTDKDQWE  349
             GNQ +++ K L  G AG+QG +Y GTGCFHRRKVIY M P    HV     K +    WE
Sbjct  272   GNQTEVMYKKLGYGFAGLQGIYYNGTGCFHRRKVIYSMPPDCSTHVKPRRTKGSP--SWE  329

Query  350   ----TFGKSKTFALSTTQILSGSLYPEIPI--FPNSLEAAKEVASCVYEFGTAWGQKVGL  511
                   G  K    S   I+SG +   +PI    + ++ A EV++C YE  T WGQ++G 
Sbjct  330   ELRVKLGSQKELIESARSIISGDML-AVPIVGLSSRIKVANEVSACSYEASTGWGQEIGW  388

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             +YGS  ED  TG  IH  GWKS   + NPP FLGS+PTGGPA+LTQ KRW T   +IL+ 
Sbjct  389   VYGSTTEDILTGQRIHAAGWKSALMNTNPPAFLGSAPTGGPASLTQYKRWATGLFEILVS  448

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             + +PI+ ++  RLHFRQCLAYL I  WP+R  FE+CYSLL  YC++ N  F PK +E   
Sbjct  449   RNNPILLSICKRLHFRQCLAYLVIDVWPLRAPFELCYSLLGPYCLLTNHSFLPKSSEPGF  508

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
              I  ++F+ YN+Y   EY++   S RAWWNNQRM R+ +S +WL  FL+ ++K  GLSE 
Sbjct  509   SITLALFLTYNIYNFMEYMDCQLSARAWWNNQRMQRIISSSAWLLAFLTVLLKTLGLSET  568

Query  1052  VFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDF-----  1216
             VFEVT+KD SS       DD+  GRFTFD SP+F+P T + ++N+ A+ +G         
Sbjct  569   VFEVTRKDKSSSNGDGSTDDADPGRFTFDSSPVFIPATALAILNIVAVAVGAWRVVAGAV  628

Query  1217  -KQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
               +     +GE +C  W++L +W F+ GL GK  +GIP S  LK+G L   F H C+
Sbjct  629   EDKPGGPGVGEFVCCGWLLLCFWPFVTGLVGKRSYGIPWSVKLKAGLLVAAFVHFCR  685



>gb|KGN63228.1| hypothetical protein Csa_2G416190 [Cucumis sativus]
Length=743

 Score =   439 bits (1128),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 240/464 (52%), Positives = 302/464 (65%), Gaps = 6/464 (1%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAP++LN+DCD +VN+P V+L  MC  L    +K+  FVQFPQ FY GLKDDPY
Sbjct  278   VSGLMTNAPYILNVDCDMYVNNPSVLLQGMCLFLDPTIDKEYAFVQFPQRFYNGLKDDPY  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ  ++M++ FRG AGIQGP YMGTGC HRRKV+YG  P   +   K  D +  +TFG 
Sbjct  338   GNQWIVMMEFTFRGMAGIQGPGYMGTGCIHRRKVLYGQSPDGANIFGKHYDSELHKTFGS  397

Query  362   SKTFALSTTQILSG-SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             SK F  S    L   + YP      NS+ + KEVA+  YE  + WG K G LYGS  ED 
Sbjct  398   SKDFVNSAAHALRNLADYPNS--LSNSIISLKEVATSDYEITSCWGTKFGWLYGSLLEDV  455

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG  IH KGWKS Y  P PP FLG +P+GGP  L  QKR  T  L+I   KK PI  +L
Sbjct  456   LTGSEIHKKGWKSAYLTPTPPAFLGCAPSGGPIPLNHQKRAMTGLLEIFFSKKCPIFNSL  515

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             FG+L FRQ +  +W+  W IR   EICY+ LPA+C+I NSHF PK+ E  + IP  +F+ 
Sbjct  516   FGKLQFRQRMVSVWMSLWGIRSIPEICYATLPAFCLIANSHFLPKIQEPVVCIPLLLFVF  575

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV-TKKD  1075
             YNL  L +Y ETG+S RAWWNN+RM R+    + L G ++  +K+ GLSE VFEV  K+ 
Sbjct  576   YNLQQLLQYWETGQSARAWWNNERMARINTICASLLGAVAVALKLLGLSETVFEVTKKES  635

Query  1076  HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNK--SWSLGEA  1249
              SS +  +   D  +GRFTFDESPLFVPGTTIL++ L AL I F   +Q     + +GE 
Sbjct  636   SSSSDDTESSSDGDLGRFTFDESPLFVPGTTILIIQLLALSIAFSRIRQPNVVEFGVGEV  695

Query  1250  ICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
              CSVW+IL +W+FLKG+F KGK+G+P ST+ KS  LA LF   C
Sbjct  696   TCSVWLILCFWSFLKGMFAKGKYGLPWSTLCKSSALAFLFVCFC  739



>ref|XP_004151939.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=743

 Score =   439 bits (1128),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 240/464 (52%), Positives = 302/464 (65%), Gaps = 6/464 (1%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAP++LN+DCD +VN+P V+L  MC  L    +K+  FVQFPQ FY GLKDDPY
Sbjct  278   VSGLMTNAPYILNVDCDMYVNNPSVLLQGMCLFLDPTIDKEYAFVQFPQRFYNGLKDDPY  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ  ++M++ FRG AGIQGP YMGTGC HRRKV+YG  P   +   K  D +  +TFG 
Sbjct  338   GNQWIVMMEFTFRGMAGIQGPGYMGTGCIHRRKVLYGQSPDGANIFGKHYDSELHKTFGS  397

Query  362   SKTFALSTTQILSG-SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             SK F  S    L   + YP      NS+ + KEVA+  YE  + WG K G LYGS  ED 
Sbjct  398   SKDFVNSAAHALRNLADYPNS--LSNSIISLKEVATSDYEITSCWGTKFGWLYGSLLEDV  455

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG  IH KGWKS Y  P PP FLG +P+GGP  L  QKR  T  L+I   KK PI  +L
Sbjct  456   LTGSEIHKKGWKSAYLTPTPPAFLGCAPSGGPIPLNHQKRAMTGLLEIFFSKKCPIFNSL  515

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             FG+L FRQ +  +W+  W IR   EICY+ LPA+C+I NSHF PK+ E  + IP  +F+ 
Sbjct  516   FGKLQFRQRMVSVWMSLWGIRSIPEICYATLPAFCLIANSHFLPKIQEPVVCIPLLLFVF  575

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV-TKKD  1075
             YNL  L +Y ETG+S RAWWNN+RM R+    + L G ++  +K+ GLSE VFEV  K+ 
Sbjct  576   YNLQQLLQYWETGQSARAWWNNERMARINTICASLLGAVAVALKLLGLSETVFEVTKKES  635

Query  1076  HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNK--SWSLGEA  1249
              SS +  +   D  +GRFTFDESPLFVPGTTIL++ L AL I F   +Q     + +GE 
Sbjct  636   SSSSDDTESSSDGDLGRFTFDESPLFVPGTTILIIQLLALSIAFSRIRQPNVVEFGVGEV  695

Query  1250  ICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
              CSVW+IL +W+FLKG+F KGK+G+P ST+ KS  LA LF   C
Sbjct  696   TCSVWLILCFWSFLKGMFAKGKYGLPWSTLCKSSALAFLFVCFC  739



>gb|KHG07611.1| Cellulose synthase-like protein H1 [Gossypium arboreum]
Length=464

 Score =   429 bits (1103),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 230/459 (50%), Positives = 309/459 (67%), Gaps = 11/459 (2%)
 Frame = +2

Query  14    MTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPYGNQM  193
             MTNAP MLN+DCD  VN+P+VV  A+C L+G + E D  F+Q+PQ FY   KDDP+GNQM
Sbjct  1     MTNAPLMLNVDCDMFVNNPQVVRQALCQLVGRESEGDMGFIQYPQCFYNATKDDPFGNQM  60

Query  194   KIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGKSKTF  373
              ++M+Y+ RG AG+QGP Y GTGCFHRRKVIYG+WP   DN     D +  + FGKS+ F
Sbjct  61    VVLMEYIGRGIAGLQGPPYAGTGCFHRRKVIYGVWP---DNAASINDYEAMKEFGKSEEF  117

Query  374   ALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTKTGVS  553
               S T  L G       I  + LEA+ +VA+C YEFG++WG K G +YGS  ED  TG++
Sbjct  118   LESATHALKGEKGIRKSI-SDYLEASFQVAACDYEFGSSWGTKFGWIYGSMTEDVLTGLN  176

Query  554   IHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRLH  733
             IH KGWKS +   +PP FLG +PTGGPAA+TQQKRW T  L+IL+ K +PI++ L G L 
Sbjct  177   IHKKGWKSNFHFLDPPAFLGCAPTGGPAAMTQQKRWATGLLEILVSKSNPIVFTLTGNLQ  236

Query  734   FRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLYG  913
             FR  L Y++++ W +    E+CY+ LPAYCII NSHF PK+ + AI+IP +IF+ YN+  
Sbjct  237   FRLYLFYIYLLSWGLTSVPELCYAALPAYCIIANSHFLPKVQDPAILIPVAIFVTYNMLT  296

Query  914   LFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDEA  1093
             L EY++   S RAWWNN RM R+ A+ ++LFG L+ V+K+ GLS+ VF+VT+K+  + E 
Sbjct  297   LREYLKVDLSFRAWWNNMRMARITATSAYLFGVLTIVLKLLGLSDTVFDVTQKNDEASED  356

Query  1094  LDKDDDSKVGRFTFDESPLFVPG---TTILLVNLAALFIGFLDF----KQNKSWSLGEAI  1252
              D D+ +   +FTFDESP+FVPG     + L  L +L +G         Q     LGE +
Sbjct  357   EDDDEINGTAKFTFDESPIFVPGTTLLLVHLTALLSLCLGLRPLVHKDGQGSGIGLGEVL  416

Query  1253  CSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
             CS+WV+L +  F+KGLF  GK+G+P ST+ KS  LAL+ 
Sbjct  417   CSLWVVLCFRPFMKGLFRIGKYGLPSSTIFKSTSLALVL  455



>ref|XP_004953419.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Setaria italica]
Length=714

 Score =   437 bits (1125),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 227/477 (48%), Positives = 299/477 (63%), Gaps = 19/477 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS V+TNAP MLN+DCD   N+P+V+LHAMC LLG  DE  + FVQ PQ FY  L+DDP+
Sbjct  241   VSAVLTNAPIMLNVDCDMFANNPQVILHAMCLLLGFDDEVHSGFVQAPQIFYNALQDDPF  300

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP----HVVDNNEKSTDKDQWE  349
             GNQ +++ K L  G AG+QG +Y GTGCFHRRKVIY M P    HV     K +    WE
Sbjct  301   GNQTEVMYKKLGYGFAGLQGIYYNGTGCFHRRKVIYSMPPDCSTHVKPRRTKGSP--SWE  358

Query  350   ----TFGKSKTFALSTTQILSGSLYPEIPI--FPNSLEAAKEVASCVYEFGTAWGQKVGL  511
                   G  K    S   I+SG +   +PI    + ++ A EV++C YE  T WGQ++G 
Sbjct  359   ELRVKLGSQKELIESARSIISGDML-AVPIVGLSSRIKVANEVSACSYEASTGWGQEIGW  417

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             +YGS  ED  TG  IH  GWKS   + NPP FLGS+PTGGPA+LTQ KRW T   +IL+ 
Sbjct  418   VYGSTTEDILTGQRIHAAGWKSALMNTNPPAFLGSAPTGGPASLTQYKRWATGLFEILVS  477

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             + +PI+ ++  RLHFRQCLAYL I  WP+R  FE+CYSLL  YC++ N  F PK +E   
Sbjct  478   RNNPILLSICKRLHFRQCLAYLVIDVWPLRAPFELCYSLLGPYCLLTNHSFLPKSSEPGF  537

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
              I  ++F+ YN+Y   EY++   S RAWWNNQRM R+ +S +WL  FL+ ++K  GLSE 
Sbjct  538   SITLALFLTYNIYNFMEYMDCQLSARAWWNNQRMQRIISSSAWLLAFLTVLLKTLGLSET  597

Query  1052  VFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDF-----  1216
             VFEVT+KD SS       DD+  GRFTFD SP+F+P T + ++N+ A+ +G         
Sbjct  598   VFEVTRKDKSSSNGDGSTDDADPGRFTFDSSPVFIPATALAILNIVAVAVGAWRVVAGAV  657

Query  1217  -KQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
               +     +GE +C  W++L +W F+ GL GK  +GIP S  LK+G L   F H C+
Sbjct  658   EDKPGGPGVGEFVCCGWLLLCFWPFVTGLVGKRSYGIPWSVKLKAGLLVAAFVHFCR  714



>ref|XP_004953418.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Setaria italica]
Length=754

 Score =   438 bits (1126),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 227/477 (48%), Positives = 299/477 (63%), Gaps = 19/477 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS V+TNAP MLN+DCD   N+P+V+LHAMC LLG  DE  + FVQ PQ FY  L+DDP+
Sbjct  281   VSAVLTNAPIMLNVDCDMFANNPQVILHAMCLLLGFDDEVHSGFVQAPQIFYNALQDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP----HVVDNNEKSTDKDQWE  349
             GNQ +++ K L  G AG+QG +Y GTGCFHRRKVIY M P    HV     K +    WE
Sbjct  341   GNQTEVMYKKLGYGFAGLQGIYYNGTGCFHRRKVIYSMPPDCSTHVKPRRTKGSP--SWE  398

Query  350   ----TFGKSKTFALSTTQILSGSLYPEIPI--FPNSLEAAKEVASCVYEFGTAWGQKVGL  511
                   G  K    S   I+SG +   +PI    + ++ A EV++C YE  T WGQ++G 
Sbjct  399   ELRVKLGSQKELIESARSIISGDML-AVPIVGLSSRIKVANEVSACSYEASTGWGQEIGW  457

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             +YGS  ED  TG  IH  GWKS   + NPP FLGS+PTGGPA+LTQ KRW T   +IL+ 
Sbjct  458   VYGSTTEDILTGQRIHAAGWKSALMNTNPPAFLGSAPTGGPASLTQYKRWATGLFEILVS  517

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             + +PI+ ++  RLHFRQCLAYL I  WP+R  FE+CYSLL  YC++ N  F PK +E   
Sbjct  518   RNNPILLSICKRLHFRQCLAYLVIDVWPLRAPFELCYSLLGPYCLLTNHSFLPKSSEPGF  577

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
              I  ++F+ YN+Y   EY++   S RAWWNNQRM R+ +S +WL  FL+ ++K  GLSE 
Sbjct  578   SITLALFLTYNIYNFMEYMDCQLSARAWWNNQRMQRIISSSAWLLAFLTVLLKTLGLSET  637

Query  1052  VFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDF-----  1216
             VFEVT+KD SS       DD+  GRFTFD SP+F+P T + ++N+ A+ +G         
Sbjct  638   VFEVTRKDKSSSNGDGSTDDADPGRFTFDSSPVFIPATALAILNIVAVAVGAWRVVAGAV  697

Query  1217  -KQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
               +     +GE +C  W++L +W F+ GL GK  +GIP S  LK+G L   F H C+
Sbjct  698   EDKPGGPGVGEFVCCGWLLLCFWPFVTGLVGKRSYGIPWSVKLKAGLLVAAFVHFCR  754



>ref|XP_008455914.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Cucumis 
melo]
Length=744

 Score =   437 bits (1124),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 243/464 (52%), Positives = 303/464 (65%), Gaps = 6/464 (1%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAP++LN+DCD +VN+P V+L  MC  L    +K+  FVQFPQ FY G KDDPY
Sbjct  278   VSGLMTNAPYILNVDCDMYVNNPSVLLQGMCLFLDPTIDKEYAFVQFPQRFYNGPKDDPY  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ  ++M++ FRG AGIQGP YMGTGC HRRKV+YG  P   +   K  D +  +TFG 
Sbjct  338   GNQWIVMMEFTFRGMAGIQGPGYMGTGCIHRRKVLYGQSPDGANIFGKHYDDELHKTFGN  397

Query  362   SKTFALSTTQIL-SGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             SK F  S    L S + YP      NS+ + KEVA+  YE  + WG K G LYGS  ED 
Sbjct  398   SKDFVNSAAHALRSLTDYPNS--LSNSIISLKEVATSDYEINSCWGTKFGWLYGSLLEDV  455

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG  IH KGWKS Y  P PP FLG +P+GGP  L  QKR  T  L+I   KK P+  +L
Sbjct  456   LTGSEIHKKGWKSAYLTPTPPAFLGCAPSGGPIPLNHQKRAMTGLLEIFFSKKCPVFNSL  515

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             FG+L FRQ +  +WI  W IR   EICY+ LPA+C+I NSHF PK+ E    IP  +F+ 
Sbjct  516   FGKLQFRQRMVSVWISLWGIRSIPEICYATLPAFCLIANSHFLPKVQEPVGCIPLLLFVF  575

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             YNL  L +Y ETG+S RAWWNN+RM R+    + L G ++ V+K+ GLSE VFEVTKK+ 
Sbjct  576   YNLQQLLQYWETGQSARAWWNNERMARINTICASLLGAVAVVLKLLGLSETVFEVTKKES  635

Query  1079  SSDEALDKDDDS-KVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNK--SWSLGEA  1249
             SS     +      +GRFTFDESPLFVPGTTIL++ L AL I FL  +Q     + +GE 
Sbjct  636   SSSSDDKESSSDGDLGRFTFDESPLFVPGTTILIIQLLALSIAFLRIRQPNVVEFGVGEV  695

Query  1250  ICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
              CSVW+IL +W+FLKG+F KGK+G+P ST+ KS  LA LF   C
Sbjct  696   TCSVWLILCFWSFLKGMFAKGKYGLPWSTLCKSSALAFLFVCFC  739



>gb|KDO39591.1| hypothetical protein CISIN_1g006357mg [Citrus sinensis]
Length=648

 Score =   434 bits (1115),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 243/470 (52%), Positives = 303/470 (64%), Gaps = 20/470 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD + N+P++VL AMC LLG K E D  FVQ PQ FY    D P 
Sbjct  185   VSGLMTNAPFMLNVDCDMYANNPEIVLQAMCLLLGSK-EGDCAFVQSPQYFY----DSP-  238

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDK-------D  340
              + + I+ + L +G  GIQGPFY GTG FHRRKVIYG+WP  ++N  K  +        +
Sbjct  239   ADSLAILHESLGKGIVGIQGPFYAGTGTFHRRKVIYGLWPDEIENQGKCINSVNGQVGGE  298

Query  341   QWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYG  520
               +  G SK F  S    L G          +SL+AA +VA C YE+G++WG+KVG LYG
Sbjct  299   LLQKSGNSKEFIKSAVDALEGKNTGFSSNLSDSLKAANQVAGCGYEYGSSWGKKVGWLYG  358

Query  521   SAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKS  700
             SA ED  TG+ IH KGWK+ YC P+P  FLG  P+  PAA+ QQKRW    L+IL+ + S
Sbjct  359   SATEDILTGLMIHAKGWKTSYCSPDPHAFLGCGPSDLPAAMRQQKRWAMGLLEILLSEHS  418

Query  701   PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP  880
             PI+  L G+L FRQCL YLW++ W +R   E+CY  LPAYCII N+ F PK+ E  I I 
Sbjct  419   PILATLTGKLQFRQCLGYLWLLIWGLRSIPELCYVALPAYCIITNTSFLPKVQEPGICIA  478

Query  881   ASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFE  1060
              +IF+IY LY L EYI  G  + +W+ N  MLR+ A+ +WLFGF S V+K+ GLSE VFE
Sbjct  479   VAIFVIYKLYTLSEYIHGGFPIYSWFVNNSMLRIVATSAWLFGFGSTVLKLLGLSETVFE  538

Query  1061  VTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGF--LDFKQNKSW  1234
             +TKK H S    D   D K     FDESP FVPGTTILLV+LAAL  G   +  +  +  
Sbjct  539   ITKKVHQSS---DGGKDGK--ELLFDESPFFVPGTTILLVHLAALATGLLGMQPQGGQGP  593

Query  1235  SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
              LGE  CSV+V+L +  FL GLF KGK GIPLST+ KS  LALLF  +CK
Sbjct  594   GLGEYFCSVYVVLCFSPFLLGLFRKGKNGIPLSTICKSAALALLFLRSCK  643



>ref|XP_008781463.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Phoenix 
dactylifera]
Length=744

 Score =   436 bits (1122),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 239/465 (51%), Positives = 310/465 (67%), Gaps = 9/465 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD   N+P+V+LH MC LLG  +E  + FVQ PQ FYG LKDDP+
Sbjct  278   VSGVMTNAPFMLNVDCDMFANNPEVILHGMCLLLGFDNEVSSGFVQAPQQFYGALKDDPF  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGM-WPHVVDNNEKSTDKDQWETFG  358
             GNQ+ ++ +    GT G+QGPFY GTGCFHRRK+I     P  V  +++ +  +    +G
Sbjct  338   GNQLVVLQEITVGGTGGLQGPFYGGTGCFHRRKIICSTPRPAGVSKHDELSYNELQRIYG  397

Query  359   KSKTFALSTTQILSGSLYPEIPI---FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
              S+    S +QI SG  + EI       +S+EAAK VASC YEF T WG K+G  YGS  
Sbjct  398   DSRELIESASQITSGK-FREISCVDDLSSSVEAAKRVASCTYEFNTCWGNKIGWAYGSMA  456

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG+ IH  GWKSV    +PP FLGS+ TGGPA+LTQ KRW T  L+IL+ ++SPI+
Sbjct  457   EDVLTGLRIHSMGWKSVCLKLDPPAFLGSAATGGPASLTQNKRWSTGLLEILLTRRSPIL  516

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
                  +L FR CLAYL ++ W +R   E+CY+LLPAYC+I N+ F PK +E   VIP ++
Sbjct  517   ATFTKQLEFRMCLAYLLVIVWALRSMGELCYALLPAYCLIANTSFMPKASEPVFVIPLAL  576

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+I N++ L EY++ G S+RA+WNNQRM R++A  +WL G L+ ++K  GLSE VFEVT+
Sbjct  577   FLICNMHSLMEYVQCGLSVRAYWNNQRMNRIFAMTAWLLGLLAVLLKTLGLSETVFEVTR  636

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN-KSWSLGE  1246
             KD  SD     D D   GRFTFD SPLFV GT +LL NLAAL +G L  ++      LGE
Sbjct  637   KDQQSD---TNDTDKDPGRFTFDNSPLFVSGTAVLLANLAALTVGLLRLRRPVVGPGLGE  693

Query  1247  AICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
              +CSVWV+L +W F +GL G+G +GIP   + K+  LA LF   C
Sbjct  694   FVCSVWVVLSFWPFARGLVGRGSYGIPWPVIWKAAVLASLFVQFC  738



>ref|XP_008229982.1| PREDICTED: cellulose synthase-like protein B4 isoform X3 [Prunus 
mume]
Length=713

 Score =   435 bits (1119),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 235/467 (50%), Positives = 298/467 (64%), Gaps = 33/467 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGV-KDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAPFMLN+DCD   N+P VVLHAMC LLG  +++ +  F QFPQ FY GLKDDP
Sbjct  275   VSGLMTNAPFMLNVDCDMFANNPSVVLHAMCILLGSNENQNEIAFAQFPQIFYDGLKDDP  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFG  358
             +GNQM +I KY+  G  GIQG FY GTGCFHRR+VIYG+ P    NN K  +++  +TFG
Sbjct  335   FGNQMAVIWKYMGHGIQGIQGIFYAGTGCFHRRQVIYGLSP----NNGKLGNQELLKTFG  390

Query  359   KSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
              SK    S    L G       +  +   AA +VASC YE+GT WG+KVG +YGS  ED 
Sbjct  391   NSKELTKSAADALRGETKCPSLLLKSIDAAAYQVASCEYEYGTNWGRKVGWMYGSTTEDI  450

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+SIH +GWKS++C P+ P FLG +PTGGPA++TQQKRW T  L++L+ K  PI   +
Sbjct  451   LTGLSIHNRGWKSIFCTPDQPAFLGCTPTGGPASMTQQKRWATGLLEVLLSKNCPIFGTV  510

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F  L FRQCLAYLWI  W +R   E CY+ LPAY II N+H  PK               
Sbjct  511   FAHLQFRQCLAYLWIFTWGLRSLPETCYAALPAYSIITNTHIFPK---------------  555

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
                     YI++G S+RAWWNNQ+M R+    +WLFG    V+K+ G+SE VFEVTKKD 
Sbjct  556   --------YIQSGLSIRAWWNNQKMGRITTMSAWLFGVFGIVLKLSGISETVFEVTKKDQ  607

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSLG----E  1246
             SS      +++ +  RFTFD+SP+FVP T +LL++L AL       +      +G    E
Sbjct  608   SSSTEKGTEEE-EASRFTFDKSPMFVPPTAVLLLHLTALASALFGLQPPAHDGVGSGRLE  666

Query  1247  AICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
                SV ++L  W FLKGLFG GK+GIPLST+ KS GL L+F   C+S
Sbjct  667   VAGSVCLVLCLWPFLKGLFGSGKYGIPLSTIFKSAGLTLMFCTLCRS  713



>ref|XP_006447593.1| hypothetical protein CICLE_v10014586mg [Citrus clementina]
 gb|ESR60833.1| hypothetical protein CICLE_v10014586mg [Citrus clementina]
Length=512

 Score =   428 bits (1101),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 226/469 (48%), Positives = 296/469 (63%), Gaps = 17/469 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD + N+P++VL AMC  LG K+E +  F+Q PQ FY    D P 
Sbjct  59    VSGLMTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFY----DRP-  113

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
                + I+ +Y+ +G  GIQGPFY GTG FHRR V+YG+    +++     + +  + FG 
Sbjct  114   -ENLCILNEYIGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGN  172

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             SK F  S  Q L G           SL+ A  VA C YE+G++WG +VG LYG+  ED  
Sbjct  173   SKEFIKSAAQTLEGKTGGYSSNISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNL  232

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGW+S YC P P  FLG +   GPA + QQKRW T  L+IL  K++PI+  L 
Sbjct  233   TGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLI  292

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
             G+L FRQCLAYLWI+ W +R   E+CY  LPAYCII NS F PK+ E  ++IP ++F+IY
Sbjct  293   GKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIY  352

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
              LY L EYI+ G S+R+WW N  M R+  + +WLFG ++  ++ FG SEAVFE+T+K H 
Sbjct  353   KLYTLLEYIQAGLSIRSWWVNNCMARIVTTSAWLFGLVNAALEQFGFSEAVFEITQKIHR  412

Query  1082  SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN--KSWSLGEAIC  1255
             S         S V    FD+SP FVPGTTI+LV+LAA   G L  +        LG+  C
Sbjct  413   S---------SDVDEVMFDDSPFFVPGTTIILVHLAAWATGLLRLQSQCAHGSGLGDYFC  463

Query  1256  SVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSVH*FN  1402
             SV+V+L ++ FL+GLF  GK GIP ST+ KS  LALLF   CK +   N
Sbjct  464   SVYVVLCFFPFLRGLFMTGKKGIPWSTIGKSTALALLFVQWCKMMSSMN  512



>ref|XP_004487427.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Cicer arietinum]
Length=743

 Score =   435 bits (1118),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 229/471 (49%), Positives = 305/471 (65%), Gaps = 23/471 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             +SG+MTNAPF+LN+DCD +VN+ K+ LHA+C LL  K EK+  F Q PQ FY  +KDD Y
Sbjct  279   ISGLMTNAPFILNVDCDMYVNNSKIALHALCILLDSKGEKEVAFAQCPQRFYDAVKDDAY  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH------VVDNNEKSTDKDQ  343
             GNQ+  +  Y+  G AG+QG  Y GT CFHRRKVIYG+ PH        D++  + DK+ 
Sbjct  339   GNQLVALPMYIGSGFAGLQGIIYAGTNCFHRRKVIYGVSPHHDIQNANKDHHGLANDKET  398

Query  344   WETFGKSKTFALSTTQILSG---SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLL  514
              + FG SK F  S T +L G     Y  + +     +AA++VASC YE+ TAWG++VG L
Sbjct  399   MQKFGTSKGFVESVTHVLEGMTLDFYKSLDV-----KAARKVASCDYEYNTAWGKQVGWL  453

Query  515   YGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICK  694
             YGS  ED  TG+  H KGW+S  C  +P  F+G SP      + Q KRW T  LDI + K
Sbjct  454   YGSTSEDVLTGLKFHTKGWRSELCSTDPIAFMGCSPQDNLGQMAQHKRWSTGLLDIFLSK  513

Query  695   KSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIV  874
               PI   LFG+L  R+CLAY+WI  W +R   EICY+LLPAYCII NS+F P   E+++ 
Sbjct  514   HCPIFGTLFGKLQLRECLAYIWITNWALRSVPEICYALLPAYCIITNSNFLPNQQESSMW  573

Query  875   IPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAV  1054
             IP ++F+IYN+  LFE+I++G S+R WWNNQRM R+    S   GFL+ ++K   +S+  
Sbjct  574   IPTTLFVIYNISNLFEHIKSGLSIRTWWNNQRMGRITTMNSCFLGFLTILLKHLRISDTP  633

Query  1055  FEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ--NK  1228
             FE+TKK+  S        +  VGRF F+ES +F+PGTTIL+V   ALF+  L+++   + 
Sbjct  634   FEITKKEQPS-------SNENVGRFIFNESLIFLPGTTILMVQFIALFMSLLEWQPLVSN  686

Query  1229  SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
              + +GE  CS +V+L Y  FLKGLFGKGK+GIPLST+ KS  LA LF H C
Sbjct  687   GYGVGEVFCSGYVVLCYLPFLKGLFGKGKYGIPLSTICKSTVLAFLFVHFC  737



>ref|XP_004158578.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
H1-like [Cucumis sativus]
Length=675

 Score =   432 bits (1111),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 230/463 (50%), Positives = 305/463 (66%), Gaps = 2/463 (0%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAP+MLNLDCD  VN+P V+L AMC LL    +K+  FVQFPQ FY GLKDDP+
Sbjct  211   VSGVMTNAPYMLNLDCDMFVNNPDVLLQAMCLLLHPTIDKEYAFVQFPQTFYNGLKDDPF  270

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ  + M+ L  G AG+QGP YMGTGC HRRKV+YG  P   + + K  ++  ++TFG 
Sbjct  271   GNQWIVTMQILIHGQAGVQGPMYMGTGCIHRRKVLYGQSPKEANVDAKYNEEKLYKTFGN  330

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             SK F  S  + L  S   +     +S+++  EVA+  YE   AWG +VG  YGS  ED  
Sbjct  331   SKDFVKSAIRSLR-SFADDSNCLSSSIKSTYEVATADYEHNNAWGSEVGWKYGSIVEDVL  389

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGWKS Y  P PP FLG +P GGP  L+  KR  T  L+ILI K SPI+ AL 
Sbjct  390   TGMEIHKKGWKSAYITPTPPAFLGCAPLGGPVPLSHHKRAMTGLLEILISKNSPILTALS  449

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
              +L FRQ L Y+W         +EICY+ LPA+C+I+NSHF PK+ E  I +P  +F++ 
Sbjct  450   DKLQFRQRLMYMWAYLIGFGAIWEICYATLPAFCLISNSHFLPKVQEPVICVPLLLFVLL  509

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
              L  L ++ +TG+S+RAWWNN RM ++    S L G ++ + K+FG+SE VFE+TKK+ S
Sbjct  510   KLRMLLDFFKTGQSVRAWWNNLRMEKIQKMSSSLLGIVAVIFKIFGISETVFEITKKESS  569

Query  1082  SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN-KSWSLGEAICS  1258
             S     K DD  +GR TFDESPLFVP TTIL++ LAAL+IGFL  + + + + + E +C 
Sbjct  570   SSSDDIKSDDGDLGRLTFDESPLFVPVTTILMIQLAALYIGFLQMQASVREFGVAEVMCC  629

Query  1259  VWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             +W IL +W+FL+G+F KG +G+P  T+ KS  LA LF + C+ 
Sbjct  630   LWTILSFWSFLRGMFAKGNYGLPWPTLFKSSVLAFLFVYLCQQ  672



>ref|XP_004151940.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=701

 Score =   432 bits (1110),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 230/463 (50%), Positives = 305/463 (66%), Gaps = 2/463 (0%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAP+MLNLDCD  VN+P V+L AMC LL    +K+  FVQFPQ FY GLKDDP+
Sbjct  237   VSGVMTNAPYMLNLDCDMFVNNPDVLLQAMCLLLHPTIDKEYAFVQFPQTFYNGLKDDPF  296

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ  + M+ L  G AG+QGP YMGTGC HRRKV+YG  P   + + K  ++  ++TFG 
Sbjct  297   GNQWIVTMQILIHGQAGVQGPMYMGTGCIHRRKVLYGQSPKEANVDAKYNEEKLYKTFGN  356

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             SK F  S  + L  S   +     +S+++  EVA+  YE   AWG +VG  YGS  ED  
Sbjct  357   SKDFVKSAIRSLR-SFADDSNCLSSSIKSTYEVATADYEHNNAWGSEVGWKYGSIVEDVL  415

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGWKS Y  P PP FLG +P GGP  L+  KR  T  L+ILI K SPI+ AL 
Sbjct  416   TGMEIHKKGWKSAYITPTPPAFLGCAPLGGPVPLSHHKRAMTGLLEILISKNSPILTALS  475

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
              +L FRQ L Y+W         +EICY+ LPA+C+I+NSHF PK+ E  I +P  +F++ 
Sbjct  476   DKLQFRQRLMYMWAYLIGFGAIWEICYATLPAFCLISNSHFLPKVQEPVICVPLLLFVLL  535

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
              L  L ++ +TG+S+RAWWNN RM ++    S L G ++ + K+FG+SE VFE+TKK+ S
Sbjct  536   KLRMLLDFFKTGQSVRAWWNNLRMEKIQKMSSSLLGIVAVIFKIFGISETVFEITKKESS  595

Query  1082  SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN-KSWSLGEAICS  1258
             S     K DD  +GR TFDESPLFVP TTIL++ LAAL+IGFL  + + + + + E +C 
Sbjct  596   SSSDDIKSDDGDLGRLTFDESPLFVPVTTILMIQLAALYIGFLQMQASVREFGVAEVMCC  655

Query  1259  VWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             +W IL +W+FL+G+F KG +G+P  T+ KS  LA LF + C+ 
Sbjct  656   LWTILSFWSFLRGMFAKGNYGLPWPTLFKSSVLAFLFVYLCQQ  698



>ref|XP_006447594.1| hypothetical protein CICLE_v10014586mg [Citrus clementina]
 gb|ESR60834.1| hypothetical protein CICLE_v10014586mg [Citrus clementina]
Length=636

 Score =   429 bits (1102),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 226/469 (48%), Positives = 296/469 (63%), Gaps = 17/469 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD + N+P++VL AMC  LG K+E +  F+Q PQ FY    D P 
Sbjct  183   VSGLMTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFY----DRP-  237

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
                + I+ +Y+ +G  GIQGPFY GTG FHRR V+YG+    +++     + +  + FG 
Sbjct  238   -ENLCILNEYIGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGN  296

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             SK F  S  Q L G           SL+ A  VA C YE+G++WG +VG LYG+  ED  
Sbjct  297   SKEFIKSAAQTLEGKTGGYSSNISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNL  356

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGW+S YC P P  FLG +   GPA + QQKRW T  L+IL  K++PI+  L 
Sbjct  357   TGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLI  416

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
             G+L FRQCLAYLWI+ W +R   E+CY  LPAYCII NS F PK+ E  ++IP ++F+IY
Sbjct  417   GKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIY  476

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
              LY L EYI+ G S+R+WW N  M R+  + +WLFG ++  ++ FG SEAVFE+T+K H 
Sbjct  477   KLYTLLEYIQAGLSIRSWWVNNCMARIVTTSAWLFGLVNAALEQFGFSEAVFEITQKIHR  536

Query  1082  SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN--KSWSLGEAIC  1255
             S         S V    FD+SP FVPGTTI+LV+LAA   G L  +        LG+  C
Sbjct  537   S---------SDVDEVMFDDSPFFVPGTTIILVHLAAWATGLLRLQSQCAHGSGLGDYFC  587

Query  1256  SVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSVH*FN  1402
             SV+V+L ++ FL+GLF  GK GIP ST+ KS  LALLF   CK +   N
Sbjct  588   SVYVVLCFFPFLRGLFMTGKKGIPWSTIGKSTALALLFVQWCKMMSSMN  636



>ref|XP_007132522.1| hypothetical protein PHAVU_011G101500g [Phaseolus vulgaris]
 gb|ESW04516.1| hypothetical protein PHAVU_011G101500g [Phaseolus vulgaris]
Length=746

 Score =   432 bits (1111),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 226/470 (48%), Positives = 297/470 (63%), Gaps = 11/470 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  VN+PK+V  A+C LL  K +K+  F QFPQ FY  LKDDP+
Sbjct  278   VSGLITNAPFMLNVDCDMIVNNPKIVHDALCILLDPKGQKEVAFAQFPQQFYATLKDDPF  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQM I++KY   G AG+QGPFY GT CFHRRKVIYG+ P  V      ++++  + FG 
Sbjct  338   GNQMAILIKYFATGLAGLQGPFYAGTNCFHRRKVIYGLSPDYVHKGNSISEEELKQKFGA  397

Query  362   SKTFALSTTQILSGSLY-PEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             SK    S    L G  Y P        ++ A +VASC YE+GT WG++VG +YGS  ED 
Sbjct  398   SKEIMKSAGCALEGRRYSPNADNIAQVIDLASQVASCGYEYGTGWGKQVGWIYGSLTEDV  457

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG++IH KGW+S  C P P  F G +P GGP  + QQKRW    L+I + K  PI   L
Sbjct  458   LTGLTIHEKGWRSELCTPRPIAFTGFAPGGGPTTMAQQKRWAIGLLEIFLSKHCPIFATL  517

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F +L FRQC+AY+WIM W +RPFFE+CY+ L A+CII NS+F P+  E  I IP +  +I
Sbjct  518   FHKLTFRQCIAYMWIMNWGLRPFFEVCYASLLAHCIITNSNFLPQ--EHGICIPVAFLVI  575

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             Y +Y +  Y+  G S++AWWNNQRM R+    +    FLS ++K   +SE VF++TKKD 
Sbjct  576   YKVYTVSVYLAEGLSVKAWWNNQRMSRITPMNAGFCAFLSVLLKKLRISETVFDITKKDL  635

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK------QNKSWSL  1240
                +      D    R+TFDES +F+PGTTILL+ L A+ I  L  +        K   +
Sbjct  636   PPTDDAGD--DKDAARYTFDESLVFLPGTTILLLQLTAIMIKLLGMQAVVATESKKDCGI  693

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
             GE  CSV++I+ YW FLKGLF  GK+ IP+ST+ KS  L  LF H  ++ 
Sbjct  694   GEIFCSVYLIICYWPFLKGLFETGKYRIPMSTIYKSTILTSLFVHLSRNT  743



>gb|KGN63226.1| hypothetical protein Csa_2G416170 [Cucumis sativus]
Length=746

 Score =   432 bits (1111),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 230/464 (50%), Positives = 305/464 (66%), Gaps = 2/464 (0%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAP+MLNLDCD  VN+P V+L AMC LL    +K+  FVQFPQ FY GLKDDP+
Sbjct  282   VSGVMTNAPYMLNLDCDMFVNNPDVLLQAMCLLLHPTIDKEYAFVQFPQTFYNGLKDDPF  341

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ  + M+ L  G AG+QGP YMGTGC HRRKV+YG  P   + + K  ++  ++TFG 
Sbjct  342   GNQWIVTMQILIHGQAGVQGPMYMGTGCIHRRKVLYGQSPKEANVDAKYNEEKLYKTFGN  401

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             SK F  S  + L  S   +     +S+++  EVA+  YE   AWG +VG  YGS  ED  
Sbjct  402   SKDFVKSAIRSLR-SFADDSNCLSSSIKSTYEVATADYEHNNAWGSEVGWKYGSIVEDVL  460

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGWKS Y  P PP FLG +P GGP  L+  KR  T  L+ILI K SPI+ AL 
Sbjct  461   TGMEIHKKGWKSAYITPTPPAFLGCAPLGGPVPLSHHKRAMTGLLEILISKNSPILTALS  520

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
              +L FRQ L Y+W         +EICY+ LPA+C+I+NSHF PK+ E  I +P  +F++ 
Sbjct  521   DKLQFRQRLMYMWAYLIGFGAIWEICYATLPAFCLISNSHFLPKVQEPVICVPLLLFVLL  580

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
              L  L ++ +TG+S+RAWWNN RM ++    S L G ++ + K+FG+SE VFE+TKK+ S
Sbjct  581   KLRMLLDFFKTGQSVRAWWNNLRMEKIQKMSSSLLGIVAVIFKIFGISETVFEITKKESS  640

Query  1082  SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN-KSWSLGEAICS  1258
             S     K DD  +GR TFDESPLFVP TTIL++ LAAL+IGFL  + + + + + E +C 
Sbjct  641   SSSDDIKSDDGDLGRLTFDESPLFVPVTTILMIQLAALYIGFLQMQASVREFGVAEVMCC  700

Query  1259  VWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
             +W IL +W+FL+G+F KG +G+P  T+ KS  LA LF + C+  
Sbjct  701   LWTILSFWSFLRGMFAKGNYGLPWPTLFKSSVLAFLFVYLCQQT  744



>ref|XP_006447592.1| hypothetical protein CICLE_v10014586mg [Citrus clementina]
 gb|ESR60832.1| hypothetical protein CICLE_v10014586mg [Citrus clementina]
Length=450

 Score =   422 bits (1084),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 223/465 (48%), Positives = 292/465 (63%), Gaps = 17/465 (4%)
 Frame = +2

Query  14    MTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPYGNQM  193
             MTNAPFMLN+DCD + N+P++VL AMC  LG K+E +  F+Q PQ FY    D P    +
Sbjct  1     MTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFY----DRP--ENL  54

Query  194   KIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGKSKTF  373
              I+ +Y+ +G  GIQGPFY GTG FHRR V+YG+    +++     + +  + FG SK F
Sbjct  55    CILNEYIGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGNSKEF  114

Query  374   ALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTKTGVS  553
               S  Q L G           SL+ A  VA C YE+G++WG +VG LYG+  ED  TG+ 
Sbjct  115   IKSAAQTLEGKTGGYSSNISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNLTGLV  174

Query  554   IHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRLH  733
             IH KGW+S YC P P  FLG +   GPA + QQKRW T  L+IL  K++PI+  L G+L 
Sbjct  175   IHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLIGKLQ  234

Query  734   FRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLYG  913
             FRQCLAYLWI+ W +R   E+CY  LPAYCII NS F PK+ E  ++IP ++F+IY LY 
Sbjct  235   FRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIYKLYT  294

Query  914   LFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDEA  1093
             L EYI+ G S+R+WW N  M R+  + +WLFG ++  ++ FG SEAVFE+T+K H S   
Sbjct  295   LLEYIQAGLSIRSWWVNNCMARIVTTSAWLFGLVNAALEQFGFSEAVFEITQKIHRS---  351

Query  1094  LDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN--KSWSLGEAICSVWV  1267
                   S V    FD+SP FVPGTTI+LV+LAA   G L  +        LG+  CSV+V
Sbjct  352   ------SDVDEVMFDDSPFFVPGTTIILVHLAAWATGLLRLQSQCAHGSGLGDYFCSVYV  405

Query  1268  ILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSVH*FN  1402
             +L ++ FL+GLF  GK GIP ST+ KS  LALLF   CK +   N
Sbjct  406   VLCFFPFLRGLFMTGKKGIPWSTIGKSTALALLFVQWCKMMSSMN  450



>ref|XP_003596942.1| Cellulose synthase-like protein H1 [Medicago truncatula]
 gb|AES67193.1| cellulose synthase H1-like protein [Medicago truncatula]
Length=755

 Score =   431 bits (1109),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 236/479 (49%), Positives = 309/479 (65%), Gaps = 29/479 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLNLDCD +VN+ K+VLHA+C LL  K EK+  F Q PQ FY  +KDD Y
Sbjct  281   VSGLMTNAPFMLNLDCDMYVNNSKIVLHALCILLDSKGEKEVAFAQCPQRFYDAVKDDAY  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP-HVVDNNEKS---------T  331
             GNQ+  +  Y+  G AG+QG  Y GT CFHRRKV+YG+ P + + N +K          +
Sbjct  341   GNQLVALPMYIGSGFAGLQGIIYAGTNCFHRRKVMYGLSPPNEIQNAKKGQGFTNGTFLS  400

Query  332   DKDQWETFGKSKTFALSTTQILSG---SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQK  502
             +K+  + FG SK F  S T IL G    L+  +      LEAA +VASC YE+ TAWG++
Sbjct  401   EKETMQKFGTSKGFVESATHILEGITSDLHKSL-----DLEAASKVASCDYEYNTAWGKQ  455

Query  503   VGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDI  682
             VG LYGS  ED  TG+  H KGW+S  C P+P  F+G SP      + Q KRW T  LDI
Sbjct  456   VGWLYGSTSEDVLTGLKFHTKGWRSELCSPDPIAFMGCSPQDNLGQMAQHKRWSTGLLDI  515

Query  683   LICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE  862
              + K  PI   LFG+L FR+CL+Y+WI  W +R   EICY+LLPAYCII NS F P   E
Sbjct  516   FLSKHCPIFGTLFGKLQFRECLSYIWITNWALRSIPEICYALLPAYCIITNSSFLPN-KE  574

Query  863   AAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGL  1042
              ++ IP ++F+IYN+  L E++++G S+R WWNNQRM R+    S   GFL+ ++K   +
Sbjct  575   LSMWIPTTLFVIYNVSNLIEHVKSGLSIRTWWNNQRMGRITTMNSCFLGFLTIILKNLRI  634

Query  1043  SEAVFEVTKKDH-SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK  1219
             S+  FE+TKK+   S+E+ +++     GRF F+ES +F+PGTTILLV L A+F  +L +K
Sbjct  635   SDTNFEITKKEQVPSNESTNEN----AGRFIFNESLIFLPGTTILLVQLIAIFTSWLGWK  690

Query  1220  Q-----NKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
                      +  GE  CS +V+L Y  FLKGLFGKGK+GIPLST+ KS  LALLF H C
Sbjct  691   PLIKSGADGYGAGEVFCSAYVVLCYLPFLKGLFGKGKYGIPLSTICKSMVLALLFVHLC  749



>ref|XP_004487428.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Cicer arietinum]
Length=742

 Score =   431 bits (1108),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 229/471 (49%), Positives = 305/471 (65%), Gaps = 24/471 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             +SG+MTNAPF+LN+DCD +VN+ K+ LHA+C LL  K EK+  F Q PQ FY  +KDD Y
Sbjct  279   ISGLMTNAPFILNVDCDMYVNNSKIALHALCILLDSKGEKEVAFAQCPQRFYDAVKDDAY  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH------VVDNNEKSTDKDQ  343
             GNQ+  +  Y+  G AG+QG  Y GT CFHRRKVIYG+ PH        D++  + DK+ 
Sbjct  339   GNQLVALPMYIGSGFAGLQGIIYAGTNCFHRRKVIYGVSPHHDIQNANKDHHGLANDKET  398

Query  344   WETFGKSKTFALSTTQILSG---SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLL  514
              + FG SK F  S T +L G     Y  + +     +AA++VASC YE+ TAWG++VG L
Sbjct  399   MQKFGTSKGFVESVTHVLEGMTLDFYKSLDV-----KAARKVASCDYEYNTAWGKQVGWL  453

Query  515   YGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICK  694
             YGS  ED  TG+  H KGW+S  C  +P  F+G SP      + Q KRW T  LDI + K
Sbjct  454   YGSTSEDVLTGLKFHTKGWRSELCSTDPIAFMGCSPQDNLGQMAQHKRWSTGLLDIFLSK  513

Query  695   KSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIV  874
               PI   LFG+L  R+CLAY+WI  W +R   EICY+LLPAYCII NS+F P   E+++ 
Sbjct  514   HCPIFGTLFGKLQLRECLAYIWITNWALRSVPEICYALLPAYCIITNSNFLPN-QESSMW  572

Query  875   IPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAV  1054
             IP ++F+IYN+  LFE+I++G S+R WWNNQRM R+    S   GFL+ ++K   +S+  
Sbjct  573   IPTTLFVIYNISNLFEHIKSGLSIRTWWNNQRMGRITTMNSCFLGFLTILLKHLRISDTP  632

Query  1055  FEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ--NK  1228
             FE+TKK+  S        +  VGRF F+ES +F+PGTTIL+V   ALF+  L+++   + 
Sbjct  633   FEITKKEQPS-------SNENVGRFIFNESLIFLPGTTILMVQFIALFMSLLEWQPLVSN  685

Query  1229  SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
              + +GE  CS +V+L Y  FLKGLFGKGK+GIPLST+ KS  LA LF H C
Sbjct  686   GYGVGEVFCSGYVVLCYLPFLKGLFGKGKYGIPLSTICKSTVLAFLFVHFC  736



>gb|KHN18006.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=728

 Score =   430 bits (1105),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 244/475 (51%), Positives = 309/475 (65%), Gaps = 19/475 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPF+LNLDCD HVN+PK+VLHA+C LL  K EK+  F Q  Q FY GLKDDP 
Sbjct  259   VSGVMTNAPFILNLDCDMHVNNPKIVLHALCILLDSKGEKEVAFAQCIQQFYDGLKDDPL  318

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP-HVVDNNEKSTD------KD  340
             GNQ+    +YL  G AG+QG FY+GT C HRRKVIYG+ P H + N +K          +
Sbjct  319   GNQLVAAFRYLGGGLAGLQGIFYLGTNCMHRRKVIYGLSPYHGIQNGKKDHGVSNGKFSE  378

Query  341   QWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYG  520
             +   FG SK F  S T  L G  +        SLEAA EV+SC YE+GTAWG++VG +YG
Sbjct  379   KKTIFGTSKGFVESATHALEGKTFTPNNNICKSLEAASEVSSCEYEYGTAWGKQVGWMYG  438

Query  521   SAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKS  700
             S  ED  TG+ IH KGW+S  C P    F+G SP      + QQKRW +  LDIL+ K  
Sbjct  439   STSEDLLTGLKIHTKGWRSEVCSPELSPFMGCSPQDILVVIGQQKRWISGLLDILLSKHC  498

Query  701   PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP  880
             PI   LFG+L FRQCL YLWI  W +RP  EICY+ LPAYCIINNS F PK  E    IP
Sbjct  499   PIFGTLFGKLQFRQCLGYLWITTWSLRPVPEICYAALPAYCIINNSSFLPK--ELGQWIP  556

Query  881   ASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFE  1060
             A++ +IYN+  L E ++ G S+R W NNQRM R+    SW FGFL+ ++K   +S   FE
Sbjct  557   ATLLVIYNVSTLLENLKIGLSIRTWCNNQRMARITTMNSWFFGFLAILLKRLRISNIGFE  616

Query  1061  VTKKDHS-SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDF----KQN  1225
             +T+KD + S+E  +++D    GRF F++SP+F+PGTTILL+ L AL   +L +    + N
Sbjct  617   ITRKDETFSNEGANEND----GRFIFNKSPVFIPGTTILLIQLTALVTMWLGWQPPVRNN  672

Query  1226  KSWS-LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
                S +GE  CS ++++ YW FLKGLF KGK+GIPLST+ KS  LA LF + CK+
Sbjct  673   GHGSGVGEVFCSTYLVVCYWPFLKGLFEKGKYGIPLSTICKSMALAFLFVYLCKA  727



>gb|EEE50784.1| hypothetical protein OsJ_31143 [Oryza sativa Japonica Group]
Length=627

 Score =   427 bits (1097),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 221/468 (47%), Positives = 294/468 (63%), Gaps = 7/468 (1%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS +MTNAPFMLNLDCD  VN+P+VVLHAMC LLG  DE    FVQ PQ FYG LKDDP+
Sbjct  158   VSALMTNAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPF  217

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ+++ +  + RG AG+QG FY GTGCFHRRKVIYGM          S++K+    FG 
Sbjct  218   GNQLEVSLMKVGRGIAGLQGIFYCGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGS  277

Query  362   SKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             S  F  S   ++ G+L  E I    + ++ AKEVA+C YE GT WGQ+VG +YGS  ED 
Sbjct  278   SNNFKESARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDV  337

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG  IH  GW+S   +  PP F+G +P GGPA LTQ KRW +  L+ILI + +PI+   
Sbjct  338   LTGQRIHAAGWRSTLMEIEPPAFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTT  397

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F  L FRQCLAYL    WP+R  FE+CY+LL  YC+++N  F PK +E    I  ++FI 
Sbjct  398   FKSLQFRQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPKTSEDGFYIALALFIA  457

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             YN Y   E+IE G+S RA WNN RM R+ ++ +WL  FL+ ++K  G SE VFEVT+KD 
Sbjct  458   YNTYMFMEFIECGQSARACWNNHRMQRITSASAWLLAFLTVILKTLGFSETVFEVTRKDK  517

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSL------  1240
             S+ +     D+ + GRFTFDES +F+P T + ++++ A+ +G        +  L      
Sbjct  518   STSDGDSNTDEPEPGRFTFDESTVFIPVTALAMLSVIAIAVGAWRVVLVTTEGLPGGPGI  577

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
              E I   W++L +   L+GL G G++GIP S  +K+  L  +F   CK
Sbjct  578   SEFISCGWLVLCFMPLLRGLVGSGRYGIPWSIKMKACLLVAIFLLFCK  625



>ref|XP_003540275.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Glycine max]
Length=750

 Score =   430 bits (1106),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 244/475 (51%), Positives = 309/475 (65%), Gaps = 19/475 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPF+LNLDCD HVN+PK+VLHA+C LL  K EK+  F Q  Q FY GLKDDP 
Sbjct  281   VSGVMTNAPFILNLDCDMHVNNPKIVLHALCILLDSKGEKEVAFAQCIQQFYDGLKDDPL  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP-HVVDNNEKSTD------KD  340
             GNQ+    +YL  G AG+QG FY+GT C HRRKVIYG+ P H + N +K          +
Sbjct  341   GNQLVAAFRYLGGGLAGLQGIFYLGTNCMHRRKVIYGLSPYHGIQNGKKDHGVSNGKFSE  400

Query  341   QWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYG  520
             +   FG SK F  S T  L G  +        SLEAA EV+SC YE+GTAWG++VG +YG
Sbjct  401   KKTIFGTSKGFVESATHALEGKTFTPNNNICKSLEAASEVSSCEYEYGTAWGKQVGWMYG  460

Query  521   SAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKS  700
             S  ED  TG+ IH KGW+S  C P    F+G SP      + QQKRW +  LDIL+ K  
Sbjct  461   STSEDLLTGLKIHTKGWRSEVCSPELSPFMGCSPQDILVVIGQQKRWISGLLDILLSKHC  520

Query  701   PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP  880
             PI   LFG+L FRQCL YLWI  W +RP  EICY+ LPAYCIINNS F PK  E    IP
Sbjct  521   PIFGTLFGKLQFRQCLGYLWITTWSLRPVPEICYAALPAYCIINNSSFLPK--ELGQWIP  578

Query  881   ASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFE  1060
             A++ +IYN+  L E ++ G S+R W NNQRM R+    SW FGFL+ ++K   +S   FE
Sbjct  579   ATLLVIYNVSTLLENLKIGLSIRTWCNNQRMARITTMNSWFFGFLAILLKRLRISNIGFE  638

Query  1061  VTKKDHS-SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDF----KQN  1225
             +T+KD + S+E  +++D    GRF F++SP+F+PGTTILL+ L AL   +L +    + N
Sbjct  639   ITRKDETFSNEGANEND----GRFIFNKSPVFIPGTTILLIQLTALVTMWLGWQPPVRNN  694

Query  1226  KSWS-LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
                S +GE  CS ++++ YW FLKGLF KGK+GIPLST+ KS  LA LF + CK+
Sbjct  695   GHGSGVGEVFCSTYLVVCYWPFLKGLFEKGKYGIPLSTICKSMALAFLFVYLCKA  749



>ref|XP_003539497.1| PREDICTED: cellulose synthase-like protein H1-like [Glycine max]
Length=748

 Score =   430 bits (1106),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 229/469 (49%), Positives = 308/469 (66%), Gaps = 11/469 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK VLHAMC L+  K  K+  FVQ  Q FY G+KDDP+
Sbjct  279   VSGLMTNAPFMLNVDCDMVVNNPKFVLHAMCILMDSKSGKEVAFVQCFQQFYDGIKDDPF  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDN---NEKSTDKDQWET  352
             GNQ     +Y+ RG AG+QGP+Y GT  FHRR  IYG++PH ++N   +EK  +K   + 
Sbjct  339   GNQWVAAYEYIIRGMAGLQGPYYGGTNTFHRRNAIYGLYPHEMENGREDEKLGEKILIQQ  398

Query  353   FGKSKTFALSTTQILSGSLYPEIPIFP-NSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             FG SK F  S    L G  Y    I P N +EAA +VA C YE GT WG+K+G LYGS  
Sbjct  399   FGSSKEFVKSAAVALDGKAYLPKDISPSNFIEAAIQVARCGYECGTFWGKKIGWLYGSIS  458

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG++IH +GW+S  C P+P  F G +P G  + + QQKRW +    +   K SP++
Sbjct  459   EDVPTGLNIHRRGWRSECCTPDPIPFTGCAPRGFISTMVQQKRWASGLTVVFFGKHSPVM  518

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               LFG++ FR  L+Y W+  W  R  F++CY+ LPAYCII N++  PK     + IP ++
Sbjct  519   GMLFGKIQFRAGLSYFWLTNWGSRGPFQVCYAALPAYCIITNTNIFPK--GPGLWIPIAL  576

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
              +IYNL+ L EY+  G S+R WWNNQRM  V  + +W  GFLS ++K+ G+S+ VFE+T+
Sbjct  577   LVIYNLHTLLEYLRIGLSIRYWWNNQRMSLVTTTTAWFIGFLSAMLKLSGISDTVFEITE  636

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS---L  1240
             K+ S+  +   + D+  GRFTFDESP+FV GTTILLV+L A+ I F   +   S +   L
Sbjct  637   KEQSTSGSDGNNADA--GRFTFDESPVFVVGTTILLVHLTAMLIKFWGLQPTHSENGSGL  694

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             GE ICS ++++ YW + KGLFG+GK+GIP ST+ KS   AL+F H C+S
Sbjct  695   GEFICSTYLVMCYWPYFKGLFGRGKYGIPFSTMCKSVVFALVFVHFCRS  743



>gb|KHN44862.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=748

 Score =   430 bits (1105),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 228/469 (49%), Positives = 309/469 (66%), Gaps = 11/469 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK VLHAMC L+  K  K+  FVQ  Q FY G+KDDP+
Sbjct  279   VSGLMTNAPFMLNVDCDMVVNNPKFVLHAMCILMDSKSGKEVAFVQCFQQFYDGIKDDPF  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDN---NEKSTDKDQWET  352
             GNQ     +Y+ RG AG+QGP+Y GT  FHRR  IYG++PH ++N   +EK  +K   + 
Sbjct  339   GNQWVAAYEYIIRGMAGLQGPYYGGTNTFHRRNAIYGLYPHEMENGREDEKLGEKILIQQ  398

Query  353   FGKSKTFALSTTQILSGSLYPEIPIFP-NSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             FG+SK F  S    L G  Y    I P N +EAA +VA C YE GT WG+K+G LYGS  
Sbjct  399   FGRSKEFVKSAAVALDGKAYLPKDISPSNFIEAAIQVARCGYECGTFWGKKIGWLYGSIS  458

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG++IH +GW+S  C P+P  F G +P G  + + QQKRW +    +   K SP++
Sbjct  459   EDVPTGLNIHRRGWRSECCTPDPIPFTGCAPRGFISTMVQQKRWASGLTVVFFGKHSPVM  518

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               LFG++ FR  L+Y W+  W  R  F++CY+ LPAYCII N++  PK     + IP ++
Sbjct  519   GMLFGKIQFRAGLSYFWLTNWGSRGPFQVCYAALPAYCIITNTNIFPK--GPGLWIPIAL  576

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
              +IYNL+ L EY+  G S+R WWNNQRM  V  + +W  GFLS ++K+ G+S+ VFE+T+
Sbjct  577   LVIYNLHTLLEYLRIGLSIRYWWNNQRMSLVTTTTAWFIGFLSAMLKLSGISDTVFEITE  636

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS---L  1240
             K+ S+  +   + D+  GRFTFD+SP+FV GTTILLV+L A+ I F   +   S +   L
Sbjct  637   KEQSTSGSDGNNADA--GRFTFDDSPVFVVGTTILLVHLTAMLIKFWGLQPTHSENGSGL  694

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             GE ICS ++++ YW + KGLFG+GK+GIP ST+ KS   AL+F H C+S
Sbjct  695   GEFICSTYLVMCYWPYFKGLFGRGKYGIPFSTMCKSVVFALVFVHFCRS  743



>ref|XP_006469656.1| PREDICTED: cellulose synthase-like protein B4-like isoform X2 
[Citrus sinensis]
Length=690

 Score =   427 bits (1098),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 226/469 (48%), Positives = 297/469 (63%), Gaps = 17/469 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD + N+P++VL AMC  LG K+E +  F+Q PQ FY    D P 
Sbjct  237   VSGLMTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFY----DRP-  291

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
                + I+ +Y+ +G  GIQGPFY GTG FHRR V+YG+    +++     + +  + FG 
Sbjct  292   -ENLCILNEYIGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGN  350

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             SK F  S  Q L G           SL+ A  VA C YE+G++WG +VG LYG+  ED  
Sbjct  351   SKEFIKSAAQTLEGKTGGYSSNISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNL  410

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGW+S YC P P  FLG +   GPA + QQKRW T  L+IL  K++PI+  L 
Sbjct  411   TGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLI  470

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
             G+L FRQCLAYLWI+ W +R   E+CY  LPAYCII NS F PK+ E  ++IP ++F+IY
Sbjct  471   GKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIY  530

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
              LY L EYI+ G S+R+WW N  M R+  + +WLFG ++  ++ FG SEAVFE+T+K H 
Sbjct  531   KLYTLLEYIQAGLSIRSWWVNNCMARIVTTSAWLFGLVNAALEQFGFSEAVFEITQKIHR  590

Query  1082  SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW--SLGEAIC  1255
             S         S V    FD+SP FVPGTTI+LV+LAA   G L  +   +    LG+  C
Sbjct  591   S---------SDVDEVMFDDSPFFVPGTTIILVHLAAWATGLLRLQSQCAHGSGLGDYFC  641

Query  1256  SVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSVH*FN  1402
             SV+V+L ++ FL+GLF  GK GIP ST+ KS  LALLF   CK +   N
Sbjct  642   SVYVVLCFFPFLRGLFMTGKKGIPWSTIGKSTALALLFVQWCKMMSSMN  690



>gb|ADO34997.1| cellulose synthase-like protein H1 [Avena sativa]
Length=758

 Score =   429 bits (1103),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 225/470 (48%), Positives = 305/470 (65%), Gaps = 12/470 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVK-DEKDAEFVQFPQNFYGGLKDDP  178
             VSGVM+NAP MLN+DCD   N+P+VVLHAMC LLG   DE  + FVQ PQ FYG LKDDP
Sbjct  284   VSGVMSNAPIMLNVDCDMFANNPQVVLHAMCLLLGFGGDETQSGFVQAPQKFYGALKDDP  343

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTD---KDQWE  349
             +GNQ++++ K +  G AGIQG FY GTGCFHRRKVIYG+ P  V  +E++     K+   
Sbjct  344   FGNQLEVLYKKVGGGVAGIQGIFYGGTGCFHRRKVIYGVPPPDVVKHERAGSPSFKELQI  403

Query  350   TFGKSKTFALSTTQILSGSLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSA  526
              FG SK    S+  I+SG +     +   + +E AK V +C YE GT WGQ++G +YGS 
Sbjct  404   KFGSSKELIESSRDIISGDVLARPAVDMSSRVEVAKLVGACSYEAGTCWGQEIGWVYGSM  463

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG  IH  GWKS   D  PP FLG +PTGGPA+LTQ KRW T  L+ILI   SPI
Sbjct  464   TEDILTGQRIHATGWKSALLDTTPPAFLGCAPTGGPASLTQFKRWATGLLEILISGNSPI  523

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
             + A+F RL  RQCLAYL I  W +R  FE+CY+LL  +C++ N  F PK+++    IP +
Sbjct  524   LGAIFRRLQLRQCLAYLIIDVWLVRAPFELCYALLGPFCLLTNQSFLPKVSDEGFRIPLA  583

Query  887   IFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
             +F+ YN+Y L EY + G S RAWWNN RM R+ ++ +WL  FL+ ++K  GLSE VFEVT
Sbjct  584   LFLAYNMYNLMEYKDCGLSARAWWNNHRMQRITSASAWLLAFLTVLLKTVGLSETVFEVT  643

Query  1067  KKDHSS-DEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS--  1237
             +K+ SS  +     D++  G FTFD SP+F+P T + ++N+ A+ +G        + +  
Sbjct  644   RKESSSTSDGGATTDEADPGLFTFDSSPVFIPVTALSILNIVAIVVGAWRALFGTATAVR  703

Query  1238  ----LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
                 +GE +C VW++L  W F++GL  +G++GIP S  +K+G +  +F H
Sbjct  704   GGPGMGEFVCCVWMVLCLWPFVRGLVSRGRYGIPWSVKVKAGLIVSVFVH  753



>ref|XP_004487429.1| PREDICTED: cellulose synthase-like protein H1-like isoform X3 
[Cicer arietinum]
Length=747

 Score =   428 bits (1101),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 230/476 (48%), Positives = 305/476 (64%), Gaps = 29/476 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             +SG+MTNAPF+LN+DCD +VN+ K+ LHA+C LL  K EK+  F Q PQ FY  +KDD Y
Sbjct  279   ISGLMTNAPFILNVDCDMYVNNSKIALHALCILLDSKGEKEVAFAQCPQRFYDAVKDDAY  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHV-VDNNEKS----------  328
             GNQ+  +  Y+  G AG+QG  Y GT CFHRRKVIYG+ PH  + N  K           
Sbjct  339   GNQLVALPMYIGSGFAGLQGIIYAGTNCFHRRKVIYGVSPHHDIQNANKDHHGLANGILL  398

Query  329   TDKDQWETFGKSKTFALSTTQILSG---SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQ  499
             +DK+  + FG SK F  S T +L G     Y  + +     +AA++VASC YE+ TAWG+
Sbjct  399   SDKETMQKFGTSKGFVESVTHVLEGMTLDFYKSLDV-----KAARKVASCDYEYNTAWGK  453

Query  500   KVGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALD  679
             +VG LYGS  ED  TG+  H KGW+S  C  +P  F+G SP      + Q KRW T  LD
Sbjct  454   QVGWLYGSTSEDVLTGLKFHTKGWRSELCSTDPIAFMGCSPQDNLGQMAQHKRWSTGLLD  513

Query  680   ILICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLN  859
             I + K  PI   LFG+L  R+CLAY+WI  W +R   EICY+LLPAYCII NS+F P   
Sbjct  514   IFLSKHCPIFGTLFGKLQLRECLAYIWITNWALRSVPEICYALLPAYCIITNSNFLPN-Q  572

Query  860   EAAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFG  1039
             E+++ IP ++F+IYN+  LFE+I++G S+R WWNNQRM R+    S   GFL+ ++K   
Sbjct  573   ESSMWIPTTLFVIYNISNLFEHIKSGLSIRTWWNNQRMGRITTMNSCFLGFLTILLKHLR  632

Query  1040  LSEAVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK  1219
             +S+  FE+TKK+  S        +  VGRF F+ES +F+PGTTIL+V   ALF+  L+++
Sbjct  633   ISDTPFEITKKEQPS-------SNENVGRFIFNESLIFLPGTTILMVQFIALFMSLLEWQ  685

Query  1220  Q--NKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
                +  + +GE  CS +V+L Y  FLKGLFGKGK+GIPLST+ KS  LA LF H C
Sbjct  686   PLVSNGYGVGEVFCSGYVVLCYLPFLKGLFGKGKYGIPLSTICKSTVLAFLFVHFC  741



>ref|XP_006469655.1| PREDICTED: cellulose synthase-like protein B4-like isoform X1 
[Citrus sinensis]
Length=732

 Score =   428 bits (1100),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 226/469 (48%), Positives = 297/469 (63%), Gaps = 17/469 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD + N+P++VL AMC  LG K+E +  F+Q PQ FY    D P 
Sbjct  279   VSGLMTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFY----DRP-  333

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
                + I+ +Y+ +G  GIQGPFY GTG FHRR V+YG+    +++     + +  + FG 
Sbjct  334   -ENLCILNEYIGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGN  392

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             SK F  S  Q L G           SL+ A  VA C YE+G++WG +VG LYG+  ED  
Sbjct  393   SKEFIKSAAQTLEGKTGGYSSNISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNL  452

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGW+S YC P P  FLG +   GPA + QQKRW T  L+IL  K++PI+  L 
Sbjct  453   TGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLI  512

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
             G+L FRQCLAYLWI+ W +R   E+CY  LPAYCII NS F PK+ E  ++IP ++F+IY
Sbjct  513   GKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIY  572

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
              LY L EYI+ G S+R+WW N  M R+  + +WLFG ++  ++ FG SEAVFE+T+K H 
Sbjct  573   KLYTLLEYIQAGLSIRSWWVNNCMARIVTTSAWLFGLVNAALEQFGFSEAVFEITQKIHR  632

Query  1082  SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW--SLGEAIC  1255
             S         S V    FD+SP FVPGTTI+LV+LAA   G L  +   +    LG+  C
Sbjct  633   S---------SDVDEVMFDDSPFFVPGTTIILVHLAAWATGLLRLQSQCAHGSGLGDYFC  683

Query  1256  SVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSVH*FN  1402
             SV+V+L ++ FL+GLF  GK GIP ST+ KS  LALLF   CK +   N
Sbjct  684   SVYVVLCFFPFLRGLFMTGKKGIPWSTIGKSTALALLFVQWCKMMSSMN  732



>ref|XP_008455913.1| PREDICTED: cellulose synthase-like protein H1 [Cucumis melo]
Length=746

 Score =   428 bits (1100),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 232/464 (50%), Positives = 303/464 (65%), Gaps = 2/464 (0%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAP+MLNLDCD  VN+P ++L AMC  L    +K+  F+QFPQ FY GLKDDP+
Sbjct  282   VSGVMTNAPYMLNLDCDMFVNNPDILLQAMCLFLDPTIDKEYAFIQFPQIFYNGLKDDPF  341

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ  +IM+ L  G  GIQGP YMGTGC HRRKV+YG  P   + NEK  ++  ++ FG 
Sbjct  342   GNQWIVIMQILIYGQTGIQGPMYMGTGCIHRRKVLYGRSPTEDNINEKYDEEKLYKRFGN  401

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             SK F  S  + L  S         NS+++  EVA+  YE   AWG +VG  YGS  ED  
Sbjct  402   SKEFVRSAIRSLR-SFADHSNCLSNSIKSTYEVATANYEHNNAWGSEVGWKYGSIVEDVL  460

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGWKS Y  P PP FLG +P+GGP  L   KR  T  L+ILI K SPI+ AL 
Sbjct  461   TGMEIHKKGWKSAYITPTPPAFLGCAPSGGPVPLNHHKRAITGLLEILISKNSPILTALS  520

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
              +L FRQ L Y+W         +EICY+ LPA+C+I+NSHF PK+ E  I +P  +F++ 
Sbjct  521   DKLQFRQRLVYMWAYLMGFGAIWEICYATLPAFCLISNSHFLPKVQEPVICVPLLLFVLL  580

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
              L  L +Y ETG+S+RAWWNN RM ++    S L G ++ ++K+FG+SE VFE+TKK+ S
Sbjct  581   KLRMLLDYFETGQSVRAWWNNLRMEKIQKMSSSLLGIVAVILKIFGISETVFEITKKESS  640

Query  1082  SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN-KSWSLGEAICS  1258
             S     K  D  +GRFTFDESPLFVP TT+L++ L AL IGFL  + + + + + E +C 
Sbjct  641   SSSDDIKSGDGDLGRFTFDESPLFVPVTTVLMIQLTALSIGFLQTQPSIREFGVAEVMCC  700

Query  1259  VWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
             +W IL +W+FLKG+F KG +G+P  T+ KS  LALLF + C+  
Sbjct  701   LWTILSFWSFLKGMFAKGNYGLPWPTLFKSSVLALLFVYLCQET  744



>gb|ACN67534.1| cellulose synthase-like protein H1 [Hordeum vulgare subsp. vulgare]
Length=751

 Score =   428 bits (1100),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 226/470 (48%), Positives = 299/470 (64%), Gaps = 10/470 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP MLN+DCD   N+P+V LHAMC LLG  DE  + FVQ PQ FYGGLKDDP+
Sbjct  279   VSAVMTNAPIMLNVDCDMFANNPQVALHAMCLLLGFDDEIHSGFVQVPQKFYGGLKDDPF  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTD---KDQWET  352
             GNQM++I K +  G AGIQG FY GTGCFHRRKVIYGM P     +E       K+    
Sbjct  339   GNQMQVITKKIGGGIAGIQGMFYGGTGCFHRRKVIYGMPPPDTLKHETRGSPSYKELQVR  398

Query  353   FGKSKTFALSTTQILSGSLYPEIPIFPNS-LEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             FG SK    S+  I+SG L     +  +S +E AK+V  C YE GT WG+++G +YGS  
Sbjct  399   FGSSKVLIESSRNIISGDLLARPTVDVSSRIEMAKQVGDCNYEAGTCWGKEIGWVYGSMT  458

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG  IH  GWKS   D NPP FLG +PTGGPA+LTQ KRW T  L+ILI + SPI+
Sbjct  459   EDILTGQRIHAAGWKSALLDTNPPAFLGCAPTGGPASLTQFKRWATGVLEILISRNSPIL  518

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               +F RL  RQCL YL +  WP+R  FE+CY+LL  +C++ N  F P  ++    IP ++
Sbjct  519   GTIFQRLQLRQCLGYLIVEAWPVRAPFELCYALLGPFCLLTNQSFLPTASDEGFRIPVAL  578

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+ Y++Y L EY E G S RAWWNN RM R+ ++ +WL  FL+ ++K  GLSE VFEVT+
Sbjct  579   FLSYHIYHLMEYKECGLSARAWWNNHRMQRITSASAWLLAFLTVILKTLGLSETVFEVTR  638

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW-----  1234
             K+ S+ +     D++  G FTFD +P+F+P T + ++N+ AL +G        +      
Sbjct  639   KESSTSDGGAGTDEADPGLFTFDSAPVFIPVTALSVLNIVALAVGAWRAVIGTAAVVHGG  698

Query  1235  -SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
               +GE +C  W++L +W F++GL  +GK GIP S  +K+G +   F H C
Sbjct  699   PGIGEFVCCGWMVLCFWPFVRGLVSRGKHGIPWSVKVKAGLIVAAFVHLC  748



>ref|XP_008342031.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Malus 
domestica]
Length=751

 Score =   427 bits (1099),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 228/469 (49%), Positives = 306/469 (65%), Gaps = 11/469 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD + N+PK+VLHAMC LLG K EK+  FVQFPQ FY  L+DDP+
Sbjct  279   VSGVMTNAPFMLNVDCDMYANNPKIVLHAMCLLLGFKHEKEGAFVQFPQMFYDTLEDDPF  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN-EKSTDKDQWETFG  358
             G+ +   +K ++ G AGIQGP Y GTGCFHRRKVIYG+   + DN    ++++   E FG
Sbjct  339   GSNVVEAVKKIWPGLAGIQGPIYAGTGCFHRRKVIYGL--SLTDNEGNLTSERLNKECFG  396

Query  359   KSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
              S     S TQIL      ++     ++E A +VA   YE  T WG+KVG +YGS  ED 
Sbjct  397   NSPELIRSATQILLEENIDQLDDLSCAVEIAYQVAGSEYEDDTLWGKKVGWVYGSVSEDV  456

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+ IH +GWKS+ C P PPGFLG+ P+     L Q+KRW T  L+IL  K  PI   L
Sbjct  457   LTGMKIHARGWKSILCTPEPPGFLGTGPSTTHVMLIQRKRWITGLLEILFSKNCPIFATL  516

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             + +L FRQCLAYL I+ W +    ++CY+LLPAYCII NSHF PK+ E  ++I A++F+I
Sbjct  517   YAKLEFRQCLAYLRILIWGLLSVPDLCYALLPAYCIITNSHFLPKVEEPTLIIFAALFLI  576

Query  899   YNLYGLFEYIETGESLRAWWNNQRM---LRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
              +LY L  Y+++G S+RAWWN   +    ++    + LFG ++ V K+ G+SE  FEVT+
Sbjct  577   KHLYTLHSYLDSGRSIRAWWNQLTVGPWSKITTLTASLFGLVTVVFKLLGISEVTFEVTQ  636

Query  1070  KD-HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN----KSW  1234
             K+ +SS    +   D+  GRFTFD + +FVP T +L +   AL    L  +         
Sbjct  637   KEQNSSSSDQEATYDANAGRFTFDGTTIFVPATALLFLQFTALVTAALGLEPPALGVNGA  696

Query  1235  SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
              +GE +CSVWV+L +W F+KGLFGKGK+GIP+ T++KS  LALLF H+C
Sbjct  697   GIGEMMCSVWVVLCFWPFVKGLFGKGKYGIPMVTIVKSAVLALLFMHSC  745



>gb|KHN44861.1| Cellulose synthase-like protein B3 [Glycine soja]
Length=746

 Score =   427 bits (1097),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 224/468 (48%), Positives = 303/468 (65%), Gaps = 10/468 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK+V HA+C L+  +  K+  FVQ  Q FY G+KDDP+
Sbjct  279   VSGLMTNAPFMLNVDCDMFVNNPKIVQHALCILMDSQRGKEVAFVQCFQQFYDGIKDDPF  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKST--DKDQWETF  355
             GNQ  I  +Y+ RG AG+QGPFY GT  FHRR  IYG++PH +++  K    +K     F
Sbjct  339   GNQWVIAFEYIIRGMAGLQGPFYGGTNTFHRRNAIYGLYPHEIESGRKGKLEEKILIRQF  398

Query  356   GKSKTFALSTTQILSGSLYPEIPIFP-NSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             G SK F  S    L G+ Y    I P N +EAA +VA+C YE  T WG+++G LYGS  E
Sbjct  399   GSSKEFIKSAAHALGGNAYSANDITPSNFIEAATQVANCEYEDDTFWGKQMGWLYGSISE  458

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  TG++I  +GW+S  C P+P  F G +P G    + QQKRW +    +   K SP++ 
Sbjct  459   DVPTGLNIQRRGWRSECCTPDPIAFTGCAPGGLLTTMVQQKRWASGLTVVFFGKHSPLMG  518

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIF  892
              LFG++ FR  L+Y W+  W +R FF +CY  L  YCII N++  PK     + IP ++F
Sbjct  519   MLFGKIQFRAGLSYFWLTNWGLRAFFLVCYVALLEYCIITNTNIFPK--GLGLWIPIALF  576

Query  893   IIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKK  1072
             +IYN + L EY+  G S+R WWNNQRM  +  + +W  GFLS V+K+ G+S+ VFE+T+K
Sbjct  577   VIYNAHTLLEYLTIGLSMRHWWNNQRMCIIRTTTAWFVGFLSAVLKLSGISDTVFEITEK  636

Query  1073  DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS---LG  1243
             + S+  A   + D+  GRFTFDESP+FV GTTILLV+L A+ I F   + N S +   LG
Sbjct  637   EQSTSGADGNNADA--GRFTFDESPVFVVGTTILLVHLTAMLIKFWGLQPNHSGNGSGLG  694

Query  1244  EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             E ICS ++++ YW + KGLF +GK+GIPLST+ KS   AL+F H C S
Sbjct  695   EFICSTYLVVCYWPYFKGLFARGKYGIPLSTICKSAVFALVFVHFCGS  742



>ref|XP_003539496.1| PREDICTED: cellulose synthase-like protein H1-like [Glycine max]
Length=746

 Score =   427 bits (1097),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 224/468 (48%), Positives = 303/468 (65%), Gaps = 10/468 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK+V HA+C L+  +  K+  FVQ  Q FY G+KDDP+
Sbjct  279   VSGLMTNAPFMLNVDCDMFVNNPKIVQHALCILMDSQRGKEVAFVQCFQQFYDGIKDDPF  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKST--DKDQWETF  355
             GNQ  I  +Y+ RG AG+QGPFY GT  FHRR  IYG++PH +++  K    +K     F
Sbjct  339   GNQWVIAFEYIIRGMAGLQGPFYGGTNTFHRRNAIYGLYPHEIESGRKGKLEEKILIRQF  398

Query  356   GKSKTFALSTTQILSGSLYPEIPIFP-NSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             G SK F  S    L G+ Y    I P N +EAA +VA+C YE  T WG+++G LYGS  E
Sbjct  399   GSSKEFIKSAAHALGGNAYSANDITPSNFIEAATQVANCEYEDDTFWGKQMGWLYGSISE  458

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  TG++I  +GW+S  C P+P  F G +P G    + QQKRW +    +   K SP++ 
Sbjct  459   DVPTGLNIQRRGWRSECCTPDPIAFTGCAPGGLLTTMVQQKRWASGLTVVFFGKHSPLMG  518

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIF  892
              LFG++ FR  L+Y W+  W +R FF +CY  L  YCII N++  PK     + IP ++F
Sbjct  519   MLFGKIQFRAGLSYFWLTNWGLRAFFLVCYVALLEYCIITNTNIFPK--GLGLWIPIALF  576

Query  893   IIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKK  1072
             +IYN + L EY+  G S+R WWNNQRM  +  + +W  GFLS V+K+ G+S+ VFE+T+K
Sbjct  577   VIYNAHTLLEYLTIGLSMRHWWNNQRMCIIRTTTAWFVGFLSAVLKLSGISDTVFEITEK  636

Query  1073  DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS---LG  1243
             + S+  A   + D+  GRFTFDESP+FV GTTILLV+L A+ I F   + N S +   LG
Sbjct  637   EQSTSGADGNNADA--GRFTFDESPVFVVGTTILLVHLTAMLIKFWGLQPNHSGNGSGLG  694

Query  1244  EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             E ICS ++++ YW + KGLF +GK+GIPLST+ KS   AL+F H C S
Sbjct  695   EFICSTYLVVCYWPYFKGLFARGKYGIPLSTICKSAVFALVFVHFCGS  742



>ref|XP_003579750.1| PREDICTED: cellulose synthase-like protein H1 [Brachypodium distachyon]
Length=754

 Score =   426 bits (1094),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 223/473 (47%), Positives = 298/473 (63%), Gaps = 15/473 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP MLN+DCD   N+P V LHAMC LLG  DE D+ FVQ PQ FYG L+DDP+
Sbjct  281   VSAVMTNAPIMLNVDCDMFANNPGVALHAMCLLLGFDDETDSGFVQAPQKFYGSLRDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTD-----KDQW  346
             GNQM+++ + L  G AGIQG FY GTGCFHRRKVIYG  P   D  +  T      K+  
Sbjct  341   GNQMEVLFQKLGGGVAGIQGMFYGGTGCFHRRKVIYGTPPP--DTVKHGTTGSPSYKELQ  398

Query  347   ETFGKSKTFALSTTQILSGSLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
               FG SK    S+  I+SG +         + +E AK+V +C YE GT WGQ+VG +YGS
Sbjct  399   MKFGNSKELIDSSRSIISGDVLARTTANMSSRIEMAKQVGACNYEAGTCWGQEVGWVYGS  458

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG  IH  GWKSV  D NPP FLG +PTGGPA+LTQ KRW T  L+ILI K SP
Sbjct  459   MTEDILTGQRIHTTGWKSVLMDTNPPAFLGCAPTGGPASLTQFKRWATGVLEILISKNSP  518

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             I+  +FGRL  RQCLAYL +  WP+R  FE+CY+LL  +C++ N  F PK ++    IP 
Sbjct  519   ILGTIFGRLQLRQCLAYLIVDVWPVRAPFELCYALLGPFCLLANQSFLPKASDEGFYIPV  578

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             ++F+ + +Y L EY + G S RAWWNN RM R+ ++ +WL  FL+ ++K  GLSE VFEV
Sbjct  579   ALFLTFQVYYLMEYKDCGLSARAWWNNHRMQRITSASAWLLAFLTVLLKTMGLSETVFEV  638

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS--  1237
             T+K+ S+ +     +++  G FTFD SP+F+P T + ++N+ A+ +G        +    
Sbjct  639   TRKESSTSDGSGSTNEADPGLFTFDSSPVFIPVTVLAILNIVAIAVGVWHAVVTGTVKGI  698

Query  1238  -----LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
                  +GE +   W +L +W F++GL  +G++GIP S  +K+G +     H C
Sbjct  699   HGGPGIGEFLYCCWTVLCFWPFVRGLVSRGRYGIPWSVKVKAGLIVGALVHFC  751



>gb|AAL38531.1|AF435646_1 CSLH1 [Oryza sativa]
Length=743

 Score =   425 bits (1093),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 221/468 (47%), Positives = 294/468 (63%), Gaps = 7/468 (1%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS +MTNAPFMLNLDCD  VN+P+VVLHAMC LLG  DE    FVQ PQ FYG LKDDP+
Sbjct  274   VSALMTNAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPF  333

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ+++ +  + RG AG+QG FY GTGCFHRRKVIYGM          S++K+    FG 
Sbjct  334   GNQLEVSLMKVGRGIAGLQGIFYCGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGS  393

Query  362   SKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             S  F  S   ++ G+L  E I    + ++ AKEVA+C YE GT WGQ+VG +YGS  ED 
Sbjct  394   SNNFKESARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDV  453

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG  IH  GW+S   +  PP F+G +P GGPA LTQ KRW +  L+ILI + +PI+   
Sbjct  454   LTGQRIHAAGWRSTLMEIEPPAFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTT  513

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F  L FRQCLAYL    WP+R  FE+CY+LL  YC+++N  F PK +E    I  ++FI 
Sbjct  514   FKSLQFRQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPKTSEDGFYIALALFIA  573

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             YN Y   E+IE G+S RA WNN RM R+ ++ +WL  FL+ ++K  G SE VFEVT+KD 
Sbjct  574   YNTYMFMEFIECGQSARACWNNHRMQRITSASAWLLAFLTVILKTLGFSETVFEVTRKDK  633

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSL------  1240
             S+ +     D+ + GRFTFDES +F+P T + ++++ A+ +G        +  L      
Sbjct  634   STSDGDSNTDEPEPGRFTFDESTVFIPVTALAMLSVIAIAVGAWRVVLVTTEGLPGGPGI  693

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
              E I   W++L +   L+GL G G++GIP S  +K+  L  +F   CK
Sbjct  694   SEFISCGWLVLCFMPLLRGLVGSGRYGIPWSIKMKACLLVAIFLLFCK  741



>ref|NP_001064384.1| Os10g0341700 [Oryza sativa Japonica Group]
 sp|Q339N5.2|CSLH1_ORYSJ RecName: Full=Cellulose synthase-like protein H1; AltName: Full=OsCslH1 
[Oryza sativa Japonica Group]
 tpg|DAA01747.1| TPA_exp: cellulose synthase-like H1 [Oryza sativa]
 gb|ABB47242.2| Cellulose synthase family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26298.1| Os10g0341700 [Oryza sativa Japonica Group]
 dbj|BAG91240.1| unnamed protein product [Oryza sativa Japonica Group]
Length=750

 Score =   425 bits (1092),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 221/468 (47%), Positives = 294/468 (63%), Gaps = 7/468 (1%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS +MTNAPFMLNLDCD  VN+P+VVLHAMC LLG  DE    FVQ PQ FYG LKDDP+
Sbjct  281   VSALMTNAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ+++ +  + RG AG+QG FY GTGCFHRRKVIYGM          S++K+    FG 
Sbjct  341   GNQLEVSLMKVGRGIAGLQGIFYCGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGS  400

Query  362   SKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             S  F  S   ++ G+L  E I    + ++ AKEVA+C YE GT WGQ+VG +YGS  ED 
Sbjct  401   SNNFKESARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDV  460

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG  IH  GW+S   +  PP F+G +P GGPA LTQ KRW +  L+ILI + +PI+   
Sbjct  461   LTGQRIHAAGWRSTLMEIEPPAFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTT  520

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F  L FRQCLAYL    WP+R  FE+CY+LL  YC+++N  F PK +E    I  ++FI 
Sbjct  521   FKSLQFRQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPKTSEDGFYIALALFIA  580

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             YN Y   E+IE G+S RA WNN RM R+ ++ +WL  FL+ ++K  G SE VFEVT+KD 
Sbjct  581   YNTYMFMEFIECGQSARACWNNHRMQRITSASAWLLAFLTVILKTLGFSETVFEVTRKDK  640

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSL------  1240
             S+ +     D+ + GRFTFDES +F+P T + ++++ A+ +G        +  L      
Sbjct  641   STSDGDSNTDEPEPGRFTFDESTVFIPVTALAMLSVIAIAVGAWRVVLVTTEGLPGGPGI  700

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
              E I   W++L +   L+GL G G++GIP S  +K+  L  +F   CK
Sbjct  701   SEFISCGWLVLCFMPLLRGLVGSGRYGIPWSIKMKACLLVAIFLLFCK  748



>ref|XP_004165439.1| PREDICTED: cellulose synthase-like protein H1-like, partial [Cucumis 
sativus]
Length=651

 Score =   422 bits (1084),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 228/459 (50%), Positives = 304/459 (66%), Gaps = 18/459 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDE-KDAEFVQFPQNFYGGLKDDP  178
             VSGV+TNAP++LN+DCD  +N+P+VVLHAMC     +D+ +D  +VQ P  FY G+KDDP
Sbjct  186   VSGVLTNAPYILNVDCDMFMNNPQVVLHAMCVFFNSEDDFEDIGYVQTPPCFYDGIKDDP  245

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---EKSTDKDQWE  349
             YGNQ+ I+ +Y  RG  G+QGP Y G+GCFHRRKV+YG +PH   N+    K+++++  +
Sbjct  246   YGNQLVIVYEYFTRGIMGLQGPIYSGSGCFHRRKVLYGQFPHYTTNSVDGRKASEQEIIK  305

Query  350   TFGKSKTFALSTTQILSGSLY---PEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYG  520
             +FG SK+FA S       + +   PE     N+LEAA +VA C YE GT WG K+G +YG
Sbjct  306   SFGYSKSFAKSAIYAFEETTFGYLPEGLFNNNNLEAAIQVAGCGYEIGTTWGSKIGWMYG  365

Query  521   SAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKS  700
             S  ED  T + IH KGW+S+Y   NPP FLG +P+    +LTQQKRW T  L+IL  K  
Sbjct  366   STCEDILTSLVIHRKGWRSIYIALNPPAFLGCAPSQLVTSLTQQKRWVTGLLEILFSKHC  425

Query  701   PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP  880
             PI   LF  L ++QC AYLWI+ W IR   E+ Y+LLP YC+I N+ F P + E AI IP
Sbjct  426   PIFGTLFENLQWKQCAAYLWILTWGIRSILELSYALLPPYCLITNTSFFPTMEERAIFIP  485

Query  881   ASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFE  1060
              S+FI+YN   L +Y ETG+S+RAWWNNQRM R+    +WLFG  + V+K+ G+ E VFE
Sbjct  486   ISLFIVYNFQQLLQYKETGQSVRAWWNNQRMGRINTICAWLFGVGNAVLKLLGVRETVFE  545

Query  1061  VTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSL  1240
             VTKK+   +  L        G FTFDESP+FV GTTILL+ L AL   F+   +++S  L
Sbjct  546   VTKKETYCEVDL--------GHFTFDESPMFVTGTTILLLQLIALLTSFIRLGRSRSAVL  597

Query  1241  GEAICSVWVILMYWAflkglfg--kgkfgIPLSTVLKSG  1351
              E ICS+W+ L +W FLKG+    KG++G+P ST+ KS 
Sbjct  598   -EVICSLWLFLCFWPFLKGILMFGKGRYGLPFSTIYKSA  635



>ref|XP_008669411.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Zea 
mays]
Length=781

 Score =   426 bits (1094),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 217/468 (46%), Positives = 293/468 (63%), Gaps = 10/468 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS V+TNAP MLN+DCD   N+P+  LHAMC LLG  DE  + FVQ PQ FYGGL DDP+
Sbjct  309   VSAVLTNAPIMLNVDCDMFANNPQAALHAMCLLLGFDDEVHSGFVQAPQRFYGGLADDPF  368

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTD----KDQWE  349
             GNQM++I + +  G AG+QG FY GTGCFHRRKV+YG+ P       K+ D    K+  +
Sbjct  369   GNQMQVIFEKVGHGIAGLQGIFYCGTGCFHRRKVMYGVPPGSGTGATKAADSPSYKELQK  428

Query  350   TFGKSKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSA  526
              FG SK    S   I++    P  +    + +E AK+V++C YE GT+WGQ+VG +YGS 
Sbjct  429   KFGSSKELIESARSIITSKEAPAAVADLTSRVEVAKQVSACSYETGTSWGQEVGWVYGSM  488

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG  IH  GW+S    P+PP FLG +PTGGPA+LTQ KRW T  L+I++ + +P 
Sbjct  489   TEDVLTGQRIHAAGWRSALLSPDPPAFLGGAPTGGPASLTQYKRWATGLLEIVLSRHNPF  548

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
             + +   RL FRQCLAYL I  WP+R  FE+CY+LL  YC+I N  F PK +E   V+P +
Sbjct  549   LLSASKRLRFRQCLAYLVIDVWPVRAPFELCYALLGPYCLIANRSFLPKASEPGFVVPLA  608

Query  887   IFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
             +F+ YN Y L EY++   S RAWWNNQRM R+ +S +WL  FL+ V+K  GLSE VFEVT
Sbjct  609   LFLAYNAYNLGEYVDCRLSARAWWNNQRMQRITSSSAWLLAFLTVVLKTVGLSETVFEVT  668

Query  1067  KKDHSSDEALDKDD--DSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLD--FKQNKSW  1234
             +K+    +     D  D+  GRFTFD SP+FVP   + ++++ A+ +G            
Sbjct  669   RKEQQQQQGSPDGDGADADPGRFTFDSSPVFVPPAALAMLSVVAVAVGAWRAVTGGGGGP  728

Query  1235  SLGEAICSVWVILMYWA-flkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
              +GE +C  W++L +W      + G+G +GIP S  +K+  L   F H
Sbjct  729   GVGEFVCCAWLLLCFWPFVRGLVGGRGSYGIPWSVRIKAALLVAAFVH  776



>ref|XP_004487424.1| PREDICTED: cellulose synthase-like protein B4-like isoform X2 
[Cicer arietinum]
Length=747

 Score =   424 bits (1090),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 223/466 (48%), Positives = 299/466 (64%), Gaps = 12/466 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK++ HAMC L+  K  KD  FVQ  Q FY G+KDDP+
Sbjct  278   VSGLMTNAPFMLNVDCDMVVNNPKIIQHAMCILMDSKSGKDVAFVQCFQQFYDGIKDDPF  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS--TDKDQWETF  355
             GNQ     +Y+ RG AG+QGP+Y GT  FHRR  IYG++P  V   +K   T+K   + F
Sbjct  338   GNQWVAAFEYIIRGMAGLQGPYYGGTNTFHRRNAIYGLYPDEVQYGKKGKLTEKKLIQQF  397

Query  356   GKSKTFALSTTQILSGSLYPEIP--IFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             G SK F  S T     S Y         N +E A +V+ C Y+ GT+WG+K+G LYGS  
Sbjct  398   GSSKEFVKSATHAFERSDYSTNNGISLSNFIEEAIQVSDCGYDNGTSWGKKMGWLYGSIS  457

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG+++H KGW+S  C P    F G +P G    + QQKRW +    +   + SP++
Sbjct  458   EDVPTGLNMHRKGWRSECCTPVQTAFKGCAPVGLLTTMIQQKRWASGLTVVFFGRHSPVM  517

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               LFG++  R  L+Y W+  W +R  FE+CY+ L AYCII NS+  PK     + IP ++
Sbjct  518   GTLFGKIQIRAGLSYCWLTNWGLRSVFEVCYAALVAYCIITNSNIFPK--GLGLWIPFTL  575

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+IYNL+ L EY+ TG SLR WWNNQRM  +  +  W  GFLS ++K+ G+S++VFEVT+
Sbjct  576   FVIYNLHTLQEYLSTGLSLRHWWNNQRMSIIRTTSVWFIGFLSAMLKILGISDSVFEVTQ  635

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK----QNKSWS  1237
             K ++S  A   +DD+  GRFTFD+SP+FV GTTILLV L ALF+  L  +          
Sbjct  636   KKNTSSSA--AEDDANAGRFTFDDSPVFVVGTTILLVQLTALFVKILGLQLQAHSGNGCG  693

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
             LGE +CSV++++ YW +LKGLF +GK+GIPLST+ KS  LA +F H
Sbjct  694   LGELMCSVYLVVCYWPYLKGLFARGKYGIPLSTIFKSALLAFIFVH  739



>ref|XP_004151937.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=743

 Score =   423 bits (1088),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 220/435 (51%), Positives = 288/435 (66%), Gaps = 17/435 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDE-KDAEFVQFPQNFYGGLKDDP  178
             VSGV+TNAP++LN+DCD   NDP+VVLHAMC  L  KD+ +D  +VQ PQ FY GLKDDP
Sbjct  277   VSGVLTNAPYILNVDCDMFANDPQVVLHAMCVFLNSKDDLEDIGYVQTPQCFYDGLKDDP  336

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDN--NEKSTDKDQWET  352
             +GNQ+ ++ +Y  RG  G+QGPFY GTGCFHRRKV+Y  +PH      N K+++++  +T
Sbjct  337   FGNQLVVVFEYFGRGIMGLQGPFYGGTGCFHRRKVLYAQFPHHTAYFLNGKASEQELIKT  396

Query  353   FGKSKTFALSTTQIL----SGSLYPEIPIF-PNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
             FG SKTF  S T       + S YP   +F  N+L+AA  VA C YE  T WG K+G +Y
Sbjct  397   FGYSKTFTKSATYAFKDDQNTSGYPPKGLFNTNNLDAANHVAGCGYEISTTWGSKIGWIY  456

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GS  ED  TG+ I  +GW+S++   NPP FLG +P+   A+L QQKRW T  L +L  K 
Sbjct  457   GSTSEDVLTGLVIQTRGWRSIFLALNPPAFLGCAPSQLVASLNQQKRWATGFLQVLFNKH  516

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
              PI   LFG+L +RQC AYLW++ W +R   E+ Y+LLPAYC+I NS F P + E AI I
Sbjct  517   CPIFGTLFGKLQWRQCAAYLWMLTWGLRSIPELSYALLPAYCLITNSSFFPTMKERAIFI  576

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
             P  +FIIYN   L +Y ETG+SLRAWWNNQ+M RV    +WLFG  + V+   G  E VF
Sbjct  577   PIFLFIIYNFQQLLQYKETGQSLRAWWNNQKMGRVNTICAWLFGVRNVVLNFLGGKETVF  636

Query  1058  EVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS  1237
             EVTKK+   +  L        G FTFDESP+FVPGTTI+L+   ALF+ F+  ++ +S  
Sbjct  637   EVTKKETCCEVNL--------GHFTFDESPMFVPGTTIMLLQFIALFMSFIRLERPRSAV  688

Query  1238  LGEAICSVWVILMYW  1282
             L E +CS+W++L +W
Sbjct  689   L-EVVCSIWLLLCFW  702



>ref|XP_008455907.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Cucumis 
melo]
Length=746

 Score =   423 bits (1088),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 233/474 (49%), Positives = 316/474 (67%), Gaps = 23/474 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDE-KDAEFVQFPQNFYGGLKDDP  178
             VSGV+TNAP++LN+DCD  VN+P+VVLHAMC  L  KD+ +D  +VQ PQ FY GLKDDP
Sbjct  282   VSGVLTNAPYILNVDCDMFVNNPQVVLHAMCVFLNSKDDLEDIGYVQTPQCFYDGLKDDP  341

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH--VVDNNEKSTDKDQWET  352
             +GNQ+ ++ +Y  RG  G+QGPFY GTGCFHRRKV+Y  +PH  +   + K+++++  +T
Sbjct  342   FGNQLVVVFEYSARGIMGLQGPFYSGTGCFHRRKVLYAQFPHHTIYFLDGKASEQELIKT  401

Query  353   FGKSKTFALSTT-----QILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
             FG SKTFA S T     Q  + S YP   +  N+LEAA +VA C YE  T+WG ++G +Y
Sbjct  402   FGYSKTFAKSATYAFKDQNTNTSGYPPKGLLNNNLEAANQVAGCGYEISTSWGSEIGWMY  461

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GS  ED  TG+ I  +GW+S++   NPP FLG +P+   A+LTQQKRW +  L +L+ ++
Sbjct  462   GSTSEDVLTGLVIQTRGWRSIFLALNPPAFLGCAPSQLVASLTQQKRWASGFLQVLLNRR  521

Query  698   S-PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIV  874
               PI   LFG+L ++QC AYLWI+ W +R   E+ Y+LLP YC+I NS   P + E AI 
Sbjct  522   HCPIFGTLFGKLQWKQCAAYLWILTWGLRSIPELSYTLLPPYCLITNSSIFPTVKERAIF  581

Query  875   IPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAV  1054
             IP  +FIIYN   L +Y ETG+S+RAWWNNQ+M RV    +WLFG    V+K  G  E  
Sbjct  582   IPIFLFIIYNFQQLLQYKETGQSIRAWWNNQKMGRVNTMCAWLFGVWDVVLKFLGERETA  641

Query  1055  FEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW  1234
             FEVTKK+  S+  L        G FTFDESP+FVPGTTILL+ L ALFI      +    
Sbjct  642   FEVTKKETCSEINL--------GHFTFDESPMFVPGTTILLLQLIALFIRL----ERPGS  689

Query  1235  SLGEAICSVWVILMYWAflkglfg--kgkfgIPLSTVLKSGGLALLFFHACKSV  1390
             ++ E +CS+W++L +W FLKG+F   +G++G+  ST+ KS  +ALLF   C++ 
Sbjct  690   AVLEVVCSIWLLLCFWPFLKGIFMFGRGRYGLSFSTIYKSVAIALLFVLLCQTT  743



>ref|XP_004487423.1| PREDICTED: cellulose synthase-like protein B4-like isoform X1 
[Cicer arietinum]
Length=748

 Score =   423 bits (1087),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 223/467 (48%), Positives = 299/467 (64%), Gaps = 13/467 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK++ HAMC L+  K  KD  FVQ  Q FY G+KDDP+
Sbjct  278   VSGLMTNAPFMLNVDCDMVVNNPKIIQHAMCILMDSKSGKDVAFVQCFQQFYDGIKDDPF  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS---TDKDQWET  352
             GNQ     +Y+ RG AG+QGP+Y GT  FHRR  IYG++P  V   +K    T+K   + 
Sbjct  338   GNQWVAAFEYIIRGMAGLQGPYYGGTNTFHRRNAIYGLYPDEVQYGKKVGKLTEKKLIQQ  397

Query  353   FGKSKTFALSTTQILSGSLYPEIP--IFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSA  526
             FG SK F  S T     S Y         N +E A +V+ C Y+ GT+WG+K+G LYGS 
Sbjct  398   FGSSKEFVKSATHAFERSDYSTNNGISLSNFIEEAIQVSDCGYDNGTSWGKKMGWLYGSI  457

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG+++H KGW+S  C P    F G +P G    + QQKRW +    +   + SP+
Sbjct  458   SEDVPTGLNMHRKGWRSECCTPVQTAFKGCAPVGLLTTMIQQKRWASGLTVVFFGRHSPV  517

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
             +  LFG++  R  L+Y W+  W +R  FE+CY+ L AYCII NS+  PK     + IP +
Sbjct  518   MGTLFGKIQIRAGLSYCWLTNWGLRSVFEVCYAALVAYCIITNSNIFPK--GLGLWIPFT  575

Query  887   IFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
             +F+IYNL+ L EY+ TG SLR WWNNQRM  +  +  W  GFLS ++K+ G+S++VFEVT
Sbjct  576   LFVIYNLHTLQEYLSTGLSLRHWWNNQRMSIIRTTSVWFIGFLSAMLKILGISDSVFEVT  635

Query  1067  KKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK----QNKSW  1234
             +K ++S  A   +DD+  GRFTFD+SP+FV GTTILLV L ALF+  L  +         
Sbjct  636   QKKNTSSSA--AEDDANAGRFTFDDSPVFVVGTTILLVQLTALFVKILGLQLQAHSGNGC  693

Query  1235  SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
              LGE +CSV++++ YW +LKGLF +GK+GIPLST+ KS  LA +F H
Sbjct  694   GLGELMCSVYLVVCYWPYLKGLFARGKYGIPLSTIFKSALLAFIFVH  740



>gb|EMT26547.1| Cellulose synthase-like protein H1 [Aegilops tauschii]
Length=717

 Score =   422 bits (1085),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 206/406 (51%), Positives = 269/406 (66%), Gaps = 5/406 (1%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP MLN+DCD   N+P+V LHAMC LLG  DE  + FVQ PQ FYGGLKDDP+
Sbjct  279   VSAVMTNAPIMLNVDCDMFANNPQVALHAMCLLLGFDDEIHSGFVQAPQKFYGGLKDDPF  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP-HVVDNNEKSTD--KDQWET  352
             GNQM++I K +  G AGIQG FY GTGCFHRRKVIYG+ P   V +  K +   K+    
Sbjct  339   GNQMQVITKKIGGGLAGIQGMFYGGTGCFHRRKVIYGVPPPDTVKHEMKGSPSYKELQAK  398

Query  353   FGKSKTFALSTTQILSGSLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             FG SK    S+  I+SG L     +   + +E AK+V  C YE GT WGQ++G +YGS  
Sbjct  399   FGSSKELIESSRNIISGDLLARPTVDLSSRVEMAKQVGDCNYEAGTCWGQEIGWVYGSMT  458

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG+ IH  GW S   D  PP FLG +PTGGPA+LTQ KRW T  L+ILI + SPI+
Sbjct  459   EDILTGLRIHAAGWGSALLDTEPPAFLGCAPTGGPASLTQFKRWATGLLEILISQNSPIL  518

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               +F RL  RQCLAYL +  WP+R  FE+CY+LL  +C++ N  F P  ++    IPA++
Sbjct  519   GTIFRRLQLRQCLAYLIVEAWPVRAPFELCYALLGPFCLLTNQSFLPTASDEGFRIPAAL  578

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+ Y++Y L EY E G S+RAWWNN RM R+ ++ +WL  FL+ ++K  GLSE VFEVT+
Sbjct  579   FLTYHIYHLMEYKECGLSVRAWWNNHRMQRITSASAWLLAFLTVILKTLGLSETVFEVTR  638

Query  1070  KDHS-SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIG  1204
             K+ S S +     D++  G FTFD +P+F+P T + ++N+ AL + 
Sbjct  639   KESSTSSDGGAGTDEADPGLFTFDSAPVFIPVTVLSMLNIVALAVA  684



>ref|XP_007049096.1| Cellulose synthase-like B4, putative isoform 2, partial [Theobroma 
cacao]
 gb|EOX93253.1| Cellulose synthase-like B4, putative isoform 2, partial [Theobroma 
cacao]
Length=740

 Score =   422 bits (1086),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 218/432 (50%), Positives = 280/432 (65%), Gaps = 9/432 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD   ++PK++LHA+C L+GV DE++  FVQ PQ FY  LKDDP+
Sbjct  298   VSGVMTNAPFMLNVDCDMFASNPKIILHAVCLLVGVDDEQECAFVQCPQIFYDALKDDPF  357

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GN+M +       G AGIQGP Y GTGCFHRRK IYG+ P+   + +    K   E FGK
Sbjct  358   GNRMTVPFTIFVGGMAGIQGPPYAGTGCFHRRKAIYGLPPN--HDFDIKDCKILEERFGK  415

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLE-AAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             S  F+ S  +IL GS     P   +S+  +A  VA+C YE  T WG +VGL YGS  ED 
Sbjct  416   STEFSESVAEILFGSGEKHFPCDISSITGSACRVANCSYENNTCWGIEVGLTYGSVTEDV  475

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+ IH  GWKSV   P+PP F+G +P GGP ++TQ KRWGT  L++L  K SPI+ A 
Sbjct  476   LTGLRIHTMGWKSVLLMPSPPAFMGCAPPGGPVSMTQMKRWGTGLLEVLFSKHSPILSAF  535

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
               +LHFRQ LAYL I+ W  R   + CY++L AYCI  +S F PK++E    IP S  +I
Sbjct  536   STKLHFRQALAYLQIVMWASRSIPQFCYNMLSAYCITTDSQFLPKVHEPFFYIPVSFSLI  595

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
              NL+ L +Y++ GES++AWWN+QRM R++A  S LF  L   VK+ G SE VFE+T K  
Sbjct  596   SNLHSLSQYLQYGESIQAWWNHQRMERIHAVSSMLFACLGMFVKLLGFSETVFEITPKTQ  655

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDF----KQNKSWSLGE  1246
             S     D++D  KVGRF+FDESP+F+P T +LLV+L AL I  L      +      LGE
Sbjct  656   SVFN--DENDVEKVGRFSFDESPIFIPITALLLVHLTALAIWLLGLQPLARGGDGSGLGE  713

Query  1247  AICSVWVILMYW  1282
               CSVWV+L +W
Sbjct  714   ISCSVWVVLNFW  725



>ref|XP_008455906.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Cucumis 
melo]
Length=750

 Score =   423 bits (1087),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 233/474 (49%), Positives = 316/474 (67%), Gaps = 23/474 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDE-KDAEFVQFPQNFYGGLKDDP  178
             VSGV+TNAP++LN+DCD  VN+P+VVLHAMC  L  KD+ +D  +VQ PQ FY GLKDDP
Sbjct  286   VSGVLTNAPYILNVDCDMFVNNPQVVLHAMCVFLNSKDDLEDIGYVQTPQCFYDGLKDDP  345

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH--VVDNNEKSTDKDQWET  352
             +GNQ+ ++ +Y  RG  G+QGPFY GTGCFHRRKV+Y  +PH  +   + K+++++  +T
Sbjct  346   FGNQLVVVFEYSARGIMGLQGPFYSGTGCFHRRKVLYAQFPHHTIYFLDGKASEQELIKT  405

Query  353   FGKSKTFALSTT-----QILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
             FG SKTFA S T     Q  + S YP   +  N+LEAA +VA C YE  T+WG ++G +Y
Sbjct  406   FGYSKTFAKSATYAFKDQNTNTSGYPPKGLLNNNLEAANQVAGCGYEISTSWGSEIGWMY  465

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GS  ED  TG+ I  +GW+S++   NPP FLG +P+   A+LTQQKRW +  L +L+ ++
Sbjct  466   GSTSEDVLTGLVIQTRGWRSIFLALNPPAFLGCAPSQLVASLTQQKRWASGFLQVLLNRR  525

Query  698   S-PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIV  874
               PI   LFG+L ++QC AYLWI+ W +R   E+ Y+LLP YC+I NS   P + E AI 
Sbjct  526   HCPIFGTLFGKLQWKQCAAYLWILTWGLRSIPELSYTLLPPYCLITNSSIFPTVKERAIF  585

Query  875   IPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAV  1054
             IP  +FIIYN   L +Y ETG+S+RAWWNNQ+M RV    +WLFG    V+K  G  E  
Sbjct  586   IPIFLFIIYNFQQLLQYKETGQSIRAWWNNQKMGRVNTMCAWLFGVWDVVLKFLGERETA  645

Query  1055  FEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW  1234
             FEVTKK+  S+  L        G FTFDESP+FVPGTTILL+ L ALFI      +    
Sbjct  646   FEVTKKETCSEINL--------GHFTFDESPMFVPGTTILLLQLIALFIRL----ERPGS  693

Query  1235  SLGEAICSVWVILMYWAflkglfg--kgkfgIPLSTVLKSGGLALLFFHACKSV  1390
             ++ E +CS+W++L +W FLKG+F   +G++G+  ST+ KS  +ALLF   C++ 
Sbjct  694   AVLEVVCSIWLLLCFWPFLKGIFMFGRGRYGLSFSTIYKSVAIALLFVLLCQTT  747



>gb|EAY78097.1| hypothetical protein OsI_33141 [Oryza sativa Indica Group]
Length=750

 Score =   422 bits (1086),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 220/468 (47%), Positives = 293/468 (63%), Gaps = 7/468 (1%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS +MTNAPFMLNLDCD  VN+P+VVLHAMC LLG  DE    FVQ PQ FYG LKDDP+
Sbjct  281   VSALMTNAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ+++ +  + RG AG+QG FY GTGCFHRRKVIYGM          S++K+    FG 
Sbjct  341   GNQLEVSLMKVGRGVAGLQGIFYFGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGS  400

Query  362   SKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             S     S   ++ G+L  E I    + ++ AKEVA+C YE GT WGQ+VG +YGS  ED 
Sbjct  401   SNNLKESARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDV  460

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG  IH  GW+S   +  PP F+G +P GGPA LTQ KRW +  L+ILI + +PI+   
Sbjct  461   LTGQRIHAAGWRSTLMEIEPPVFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTT  520

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F  L FRQCLAYL    WP+R  FE+CY+LL  YC+++N  F PK +E    I  ++FI 
Sbjct  521   FKSLQFRQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPKTSEDGFYIALALFIA  580

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             YN Y   E+IE G+S RA WNN RM R+ ++ +WL  FL+ ++K  G SE VFEVT+KD 
Sbjct  581   YNTYMFMEFIECGQSARACWNNHRMQRITSASAWLLAFLTVILKTLGFSETVFEVTRKDK  640

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSL------  1240
             S+ +     D+ + GRFTFDES +F+P T + ++++ A+ +G        +  L      
Sbjct  641   STSDGDSNTDEPEPGRFTFDESTVFIPVTALAMLSVIAIAVGAWRVVLVTTEGLPGGPGI  700

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
              E I   W++L +   L+GL G G++GIP S  +K+  L  +F   CK
Sbjct  701   SEFISCGWLVLCFMPLLRGLVGSGRYGIPWSIKMKACLLVAIFLLFCK  748



>ref|XP_008669412.1| PREDICTED: cellulose synthase-like protein H1 isoform X3 [Zea 
mays]
Length=780

 Score =   423 bits (1088),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 216/467 (46%), Positives = 292/467 (63%), Gaps = 9/467 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS V+TNAP MLN+DCD   N+P+  LHAMC LLG  DE  + FVQ PQ FYGGL DDP+
Sbjct  309   VSAVLTNAPIMLNVDCDMFANNPQAALHAMCLLLGFDDEVHSGFVQAPQRFYGGLADDPF  368

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTD---KDQWET  352
             GNQM++I + +  G AG+QG FY GTGCFHRRKV+YG+ P       K+     K+  + 
Sbjct  369   GNQMQVIFEKVGHGIAGLQGIFYCGTGCFHRRKVMYGVPPGSGTGATKADSPSYKELQKK  428

Query  353   FGKSKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             FG SK    S   I++    P  +    + +E AK+V++C YE GT+WGQ+VG +YGS  
Sbjct  429   FGSSKELIESARSIITSKEAPAAVADLTSRVEVAKQVSACSYETGTSWGQEVGWVYGSMT  488

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG  IH  GW+S    P+PP FLG +PTGGPA+LTQ KRW T  L+I++ + +P +
Sbjct  489   EDVLTGQRIHAAGWRSALLSPDPPAFLGGAPTGGPASLTQYKRWATGLLEIVLSRHNPFL  548

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
              +   RL FRQCLAYL I  WP+R  FE+CY+LL  YC+I N  F PK +E   V+P ++
Sbjct  549   LSASKRLRFRQCLAYLVIDVWPVRAPFELCYALLGPYCLIANRSFLPKASEPGFVVPLAL  608

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+ YN Y L EY++   S RAWWNNQRM R+ +S +WL  FL+ V+K  GLSE VFEVT+
Sbjct  609   FLAYNAYNLGEYVDCRLSARAWWNNQRMQRITSSSAWLLAFLTVVLKTVGLSETVFEVTR  668

Query  1070  KDHSSDEALDKDD--DSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLD--FKQNKSWS  1237
             K+    +     D  D+  GRFTFD SP+FVP   + ++++ A+ +G             
Sbjct  669   KEQQQQQGSPDGDGADADPGRFTFDSSPVFVPPAALAMLSVVAVAVGAWRAVTGGGGGPG  728

Query  1238  LGEAICSVWVILMYWA-flkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
             +GE +C  W++L +W      + G+G +GIP S  +K+  L   F H
Sbjct  729   VGEFVCCAWLLLCFWPFVRGLVGGRGSYGIPWSVRIKAALLVAAFVH  775



>ref|XP_004151897.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
 gb|KGN63234.1| hypothetical protein Csa_2G416240 [Cucumis sativus]
Length=743

 Score =   422 bits (1084),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 229/459 (50%), Positives = 303/459 (66%), Gaps = 18/459 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDE-KDAEFVQFPQNFYGGLKDDP  178
             VSGV+TNAP++LN+DCD  +N+P+VVLHAMC     +D+ +D  +VQ P  FY GLKDDP
Sbjct  278   VSGVLTNAPYILNVDCDMFMNNPQVVLHAMCVFFNSEDDFEDIGYVQTPPCFYDGLKDDP  337

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---EKSTDKDQWE  349
             YGNQ+ I+ +Y  RG  G+QGP Y G+GCFHRRKV+YG +PH   N+    K+++++  +
Sbjct  338   YGNQLVIVYEYFTRGIMGLQGPIYSGSGCFHRRKVLYGQFPHYTTNSVDGRKASEQEIIK  397

Query  350   TFGKSKTFALSTTQILSGSLY---PEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYG  520
             +FG SK FA S       + +   PE     N+LEAA +VA C YE GT WG K+G +YG
Sbjct  398   SFGYSKAFAKSAIYAFEETTFGYLPEGLFNNNNLEAAIQVAGCGYEIGTTWGSKIGWMYG  457

Query  521   SAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKS  700
             S  ED  T + IH KGW+S+Y   NPP FLG +P+    +LTQQKRW T  L+IL  K  
Sbjct  458   STCEDILTSLVIHRKGWRSIYIALNPPAFLGCAPSQLVTSLTQQKRWVTGLLEILFSKHC  517

Query  701   PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP  880
             PI   LF  L ++QC AYLWI+ W IR   E+ Y+LLP YC+I N+ F P + E AI IP
Sbjct  518   PIFGTLFENLQWKQCAAYLWILTWGIRSILELSYALLPPYCLITNTSFFPTMEERAIFIP  577

Query  881   ASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFE  1060
              S+FI+YN   L +Y ETG+S+RAWWNNQRM R+    +WLFG  + V+K+ G+ E VFE
Sbjct  578   ISLFIVYNFQQLLQYKETGQSVRAWWNNQRMGRINTICAWLFGVGNAVLKLLGVRETVFE  637

Query  1061  VTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSL  1240
             VTKK+   +  L        G FTFDESP+FV GTTILL+ L AL   F+   +++S  L
Sbjct  638   VTKKETYCEVDL--------GHFTFDESPMFVTGTTILLLQLIALLTSFIRLGRSRSAVL  689

Query  1241  GEAICSVWVILMYWAflkglfg--kgkfgIPLSTVLKSG  1351
              E ICS+W+ L +W FLKG+    KG++G+P ST+ KS 
Sbjct  690   -EVICSLWLFLCFWPFLKGILMFGKGRYGLPFSTIYKSA  727



>gb|KEH29713.1| cellulose synthase H1-like protein [Medicago truncatula]
Length=743

 Score =   422 bits (1084),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 221/462 (48%), Positives = 295/462 (64%), Gaps = 10/462 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  VN+P +V+HA+C LL  K EK+  F Q PQ FY  LKDDP+
Sbjct  276   VSGLITNAPFMLNVDCDMFVNNPNIVMHALCILLDSKGEKEVAFAQCPQQFYATLKDDPF  335

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQM I+ KYL  G AG+QG FY GT CFHRRKVIYG+ P  V+     ++ +  + FG 
Sbjct  336   GNQMAILYKYLGAGLAGLQGIFYGGTNCFHRRKVIYGLSPDDVEKGNNLSEVELKQKFGT  395

Query  362   SKTFALSTTQILSGSLYPEIPIFPN-SLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             SK    S    L    Y    I  N ++E A  VAS  YE+GT WG++VG +YG+  ED 
Sbjct  396   SKELMKSVGHALEDRTYSASDISVNKAVEEAIHVASYGYEYGTGWGKQVGWMYGTMTEDI  455

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG++IH KGW+S  C P+P  F G +P  GP  + Q KRW T  L+I   K  P+  A+
Sbjct  456   LTGLTIHKKGWRSELCTPDPIAFTGCAPIDGPTCMAQHKRWATGMLEIFFSKHCPVFGAI  515

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F +L FRQ LAY+WIM W   P  ++CY+ L AYCII NS+F PK  +  + IP +IF I
Sbjct  516   FDKLSFRQFLAYMWIMNWGFSPVAQVCYACLVAYCIITNSYFLPK--DWGMYIPTAIFGI  573

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             Y +Y L+EY+ +G S++AWWNNQRM R+    +   GF++ ++K+ G+S  VF++TKK+ 
Sbjct  574   YKVYTLYEYLASGLSIKAWWNNQRMSRITPMNAGFCGFITVLLKLLGISNTVFDITKKEL  633

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK-----QNKSWSLG  1243
                   D   D   GR+TF+ES +F+PGTTILL+ L A+FI    F+     +N    L 
Sbjct  634   PPSR--DDRHDKNAGRYTFNESLVFLPGTTILLLQLTAIFIKLFGFQPQGLSRNYECGLA  691

Query  1244  EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
             E + SV++I+ YW FL+GLF  GKFGIPLST+ K   L  +F
Sbjct  692   EMLISVYLIICYWPFLRGLFETGKFGIPLSTICKGATLTCIF  733



>ref|XP_008669410.1| PREDICTED: cellulose synthase-like protein H1 isoform X1 [Zea 
mays]
Length=784

 Score =   422 bits (1085),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 215/471 (46%), Positives = 293/471 (62%), Gaps = 13/471 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS V+TNAP MLN+DCD   N+P+  LHAMC LLG  DE  + FVQ PQ FYGGL DDP+
Sbjct  309   VSAVLTNAPIMLNVDCDMFANNPQAALHAMCLLLGFDDEVHSGFVQAPQRFYGGLADDPF  368

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP-------HVVDNNEKSTDKD  340
             GNQM++I + +  G AG+QG FY GTGCFHRRKV+YG+ P         +   +  + K+
Sbjct  369   GNQMQVIFEKVGHGIAGLQGIFYCGTGCFHRRKVMYGVPPGSGTGATKALAAADSPSYKE  428

Query  341   QWETFGKSKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
               + FG SK    S   I++    P  +    + +E AK+V++C YE GT+WGQ+VG +Y
Sbjct  429   LQKKFGSSKELIESARSIITSKEAPAAVADLTSRVEVAKQVSACSYETGTSWGQEVGWVY  488

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GS  ED  TG  IH  GW+S    P+PP FLG +PTGGPA+LTQ KRW T  L+I++ + 
Sbjct  489   GSMTEDVLTGQRIHAAGWRSALLSPDPPAFLGGAPTGGPASLTQYKRWATGLLEIVLSRH  548

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             +P + +   RL FRQCLAYL I  WP+R  FE+CY+LL  YC+I N  F PK +E   V+
Sbjct  549   NPFLLSASKRLRFRQCLAYLVIDVWPVRAPFELCYALLGPYCLIANRSFLPKASEPGFVV  608

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
             P ++F+ YN Y L EY++   S RAWWNNQRM R+ +S +WL  FL+ V+K  GLSE VF
Sbjct  609   PLALFLAYNAYNLGEYVDCRLSARAWWNNQRMQRITSSSAWLLAFLTVVLKTVGLSETVF  668

Query  1058  EVTKKDHSSDEALDKDD--DSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLD--FKQN  1225
             EVT+K+    +     D  D+  GRFTFD SP+FVP   + ++++ A+ +G         
Sbjct  669   EVTRKEQQQQQGSPDGDGADADPGRFTFDSSPVFVPPAALAMLSVVAVAVGAWRAVTGGG  728

Query  1226  KSWSLGEAICSVWVILMYWA-flkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
                 +GE +C  W++L +W      + G+G +GIP S  +K+  L   F H
Sbjct  729   GGPGVGEFVCCAWLLLCFWPFVRGLVGGRGSYGIPWSVRIKAALLVAAFVH  779



>ref|XP_008781464.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Phoenix 
dactylifera]
Length=744

 Score =   421 bits (1081),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 240/464 (52%), Positives = 308/464 (66%), Gaps = 7/464 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD   N+P+V+LH MC LLG  +E  + FVQ PQ FYG LKDDP+
Sbjct  278   VSGVMTNAPFMLNVDCDMFANNPEVILHGMCLLLGFDNEVSSGFVQAPQQFYGALKDDPF  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGM-WPHVVDNNEKSTDKDQWETFG  358
             GNQ+ ++ + +  G  G+QGPFY GTGCFHRRK+I     P  V  +++ + K+    +G
Sbjct  338   GNQLVVLQELIGGGIGGLQGPFYGGTGCFHRRKIICSPPRPAGVSKHDELSYKELQRIYG  397

Query  359   KSKTFALSTTQILSGSLYPEIPIFPNSL--EAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
              S+    S +QI SG +     +   S   EAAK VASC YEF T WG K+G  YGS  E
Sbjct  398   DSRELIESASQITSGKIRESSSVDDLSSSVEAAKRVASCTYEFNTCWGNKIGWAYGSMTE  457

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  TG+ IH  GWKSVY   +PP FLGS+PTGGPA+LTQ KRW T  L+IL+ ++SPI+ 
Sbjct  458   DVLTGLRIHSMGWKSVYLILDPPAFLGSAPTGGPASLTQYKRWSTGLLEILLSRRSPILA  517

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIF  892
                 RL FR  LAYL I  W +R   E+CY+LLPAYC+I N+ F PK +E   VIP ++F
Sbjct  518   TFAKRLEFRMNLAYLLITVWALRSIGELCYALLPAYCLITNTSFMPKASEPVFVIPLALF  577

Query  893   IIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKK  1072
             +I N++ L EY++ G S+RA+WNNQRM R++A  +WL G L+ ++K  GLSE VFEVT+K
Sbjct  578   LICNMHSLMEYVQCGLSVRAYWNNQRMNRIFAMTAWLLGLLAVLLKTLGLSETVFEVTRK  637

Query  1073  DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN-KSWSLGEA  1249
             D  SD     D D   GRFTFD SPLFV GT +LL NLAAL +G L  ++      LGE 
Sbjct  638   DQQSD---TNDTDKDPGRFTFDNSPLFVSGTAVLLANLAALTVGLLRLRRPVVGPGLGEF  694

Query  1250  ICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
             +CSVWV+L +W F +GL G+G +GIP   + K+  LA LF   C
Sbjct  695   VCSVWVVLSFWPFARGLVGRGSYGIPWPVIWKAAVLASLFVQFC  738



>ref|XP_003540273.1| PREDICTED: cellulose synthase-like protein H1-like [Glycine max]
Length=754

 Score =   419 bits (1077),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 225/478 (47%), Positives = 296/478 (62%), Gaps = 23/478 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS +MTNAP++LN+DCD +VN+PK+  HA+C  L  K EK+  FVQ PQ FY  +KDD Y
Sbjct  280   VSALMTNAPYILNVDCDMYVNNPKIAQHALCIFLDSKGEKEVAFVQCPQRFYDTVKDDAY  339

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS---------TD  334
             GNQ+  +  Y+  G AG+QG  Y GT CFHRRKVIYG+ P     N K          + 
Sbjct  340   GNQLVALPMYIGGGFAGLQGIIYAGTNCFHRRKVIYGLSPDYDIQNMKKDFGFINGTKSQ  399

Query  335   KDQWETFGKSKTFALSTTQILSGSLY-PEIPIFPN-SLEAAKEVASCVYEFGTAWGQKVG  508
             K   + FG S+ F  S    L    + P   +F +  L+AA +VASC YE+ TAWG++VG
Sbjct  400   KKTMQIFGASRGFVESAKHALEEMTFTPNDKLFKSLELKAANQVASCDYEYSTAWGKQVG  459

Query  509   LLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILI  688
              LYGS  ED  TG+ +H KGW+S  C P+P  F+G SP      + Q KRW +   DI +
Sbjct  460   WLYGSTSEDVLTGLVMHTKGWRSEVCSPDPMAFMGCSPQDNLGQMGQHKRWSSGLFDIFL  519

Query  689   CKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAA  868
                 PI   LFG+L FR+CLAY+WI  W +R   EICY+LLPAYCII NS F P   E  
Sbjct  520   SSHCPIFGTLFGKLQFRECLAYVWITNWALRSVPEICYALLPAYCIITNSSFLPN-KEPG  578

Query  869   IVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSE  1048
             + IP S+F++YN+  L E++ +G S R WWNNQRM R+    S  FGFL  V+K   +S+
Sbjct  579   MWIPTSVFVMYNVATLLEHLISGLSARTWWNNQRMGRITTMTSCFFGFLDIVLKRLRISD  638

Query  1049  AVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN-  1225
              VFE+TKKD  S       +D  VGRF F++SP+FVPGT ILL+ L AL I +  ++Q+ 
Sbjct  639   TVFEITKKDQPS------SNDENVGRFIFNKSPIFVPGTAILLIQLTALVISWWRWQQSL  692

Query  1226  ----KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
                 +++ LGE  CS +++L Y   LKGLF KGK+GIPLST+ K+  LA LF   C +
Sbjct  693   LKNERTYGLGEVFCSAYLVLCYLPLLKGLFAKGKYGIPLSTICKAMVLAFLFVQLCNA  750



>gb|AAN01252.1| Unknown protein similar to putative cellulose synthase [Oryza 
sativa Japonica Group]
Length=913

 Score =   422 bits (1086),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 202/402 (50%), Positives = 265/402 (66%), Gaps = 1/402 (0%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS +MTNAPFMLNLDCD  VN+P+VVLHAMC LLG  DE    FVQ PQ FYG LKDDP+
Sbjct  281   VSALMTNAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ+++ +  + RG AG+QG FY GTGCFHRRKVIYGM          S++K+    FG 
Sbjct  341   GNQLEVSLMKVGRGIAGLQGIFYCGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGS  400

Query  362   SKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             S  F  S   ++ G+L  E I    + ++ AKEVA+C YE GT WGQ+VG +YGS  ED 
Sbjct  401   SNNFKESARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDV  460

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG  IH  GW+S   +  PP F+G +P GGPA LTQ KRW +  L+ILI + +PI+   
Sbjct  461   LTGQRIHAAGWRSTLMEIEPPAFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTT  520

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             F  L FRQCLAYL    WP+R  FE+CY+LL  YC+++N  F PK +E    I  ++FI 
Sbjct  521   FKSLQFRQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPKTSEDGFYIALALFIA  580

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             YN Y   E+IE G+S RA WNN RM R+ ++ +WL  FL+ ++K  G SE VFEVT+KD 
Sbjct  581   YNTYMFMEFIECGQSARACWNNHRMQRITSASAWLLAFLTVILKTLGFSETVFEVTRKDK  640

Query  1079  SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIG  1204
             S+ +     D+ + GRFTFDES +F+P T + ++++ A+ +G
Sbjct  641   STSDGDSNTDEPEPGRFTFDESTVFIPVTALAMLSVIAIAVG  682



>ref|XP_008342032.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Malus 
domestica]
Length=734

 Score =   417 bits (1072),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 225/468 (48%), Positives = 299/468 (64%), Gaps = 26/468 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD + N+PK+VLHAMC LLG K EK+  FVQFPQ FY  L+DDP+
Sbjct  279   VSGVMTNAPFMLNVDCDMYANNPKIVLHAMCLLLGFKHEKEGAFVQFPQMFYDTLEDDPF  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             G+ +   +K ++ G AGIQGP Y GTGCFHRRKVIYG+   + DN E             
Sbjct  339   GSNVVEAVKKIWPGLAGIQGPIYAGTGCFHRRKVIYGL--SLTDNEE-------------  383

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
                   S TQIL      ++     ++E A +VA   YE  T WG+KVG +YGS  ED  
Sbjct  384   ---LIRSATQILLEENIDQLDDLSCAVEIAYQVAGSEYEDDTLWGKKVGWVYGSVSEDVL  440

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH +GWKS+ C P PPGFLG+ P+     L Q+KRW T  L+IL  K  PI   L+
Sbjct  441   TGMKIHARGWKSILCTPEPPGFLGTGPSTTHVMLIQRKRWITGLLEILFSKNCPIFATLY  500

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
              +L FRQCLAYL I+ W +    ++CY+LLPAYCII NSHF PK+ E  ++I A++F+I 
Sbjct  501   AKLEFRQCLAYLRILIWGLLSVPDLCYALLPAYCIITNSHFLPKVEEPTLIIFAALFLIK  560

Query  902   NLYGLFEYIETGESLRAWWNNQRM---LRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKK  1072
             +LY L  Y+++G S+RAWWN   +    ++    + LFG ++ V K+ G+SE  FEVT+K
Sbjct  561   HLYTLHSYLDSGRSIRAWWNQLTVGPWSKITTLTASLFGLVTVVFKLLGISEVTFEVTQK  620

Query  1073  D-HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN----KSWS  1237
             + +SS    +   D+  GRFTFD + +FVP T +L +   AL    L  +          
Sbjct  621   EQNSSSSDQEATYDANAGRFTFDGTTIFVPATALLFLQFTALVTAALGLEPPALGVNGAG  680

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
             +GE +CSVWV+L +W F+KGLFGKGK+GIP+ T++KS  LALLF H+C
Sbjct  681   IGEMMCSVWVVLCFWPFVKGLFGKGKYGIPMVTIVKSAVLALLFMHSC  728



>ref|XP_006653400.1| PREDICTED: cellulose synthase-like protein H2-like [Oryza brachyantha]
Length=777

 Score =   418 bits (1075),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 219/480 (46%), Positives = 297/480 (62%), Gaps = 19/480 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP +LN DCD   N+PK +LHAMC LLG  DE ++ FVQ PQ FY  LKDDP+
Sbjct  296   VSAVMTNAPIVLNTDCDMFANNPKALLHAMCLLLGFHDEINSGFVQVPQRFYDALKDDPF  355

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GN ++   K L RG  G+QGPFY GTGCFHRRK IYG+ P+  +++  S  K+    FG 
Sbjct  356   GNHLECFFKRLVRGIQGLQGPFYAGTGCFHRRKAIYGVPPNCNNSSGSSCHKEVQTKFGN  415

Query  362   SKTFALSTTQILSGSLYPEIPIFPNS--LEAAKEVASCVYEFGTAWGQKVGLLYGSAGED  535
             S+    ST  I+SG L    P+   S  ++AAKEV++C YE GT WGQ+VG +YGS  ED
Sbjct  416   SEELKESTKPIISGDLSSTKPMADVSGRVDAAKEVSACNYEVGTCWGQEVGWVYGSLTED  475

Query  536   TKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWA  715
               TG  IH KGW+S   +  PP F+GS+P GGPA+LTQ KRW T   +I++ + +P+  A
Sbjct  476   ILTGQRIHTKGWRSTLMETEPPAFMGSAPVGGPASLTQFKRWATGLFEIIVSRNNPVFSA  535

Query  716   LFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFI  895
             +F RL  RQCL YL + GWP+R  FE+CY LL  YC++ N  F PK +E    IP ++F+
Sbjct  536   MFERLQLRQCLGYLIVYGWPVRAPFELCYGLLGPYCLLTNQSFLPKASEDGFSIPFALFL  595

Query  896   IYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKD  1075
              YN Y   EY   G S RAWWNN RM R+ +  +WL   L+ ++K  GLSE VFEVT K+
Sbjct  596   SYNAYSFMEYKACGLSARAWWNNHRMQRIVSVSAWLLAVLTVLLKTLGLSETVFEVTSKE  655

Query  1076  HSSDEALDKDDD------SKVGRFTFDESPLFVPGTTILLVNLAALFIGF--LDFK----  1219
               +    + DD       ++ GRFTFD SP+F+P T + ++N+ A+ +G   + F+    
Sbjct  656   DKAGTPSNGDDGGGIDGATRPGRFTFDSSPVFIPVTALAMLNVVAIGVGAWRVAFRGADD  715

Query  1220  -----QNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
                     +  +GE +C  W++L +  F++GL GKG  GIP S  LK+  +  +F   C+
Sbjct  716   PAVPVPGGAPGVGEFVCCGWLVLCFSPFVRGLVGKGSHGIPWSVQLKASLVVSMFLVFCR  775



>gb|KHN18003.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=731

 Score =   416 bits (1070),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 224/478 (47%), Positives = 295/478 (62%), Gaps = 23/478 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS +MTNAP++LN+DCD +VN+PK+  HA+C  L  K EK+  FVQ PQ FY  +KDD Y
Sbjct  257   VSALMTNAPYILNVDCDMYVNNPKIAQHALCIFLDSKGEKEVAFVQCPQRFYDTVKDDAY  316

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS---------TD  334
             GNQ+  +  Y+  G AG+QG  Y GT CFHRRKVIYG+ P     N K          + 
Sbjct  317   GNQLVALPMYIGGGFAGLQGIIYAGTNCFHRRKVIYGLSPDYDIQNMKKDFGFINGTKSQ  376

Query  335   KDQWETFGKSKTFALSTTQILSGSLY-PEIPIFPN-SLEAAKEVASCVYEFGTAWGQKVG  508
             K   + FG S+ F  S    L    + P   +F +  L+AA +VASC YE+ TAWG++VG
Sbjct  377   KKTMQIFGASRGFVESAKHALEEMTFTPNDKLFKSLELKAANQVASCDYEYSTAWGKQVG  436

Query  509   LLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILI  688
              LYGS  ED  TG+ +H KGW+S  C P+P  F+G SP      + Q KRW +   DI +
Sbjct  437   WLYGSTSEDVLTGLVMHTKGWRSEVCSPDPMAFMGCSPQDNLGQMGQHKRWSSGLFDIFL  496

Query  689   CKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAA  868
                 PI   LFG+L FR+CLAY+WI  W +R   EICY+LLPAYCII NS F P   E  
Sbjct  497   SSHCPIFGTLFGKLQFRECLAYVWITNWALRSVPEICYALLPAYCIITNSSFLPN-KEPG  555

Query  869   IVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSE  1048
             + IP S+ ++YN+  L E++ +G S R WWNNQRM R+    S  FGFL  V+K   +S+
Sbjct  556   MWIPTSVCVMYNVATLLEHLISGLSARTWWNNQRMGRITTMTSCFFGFLDIVLKRLRISD  615

Query  1049  AVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN-  1225
              VFE+TKKD  S       +D  VGRF F++SP+FVPGT ILL+ L AL I +  ++Q+ 
Sbjct  616   TVFEITKKDQPS------SNDENVGRFIFNKSPIFVPGTAILLIQLTALVISWWRWQQSL  669

Query  1226  ----KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
                 +++ LGE  CS +++L Y   LKGLF KGK+GIPLST+ K+  LA LF   C +
Sbjct  670   LKNERTYGLGEVFCSAYLVLCYLPLLKGLFAKGKYGIPLSTICKAMVLAFLFVQLCNA  727



>ref|XP_007149986.1| hypothetical protein PHAVU_005G1163000g, partial [Phaseolus vulgaris]
 gb|ESW21980.1| hypothetical protein PHAVU_005G1163000g, partial [Phaseolus vulgaris]
Length=528

 Score =   409 bits (1052),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 214/468 (46%), Positives = 307/468 (66%), Gaps = 10/468 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+M+NAPFMLN+DCD  VN+PK+VLHA+C L+  +  K+  FVQ  Q F  G+KDDP+
Sbjct  61    VSGLMSNAPFMLNVDCDMIVNNPKIVLHALCILMDSQKGKEVAFVQCFQQFIDGIKDDPF  120

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDN--NEKSTDKDQWETF  355
             GNQM    +Y+ +G  G+QGPFY+GT  FHRR  IYG++PH ++     KS +    + F
Sbjct  121   GNQMVTAFEYIIQGIGGLQGPFYVGTNTFHRRNTIYGLYPHEIETIIKGKSEENILIQQF  180

Query  356   GKSKTFALSTTQILSGSLYPEIPIFP-NSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             G SK F  S   ++ G+ Y    I P N +EAA +VA+C YE GT WG+++G LYGS  E
Sbjct  181   GSSKEFIKSAAHVVGGNGYSANDITPSNFIEAATQVANCEYECGTFWGKQLGWLYGSISE  240

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  TG++IH KGW+S  C P+P  F G +P G  + + QQKRW +    +   K SP++ 
Sbjct  241   DVPTGLNIHRKGWRSECCTPDPIAFTGCAPGGLLSTMIQQKRWASGLTVVFFGKHSPLMA  300

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIF  892
              LFG++ FR CL+Y W   W +R  F +CY  + AYC+I N+   P+     + I  S+F
Sbjct  301   MLFGKIQFRTCLSYFWPTIWGLRGAFLVCYVAVIAYCMIANTSIFPQ--GLGLWIAISLF  358

Query  893   IIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKK  1072
             +IYN++ L E++  G S+  WWNNQRM  +  + +   GFLS ++K+ G+S+ VFE+T+K
Sbjct  359   VIYNIHTLLEHLTIGLSITNWWNNQRMCVMRTTTACFIGFLSAMLKLSGISDTVFEITEK  418

Query  1073  DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS---LG  1243
             +H++ +A   + D+  GRFTFDESP+FV GTTILLV+LA + I  L  + + S +   +G
Sbjct  419   EHTTSDADGNNADA--GRFTFDESPVFVVGTTILLVHLAGMVIKLLGLQPSDSGNGSGIG  476

Query  1244  EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             E ICS ++I+ Y+ +LKGLFG+GK+GIPL+T+  S   AL+F   C+S
Sbjct  477   EFICSTYLIVCYFPYLKGLFGRGKYGIPLTTICMSSVFALVFVQLCRS  524



>ref|XP_008455910.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Cucumis 
melo]
Length=447

 Score =   406 bits (1043),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 222/448 (50%), Positives = 295/448 (66%), Gaps = 16/448 (4%)
 Frame = +2

Query  62    NDPKVVLHAMCFLLGVKDE-KDAEFVQFPQNFYGGLKDDPYGNQMKIIMKYLFRGTAGIQ  238
             N+P+VVLHAMC  L  KD+ +D  +VQ PQ FY GLKDDP+GNQ+ ++ +Y  RG  G+Q
Sbjct  4     NNPQVVLHAMCVFLNSKDDLEDIGYVQTPQCFYDGLKDDPFGNQLVVVFQYYSRGVMGLQ  63

Query  239   GPFYMGTGCFHRRKVIYGMWPHVVDN--NEKSTDKDQWETFGKSKTFALSTTQILSGSLY  412
             GP Y GTGCFHRR V+YG +PH   +  N K+++++  + FG SK FA S       + +
Sbjct  64    GPLYNGTGCFHRRNVLYGQFPHHTTHFMNGKASEQELMKLFGYSKCFAKSAIYAFEETTH  123

Query  413   PEIP--IFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTKTGVSIHGKGWKSVYC  586
                P  +F ++LEAAK+VA C YE  T WG K+G +YGS  ED  T + IH +GW+S+Y 
Sbjct  124   GYHPNGLFNDNLEAAKQVAGCGYEINTTWGSKIGWMYGSTCEDILTSLVIHRRGWRSIYI  183

Query  587   DPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRLHFRQCLAYLWIM  766
               NPP FLG +P+    +LTQQKRW +  L+IL  K  PI   LF +L ++QC AYLWI+
Sbjct  184   ALNPPAFLGCAPSQLLTSLTQQKRWASGFLEILFSKHCPIFGTLFEKLQWKQCAAYLWIL  243

Query  767   GWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLYGLFEYIETGESL  946
              W IR   E+ Y+LLP YC+I NS F P + E AI IP S+FIIYN   L +Y ETG+S+
Sbjct  244   TWGIRSILELSYALLPPYCLITNSSFFPTMEERAIFIPISLFIIYNFQQLLQYKETGQSV  303

Query  947   RAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDEALDKDDDSKVGR  1126
             RAWWNNQRM R+    +WLFG  + V+K  G+ E VFEVTKK+  S+  L        G 
Sbjct  304   RAWWNNQRMGRINTICAWLFGVGNVVLKFLGVRETVFEVTKKETCSEVDL--------GH  355

Query  1127  FTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSLGEAICSVWVILMYWAflkglfg  1306
             FTFDESP+FV GTTILL+ L AL + F+  +++ S  L E ICS+W++L +W FLKG+  
Sbjct  356   FTFDESPMFVTGTTILLLQLVALLMSFIRLEKSGSAVL-EVICSLWLLLCFWPFLKGILM  414

Query  1307  --kgkfgIPLSTVLKSGGLALLFFHACK  1384
               KG++G+P ST+ KS  L LLF   C+
Sbjct  415   FGKGRYGLPFSTIYKSAILTLLFVLLCQ  442



>ref|XP_004975623.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Setaria italica]
Length=813

 Score =   415 bits (1067),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 217/479 (45%), Positives = 295/479 (62%), Gaps = 19/479 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS V+TNAP MLN+DCD   N+P+V LHAMC LLG  DE  + FVQ PQ FYG LKDDP+
Sbjct  332   VSAVVTNAPIMLNMDCDMFANNPQVALHAMCLLLGFDDELQSGFVQAPQKFYGTLKDDPF  391

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS------TDKDQ  343
             GNQM+++ + +  G AG+QG FY GTGCFHRRKVIYG+ P    + + +      + K+ 
Sbjct  392   GNQMEVLFEKIGFGIAGLQGMFYGGTGCFHRRKVIYGVPPESTADVQPTRMRGSPSYKEL  451

Query  344   WETFGKSKTFALSTTQILSGSLYPEIPI--FPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
              + FG S+    S    +SG L+   P+    + ++ AKEV++C YE GT WGQ+VG +Y
Sbjct  452   QKMFGSSRELIESARSAISGELFAAAPMVDLASRIDVAKEVSACSYEAGTCWGQEVGWVY  511

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GS  ED  TG  IH  GW+S +   +PP FLG +PTGGPA+LTQ KRW T  L+I++ + 
Sbjct  512   GSMTEDILTGQRIHAAGWRSAFLTTDPPAFLGGAPTGGPASLTQYKRWATGLLEIILSRN  571

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             +PI+      L FRQCLAYL    WP+R  FE+CY+LL  YC++ N  F PK +E   VI
Sbjct  572   NPILACTSKHLEFRQCLAYLVFYVWPVRAPFELCYALLGPYCLLANKSFLPKASEPWFVI  631

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
             P ++F+  N++ + EY+E  +S RAWWNN RM R+ +S +WL  FL+ V+K  GLSE VF
Sbjct  632   PLALFLTQNVHSVAEYMECRQSARAWWNNHRMQRIVSSSAWLLAFLTVVLKTMGLSETVF  691

Query  1058  EVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIG-----------  1204
             EVT+K+            +  GRFTFD SP+FVP T + ++ L A+ +G           
Sbjct  692   EVTRKEQGGAADGGDAAGADPGRFTFDSSPVFVPPTALTILTLVAIAVGAWRVVAGAAAA  751

Query  1205  FLDFKQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
                        +GE +C  W+ L +W F++GL GKG +GIP S  +K+  L   F H C
Sbjct  752   GGVPPAGGGPGVGEFVCCGWLALCFWPFVRGLAGKGSYGIPWSVKIKAVLLVAAFVHFC  810



>ref|XP_010089468.1| Cellulose synthase-like protein H1 [Morus notabilis]
 gb|EXB37861.1| Cellulose synthase-like protein H1 [Morus notabilis]
Length=753

 Score =   413 bits (1062),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 235/470 (50%), Positives = 304/470 (65%), Gaps = 15/470 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPF+LN+DCD  VN+PK+V  AM   LG+K ++ A FVQFPQ  Y  LKDDP+
Sbjct  285   VSGVMTNAPFLLNVDCDMFVNNPKIVHQAMSSFLGLKPQECA-FVQFPQVIYNQLKDDPF  343

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQW--ETF  355
             G QM    + +  G AGIQGP Y GT CFHRRK+IYG      D   K  D+     E+F
Sbjct  344   GTQMVAAFEVIGHGMAGIQGPLYAGTNCFHRRKLIYGFSLDNADFQGKEDDEKVLLKESF  403

Query  356   GKSKTFALSTTQILSGSLYP--EIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             G S  F  S TQIL   + P  +I I   + + + +   C YE  T WG KVG  YGS  
Sbjct  404   GNSIEFINSVTQILKDDISPVQDISI---AAQLSSQATRCDYEHDTVWGTKVGWGYGSIT  460

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG+ IHG+G +SV C P+PPGFLG++PT GPA L Q+KRW T  L  +  K SPI+
Sbjct  461   EDVLTGMRIHGEGLRSVSCMPSPPGFLGTAPTSGPACLIQRKRWATGLLQAMFSKNSPIV  520

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               L  +L FRQ LAY W++  P+   F++ YSLL AYCII N++F PK +E A++I  + 
Sbjct  521   TTLNAKLEFRQSLAYTWVLTSPLGAMFDMFYSLLAAYCIITNANFLPKAHEPAMLILVAR  580

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+  NL  L  ++  G S+RAWWNN R  ++ ++ + +FG  S + K+ G+S+ VFEVT+
Sbjct  581   FLFQNLQQLCFFLRCGFSVRAWWNNVRTAKITSATATVFGVFSFLFKLVGISDVVFEVTQ  640

Query  1070  K---DHSSDEALD-KDDDSK-VGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW  1234
             K   D+SSDE  + KD  SK VGRFTFDESP+F+ GTT L V+LAAL +    F Q+   
Sbjct  641   KDQSDNSSDEHSNHKDGTSKNVGRFTFDESPMFIAGTTFLFVHLAALTLSL--FGQHDEV  698

Query  1235  SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
              LGE + SVW +L +W F++GLFGKGK+GIP S VLKS G AL F H C+
Sbjct  699   GLGEFLSSVWTVLCFWPFVRGLFGKGKYGIPSSIVLKSAGFALFFVHLCR  748



>gb|KHN36521.1| Cellulose synthase-like protein B3 [Glycine soja]
Length=748

 Score =   413 bits (1061),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 222/469 (47%), Positives = 308/469 (66%), Gaps = 12/469 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPF+LN+DCD  VN+PK+VLHA+C L+  +  K+  FVQ  Q FY G+KDDP+
Sbjct  281   VSGLMTNAPFILNVDCDMFVNNPKIVLHALCILMDSQRGKEVAFVQCFQQFYDGIKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKST--DKDQWETF  355
             GNQ  I  K +  G AG+QGPFY GT  FHRR  IYG++P  +++  K    +K   E F
Sbjct  341   GNQWMITFKNIIMGMAGLQGPFYGGTNAFHRRNAIYGLYPDEIESERKGKLEEKILIEKF  400

Query  356   GKSKTFALSTTQILSGSLYP--EIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             G SK F  S+ Q L GS +   +I  F N +EAA +V++C YE+ T WG+++G LYGS  
Sbjct  401   GSSKEFIKSSAQALGGSAFSANDITTF-NFIEAATQVSNCEYEYDTCWGKQMGWLYGSIS  459

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG++I  KGW+S  C P+P  F G +P G  + + QQKRW +    +   K SPI 
Sbjct  460   EDVPTGLNIQRKGWRSECCTPDPIAFTGCAPGGILSTMLQQKRWASGLTVVFFGKHSPIT  519

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               LFG+  FR  L++ W+  W +R  F +CY  L A+CII N++  PK     + IP ++
Sbjct  520   GMLFGKTQFRAGLSFFWLTNWGLRGLFLVCYIALLAFCIITNTNIFPK--GLGLWIPIAL  577

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+IYN++ L EY+  G S+R WWNNQRM  +  + +   GFLS ++K+ G+S++VFE+T 
Sbjct  578   FVIYNVHTLLEYLTIGLSIRHWWNNQRMCIIRTTTASFLGFLSAMLKLSGISDSVFEITD  637

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS---L  1240
             K  S+  A   + D+  GRFTF+ESP+FV GTTILLV++ A+ I FL  +   S +   L
Sbjct  638   KKPSTSGADGNNADA--GRFTFEESPVFVIGTTILLVHMTAMLIKFLGLQPTHSGNGCGL  695

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             GE+I S++VI+ YW +LKGLF +GK+GIPLST+ KS  LAL+F H C+S
Sbjct  696   GESISSMYVIVCYWPYLKGLFARGKYGIPLSTICKSAVLALVFVHFCRS  744



>ref|XP_006594901.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Glycine max]
Length=748

 Score =   412 bits (1058),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 222/469 (47%), Positives = 307/469 (65%), Gaps = 12/469 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPF+LN+DCD  VN+PK+VLHA+C L+  +  K+  FVQ  Q FY G+KDDP+
Sbjct  281   VSGLMTNAPFILNVDCDMFVNNPKIVLHALCILMDSQRGKEVAFVQCFQQFYDGIKDDPF  340

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKST--DKDQWETF  355
             GNQ  I  K +  G AG+QGPFY GT  FHRR  IYG++P  +++  K     K   E F
Sbjct  341   GNQWMITFKNIIMGMAGLQGPFYGGTNAFHRRNAIYGLYPDEIESERKGKLEGKILIEKF  400

Query  356   GKSKTFALSTTQILSGSLYP--EIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
             G SK F  S+ Q L GS +   +I  F N +EAA +V++C YE+ T WG+++G LYGS  
Sbjct  401   GSSKEFIKSSAQALGGSAFSANDITTF-NFIEAATQVSNCEYEYDTCWGKQMGWLYGSIS  459

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG++I  KGW+S  C P+P  F G +P G  + + QQKRW +    +   K SPI 
Sbjct  460   EDVPTGLNIQRKGWRSECCTPDPIAFTGCAPGGILSTMLQQKRWASGLTVVFFGKHSPIT  519

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               LFG+  FR  L++ W+  W +R  F +CY  L A+CII N++  PK     + IP ++
Sbjct  520   GMLFGKTQFRAGLSFFWLTNWGLRGLFLVCYIALLAFCIITNTNIFPK--GLGLWIPIAL  577

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+IYN++ L EY+  G S+R WWNNQRM  +  + +   GFLS ++K+ G+S++VFE+T 
Sbjct  578   FVIYNVHTLLEYLTIGLSIRHWWNNQRMCIIRTTTASFLGFLSAMLKLSGISDSVFEITD  637

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS---L  1240
             K  S+  A   + D+  GRFTF+ESP+FV GTTILLV++ A+ I FL  +   S +   L
Sbjct  638   KKPSTSGADGNNADA--GRFTFEESPVFVIGTTILLVHMTAMLIKFLGLQPTHSGNGCGL  695

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             GE+I S++VI+ YW +LKGLF +GK+GIPLST+ KS  LAL+F H C+S
Sbjct  696   GESISSMYVIVCYWPYLKGLFARGKYGIPLSTICKSAVLALVFVHFCRS  744



>gb|AES67197.2| cellulose synthase H1-like protein [Medicago truncatula]
Length=750

 Score =   410 bits (1054),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 216/465 (46%), Positives = 294/465 (63%), Gaps = 11/465 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK++ HAMC L+  K+ KD  FVQ  Q FY G+KDDP+
Sbjct  282   VSGLMTNAPFMLNVDCDMVVNNPKIIQHAMCILMDSKNGKDVAFVQCFQQFYDGIKDDPF  341

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS--TDKDQWETF  355
             GNQ     +Y+ +G  G+QGPFY GT  FHRR  IYG++P  +    K   T+K   + F
Sbjct  342   GNQWVASFEYIIKGMGGLQGPFYGGTNTFHRRNAIYGLYPDEIQYGRKGKITEKMLIQQF  401

Query  356   GKSKTFALSTTQILSGSLYPEIPIFP-NSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             G SK F  S T    GS      I P N L+ A +V+ C YE+GT+WG+++  LYGS  E
Sbjct  402   GSSKEFVKSVTHAFEGSGNSIDGISPSNLLDKAIQVSDCGYEYGTSWGKQMCWLYGSISE  461

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  TG+++  KGW+S  C P P  F+G +P G    + QQKRW +    +   K SP++ 
Sbjct  462   DVPTGLNMQRKGWRSECCTPEPTAFMGCAPGGLLTTMIQQKRWSSGLTVVFFSKHSPVMC  521

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIF  892
              LFG++ FR  L+Y W+  W +R  FE+ Y+ L AYCII N+   PK     + IP ++F
Sbjct  522   TLFGKIQFRAGLSYCWLTNWGLRSVFEVSYAALVAYCIITNTSIFPK--GLGLWIPLTLF  579

Query  893   IIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKK  1072
             +IY ++ L EY+  G SLR WWNNQRM+ + ++  W  GFLS ++K+ G+S+ +FEVT+K
Sbjct  580   VIYTIHTLQEYLSKGLSLRFWWNNQRMITMRSTSVWFIGFLSAMLKLLGISDTIFEVTQK  639

Query  1073  DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK----QNKSWSL  1240
             +  +   +   DD+  GRFTFDESP FV GTTILLV L AL +  L  +          L
Sbjct  640   ESPTSGVI--GDDANAGRFTFDESPAFVVGTTILLVQLTALVVKILGVQLVVHSGNGCGL  697

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
             GE +CSV++++ YW FLKGLF +GK+GIPLST+ KS  L  +F H
Sbjct  698   GELMCSVYLVVCYWPFLKGLFARGKYGIPLSTIFKSALLTFIFVH  742



>ref|XP_008342030.1| PREDICTED: cellulose synthase-like protein H1 [Malus domestica]
Length=746

 Score =   410 bits (1054),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 227/471 (48%), Positives = 305/471 (65%), Gaps = 19/471 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD + N+PK+VLHAMC LLG K EK A FVQFPQ FY  LKDDP 
Sbjct  278   VSGVMTNAPFMLNVDCDMYANNPKIVLHAMCLLLGFKQEKGA-FVQFPQMFYNILKDDPC  336

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN-EKSTDKDQWETFG  358
              +++   +K ++ G AGIQGPFY GTGCFHRRKV YG    + DN    ++++     FG
Sbjct  337   ESKVVEAVKKIWPGLAGIQGPFYAGTGCFHRRKVFYG--SSLTDNEGNLTSERLNKGCFG  394

Query  359   KSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
              S     S TQIL      +      +++AA  VA   +E  T WG+KVG +YGS  ED 
Sbjct  395   NSPELIRSATQILLEENIDQPDBLSCAVBAAYHVAHSEFEHDTLWGKKVGWVYGSVTEDV  454

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+ IH +GWKS+ C P PPGFLG++P+     L Q+KR  T  L+IL  K  PI   L
Sbjct  455   LTGMKIHARGWKSILCMPEPPGFLGAAPSTTHVMLIQRKRGITGLLEILFSKNCPIFATL  514

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             + +L FRQCLAYLWI+ W +    ++CY+LLPAYC+I NSHF PK+ E A++I A++F+I
Sbjct  515   YAKLEFRQCLAYLWILIWGLHSIPDLCYALLPAYCLITNSHFLPKVQEPALIIFAAVFLI  574

Query  899   YNLYGLFEYIETGESLRAWWNN------QRMLRVYASGSWLFGFLSGVVKVFGLSEAVFE  1060
              +L  L   +++G S+RAWWN        ++L + AS   LFG ++ V K+ G+SE  FE
Sbjct  575   KHLNTLHSNLDSGRSIRAWWNQLTVGPWSKILSLTAS---LFGVITVVFKLLGISEVTFE  631

Query  1061  VTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN----K  1228
             VT+K+ +S  +    + +   RFTFDESP+FVP T +L ++  AL    L  +       
Sbjct  632   VTQKEQNSSSS--DQEATYDARFTFDESPIFVPATALLFLHFTALVTAALGLQPPAHGVN  689

Query  1229  SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
                LGE +CSVWV+L +W F+KGLFG+GK+GIP++T++KS  LALLF + C
Sbjct  690   GAGLGEMMCSVWVVLCFWPFVKGLFGEGKYGIPMATIVKSAVLALLFMYFC  740



>gb|AES67199.2| cellulose synthase H1-like protein [Medicago truncatula]
Length=740

 Score =   410 bits (1053),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 218/469 (46%), Positives = 299/469 (64%), Gaps = 13/469 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK++ HA+C L+  K  KD  FVQ  Q FY G+KDDP+
Sbjct  272   VSGLMTNAPFMLNVDCDMVVNNPKIMQHAICILVDSKSGKDVAFVQCFQKFYDGIKDDPF  331

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVD--NNEKSTDKDQWETF  355
             GNQ     +Y+  G AG+QGP+Y G+  FHRR  IYG +P+ +   N  K  +    + F
Sbjct  332   GNQWVAAFEYMIGGMAGLQGPYYGGSNTFHRRYAIYGFYPNEIQHGNKAKLAENILIQQF  391

Query  356   GKSKTFALSTTQILSGSLYPEIPIFP-NSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             G SK F  S TQ++ G+ Y      P N +E A +V+ C YE+GT WG+++G LYGS  E
Sbjct  392   GSSKKFVKSATQVMEGNDYSTHGNSPSNFIEEAIKVSDCEYEYGTCWGKQMGWLYGSISE  451

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  TG+++  KGW+S  C P P  F G +P G    + QQKRW +    +   K SP++ 
Sbjct  452   DVPTGLNMQRKGWRSECCTPEPTAFTGCAPGGLLTTMIQQKRWSSGLTVVFFSKHSPVMG  511

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIF  892
              LFG++ FR  L+Y W+  W +R  FE+ Y+ L AYCII N+   P+   A + IP ++F
Sbjct  512   TLFGKIQFRAGLSYCWLTNWGLRSVFEVSYAALVAYCIITNTSIFPE--GAGLWIPLTLF  569

Query  893   IIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKK  1072
             +IY ++ L EY   G SLR WWNNQRM+ + ++  W  GFLS ++K+ G+S+ +FEVT+K
Sbjct  570   VIYTMHTLQEYKLKGFSLRYWWNNQRMVTIRSTSVWFIGFLSAMLKLMGISDTIFEVTQK  629

Query  1073  DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL-----DFKQNKSWS  1237
             +  +  A   +DD+  GRFTFDESP FV GTTILLV L AL I  L     D   N+   
Sbjct  630   ESPTSGA--AEDDANAGRFTFDESPAFVVGTTILLVQLTALVIKILGVQLEDHSGNEC-G  686

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
             +GE +CSV++++ YW FLKGLF +GK+GI LST+ KS   AL+F H C+
Sbjct  687   IGELMCSVYLVICYWPFLKGLFARGKYGIALSTIFKSALFALIFVHFCR  735



>ref|XP_003596945.1| Cellulose synthase-like protein H1 [Medicago truncatula]
 gb|AES67196.1| cellulose synthase-like protein [Medicago truncatula]
Length=781

 Score =   410 bits (1054),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 221/457 (48%), Positives = 290/457 (63%), Gaps = 21/457 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPF+LNLDCD HVN+PK+ LHA+C LL  K EK+  FVQ PQ FY GLKDDP+
Sbjct  277   VSGMMTNAPFILNLDCDMHVNNPKIALHALCILLDSKGEKEVAFVQCPQQFYDGLKDDPF  336

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVD--NNEKSTD--KDQWE  349
             GNQ+  +  YL  G  G+QG  Y GT CFHRRKVIYG+ P   D  N +K  D   +   
Sbjct  337   GNQLVALFVYLGGGFGGLQGMLYAGTNCFHRRKVIYGLSPDHDDIQNRKKGDDVVNEMEV  396

Query  350   TFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
              FG SK F  S T  L G  +  I    N+LE AK+VASC YE+GTAWG++VG +YGS  
Sbjct  397   VFGTSKRFIESATHALEGKTFTRIDNLCNTLETAKKVASCTYEYGTAWGKQVGWIYGSTS  456

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG+ IH +GW+S  C P+P  F+G SP     ++ QQKRW +   DIL+ K +P +
Sbjct  457   EDVLTGLDIHTRGWRSEMCSPDPLAFMGCSPQDNIVSMIQQKRWASGLFDILLSKHNPFL  516

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               L+G+L FR+ L Y WI+ W +R   EICY+ LPAYCI+ NS+F P+     + I A++
Sbjct  517   GFLYGKLQFREALGYFWILSWALRSVPEICYAALPAYCILTNSNFLPE----KLWIHAAL  572

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+ YN+  + E ++TG S+R WWNNQ+M+R+    +W FGFL+ ++K+  +SE VFE+T+
Sbjct  573   FVTYNISTISESLKTGLSIRTWWNNQKMMRITTMSAWFFGFLAILLKLLRISEPVFEITQ  632

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSL---  1240
             K          D  S  GRF+F+ESP+F+P TTIL V L AL      +       L   
Sbjct  633   K---------IDQSSNNGRFSFNESPIFLPSTTILFVQLTALATSLFGWATRVGSGLGYG  683

Query  1241  -GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKS  1348
              GE  CS +++  Y  F KGLFG GK GIPLS + KS
Sbjct  684   PGEVFCSAYLVACYLPFFKGLFGTGKHGIPLSIIFKS  720



>ref|XP_003596946.1| Cellulose synthase-like protein H1 [Medicago truncatula]
Length=795

 Score =   410 bits (1054),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 216/465 (46%), Positives = 294/465 (63%), Gaps = 11/465 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK++ HAMC L+  K+ KD  FVQ  Q FY G+KDDP+
Sbjct  302   VSGLMTNAPFMLNVDCDMVVNNPKIIQHAMCILMDSKNGKDVAFVQCFQQFYDGIKDDPF  361

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS--TDKDQWETF  355
             GNQ     +Y+ +G  G+QGPFY GT  FHRR  IYG++P  +    K   T+K   + F
Sbjct  362   GNQWVASFEYIIKGMGGLQGPFYGGTNTFHRRNAIYGLYPDEIQYGRKGKITEKMLIQQF  421

Query  356   GKSKTFALSTTQILSGSLYPEIPIFP-NSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             G SK F  S T    GS      I P N L+ A +V+ C YE+GT+WG+++  LYGS  E
Sbjct  422   GSSKEFVKSVTHAFEGSGNSIDGISPSNLLDKAIQVSDCGYEYGTSWGKQMCWLYGSISE  481

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  TG+++  KGW+S  C P P  F+G +P G    + QQKRW +    +   K SP++ 
Sbjct  482   DVPTGLNMQRKGWRSECCTPEPTAFMGCAPGGLLTTMIQQKRWSSGLTVVFFSKHSPVMC  541

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIF  892
              LFG++ FR  L+Y W+  W +R  FE+ Y+ L AYCII N+   PK     + IP ++F
Sbjct  542   TLFGKIQFRAGLSYCWLTNWGLRSVFEVSYAALVAYCIITNTSIFPK--GLGLWIPLTLF  599

Query  893   IIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKK  1072
             +IY ++ L EY+  G SLR WWNNQRM+ + ++  W  GFLS ++K+ G+S+ +FEVT+K
Sbjct  600   VIYTIHTLQEYLSKGLSLRFWWNNQRMITMRSTSVWFIGFLSAMLKLLGISDTIFEVTQK  659

Query  1073  DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK----QNKSWSL  1240
             +  +   +   DD+  GRFTFDESP FV GTTILLV L AL +  L  +          L
Sbjct  660   ESPTSGVI--GDDANAGRFTFDESPAFVVGTTILLVQLTALVVKILGVQLVVHSGNGCGL  717

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
             GE +CSV++++ YW FLKGLF +GK+GIPLST+ KS  L  +F H
Sbjct  718   GELMCSVYLVVCYWPFLKGLFARGKYGIPLSTIFKSALLTFIFVH  762



>ref|XP_004151936.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=746

 Score =   409 bits (1050),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 211/433 (49%), Positives = 279/433 (64%), Gaps = 14/433 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDE-KDAEFVQFPQNFYGGLKDDP  178
             VSGV+TNAP++LN+DCD   NDP+VVLHAMC  L  KD+ +D  +VQ PQ FY GL+DDP
Sbjct  281   VSGVLTNAPYILNVDCDMFANDPQVVLHAMCVFLNSKDDLEDIGYVQTPQCFYDGLEDDP  340

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVD---NNEKSTDKDQWE  349
             +GNQ+ +I +Y  RG  G+QGP Y GTGCFHRRKV+YG  PH      + +  ++++  E
Sbjct  341   FGNQLVVIFEYYARGVMGLQGPVYSGTGCFHRRKVLYGQLPHHSTHFMDGKAYSEQELME  400

Query  350   TFGKSKTFALSTTQILSGSLYPEIP--IFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
              FG SKTFA S       + +   P   F ++LEAA +VA C YE  T WG K+G +YGS
Sbjct  401   VFGYSKTFAKSAIYAFEETTHGYHPNSRFNDNLEAANQVAGCDYEINTTWGSKIGWIYGS  460

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG+ I  +GW+S+Y   NPP FLG +P+   A+LTQQKRW +  L+IL  K  P
Sbjct  461   TTEDVLTGLVIQSRGWRSIYIALNPPAFLGCAPSQLVASLTQQKRWVSGLLEILFSKHFP  520

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             I   LFG+L ++QC  Y+W++ W +R   E+ Y+LLP YC+I+NS F P + E AI IP 
Sbjct  521   IFGTLFGKLQWKQCAVYIWLLTWGLRSIPELSYALLPPYCLISNSSFFPNMEERAIYIPI  580

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
              +FIIYN   L  Y ET +S+RAWWNNQRM RV    +WLFG  S V+K  G+ E VFEV
Sbjct  581   FLFIIYNFQQLLLYKETRQSIRAWWNNQRMGRVNTMCAWLFGVGSVVLKFLGVREVVFEV  640

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSLG  1243
             TKK+   +  L+         F FDES +FVP TT+LL+ L AL + F+        ++ 
Sbjct  641   TKKETYCEADLE--------HFMFDESAMFVPATTLLLLQLIALLMSFIRQAGRMRNTVL  692

Query  1244  EAICSVWVILMYW  1282
             E ICSVW++L +W
Sbjct  693   EVICSVWLVLCFW  705



>ref|XP_003596948.1| Cellulose synthase-like protein H1 [Medicago truncatula]
Length=751

 Score =   409 bits (1050),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 218/478 (46%), Positives = 300/478 (63%), Gaps = 20/478 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK++ HA+C L+  K  KD  FVQ  Q FY G+KDDP+
Sbjct  272   VSGLMTNAPFMLNVDCDMVVNNPKIMQHAICILVDSKSGKDVAFVQCFQKFYDGIKDDPF  331

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVD--NNEKSTDKDQWETF  355
             GNQ     +Y+  G AG+QGP+Y G+  FHRR  IYG +P+ +   N  K  +    + F
Sbjct  332   GNQWVAAFEYMIGGMAGLQGPYYGGSNTFHRRYAIYGFYPNEIQHGNKAKLAENILIQQF  391

Query  356   GKSKTFALSTTQILSGSLYPEIPIFP-NSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             G SK F  S TQ++ G+ Y      P N +E A +V+ C YE+GT WG+++G LYGS  E
Sbjct  392   GSSKKFVKSATQVMEGNDYSTHGNSPSNFIEEAIKVSDCEYEYGTCWGKQMGWLYGSISE  451

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  TG+++  KGW+S  C P P  F G +P G    + QQKRW +    +   K SP++ 
Sbjct  452   DVPTGLNMQRKGWRSECCTPEPTAFTGCAPGGLLTTMIQQKRWSSGLTVVFFSKHSPVMG  511

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE---------A  865
              LFG++ FR  L+Y W+  W +R  FE+ Y+ L AYCII N+   P++           A
Sbjct  512   TLFGKIQFRAGLSYCWLTNWGLRSVFEVSYAALVAYCIITNTSIFPEVRYSHSISTAKGA  571

Query  866   AIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLS  1045
              + IP ++F+IY ++ L EY   G SLR WWNNQRM+ + ++  W  GFLS ++K+ G+S
Sbjct  572   GLWIPLTLFVIYTMHTLQEYKLKGFSLRYWWNNQRMVTIRSTSVWFIGFLSAMLKLMGIS  631

Query  1046  EAVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL-----  1210
             + +FEVT+K+  +  A   +DD+  GRFTFDESP FV GTTILLV L AL I  L     
Sbjct  632   DTIFEVTQKESPTSGA--AEDDANAGRFTFDESPAFVVGTTILLVQLTALVIKILGVQLE  689

Query  1211  DFKQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
             D   N+   +GE +CSV++++ YW FLKGLF +GK+GI LST+ KS   AL+F H C+
Sbjct  690   DHSGNEC-GIGELMCSVYLVICYWPFLKGLFARGKYGIALSTIFKSALFALIFVHFCR  746



>ref|XP_007217162.1| hypothetical protein PRUPE_ppa001889mg [Prunus persica]
 gb|EMJ18361.1| hypothetical protein PRUPE_ppa001889mg [Prunus persica]
Length=746

 Score =   408 bits (1048),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 231/472 (49%), Positives = 302/472 (64%), Gaps = 18/472 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD + N+ K+VLHAMC LLG K EK+  FVQ PQ FY  LKDDP+
Sbjct  278   VSGVMTNAPFMLNVDCDMYANNSKIVLHAMCLLLGFKHEKEGAFVQCPQMFYDTLKDDPF  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQ+       + G AG+QGP Y GTGCF RRKVIYG      + N +    D+ E FG 
Sbjct  338   GNQLTS-----WPGFAGMQGPLYAGTGCFQRRKVIYGFSLIDSEGNLRDVALDK-ERFGN  391

Query  362   SKTFALSTTQILSGSL-YPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             S     S T   S  + +P      +++EAA +VA   YE  T WG KVG +YGS  ED 
Sbjct  392   STELIESATHTSSEKIDHPHD--LSSAVEAANQVAGSSYEHSTLWGTKVGWVYGSVTEDI  449

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+ IH +GWKS+ C P+PPGF+GS+P+     LTQ+KRW T  L+IL  K +PI   L
Sbjct  450   LTGMKIHARGWKSILCMPDPPGFMGSAPSSSHVMLTQRKRWVTGLLEILFSKNNPIFATL  509

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             + +L FRQCLAY  ++ W +    ++CY++LPAYCII NSHF PK+ E A++   ++F++
Sbjct  510   YAKLEFRQCLAYTTVLIWGLNSIPDLCYTILPAYCIITNSHFLPKVKEPALIFFVAVFLM  569

Query  899   YNLYGLFEYIETGESLRAWWNNQRM----LRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
               LY L  Y+  G S++ WWN+ RM       Y + S LFG ++   K+ G+SE  FEVT
Sbjct  570   KILYTLRFYLGFGLSIKQWWNHVRMGPSGKIPYVTAS-LFGVVTLAFKLLGISEVAFEVT  628

Query  1067  KKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS---  1237
             +KD  S  + D++DD   GRFTFDESP+FVP TT+L V+  AL +G    +     +   
Sbjct  629   QKDQYSSSSDDQEDDVNAGRFTFDESPIFVPATTLLFVHFTALAMGLFGMQPPAHGADGA  688

Query  1238  -LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
              LGE +C VWV+L +W FLKGLFGKGK+GIP+ T+ KS  LALLF H C  +
Sbjct  689   GLGEMMCCVWVVLCFWPFLKGLFGKGKYGIPMPTIFKSAALALLFMHFCGRI  740



>ref|XP_004506255.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Cicer arietinum]
Length=714

 Score =   407 bits (1045),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 218/470 (46%), Positives = 292/470 (62%), Gaps = 40/470 (9%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  VN+P +V HAMC LL  K EK+  F Q PQ FY  LKDDP+
Sbjct  275   VSGLITNAPFMLNVDCDMFVNNPNIVQHAMCILLDSKGEKEVAFAQCPQQFYATLKDDPF  334

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQM I++KYL  G AG+QG FY GT CFHRRKVIYG+ P  V+N    +  D       
Sbjct  335   GNQMTILLKYLGAGLAGLQGIFYGGTNCFHRRKVIYGLSPDDVENGRIYSPND-------  387

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
                  ++ T+               ++E A +VA   YE+GT WG++VG +YGS  ED  
Sbjct  388   -----INVTK---------------AVEEATQVACYGYEYGTGWGKQVGWIYGSITEDVL  427

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG++IH KGW+S  C P+P  F G +P GGP ++ Q KRW T  L+I   K  PI   +F
Sbjct  428   TGLTIHKKGWRSELCTPDPVAFRGCAPIGGPTSMAQHKRWATGMLEIFFSKHCPIFGTIF  487

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
             G+L FRQ LAY+WIM W   P   +CYS L  YCII NS+F PK  +  I IP ++ + Y
Sbjct  488   GKLSFRQFLAYMWIMNWGFNPVALVCYSCLLPYCIITNSNFLPK--DWGICIPIALIVTY  545

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKD--  1075
              +Y L EY+ +G ++RAWWNNQRM  +    +   GF++ ++K+ G+S  +F++TKKD  
Sbjct  546   MVYTLVEYLISGMTIRAWWNNQRMSLITPMNAGFCGFITILLKLLGISNTIFDITKKDIP  605

Query  1076  HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK-----QNKSWSL  1240
              SSDE  DKD      R TFD+S +F+PGTTILL+ L ++FI    F+     +N    +
Sbjct  606   SSSDEVQDKD----ASRHTFDKSLVFLPGTTILLLQLTSIFIKLFGFQPQGLSENYECGV  661

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
              E +CSV+ I+ YW FL+GLF +GK+GIP ST+ K   +  LF   C+S 
Sbjct  662   AEMLCSVYWIMSYWPFLRGLFERGKYGIPFSTIRKGAAMTCLFVFLCRST  711



>ref|XP_003540290.1| PREDICTED: cellulose synthase-like protein H1-like isoformX1 
[Glycine max]
 gb|KHN44859.1| Cellulose synthase-like protein H1 [Glycine soja]
Length=746

 Score =   407 bits (1046),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 219/468 (47%), Positives = 300/468 (64%), Gaps = 10/468 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK+V HAMC L+  K  K+  FVQ  Q FY G+KDDP+
Sbjct  279   VSGLMTNAPFMLNVDCDMFVNNPKIVQHAMCILMDSKSGKEVAFVQCFQQFYDGIKDDPF  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVV--DNNEKSTDKDQWETF  355
             GNQ   + +Y+ RG AG+QGPFY GT  FHRRK IYG++P       N K  +K   + F
Sbjct  339   GNQWVAVFEYIVRGMAGLQGPFYCGTNTFHRRKAIYGVYPDETGSRRNGKLEEKILIQQF  398

Query  356   GKSKTFALSTTQILSGSLYPEIPIFPNS-LEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             G  + F  S    + GS Y    I P+S +EAA +VA C YE GT WG+++G LYGS  E
Sbjct  399   GSLEEFVKSAAHAMEGSAYSANDITPSSFIEAAIQVADCGYEDGTWWGKQMGWLYGSLTE  458

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  TG+S+  +GW+S  C P+P  F G +P G  + + QQKRW T    I   K SP++ 
Sbjct  459   DVLTGLSMKRRGWRSECCTPDPIAFTGCAPGGLLSTMLQQKRWFTGHTVIFFGKHSPLMC  518

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIF  892
              LFG++ FR  L+Y W+    +R  F +CY  L AYC+I N++  PK     + IP ++F
Sbjct  519   MLFGKIQFRAGLSYFWVSTLSLRGVFLVCYIALLAYCMITNTNIFPK--GLGLWIPITLF  576

Query  893   IIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKK  1072
             +IYN+Y L EY++ G S+R WWNNQRM  V  + +   GFL+G+V++ GLS+  F++T+K
Sbjct  577   VIYNVYTLLEYVKIGLSMRQWWNNQRMCIVRTTTASFLGFLNGMVQLSGLSDIAFDITEK  636

Query  1073  DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS---LG  1243
             ++ +  A +   D+  GRFTF+ESP+FV GTTILLV L A+ I F   +   S +   LG
Sbjct  637   EYPTSSADENSTDA--GRFTFNESPVFVIGTTILLVYLTAILIKFWGLQPTHSGNGSGLG  694

Query  1244  EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             E ICS +V++ +W +LKGLF +G +GIPLS + KS   A +F H C+S
Sbjct  695   EFICSTYVVVCFWPYLKGLFARGNYGIPLSIMCKSAVFAFVFVHFCRS  742



>gb|KGN63235.1| hypothetical protein Csa_2G416250 [Cucumis sativus]
Length=746

 Score =   407 bits (1046),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 211/433 (49%), Positives = 278/433 (64%), Gaps = 14/433 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVK-DEKDAEFVQFPQNFYGGLKDDP  178
             VSGV+TNAP++LN+DCD   NDP+VVLHAMC  L  K D +D  +VQ PQ FY GL+DDP
Sbjct  281   VSGVLTNAPYILNVDCDMFANDPQVVLHAMCVFLNSKYDLEDIGYVQTPQCFYDGLEDDP  340

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVD---NNEKSTDKDQWE  349
             +GNQ+ +I +Y  RG  G+QGP Y GTGCFHRRKV+YG  PH      + +  ++++  E
Sbjct  341   FGNQLVVIFEYYARGVMGLQGPVYSGTGCFHRRKVLYGQLPHHSTHFMDGKAYSEQELME  400

Query  350   TFGKSKTFALSTTQILSGSLYPEIP--IFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
              FG SKTFA S       + +   P   F ++LEAA +VA C YE  T WG K+G +YGS
Sbjct  401   VFGYSKTFAKSAIYAFEETTHGYHPNSRFNDNLEAANQVAGCDYEINTTWGSKIGWIYGS  460

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG+ I  +GW+S+Y   NPP FLG +P+   A+LTQQKRW +  L+IL  K  P
Sbjct  461   TTEDVLTGLVIQSRGWRSIYIALNPPAFLGCAPSQLVASLTQQKRWVSGLLEILFSKHFP  520

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             I   LFG+L ++QC  Y+W++ W +R   E+ Y+LLP YC+I+NS F P + E AI IP 
Sbjct  521   IFGTLFGKLQWKQCAVYIWLLTWGLRSIPELSYALLPPYCLISNSSFFPNMEERAIYIPI  580

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
              +FIIYN   L  Y ET +S+RAWWNNQRM RV    +WLFG  S V+K  G+ E VFEV
Sbjct  581   FLFIIYNFQQLLLYKETRQSIRAWWNNQRMGRVNTMCAWLFGVGSVVLKFLGVREVVFEV  640

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSLG  1243
             TKK+   +  L+         F FDES +FVP TT+LL+ L AL + F+        ++ 
Sbjct  641   TKKETYCEADLE--------HFMFDESAMFVPATTLLLLQLIALLMSFIRQAGRMRNTVL  692

Query  1244  EAICSVWVILMYW  1282
             E ICSVW++L +W
Sbjct  693   EVICSVWLVLCFW  705



>ref|XP_004506254.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Cicer arietinum]
Length=715

 Score =   406 bits (1043),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 219/471 (46%), Positives = 290/471 (62%), Gaps = 41/471 (9%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG++TNAPFMLN+DCD  VN+P +V HAMC LL  K EK+  F Q PQ FY  LKDDP+
Sbjct  275   VSGLITNAPFMLNVDCDMFVNNPNIVQHAMCILLDSKGEKEVAFAQCPQQFYATLKDDPF  334

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GNQM I++KYL  G AG+QG FY GT CFHRRKVIYG+ P  V+N               
Sbjct  335   GNQMTILLKYLGAGLAGLQGIFYGGTNCFHRRKVIYGLSPDDVEN---------------  379

Query  362   SKTFALSTTQILSGSLY-PEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
                          G +Y P       ++E A +VA   YE+GT WG++VG +YGS  ED 
Sbjct  380   ------------EGRIYSPNDINVTKAVEEATQVACYGYEYGTGWGKQVGWIYGSITEDV  427

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG++IH KGW+S  C P+P  F G +P GGP ++ Q KRW T  L+I   K  PI   +
Sbjct  428   LTGLTIHKKGWRSELCTPDPVAFRGCAPIGGPTSMAQHKRWATGMLEIFFSKHCPIFGTI  487

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
             FG+L FRQ LAY+WIM W   P   +CYS L  YCII NS+F PK  +  I IP ++ + 
Sbjct  488   FGKLSFRQFLAYMWIMNWGFNPVALVCYSCLLPYCIITNSNFLPK--DWGICIPIALIVT  545

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKD-  1075
             Y +Y L EY+ +G ++RAWWNNQRM  +    +   GF++ ++K+ G+S  +F++TKKD 
Sbjct  546   YMVYTLVEYLISGMTIRAWWNNQRMSLITPMNAGFCGFITILLKLLGISNTIFDITKKDI  605

Query  1076  -HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK-----QNKSWS  1237
               SSDE  DKD      R TFD+S +F+PGTTILL+ L ++FI    F+     +N    
Sbjct  606   PSSSDEVQDKD----ASRHTFDKSLVFLPGTTILLLQLTSIFIKLFGFQPQGLSENYECG  661

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
             + E +CSV+ I+ YW FL+GLF +GK+GIP ST+ K   +  LF   C+S 
Sbjct  662   VAEMLCSVYWIMSYWPFLRGLFERGKYGIPFSTIRKGAAMTCLFVFLCRST  712



>ref|XP_007149989.1| hypothetical protein PHAVU_005G116500g [Phaseolus vulgaris]
 gb|ESW21983.1| hypothetical protein PHAVU_005G116500g [Phaseolus vulgaris]
Length=1374

 Score =   419 bits (1078),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 235/473 (50%), Positives = 304/473 (64%), Gaps = 16/473 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPF+LN+DCD +V++PK+VLHA+C LL  K EK+  F Q  Q FY  LKDDP+
Sbjct  906   VSGVMTNAPFILNVDCDMYVHNPKIVLHALCILLDSKGEKEVAFSQCIQQFYDALKDDPF  965

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP-HVVDNNEKSTD------KD  340
             GNQ+     YL  G AG+QG FY+GT C HRRKVIYG+ P H + N +K  D       +
Sbjct  966   GNQLVATFLYLGGGLAGLQGIFYIGTNCLHRRKVIYGLSPDHHIQNGKKDHDITNGKFSE  1025

Query  341   QWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYG  520
             +   FG SK F  S T  L G            +EAAKEVASC YE+ TAWG++VG +YG
Sbjct  1026  KKRIFGSSKGFVESATDALEGKTLASNNNIWKYVEAAKEVASCEYEYDTAWGKEVGWMYG  1085

Query  521   SAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKS  700
             S  ED  TG+ IH KGW+S  C P+   F+G SP      + QQ+RW +  L+IL+    
Sbjct  1086  STSEDALTGLKIHTKGWRSEVCSPDLIAFMGCSPQDIITVMVQQRRWVSGLLEILLSNHC  1145

Query  701   PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP  880
             PI   LFG+L FRQCL YLW+  W +R   EICYSLLPAYCIINNS F PK  E    IP
Sbjct  1146  PIFGTLFGKLQFRQCLGYLWVTTWGLRSVPEICYSLLPAYCIINNSTFLPK--ELGQGIP  1203

Query  881   ASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFE  1060
              ++F+IYN+  + EY+ TG S+R WWN+QRM R+  + +W  GFLS V+K+  +S+ VFE
Sbjct  1204  TTLFVIYNISTVVEYLGTGLSIRTWWNSQRMARITTTNAWFSGFLSIVLKLLRISDTVFE  1263

Query  1061  VTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL----DFKQNK  1228
             +TKK+ SS     K+++   GRF F+ESP+F+PGTTILL+ L AL    L      +   
Sbjct  1264  ITKKEQSSSNESAKENN---GRFIFNESPIFIPGTTILLIQLIALVTKLLGWQPRVRNGH  1320

Query  1229  SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
                + E +C  ++++ YW F KGLFGKGK+GIPLST+ KS  LA LF +  K+
Sbjct  1321  GSGIEEMLCCSYLVVCYWPFFKGLFGKGKYGIPLSTICKSMVLAFLFVYFGKA  1373


 Score =   409 bits (1051),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 229/467 (49%), Positives = 297/467 (64%), Gaps = 16/467 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPF+LN+DCD +V++PK+VLHA+C L   K EK+  F Q  Q FY  LKDDP+
Sbjct  172   VSGVMTNAPFILNVDCDMYVHNPKIVLHALCILPDSKGEKEVAFSQCIQQFYDALKDDPF  231

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP-HVVDNNEKSTD------KD  340
             GNQ+     YL  G AG+QG FY+GT C HRRKVIYG+ P H + N +K  D        
Sbjct  232   GNQLVATFFYLGGGLAGLQGIFYIGTNCLHRRKVIYGLSPDHHIQNGKKDHDITNGKFSK  291

Query  341   QWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYG  520
             +   FG SK F  STT  L G            +EAAKEV SC YE+ TAWG++VG +YG
Sbjct  292   KKRIFGSSKGFVGSTTDALEGKTLASNNNIWKYVEAAKEVVSCEYEYDTAWGKEVGWMYG  351

Query  521   SAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKS  700
             +  ED  TG+ IH KGW+   C P+   F+G SP      + QQ+RW +  L+IL+    
Sbjct  352   TTSEDALTGLKIHTKGWRFEVCSPDLIAFMGCSPKDIITVMVQQRRWVSGLLEILLSNHC  411

Query  701   PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP  880
             PI   LFG+L FRQCL YLW+  W +R   EICYSLLPAYCIINNS F PK  +    IP
Sbjct  412   PIFGTLFGKLQFRQCLGYLWVTTWGLRCVPEICYSLLPAYCIINNSTFLPK--DLGQWIP  469

Query  881   ASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFE  1060
              ++F+IYN+    EY+ TG S+R WWN+QRM R+  + +W FG LS V+K+  +S+ VFE
Sbjct  470   TTLFVIYNISTFVEYLGTGLSIRTWWNSQRMARITTTNAWFFGLLSIVLKLLRISDIVFE  529

Query  1061  VTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL----DFKQNK  1228
             +T+K+ SS     K+++   GRF F+ESP+F+PGTTILL+ L AL    L      +   
Sbjct  530   ITRKEQSSSNESAKENN---GRFIFNESPIFIPGTTILLIQLIALVTKLLGWQPRVRNGH  586

Query  1229  SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
                +GE +C  ++++ Y  F KGLFGKGK+GIPLST+ KS  LA LF
Sbjct  587   GSGIGEVLCCSYLVVCYSPFFKGLFGKGKYGIPLSTICKSMVLAFLF  633



>gb|EAZ30773.1| hypothetical protein OsJ_14837 [Oryza sativa Japonica Group]
Length=638

 Score =   402 bits (1032),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 220/474 (46%), Positives = 290/474 (61%), Gaps = 14/474 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP MLN+DCD  VN+P+ VLHAMC LLG  DE  + FVQ PQ FY  LKDDP+
Sbjct  164   VSAVMTNAPIMLNMDCDMFVNNPQAVLHAMCLLLGFDDEASSGFVQAPQRFYDALKDDPF  223

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHV-----VDNNEKSTDKDQW  346
             GNQM+   K    G  G+QG FY GTGCFHRRK +YG+ P+       D    S+ K+  
Sbjct  224   GNQMECFFKRFISGVQGVQGAFYAGTGCFHRRKAVYGVPPNFNGAEREDTIGSSSYKELH  283

Query  347   ETFGKSKTFALSTTQIL-SGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
               FG S+    S   I+   S  P + I  + +E AK V++C Y+ GT WGQ+VG +YGS
Sbjct  284   TRFGNSEELNESARNIIWDLSSKPMVDI-SSRIEVAKAVSACNYDIGTCWGQEVGWVYGS  342

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG  IH  GW+SV     PP F+GS+P GGPA LTQ KRW T   +I+I + +P
Sbjct  343   LTEDILTGQRIHAMGWRSVLMVTEPPAFMGSAPIGGPACLTQFKRWATGQSEIIISRNNP  402

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             I+  +F RL FRQCLAYL ++GWP+R  FE+CY LL  YCI+ N  F PK +E    +P 
Sbjct  403   ILATMFKRLKFRQCLAYLIVLGWPLRAPFELCYGLLGPYCILTNQSFLPKASEDGFSVPL  462

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             ++FI YN Y   EY+  G S RAWWNN RM R+ +  +W   FL+ ++K  GLSE VFEV
Sbjct  463   ALFISYNTYNFMEYMACGLSARAWWNNHRMQRIISVSAWTLAFLTVLLKSLGLSETVFEV  522

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW---  1234
             T KD S  +  D  D +  GRFTFD  P+F+P T + ++N+ A+ +G        +    
Sbjct  523   TGKDKSMSDDDDNTDGADPGRFTFDSLPVFIPVTALAMLNIVAVTVGACRVAFGTAEGVP  582

Query  1235  ---SLGEAICSVWVILMYWAflkglf-gkgkfgIPLSTVLKSGGLALLFFHACK  1384
                 +GE +C  W++L ++ F++G+  GKG +GIP S  LK+  L  +F   CK
Sbjct  583   CAPGIGEFMCCGWLVLCFFPFVRGIVWGKGSYGIPWSVKLKASLLVAMFVTFCK  636



>ref|XP_007149991.1| hypothetical protein PHAVU_005G116700g [Phaseolus vulgaris]
 gb|ESW21985.1| hypothetical protein PHAVU_005G116700g [Phaseolus vulgaris]
Length=750

 Score =   405 bits (1040),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 218/477 (46%), Positives = 293/477 (61%), Gaps = 21/477 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             +SG+MTNAP++LN+DCD +VN+PK+  HA+C LL  K EK+  FVQ PQ FY  +KDD Y
Sbjct  278   ISGLMTNAPYILNVDCDMYVNNPKIAQHALCILLDPKGEKEVAFVQCPQRFYDTVKDDAY  337

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP-HVVDNNEKS--------TD  334
             GNQ+  +  Y+  G AG+QG  Y GT CFHRRKV+YG+ P H +   +K         ++
Sbjct  338   GNQLVALPMYIGGGFAGLQGIIYAGTNCFHRRKVLYGLSPDHDIQTAKKDFGFIDGTLSE  397

Query  335   KDQWETFGKSKTFALSTTQILSGSLY-PEIPIFPN-SLEAAKEVASCVYEFGTAWGQKVG  508
             K   + FG SK F  S    L    + P   +F +   EAA ++++C YE  T WG++VG
Sbjct  398   KKTVQIFGASKGFVESANHALEEMAFTPNHNLFKSLDREAANQISTCDYENSTEWGKQVG  457

Query  509   LLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILI  688
              LYGS  ED  TG+ +H KGW+S  C P+P  F+G SP      + Q KRW +   DI +
Sbjct  458   WLYGSTSEDVLTGLLMHRKGWRSEVCSPDPMAFMGCSPQDNLGQMAQHKRWSSGLFDIFL  517

Query  689   CKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAA  868
                 PI   LFG+L FR+CLAY+W+  W +R   EI Y+LLPAYCII NS F P   E  
Sbjct  518   SSHCPIFGTLFGKLQFRECLAYIWLTNWALRSVPEISYALLPAYCIITNSSFLPN-KELG  576

Query  869   IVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSE  1048
             +  P S+F++YN+  L E++ +G S R WWNNQRM R+    S   GFL  ++K   +S+
Sbjct  577   MWFPVSVFVVYNVGTLSEHLMSGLSARTWWNNQRMGRITTMTSCFLGFLDILLKRLRISD  636

Query  1049  AVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFI---GFLDFK  1219
              VFE+TKKD  S       ++  VGRF F++SP+FVPGTTILL+ L AL     G+   K
Sbjct  637   TVFEITKKDQPS------SNNENVGRFIFNKSPIFVPGTTILLIQLTALVTALWGWQQLK  690

Query  1220  QNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
              + ++ LGE  CS +V+L Y   LKGLFG GK+GIPLST+ K+  LA  F   C+S 
Sbjct  691   NDGAYGLGEVFCSAYVVLCYLPLLKGLFGIGKYGIPLSTISKATVLAFFFVQLCRST  747



>ref|XP_004158577.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=746

 Score =   404 bits (1038),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 210/433 (48%), Positives = 277/433 (64%), Gaps = 14/433 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVK-DEKDAEFVQFPQNFYGGLKDDP  178
             VSGV+TNAP++LN+DCD   NDP+VVLHAMC  L  K D +D  +VQ PQ FY GL+DDP
Sbjct  281   VSGVLTNAPYILNVDCDMFANDPQVVLHAMCVFLNSKYDLEDIGYVQTPQCFYDGLEDDP  340

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVD---NNEKSTDKDQWE  349
             +GNQ+ +I +Y  RG  G+QGP Y GTGCFH RKV+YG  PH      + +  ++++  E
Sbjct  341   FGNQLVVIFEYYARGVMGLQGPVYSGTGCFHTRKVLYGQLPHHSTHFMDGKAYSEQELME  400

Query  350   TFGKSKTFALSTTQILSGSLYPEIP--IFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
              FG SKTFA S       + +   P   F ++LEAA +VA C YE  T WG K+G +YGS
Sbjct  401   VFGYSKTFAKSAIYAFEETTHGYHPNSRFNDNLEAANQVAGCDYEINTTWGSKIGWIYGS  460

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG+ I  +GW+S+Y   NPP FLG +P+   A+LTQQKRW +  L+IL  K  P
Sbjct  461   TTEDVLTGLVIQSRGWRSIYIALNPPAFLGCAPSQLVASLTQQKRWVSGLLEILFSKHFP  520

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             I   LFG+L ++QC  Y+W++ W +R   E+ Y+LLP YC+I+NS F P + E AI IP 
Sbjct  521   IFGTLFGKLQWKQCAVYIWLLTWGLRSIPELSYALLPPYCLISNSSFFPNMEERAIYIPI  580

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
              +FIIYN   L  Y ET +S+RAWWNNQRM RV    +WLFG  S V+K  G+ E VFEV
Sbjct  581   FLFIIYNFQQLLLYKETRQSIRAWWNNQRMGRVNTMCAWLFGVGSVVLKFLGVREVVFEV  640

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSLG  1243
             TKK+   +  L+         F FDES +FVP TT+LL+ L AL + F+        ++ 
Sbjct  641   TKKETYCEADLE--------HFMFDESAMFVPATTLLLLQLIALLMSFIRQAGRMRNTVL  692

Query  1244  EAICSVWVILMYW  1282
             E ICSVW++L +W
Sbjct  693   EVICSVWLVLCFW  705



>ref|XP_007149988.1| hypothetical protein PHAVU_005G1164000g, partial [Phaseolus vulgaris]
 gb|ESW21982.1| hypothetical protein PHAVU_005G1164000g, partial [Phaseolus vulgaris]
Length=520

 Score =   397 bits (1019),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 212/462 (46%), Positives = 299/462 (65%), Gaps = 10/462 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+M+NAPFMLN+DCD  VN+PK+VLHA+  L+  +  K+  FVQ  Q F  G+KDDP+
Sbjct  63    VSGLMSNAPFMLNVDCDMIVNNPKIVLHALSILMDSQKGKEVAFVQCFQQFIDGIKDDPF  122

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDN--NEKSTDKDQWETF  355
             GNQ+ I  +Y+ RG AG+QGP Y GT  FHRR  IYG++PH ++     KS +    + F
Sbjct  123   GNQLVIEYEYIIRGMAGLQGPLYAGTNTFHRRNTIYGLYPHEIETVIKGKSEENILIQQF  182

Query  356   GKSKTFALSTTQILSGSLYPEIPIFP-NSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             G SK F  S T ++ GS Y    I P N +EAA +VA+C YE GT WG ++G LYGS  E
Sbjct  183   GSSKEFIKSATHVVGGSGYSANDITPSNFIEAATQVANCEYECGTFWGNQLGWLYGSISE  242

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  TG++IH KGW+S  C P+P  F G +P G  + + QQKRW +    +   K SP++ 
Sbjct  243   DVPTGLNIHRKGWRSECCTPDPIAFTGCAPGGLLSTMIQQKRWASGLTVVFFGKHSPLMA  302

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIF  892
              LF ++ FR  L+Y W   W +   F +CY  L AYC+I N+   P+     + I  S+F
Sbjct  303   MLFDKIQFRTGLSYFWSTNWGLCAAFLVCYVALIAYCMIANTSIFPQ--GLGLWIAISLF  360

Query  893   IIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKK  1072
             + YN++ L E++  G S+  WWNNQRM  +  + +W  GFLS ++K+ G+S+ VFE+T+K
Sbjct  361   VFYNIHTLLEHLTIGLSITNWWNNQRMCVMRTTTAWFIGFLSAMLKLSGISDTVFEITEK  420

Query  1073  DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS---LG  1243
             +H++  A   + D+  GRFTFDESP+FV GTTILLV+LA + I  L  + + S +   +G
Sbjct  421   EHTTSGADGNNADA--GRFTFDESPVFVVGTTILLVHLAGMVIKLLGLQPSDSGNGSGIG  478

Query  1244  EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
             E ICS ++I+ Y+ +LKGLFG+GK+GIPL+T+  S   AL+F
Sbjct  479   EFICSTYLIVCYFPYLKGLFGRGKYGIPLTTICMSSVFALVF  520



>gb|EEC77287.1| hypothetical protein OsI_15924 [Oryza sativa Indica Group]
Length=762

 Score =   404 bits (1038),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 221/476 (46%), Positives = 292/476 (61%), Gaps = 14/476 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP MLN+DCD  VN+P+ VLHAMC LLG  DE  + FVQ PQ FY  LKDDP+
Sbjct  288   VSAVMTNAPIMLNMDCDMFVNNPQAVLHAMCLLLGFDDEASSGFVQAPQRFYDALKDDPF  347

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHV-----VDNNEKSTDKDQW  346
             GNQM+   K    G  G+QG FY GTGCFHRRK +YG+ P+       D    S+ K+  
Sbjct  348   GNQMECFFKRFISGVQGVQGAFYAGTGCFHRRKAVYGVPPNFNGAEREDTIGSSSYKELH  407

Query  347   ETFGKSKTFALSTTQIL-SGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
               FG S+    S   I+   S  P + I  + +E AK V++C Y+ GT WGQ+VG +YGS
Sbjct  408   TRFGNSEELNESARNIIWDLSSKPMVDI-SSRIEVAKAVSACNYDIGTCWGQEVGWVYGS  466

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG  IH  GW+SV     PP F+GS+P GGPA LTQ KRW T   +I+I + +P
Sbjct  467   LTEDILTGQRIHAMGWRSVLMVTEPPAFMGSAPIGGPACLTQFKRWATGQSEIIISRNNP  526

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             I+  +F RL FRQCLAYL ++GWP+R  FE+CY LL  YCI+ N  F PK +E    +P 
Sbjct  527   ILATMFKRLKFRQCLAYLIVLGWPLRAPFELCYGLLGPYCILTNQSFLPKASEDGFSVPL  586

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             ++FI YN Y   EY+  G S RAWWNN RM R+ +  +W   FL+ ++K  GLSE VFEV
Sbjct  587   ALFISYNTYNFMEYMACGLSARAWWNNHRMQRIISVSAWTLAFLTVLLKSLGLSETVFEV  646

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW---  1234
             T KD S  +  D  D +  GRFTFD SP+F+P T + ++N+ A+ +G        +    
Sbjct  647   TGKDKSMSDDDDNTDGADPGRFTFDSSPVFIPVTALAMLNIVAVTVGACRVAFGTAEGVP  706

Query  1235  ---SLGEAICSVWVILMYWAflkglf-gkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
                 +GE +C  W++L ++ F++G+  GKG +GIP S  LK+  L  +F   CK+ 
Sbjct  707   CAPGIGEFMCCGWLVLCFFPFVRGIVWGKGSYGIPWSVKLKASLLVAMFVTFCKTT  762



>ref|XP_008455453.1| PREDICTED: cellulose synthase-like protein B4 [Cucumis melo]
Length=742

 Score =   403 bits (1036),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 224/470 (48%), Positives = 306/470 (65%), Gaps = 22/470 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPF++N+DCD +VN+P VV+ AMC LLG  +E+++ FVQFPQ FY   KDDP+
Sbjct  273   VSGVMTNAPFIVNIDCDMYVNNPNVVVEAMCILLGA-EEQESIFVQFPQIFYNLPKDDPF  331

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             G Q+  + + L RG AGIQGP + G  CFHRRK IY +     ++++  T K + E FG+
Sbjct  332   GCQLITLFQTLLRGMAGIQGPLFGGCNCFHRRKTIYTL-----NSSQNKTGKIE-ENFGE  385

Query  362   SKTFALSTTQILSGSLY---PEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             S+    S  +IL G  +   P+      S+++A +VAS  YE  TAWG KVG LYGS  E
Sbjct  386   SEELTKSANEILRGVQFNGPPQTINLSTSIQSAYQVASADYENNTAWGLKVGWLYGSMTE  445

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  TG+ IH KGWKSV   PNPP FLG +PTGGP ALTQ+KRW T +L+IL+CK SP++ 
Sbjct  446   DILTGIKIHSKGWKSVLLQPNPPAFLGLAPTGGPDALTQRKRWVTGSLEILVCKTSPLLA  505

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP-ASI  889
                 RL  RQCLAY + +   +    E+ Y +LPAY I+ NSHF P + + A++     I
Sbjct  506   FFLTRLTLRQCLAYTYFLTRSLYAIPELVYVILPAYAILTNSHFLPSVQDTALLATFVPI  565

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             FI+Y+   +  Y++ G S+RAWWNN +M  +  + S++FG LS V+K+FG+SEAVFEVT 
Sbjct  566   FILYHSLSVCVYLQCGLSVRAWWNNVKMEMISTTSSYVFGILSLVLKLFGISEAVFEVTP  625

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAAL------FIGFLDFKQN--  1225
             K  S++   DK+DD  VG+F F+ESPLF+ GT ++L++L AL       +G L    +  
Sbjct  626   KGQSNN-VDDKEDDRNVGKFVFNESPLFIIGTAVVLLHLMALASSLLVTVGILQPPSSSD  684

Query  1226  --KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
               +   +GE +  VWV++    FL+GLF KGK+GIP  T+ KS  L LLF
Sbjct  685   GRRGSGIGEILGCVWVLMALSPFLRGLFAKGKYGIPFPTICKSASLILLF  734



>ref|NP_001052811.2| Os04g0429500 [Oryza sativa Japonica Group]
 sp|Q7XUT9.3|CSLH2_ORYSJ RecName: Full=Cellulose synthase-like protein H2; AltName: Full=OsCslH2 
[Oryza sativa Japonica Group]
 emb|CAD41009.3| OSJNBa0042L16.13 [Oryza sativa Japonica Group]
 dbj|BAF14725.2| Os04g0429500 [Oryza sativa Japonica Group]
Length=762

 Score =   401 bits (1030),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 220/474 (46%), Positives = 290/474 (61%), Gaps = 14/474 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP MLN+DCD  VN+P+ VLHAMC LLG  DE  + FVQ PQ FY  LKDDP+
Sbjct  288   VSAVMTNAPIMLNMDCDMFVNNPQAVLHAMCLLLGFDDEASSGFVQAPQRFYDALKDDPF  347

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHV-----VDNNEKSTDKDQW  346
             GNQM+   K    G  G+QG FY GTGCFHRRK +YG+ P+       D    S+ K+  
Sbjct  348   GNQMECFFKRFISGVQGVQGAFYAGTGCFHRRKAVYGVPPNFNGAEREDTIGSSSYKELH  407

Query  347   ETFGKSKTFALSTTQIL-SGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
               FG S+    S   I+   S  P + I  + +E AK V++C Y+ GT WGQ+VG +YGS
Sbjct  408   TRFGNSEELNESARNIIWDLSSKPMVDI-SSRIEVAKAVSACNYDIGTCWGQEVGWVYGS  466

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG  IH  GW+SV     PP F+GS+P GGPA LTQ KRW T   +I+I + +P
Sbjct  467   LTEDILTGQRIHAMGWRSVLMVTEPPAFMGSAPIGGPACLTQFKRWATGQSEIIISRNNP  526

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             I+  +F RL FRQCLAYL ++GWP+R  FE+CY LL  YCI+ N  F PK +E    +P 
Sbjct  527   ILATMFKRLKFRQCLAYLIVLGWPLRAPFELCYGLLGPYCILTNQSFLPKASEDGFSVPL  586

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             ++FI YN Y   EY+  G S RAWWNN RM R+ +  +W   FL+ ++K  GLSE VFEV
Sbjct  587   ALFISYNTYNFMEYMACGLSARAWWNNHRMQRIISVSAWTLAFLTVLLKSLGLSETVFEV  646

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW---  1234
             T KD S  +  D  D +  GRFTFD  P+F+P T + ++N+ A+ +G        +    
Sbjct  647   TGKDKSMSDDDDNTDGADPGRFTFDSLPVFIPVTALAMLNIVAVTVGACRVAFGTAEGVP  706

Query  1235  ---SLGEAICSVWVILMYWAflkglf-gkgkfgIPLSTVLKSGGLALLFFHACK  1384
                 +GE +C  W++L ++ F++G+  GKG +GIP S  LK+  L  +F   CK
Sbjct  707   CAPGIGEFMCCGWLVLCFFPFVRGIVWGKGSYGIPWSVKLKASLLVAMFVTFCK  760



>sp|Q7PC71.1|CSLH2_ORYSI RecName: Full=Cellulose synthase-like protein H2; AltName: Full=OsCslH2 
[Oryza sativa Indica Group]
 tpg|DAA01748.1| TPA_exp: cellulose synthase-like H2 [Oryza sativa (indica cultivar-group)]
Length=762

 Score =   401 bits (1030),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 220/474 (46%), Positives = 290/474 (61%), Gaps = 14/474 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP MLN+DCD  VN+P+ VLHAMC LLG  DE  + FVQ PQ FY  LKDDP+
Sbjct  288   VSAVMTNAPIMLNMDCDMFVNNPQAVLHAMCLLLGFDDEASSGFVQAPQRFYDALKDDPF  347

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHV-----VDNNEKSTDKDQW  346
             GNQM+   K    G  G+QG FY GTGCFHRRK +YG+ P+       D    S+ K+  
Sbjct  348   GNQMECFFKRFISGVQGVQGAFYAGTGCFHRRKAVYGVPPNFNGAEREDTIGSSSYKELH  407

Query  347   ETFGKSKTFALSTTQIL-SGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
               FG S+    S   I+   S  P + I  + +E AK V++C Y+ GT WGQ+VG +YGS
Sbjct  408   TRFGNSEELNESARNIIWDLSSKPMVDI-SSRIEVAKAVSACNYDIGTCWGQEVGWVYGS  466

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG  IH  GW+SV     PP F+GS+P GGPA LTQ KRW T   +I+I + +P
Sbjct  467   LTEDILTGQRIHAMGWRSVLMVTEPPAFMGSAPIGGPACLTQFKRWATGQSEIIISRNNP  526

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             I+  +F RL FRQCLAYL ++GWP+R  FE+CY LL  YCI+ N  F PK +E    +P 
Sbjct  527   ILATMFKRLKFRQCLAYLIVLGWPLRAPFELCYGLLGPYCILTNQSFLPKASEDGFSVPL  586

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             ++FI YN Y   EY+  G S RAWWNN RM R+ +  +W   FL+ ++K  GLSE VFEV
Sbjct  587   ALFISYNTYNFMEYMACGLSARAWWNNHRMQRIISVSAWTLAFLTVLLKSLGLSETVFEV  646

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW---  1234
             T KD S  +  D  D +  GRFTFD  P+F+P T + ++N+ A+ +G        +    
Sbjct  647   TGKDKSMSDDDDNTDGADPGRFTFDSLPVFIPVTALAMLNIVAVTVGACRVAFGTAEGVP  706

Query  1235  ---SLGEAICSVWVILMYWAflkglf-gkgkfgIPLSTVLKSGGLALLFFHACK  1384
                 +GE +C  W++L ++ F++G+  GKG +GIP S  LK+  L  +F   CK
Sbjct  707   CAPGIGEFMCCGWLVLCFFPFVRGIVWGKGSYGIPWSVKLKASLLVAMFVTFCK  760



>emb|CAH66410.1| OSIGBa0093L02.6 [Oryza sativa Indica Group]
Length=798

 Score =   401 bits (1031),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 221/474 (47%), Positives = 290/474 (61%), Gaps = 14/474 (3%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP MLN+DCD   N+P+ VLHAMC LLG  DE  + FVQ PQ FY  LKDDP+
Sbjct  324   VSAVMTNAPIMLNMDCDMFANNPQAVLHAMCLLLGFDDEASSGFVQAPQRFYDALKDDPF  383

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHV-----VDNNEKSTDKDQW  346
             GNQM+   K    G  G+QG FY GTGCFHRRK +YG+ P+       D    S+ K+  
Sbjct  384   GNQMECFFKRFISGVQGVQGAFYAGTGCFHRRKAVYGVPPNFNGAEREDTIGSSSYKELH  443

Query  347   ETFGKSKTFALSTTQIL-SGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
               FG S+    S   I+   S  P + I  + +E AK V++C Y+ GT WGQ+VG +YGS
Sbjct  444   TRFGNSEELNESARNIIWDLSSKPMVDI-SSRIEVAKAVSACNYDIGTCWGQEVGWVYGS  502

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG  IH  GW+SV     PP F+GS+P GGPA LTQ KRW T   +I+I + +P
Sbjct  503   LTEDILTGQRIHAMGWRSVLMVTEPPAFMGSAPIGGPACLTQFKRWATGQSEIIISRNNP  562

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             I+  +F RL FRQCLAYL ++GWP+R  FE+CY LL  YCI+ N  F PK +E    IP 
Sbjct  563   ILATMFKRLKFRQCLAYLIVLGWPLRAPFELCYGLLGPYCILTNQSFLPKASEDGFNIPL  622

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             ++FI YN Y   EY+  G S RAWWNN RM R+ +  +W   FL+ ++K  GLSE VFEV
Sbjct  623   ALFISYNTYNFMEYMVCGLSARAWWNNHRMQRIISVSAWTLAFLTVLLKSLGLSETVFEV  682

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW---  1234
             T KD S  +  D  D +  GRFTFD SP+F+P T + ++N+ A+ +G        +    
Sbjct  683   TGKDKSMSDDDDNTDGADPGRFTFDSSPVFIPVTALAMLNIVAVTVGACRVAFGTAEGVP  742

Query  1235  ---SLGEAICSVWVILMYWAflkglf-gkgkfgIPLSTVLKSGGLALLFFHACK  1384
                 +GE +C  W++L ++ F++G+  GKG +GIP S  LK+  L  +F   CK
Sbjct  743   CAPGIGEFMCCGWLVLCFFPFVRGIVWGKGSYGIPWSVKLKASLLVAMFVTFCK  796



>ref|XP_006847115.1| hypothetical protein AMTR_s00017p00225060 [Amborella trichopoda]
 gb|ERN08696.1| hypothetical protein AMTR_s00017p00225060 [Amborella trichopoda]
Length=763

 Score =   399 bits (1024),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 228/480 (48%), Positives = 299/480 (62%), Gaps = 23/480 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPF +N+DCD  VN+P+    A+C L G + E+DA FVQFPQ FYGGLKDDP+
Sbjct  289   VSGVMTNAPFTMNVDCDMFVNNPRCFYEALCLLFGFESERDAGFVQFPQVFYGGLKDDPF  348

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNE-------KSTDKD  340
             GNQ+K++   L RG AG+QG  Y GTGCFHRRK IYG  P  + N +         +D+ 
Sbjct  349   GNQLKVLYHTLGRGFAGLQGMLYSGTGCFHRRKAIYGAQPPELPNGKGQLTKYMNGSDEA  408

Query  341   QWET----FGKSKTFALSTTQILS--GSLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQ  499
             + E     FG S+ F  S   ILS  G L    P+   ++LEAA EVA C YE  T WG 
Sbjct  409   KMEELESIFGHSEEFLKSVVCILSEDGYLGSYNPVSLASTLEAAHEVARCTYENHTQWGD  468

Query  500   KVGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALD  679
             KVGL+YGS  ED  +G+ +H  GWKS  C P PPGFLG +P+ GP +LTQ KRW T  L+
Sbjct  469   KVGLVYGSTTEDVLSGLRLHSMGWKSASCTPEPPGFLGCAPSSGPESLTQSKRWATGILE  528

Query  680   ILICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLN  859
             +L+   SP++  +  +L FRQC AY+ I  W +    E+CY+ LPA CI+    F PK+ 
Sbjct  529   VLVGSHSPLLAVVTKKLQFRQCWAYITITVWALCSLPELCYATLPAICILTGRSFLPKVT  588

Query  860   EAAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFG  1039
             ++  + P S+FI++NLY + EY +   SLR WWNNQRM R+  + +WLFG    ++K+  
Sbjct  589   QSDALFPISLFILFNLYSIIEYWQIKLSLREWWNNQRMARINCTSAWLFGLFDVILKLLH  648

Query  1040  LSEAVFEVTKKD---HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
             LSE VF VT KD    S DEA D+      GR TFD S LF+P TT+LL+NLAAL  G  
Sbjct  649   LSETVFVVTPKDDHGSSGDEAKDR------GRLTFDSSLLFLPPTTLLLLNLAALGAGIP  702

Query  1211  DFKQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSV  1390
                      +GE +CS WV+  ++ F KGL  KG++G+P ST+ KSG +A    H C+ +
Sbjct  703   MLTSGDISLVGEMVCSAWVVASFFPFAKGLVRKGRYGLPWSTIFKSGVIASFIVHVCRYI  762



>ref|XP_007149984.1| hypothetical protein PHAVU_005G116200g [Phaseolus vulgaris]
 gb|ESW21978.1| hypothetical protein PHAVU_005G116200g [Phaseolus vulgaris]
Length=743

 Score =   397 bits (1021),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 210/468 (45%), Positives = 300/468 (64%), Gaps = 11/468 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD  VN+PK+VLHA+C L+  K  K+  FVQ  Q FY G+KDDP+
Sbjct  279   VSGLMTNAPFMLNVDCDMVVNNPKIVLHALCILMDSKSGKEVAFVQCFQQFYDGIKDDPF  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQ---WET  352
             GNQ     +Y+ RG  G+QGP Y GT  FHRR VIYG++P  ++   K    ++    + 
Sbjct  339   GNQWVTAFEYIIRGMTGLQGPHYSGTNAFHRRNVIYGLYPDEIEIGRKGKLGEKILLMQK  398

Query  353   FGKSKTFALSTTQILS-GSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
              G SK F  S  Q L   + +P      + +EAA +VA C YE GT WGQ+VG +YGS  
Sbjct  399   LGSSKEFVKSADQALDWKTNFPNDTNLSDFIEAAIQVAGCEYECGTCWGQEVGWVYGSIT  458

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG++IH +GW+S  C P+P  F G +P G    + QQKRW +    +   K S ++
Sbjct  459   EDVPTGLNIHRRGWRSESCTPDPIAFTGCAPRGLLTTMIQQKRWASGLTVVFFGKHSSLV  518

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
               LFG++ FR  ++Y W+  W +R  F +CY  + AYC+I N+   P+     + I  S+
Sbjct  519   GMLFGKIQFRTGVSYFWLTNWGLRAAFLVCYVAVIAYCMIANTSIFPQ--GLGLWIAISL  576

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+IYN++ L E++  G S+  WWN+QRM  +  +  W  GFLS ++K+ G+S+ VFE+T+
Sbjct  577   FVIYNIHTLLEHLTLGLSITYWWNSQRMCVMRTTTVWFIGFLSAMLKLSGISDTVFEITE  636

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS---L  1240
             K+H++ +A   + D+  GRFTFDESP+FV GTTILLV+LA + I  L  + + S +   +
Sbjct  637   KEHTTSDADGNNADA--GRFTFDESPVFVVGTTILLVHLAGMVIKLLGLQPSDSGNGSGI  694

Query  1241  GEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
             GE ICS ++I+ Y+ +LKGLFG+GK+GIPL+T+ KS  LA +F H C+
Sbjct  695   GEFICSTYLIVCYFPYLKGLFGRGKYGIPLTTIYKSAILAFIFVHFCR  742



>ref|XP_004975624.1| PREDICTED: cellulose synthase-like protein H1-like isoform X3 
[Setaria italica]
Length=811

 Score =   399 bits (1025),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 217/510 (43%), Positives = 296/510 (58%), Gaps = 50/510 (10%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS V+TNAP MLN+DCD   N+P+V LHAMC LLG  DE  + FVQ PQ FYG LKDDP+
Sbjct  299   VSAVVTNAPIMLNMDCDMFANNPQVALHAMCLLLGFDDELQSGFVQAPQKFYGTLKDDPF  358

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS------TDKDQ  343
             GNQM+++ + +  G AG+QG FY GTGCFHRRKVIYG+ P    + + +      + K+ 
Sbjct  359   GNQMEVLFEKIGFGIAGLQGMFYGGTGCFHRRKVIYGVPPESTADVQPTRMRGSPSYKEL  418

Query  344   WETFGKSKTFALSTTQILSGSLYPEIPI--FPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
              + FG S+    S    +SG L+   P+    + ++ AKEV++C YE GT WGQ+VG +Y
Sbjct  419   QKMFGSSRELIESARSAISGELFAAAPMVDLASRIDVAKEVSACSYEAGTCWGQEVGWVY  478

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GS  ED  TG  IH  GW+S +   +PP FLG +PTGGPA+LTQ KRW T  L+I++ + 
Sbjct  479   GSMTEDILTGQRIHAAGWRSAFLTTDPPAFLGGAPTGGPASLTQYKRWATGLLEIILSRN  538

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKL-------  856
             +PI+      L FRQCLAYL    WP+R  FE+CY+LL  YC++ N  F PK+       
Sbjct  539   NPILACTSKHLEFRQCLAYLVFYVWPVRAPFELCYALLGPYCLLANKSFLPKVTFCHQFI  598

Query  857   ------------------------NEAAIVIPASIFIIYNLYGLFEYIETGESLRAWWNN  964
                                     +E   VIP ++F+  N++ + EY+E  +S RAWWNN
Sbjct  599   IYSSVTSFFSHCSCELSCFSFLQASEPWFVIPLALFLTQNVHSVAEYMECRQSARAWWNN  658

Query  965   QRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDEALDKDDDSKVGRFTFDES  1144
              RM R+ +S +WL  FL+ V+K  GLSE VFEVT+K+            +  GRFTFD S
Sbjct  659   HRMQRIVSSSAWLLAFLTVVLKTMGLSETVFEVTRKEQGGAADGGDAAGADPGRFTFDSS  718

Query  1145  PLFVPGTTILLVNLAALFIG-----------FLDFKQNKSWSLGEAICSVWVILMYWAfl  1291
             P+FVP T + ++ L A+ +G                      +GE +C  W+ L +W F+
Sbjct  719   PVFVPPTALTILTLVAIAVGAWRVVAGAAAAGGVPPAGGGPGVGEFVCCGWLALCFWPFV  778

Query  1292  kglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
             +GL GKG +GIP S  +K+  L   F H C
Sbjct  779   RGLAGKGSYGIPWSVKIKAVLLVAAFVHFC  808



>ref|XP_004975622.1| PREDICTED: cellulose synthase-like protein H1-like isoform X1 
[Setaria italica]
Length=844

 Score =   400 bits (1027),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 217/510 (43%), Positives = 296/510 (58%), Gaps = 50/510 (10%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS V+TNAP MLN+DCD   N+P+V LHAMC LLG  DE  + FVQ PQ FYG LKDDP+
Sbjct  332   VSAVVTNAPIMLNMDCDMFANNPQVALHAMCLLLGFDDELQSGFVQAPQKFYGTLKDDPF  391

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS------TDKDQ  343
             GNQM+++ + +  G AG+QG FY GTGCFHRRKVIYG+ P    + + +      + K+ 
Sbjct  392   GNQMEVLFEKIGFGIAGLQGMFYGGTGCFHRRKVIYGVPPESTADVQPTRMRGSPSYKEL  451

Query  344   WETFGKSKTFALSTTQILSGSLYPEIPI--FPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
              + FG S+    S    +SG L+   P+    + ++ AKEV++C YE GT WGQ+VG +Y
Sbjct  452   QKMFGSSRELIESARSAISGELFAAAPMVDLASRIDVAKEVSACSYEAGTCWGQEVGWVY  511

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GS  ED  TG  IH  GW+S +   +PP FLG +PTGGPA+LTQ KRW T  L+I++ + 
Sbjct  512   GSMTEDILTGQRIHAAGWRSAFLTTDPPAFLGGAPTGGPASLTQYKRWATGLLEIILSRN  571

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKL-------  856
             +PI+      L FRQCLAYL    WP+R  FE+CY+LL  YC++ N  F PK+       
Sbjct  572   NPILACTSKHLEFRQCLAYLVFYVWPVRAPFELCYALLGPYCLLANKSFLPKVTFCHQFI  631

Query  857   ------------------------NEAAIVIPASIFIIYNLYGLFEYIETGESLRAWWNN  964
                                     +E   VIP ++F+  N++ + EY+E  +S RAWWNN
Sbjct  632   IYSSVTSFFSHCSCELSCFSFLQASEPWFVIPLALFLTQNVHSVAEYMECRQSARAWWNN  691

Query  965   QRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDEALDKDDDSKVGRFTFDES  1144
              RM R+ +S +WL  FL+ V+K  GLSE VFEVT+K+            +  GRFTFD S
Sbjct  692   HRMQRIVSSSAWLLAFLTVVLKTMGLSETVFEVTRKEQGGAADGGDAAGADPGRFTFDSS  751

Query  1145  PLFVPGTTILLVNLAALFIG-----------FLDFKQNKSWSLGEAICSVWVILMYWAfl  1291
             P+FVP T + ++ L A+ +G                      +GE +C  W+ L +W F+
Sbjct  752   PVFVPPTALTILTLVAIAVGAWRVVAGAAAAGGVPPAGGGPGVGEFVCCGWLALCFWPFV  811

Query  1292  kglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
             +GL GKG +GIP S  +K+  L   F H C
Sbjct  812   RGLAGKGSYGIPWSVKIKAVLLVAAFVHFC  841



>ref|XP_006653401.1| PREDICTED: putative cellulose synthase-like protein H3-like [Oryza 
brachyantha]
Length=769

 Score =   396 bits (1018),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 223/481 (46%), Positives = 297/481 (62%), Gaps = 21/481 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP  LN+DCD   N+P+VVLHAMC LLG  DE  + FVQ P+  YG LKDDP+
Sbjct  288   VSAVMTNAPITLNVDCDMFANNPQVVLHAMCVLLGFDDEIYSGFVQAPRKLYGTLKDDPF  347

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH--VVDNNEKSTD----KDQ  343
             G Q ++I K L  G AGI   FY G+GCFHRRK IYG  P+  +    E +TD    K+ 
Sbjct  348   GTQQEVIYKTLGSGMAGIWCTFYNGSGCFHRRKAIYGATPNSSIGARREGTTDSLPPKEF  407

Query  344   WETFGKSKTFALSTTQILSGSLYPEIPIFPNS--LEAAKEVASCVYEFGTAWGQKVGLLY  517
                FG S+    S T ILSG+L P  PI   S  +EAAKEVA+C YE GT WG++VG +Y
Sbjct  408   ENKFGSSEELKESITSILSGNL-PVEPIVDISCRVEAAKEVATCKYESGTRWGREVGWVY  466

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GS  ED  TG  IH  GW+SV  +  PP F+ ++P GGPA LTQ KRW T   +I+I + 
Sbjct  467   GSMTEDILTGQRIHAAGWRSVLLETEPPAFMCAAPIGGPACLTQFKRWATGLFEIIISRN  526

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             +PI+  +F RL  RQCL+YL I  WP+R F E+CY+LLP YCI+ N  F PK  +    I
Sbjct  527   NPILMTVFRRLRLRQCLSYLSIYAWPVRGFIELCYALLPPYCILTNQSFLPKAPQDVFGI  586

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
             P ++F+ YN Y   EY + G S+ AWWNN +M R+ ++ +WL GFL+ ++K  GLSEAVF
Sbjct  587   PLALFLTYNTYSYMEYKKCGLSVHAWWNNHKMQRITSASAWLLGFLTVLLKTVGLSEAVF  646

Query  1058  EVTKKDHSSD--------EALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGF--  1207
             EVT K+  +         +  D   D  +GRFTFD SP+F+P T + ++N+ A+  G   
Sbjct  647   EVTPKEKITSDGNGGGNDDDDDDKVDLDLGRFTFDASPVFIPVTALAMLNILAVAAGAWR  706

Query  1208  --LDFKQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
                   Q+    + E +   W++L +  F++GL GKG++GIP S  LK+  L  +F   C
Sbjct  707   ACFGTAQDDLPGVSEFMACGWMLLCFLPFVRGLVGKGRYGIPWSVKLKASLLVAMFVLLC  766

Query  1382  K  1384
             +
Sbjct  767   R  767



>ref|XP_006846949.1| hypothetical protein AMTR_s00017p00025710 [Amborella trichopoda]
 gb|ERN08530.1| hypothetical protein AMTR_s00017p00025710 [Amborella trichopoda]
Length=683

 Score =   393 bits (1009),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 206/472 (44%), Positives = 284/472 (60%), Gaps = 19/472 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP ++N+DCD  VN+P     AMC LLG K E+++ FVQFPQ FYGGLKDDP+
Sbjct  217   VSAVMTNAPIIMNVDCDMFVNNPTCFYEAMCLLLGFKSERESAFVQFPQVFYGGLKDDPF  276

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGM--------WPHVVDNNEKSTDK  337
             GNQ+K++   +  G + IQGP Y GTGCFHRRK IYG         +    + + ++  +
Sbjct  277   GNQLKVLFSVVLAGISAIQGPCYAGTGCFHRRKTIYGFPAEDSKGNFLEFFNGSNEANME  336

Query  338   DQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
             +    FG  K    S   I        +  F +++EAA  VA C YE  T WG +VG +Y
Sbjct  337   ELINRFGHCKELLRSILSIHLNKAGDTLS-FESAVEAAHIVAGCKYENNTYWGDQVGWVY  395

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
             GS+ ED    + +   GW+SVYC P PP FLG +P+ GP  L QQ+RW    L++ + + 
Sbjct  396   GSSTEDLLLSLKLFSTGWRSVYCTPQPPAFLGCAPSSGPETLLQQRRWAAGQLELFVGRH  455

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             SP++  +  +L  RQCLA+L I  W +RP  EI YS+LPA  ++ N+HF PK  E  ++I
Sbjct  456   SPLLSTITKKLEIRQCLAFLSI--WALRPIPEIFYSILPALSLLTNTHFMPKFPEPIVLI  513

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
             P S+F+++N +GL EY     S R WWNNQRM R+  +  WLFGF    +K+ GLS+ VF
Sbjct  514   PISLFVLFNFFGLMEYWRCNLSTREWWNNQRMARINCASGWLFGFFDVTLKLLGLSDIVF  573

Query  1058  EVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS  1237
              VT KD       ++D+D    +FTF+   +F+P TT+L +NL  L I      +     
Sbjct  574   FVTPKD-------ERDNDPNADKFTFNSDVMFIPPTTLLFLNLVGLVIIAPKLARGDFNM  626

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSVH  1393
             L E +CS WV+  +  FLKGL  KG++G+P S + KSG LAL+F + CK VH
Sbjct  627   LLEVLCSAWVVSCFNPFLKGLVRKGRYGLPWSIICKSGALALMFIYICK-VH  677



>gb|EEC77288.1| hypothetical protein OsI_15925 [Oryza sativa Indica Group]
 gb|EEE61015.1| hypothetical protein OsJ_14838 [Oryza sativa Japonica Group]
Length=554

 Score =   388 bits (996),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 193/407 (47%), Positives = 256/407 (63%), Gaps = 16/407 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP MLN+DCD   NDP+VVLHAMC LLG  DE  + FVQ PQ+FYG LKDDP+
Sbjct  90    VSAVMTNAPIMLNVDCDMFANDPQVVLHAMCLLLGFDDEISSGFVQVPQSFYGDLKDDPF  149

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP-HVVDNNEKSTDKDQWE---  349
             GN++++I K          G FY GTGCFH RK IYG+ P  +V   E +     ++   
Sbjct  150   GNKLEVIYK----------GLFYGGTGCFHCRKAIYGIEPDSIVVGREGAAGSPSYKELQ  199

Query  350   -TFGKSKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
               F  S+    S   I+SG +  E I    + +E AKEV+SC YE GT WG +VG  YGS
Sbjct  200   FKFESSEELKESARYIISGDMSGEPIVDISSHIEVAKEVSSCNYESGTHWGLEVGWAYGS  259

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG  IH  GW+S   +  PP FLG +PTGGPA LTQ KRW T   +ILI + +P
Sbjct  260   MTEDILTGQRIHAAGWRSAKLETEPPAFLGCAPTGGPACLTQFKRWATGLFEILISQNNP  319

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             ++ ++F  L FRQCLAYL +  W +R F E+CY LL  YC++ N  F  K +E    I  
Sbjct  320   LLLSIFKHLQFRQCLAYLTLYVWAVRGFVELCYELLVPYCLLTNQSFLSKASENCFNITL  379

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             ++F+ YN Y   EY+E G S+RAWWNN RM R+ ++ +WL  F + ++K  GLSE VFEV
Sbjct  380   ALFLTYNTYNFVEYMECGLSVRAWWNNHRMQRIISASAWLLAFFTVLLKTIGLSETVFEV  439

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIG  1204
             T+K+ S+ +   ++D+    RFTFD SP+F+P T + ++N+ A+ IG
Sbjct  440   TRKEKSTSDGNGQNDEVDPERFTFDASPVFIPVTALTMLNIVAITIG  486



>ref|XP_008455909.1| PREDICTED: cellulose synthase-like protein H2 isoform X1 [Cucumis 
melo]
Length=448

 Score =   379 bits (973),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 209/436 (48%), Positives = 283/436 (65%), Gaps = 15/436 (3%)
 Frame = +2

Query  62    NDPKVVLHAMCFLLGVKDE-KDAEFVQFPQNFYGGLKDDPYGNQMKIIMKYLFRGTAGIQ  238
             N+P+VVLHAMC  L  KD+ +D  +VQ PQ FY GLKDDP+GNQ+ ++ +Y  RG  G+Q
Sbjct  4     NNPQVVLHAMCVFLNSKDDLEDIGYVQTPQCFYDGLKDDPFGNQLVVVFQYYSRGVMGLQ  63

Query  239   GPFYMGTGCFHRRKVIYGMWPHVVDN--NEKSTDKDQWETFGKSKTFALSTTQILSGSLY  412
             GP Y GTGCFHRR V+YG +PH   +  N K+++++  + FG SK FA S       + +
Sbjct  64    GPLYNGTGCFHRRNVLYGQFPHHTTHFMNGKASEQELMKLFGYSKCFAKSAIYAFEETTH  123

Query  413   PEIP--IFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTKTGVSIHGKGWKSVYC  586
                P  +F ++LEAAK+VA C YE  T WG K+G +YGS  ED  TG+ I  +GW+S+Y 
Sbjct  124   GYHPNGLFNDNLEAAKQVAGCGYEINTTWGSKIGWIYGSTTEDILTGLVIQTRGWRSIYV  183

Query  587   DPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRLHFRQCLAYLWIM  766
               NPP FLG + +   A+LTQQKRW +  L+IL  K  P+   LFG+L ++QC AYLW++
Sbjct  184   VLNPPAFLGCAASQLVASLTQQKRWVSGLLEILFSKHFPVFGTLFGKLQWKQCAAYLWLL  243

Query  767   GWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLYGLFEYIETGESL  946
              W +R   E+ Y+LLP YC+I NS F P + E +I IP  +FIIYN   L  Y ETG+S+
Sbjct  244   TWGLRSIPELSYALLPPYCLITNSSFFPNMEERSISIPIFLFIIYNFQQLLLYKETGQSI  303

Query  947   RAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDEALDKDDDSKVGR  1126
             RAWWNNQRM RV    +WLFG  + V+K  G+ E VFEVTKK+   +  L        G 
Sbjct  304   RAWWNNQRMGRVNTMCAWLFGLGNVVLKFLGVREVVFEVTKKETYCEADL--------GH  355

Query  1127  FTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWSLGEAICSVWVILMYWAflkglfg  1306
             F FDES +FVP T++LL+ L AL + F+        ++ E ICSVW++L +W FLKG+F 
Sbjct  356   FMFDESAMFVPATSLLLLQLIALLMSFIRQAGRMRNTVLEVICSVWLVLCFWPFLKGIFV  415

Query  1307  --kgkfgIPLSTVLKS  1348
               KG++G+P ST+ KS
Sbjct  416   FGKGRYGLPFSTIYKS  431



>ref|NP_001052812.2| Os04g0429600 [Oryza sativa Japonica Group]
 sp|Q7XUU0.3|CSLH3_ORYSJ RecName: Full=Putative cellulose synthase-like protein H3; AltName: 
Full=OsCslH3 [Oryza sativa Japonica Group]
 emb|CAD41008.3| OSJNBa0042L16.14 [Oryza sativa Japonica Group]
 dbj|BAF14726.2| Os04g0429600 [Oryza sativa Japonica Group]
Length=792

 Score =   387 bits (994),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 193/407 (47%), Positives = 256/407 (63%), Gaps = 16/407 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS VMTNAP MLN+DCD   NDP+VVLHAMC LLG  DE  + FVQ PQ+FYG LKDDP+
Sbjct  328   VSAVMTNAPIMLNVDCDMFANDPQVVLHAMCLLLGFDDEISSGFVQVPQSFYGDLKDDPF  387

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP-HVVDNNEKSTDKDQWE---  349
             GN++++I K          G FY GTGCFH RK IYG+ P  +V   E +     ++   
Sbjct  388   GNKLEVIYK----------GLFYGGTGCFHCRKAIYGIEPDSIVVGREGAAGSPSYKELQ  437

Query  350   -TFGKSKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
               F  S+    S   I+SG +  E I    + +E AKEV+SC YE GT WG +VG  YGS
Sbjct  438   FKFESSEELKESARYIISGDMSGEPIVDISSHIEVAKEVSSCNYESGTHWGLEVGWAYGS  497

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  TG  IH  GW+S   +  PP FLG +PTGGPA LTQ KRW T   +ILI + +P
Sbjct  498   MTEDILTGQRIHAAGWRSAKLETEPPAFLGCAPTGGPACLTQFKRWATGLFEILISQNNP  557

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             ++ ++F  L FRQCLAYL +  W +R F E+CY LL  YC++ N  F  K +E    I  
Sbjct  558   LLLSIFKHLQFRQCLAYLTLYVWAVRGFVELCYELLVPYCLLTNQSFLSKASENCFNITL  617

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             ++F+ YN Y   EY+E G S+RAWWNN RM R+ ++ +WL  F + ++K  GLSE VFEV
Sbjct  618   ALFLTYNTYNFVEYMECGLSVRAWWNNHRMQRIISASAWLLAFFTVLLKTIGLSETVFEV  677

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIG  1204
             T+K+ S+ +   ++D+    RFTFD SP+F+P T + ++N+ A+ IG
Sbjct  678   TRKEKSTSDGNGQNDEVDPERFTFDASPVFIPVTALTMLNIVAITIG  724



>gb|KDO54722.1| hypothetical protein CISIN_1g006639mg [Citrus sinensis]
Length=417

 Score =   375 bits (962),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 177/363 (49%), Positives = 235/363 (65%), Gaps = 6/363 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD + N+P++VL AMC  LG K+E +  F+Q PQ FY    D P 
Sbjct  59    VSGLMTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFY----DRP-  113

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
                + I+ +Y+ +G  GIQGPFY GTG FHRR V+YG+    +++     + +  + FG 
Sbjct  114   -ENLCILNEYIGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGN  172

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             SK F  S  Q L G           SL+ A  VA C YE+G++WG +VG LYG+  ED  
Sbjct  173   SKEFIKSAAQTLEGKTGGYSSNISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNL  232

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGW+S YC P P  FLG +   GPA + QQKRW T  L+IL  K++PI+  L 
Sbjct  233   TGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLI  292

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
             G+L FRQCLAYLWI+ W +R   E+CY  LPAYCII NS F PK+ E  ++IP ++F+IY
Sbjct  293   GKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIY  352

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
              LY L EYI+ G S+R+WW N  M R+  + +WLFG ++  ++ FG SEAVFE+T+K H 
Sbjct  353   KLYTLLEYIQAGLSIRSWWVNNCMARIVTTSAWLFGLVNAALEQFGFSEAVFEITQKIHR  412

Query  1082  SDE  1090
             S  
Sbjct  413   SQR  415



>gb|KGN43505.1| hypothetical protein Csa_7G041990 [Cucumis sativus]
Length=662

 Score =   382 bits (980),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 221/471 (47%), Positives = 296/471 (63%), Gaps = 23/471 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPF++N+DCD +VN+P VV+ AMC L+G   EK++ F QFPQ FY   KDDP+
Sbjct  192   VSGVMTNAPFIVNIDCDMYVNNPNVVVDAMCILVGAT-EKESVFAQFPQVFYNQPKDDPF  250

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             G QM  + + L RG AGIQGP Y G  CFHRRK IY +     ++++  T K + E FG+
Sbjct  251   GCQMITLFQMLLRGMAGIQGPLYSGCNCFHRRKTIYTL-----NSSQNKTGKIE-ENFGE  304

Query  362   SKTFALSTTQILSG--SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGED  535
             S+    +T +IL G  S          S+++A +VAS  YE  TAWG KVG LYGS  ED
Sbjct  305   SEELTKATDEILRGVKSSTDHTTNLSTSIQSAYQVASANYENNTAWGLKVGWLYGSMTED  364

Query  536   TKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWA  715
                G+ IH KGWKSV   PNPP F+G +  GG   L Q+KRW T  L+ILI K +P++  
Sbjct  365   ILMGIKIHSKGWKSVLVLPNPPAFMGLASMGGSETLIQRKRWVTGILEILISKNNPLLTF  424

Query  716   LFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIV-IPASIF  892
              F  L FRQ LAY + +   +    E+ Y++LPAY I+ NSHF P + + A++ I    F
Sbjct  425   FFTHLKFRQSLAYTYFLTRSLFAIPELTYAILPAYAILTNSHFLPSVQDTALLAIFVPTF  484

Query  893   IIYNLYG-LFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             I+Y+ +  +FEY++ G SL AWWN  RM  + ++ S+ FG LS V+K+FG+SEAVFEVT 
Sbjct  485   ILYHSHSIIFEYLQWGLSLHAWWNKVRMEMILSTSSYAFGILSLVLKLFGISEAVFEVTP  544

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTIL-----------LVNLAALFIGFLDF  1216
             KD S  +A + +    VGRFTFDESPLFV GTT++            V +  L +   + 
Sbjct  545   KDQSDADATNANHHD-VGRFTFDESPLFVLGTTLVLLNLMALLFAAFVGMQPLILSVPND  603

Query  1217  KQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
              +++ + +GE +  VWV+L    FLKGLF KGK+GIP ST+ KS  L LLF
Sbjct  604   GRHRGFGIGEILGCVWVLLTLLPFLKGLFAKGKYGIPFSTICKSAALILLF  654



>gb|KGN43506.1| hypothetical protein Csa_7G042990 [Cucumis sativus]
Length=461

 Score =   374 bits (961),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 211/466 (45%), Positives = 296/466 (64%), Gaps = 26/466 (6%)
 Frame = +2

Query  14    MTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPYGNQM  193
             MTNAPF++N+DCD +VN+P VV+ AMC LLG  +E+++ FVQFPQ FY   KDDP+G Q+
Sbjct  1     MTNAPFIVNIDCDMYVNNPNVVVEAMCILLGA-EEQESIFVQFPQIFYNQPKDDPFGCQL  59

Query  194   KIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGKSKTF  373
               + + L RG AGIQGP Y G  CFHRRK IY      ++++   T K + E +G+S+  
Sbjct  60    NTLFQTLLRGMAGIQGPLYCGCNCFHRRKTIY-----TLNSSPNKTGKIE-ENYGESEEL  113

Query  374   ALSTTQIL-----SGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
               S  +IL     +G  +  I +   S+++A +VAS  YE  TAWG KVG LY S  ED 
Sbjct  114   TKSANEILRGVQANGRTHTTIDL-STSIQSAYQVASADYENNTAWGLKVGWLYESMTEDI  172

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+ IH KGWKSV   PNPP FLG +PTGGP ALTQ+KRW T +L+I++ K +P++   
Sbjct  173   LTGIKIHSKGWKSVLLQPNPPAFLGLAPTGGPDALTQRKRWVTGSLEIMVRKNTPLLAFF  232

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP-ASIFI  895
               RL  RQCLAY + +   +    ++ Y++LPAY I+ NSHF P + + A++     +FI
Sbjct  233   LTRLTLRQCLAYTYFLIRGLYAIPQLVYAILPAYAILTNSHFLPSVQDTALLATFVPMFI  292

Query  896   IYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKD  1075
             +Y+ + +  Y++ G S+RAWWNN +M  +  + S +FG LS V+++FG+SEAVFEVT K 
Sbjct  293   LYHSHSICVYLQCGLSVRAWWNNVKMEIIATTSSCVFGILSLVLRLFGISEAVFEVTPKG  352

Query  1076  HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAA----LFIGFLDFKQN----KS  1231
              S++      DD  VG+F F+ESPLF+ GT ++L+ L A    L  G L    +    + 
Sbjct  353   QSNNNV----DDGNVGKFVFNESPLFIIGTAMVLLQLMALGSKLLAGILQPPSSSDGRRG  408

Query  1232  WSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
               +GE +  VWV++    FL+GLF KGK+GIP  T+ KS  L LLF
Sbjct  409   SGIGEILGCVWVLMTLSPFLRGLFAKGKYGIPFPTICKSASLILLF  454



>ref|XP_004144501.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=743

 Score =   382 bits (981),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 221/471 (47%), Positives = 296/471 (63%), Gaps = 23/471 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPF++N+DCD +VN+P VV+ AMC L+G   EK++ F QFPQ FY   KDDP+
Sbjct  273   VSGVMTNAPFIVNIDCDMYVNNPNVVVDAMCILVGAT-EKESVFAQFPQVFYNQPKDDPF  331

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             G QM  + + L RG AGIQGP Y G  CFHRRK IY +     ++++  T K + E FG+
Sbjct  332   GCQMITLFQMLLRGMAGIQGPLYSGCNCFHRRKTIYTL-----NSSQNKTGKIE-ENFGE  385

Query  362   SKTFALSTTQILSG--SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGED  535
             S+    +T +IL G  S          S+++A +VAS  YE  TAWG KVG LYGS  ED
Sbjct  386   SEELTKATDEILRGVKSSTDHTTNLSTSIQSAYQVASANYENNTAWGLKVGWLYGSMTED  445

Query  536   TKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWA  715
                G+ IH KGWKSV   PNPP F+G +  GG   L Q+KRW T  L+ILI K +P++  
Sbjct  446   ILMGIKIHSKGWKSVLVLPNPPAFMGLASMGGSETLIQRKRWVTGILEILISKNNPLLTF  505

Query  716   LFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIV-IPASIF  892
              F  L FRQ LAY + +   +    E+ Y++LPAY I+ NSHF P + + A++ I    F
Sbjct  506   FFTHLKFRQSLAYTYFLTRSLFAIPELTYAILPAYAILTNSHFLPSVQDTALLAIFVPTF  565

Query  893   IIYNLYG-LFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             I+Y+ +  +FEY++ G SL AWWN  RM  + ++ S+ FG LS V+K+FG+SEAVFEVT 
Sbjct  566   ILYHSHSIIFEYLQWGLSLHAWWNKVRMEMILSTSSYAFGILSLVLKLFGISEAVFEVTP  625

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTIL-----------LVNLAALFIGFLDF  1216
             KD S  +A + +    VGRFTFDESPLFV GTT++            V +  L +   + 
Sbjct  626   KDQSDADATNANHHD-VGRFTFDESPLFVLGTTLVLLNLMALLFAAFVGMQPLILSVPND  684

Query  1217  KQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
              +++ + +GE +  VWV+L    FLKGLF KGK+GIP ST+ KS  L LLF
Sbjct  685   GRHRGFGIGEILGCVWVLLTLLPFLKGLFAKGKYGIPFSTICKSAALILLF  735



>ref|XP_004144597.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=737

 Score =   381 bits (979),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 215/470 (46%), Positives = 300/470 (64%), Gaps = 26/470 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPF++N+DCD +VN+P VV+ AMC LLG  +E+++ FVQFPQ FY   KDDP+
Sbjct  273   VSGVMTNAPFIVNIDCDMYVNNPNVVVEAMCILLGA-EEQESIFVQFPQIFYNQPKDDPF  331

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             G Q+  + + L RG AGIQGP Y G  CFHRRK IY +     +++   T K + E +G+
Sbjct  332   GCQLNTLFQTLLRGMAGIQGPLYSGCNCFHRRKTIYTL-----NSSPNKTGKIE-ENYGE  385

Query  362   SKTFALSTTQIL-----SGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSA  526
             S+    S  +IL     +G  +  I +   S+++A +VAS  YE  TAWG KVG LY S 
Sbjct  386   SEELTKSANEILRGVQANGRTHTTIDL-STSIQSAYQVASADYENNTAWGLKVGWLYESM  444

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG+ IH KGWKSV   PNPP FLG +PTGGP ALTQ+KRW T +L+I++ K +P+
Sbjct  445   TEDILTGIKIHSKGWKSVLLQPNPPAFLGLAPTGGPDALTQRKRWVTGSLEIMVRKNTPL  504

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP-A  883
             +     RL  RQCLAY + +   +    ++ Y++LPAY I+ NSHF P + + A++    
Sbjct  505   LAFFLTRLTLRQCLAYTYFLIRGLYAIPQLVYAILPAYAILTNSHFLPSVQDTALLATFV  564

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
              +FI+Y+ + +  Y++ G S+RAWWNN +M  +  + S +FG LS V+++FG+SEAVFEV
Sbjct  565   PMFILYHSHSICVYLQCGLSVRAWWNNVKMEIIATTSSCVFGILSLVLRLFGISEAVFEV  624

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAA----LFIGFLDFKQN--  1225
             T K  S++      DD  VG+F F+ESPLF+ GT ++L+ L A    L  G L    +  
Sbjct  625   TPKGQSNNNV----DDGNVGKFVFNESPLFIIGTAMVLLQLMALGSKLLAGILQPPSSSD  680

Query  1226  --KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
               +   +GE +  VWV++    FL+GLF KGK+GIP  T+ KS  L LLF
Sbjct  681   GRRGSGIGEILGCVWVLMTLSPFLRGLFAKGKYGIPFPTICKSASLILLF  730



>ref|XP_004171456.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=737

 Score =   380 bits (977),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 214/470 (46%), Positives = 300/470 (64%), Gaps = 26/470 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPF++N+DCD +VN+P VV+ AMC LLG  +E+++ FVQFPQ FY   KDDP+
Sbjct  273   VSGVMTNAPFIVNIDCDMYVNNPNVVVEAMCILLGA-EEQESIFVQFPQIFYNQPKDDPF  331

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             G Q+  + + L RG AGIQGP Y G  CFHRR+ IY +     +++   T K + E +G+
Sbjct  332   GCQLNTLFQTLLRGMAGIQGPLYCGCNCFHRRRTIYTL-----NSSPNKTGKIE-ENYGE  385

Query  362   SKTFALSTTQIL-----SGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSA  526
             S+    S  +IL     +G  +  I +   S+++A +VAS  YE  TAWG KVG LY S 
Sbjct  386   SEELTKSANEILRGVQANGRTHTTIDL-STSIQSAYQVASADYENNTAWGLKVGWLYESM  444

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG+ IH KGWKSV   PNPP FLG +PTGGP ALTQ+KRW T +L+I++ K +P+
Sbjct  445   TEDILTGIKIHSKGWKSVLLQPNPPAFLGLAPTGGPDALTQRKRWVTGSLEIMVRKNTPL  504

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP-A  883
             +     RL  RQCLAY + +   +    ++ Y++LPAY I+ NSHF P + + A++    
Sbjct  505   LAFFLTRLTLRQCLAYTYFLIRGLYAIPQLVYAILPAYAILTNSHFLPSVQDTALLATFV  564

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
              +FI+Y+ + +  Y++ G S+RAWWNN +M  +  + S +FG LS V+++FG+SEAVFEV
Sbjct  565   PMFILYHSHSICVYLQCGLSVRAWWNNVKMEIIATTSSCVFGILSLVLRLFGISEAVFEV  624

Query  1064  TKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAA----LFIGFLDFKQN--  1225
             T K  S++      DD  VG+F F+ESPLF+ GT ++L+ L A    L  G L    +  
Sbjct  625   TPKGQSNNNV----DDGNVGKFVFNESPLFIIGTAMVLLQLMALGSKLLAGILQPPSSSD  680

Query  1226  --KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
               +   +GE +  VWV++    FL+GLF KGK+GIP  T+ KS  L LLF
Sbjct  681   GRRGSGIGEILGCVWVLMTLSPFLRGLFAKGKYGIPFPTICKSASLILLF  730



>gb|KDO54721.1| hypothetical protein CISIN_1g006639mg [Citrus sinensis]
Length=595

 Score =   374 bits (959),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/364 (49%), Positives = 235/364 (65%), Gaps = 6/364 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD + N+P++VL AMC  LG K+E +  F+Q PQ FY    D P 
Sbjct  237   VSGLMTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFY----DRP-  291

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
                + I+ +Y+ +G  GIQGPFY GTG FHRR V+YG+    +++     + +  + FG 
Sbjct  292   -ENLCILNEYIGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGN  350

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             SK F  S  Q L G           SL+ A  VA C YE+G++WG +VG LYG+  ED  
Sbjct  351   SKEFIKSAAQTLEGKTGGYSSNISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNL  410

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGW+S YC P P  FLG +   GPA + QQKRW T  L+IL  K++PI+  L 
Sbjct  411   TGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLI  470

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
             G+L FRQCLAYLWI+ W +R   E+CY  LPAYCII NS F PK+ E  ++IP ++F+IY
Sbjct  471   GKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIY  530

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
              LY L EYI+ G S+R+WW N  M R+  + +WLFG ++  ++ FG SEAVFE+T+K H 
Sbjct  531   KLYTLLEYIQAGLSIRSWWVNNCMARIVTTSAWLFGLVNAALEQFGFSEAVFEITQKIHR  590

Query  1082  SDEA  1093
             S   
Sbjct  591   SQRC  594



>gb|KDO54720.1| hypothetical protein CISIN_1g006639mg [Citrus sinensis]
Length=637

 Score =   374 bits (960),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/364 (49%), Positives = 235/364 (65%), Gaps = 6/364 (2%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD + N+P++VL AMC  LG K+E +  F+Q PQ FY    D P 
Sbjct  279   VSGLMTNAPFMLNVDCDMYANNPEIVLQAMCLHLGSKNENEFAFIQSPQYFY----DRP-  333

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
                + I+ +Y+ +G  GIQGPFY GTG FHRR V+YG+    +++     + +  + FG 
Sbjct  334   -ENLCILNEYIGKGIVGIQGPFYQGTGTFHRRDVVYGLCLDQIEHQGNIVEDELLKKFGN  392

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             SK F  S  Q L G           SL+ A  VA C YE+G++WG +VG LYG+  ED  
Sbjct  393   SKEFIKSAAQTLEGKTGGYSSNISRSLDEAHRVADCGYEYGSSWGDEVGCLYGATAEDNL  452

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGW+S YC P P  FLG +   GPA + QQKRW T  L+IL  K++PI+  L 
Sbjct  453   TGLVIHSKGWRSGYCLPIPHAFLGCASPSGPAGMRQQKRWATGLLEILFSKRNPILATLI  512

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
             G+L FRQCLAYLWI+ W +R   E+CY  LPAYCII NS F PK+ E  ++IP ++F+IY
Sbjct  513   GKLQFRQCLAYLWILTWGLRSIPELCYIALPAYCIITNSTFLPKVQEPTVLIPLALFLIY  572

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
              LY L EYI+ G S+R+WW N  M R+  + +WLFG ++  ++ FG SEAVFE+T+K H 
Sbjct  573   KLYTLLEYIQAGLSIRSWWVNNCMARIVTTSAWLFGLVNAALEQFGFSEAVFEITQKIHR  632

Query  1082  SDEA  1093
             S   
Sbjct  633   SQRC  636



>ref|XP_002529324.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33041.1| conserved hypothetical protein [Ricinus communis]
Length=576

 Score =   369 bits (946),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 215/470 (46%), Positives = 283/470 (60%), Gaps = 75/470 (16%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAPFMLN+DCD +VN+P+VV HAMCFLLG  ++++  FVQFPQ FY  LKDDP+
Sbjct  168   VSGLMTNAPFMLNVDCDMYVNNPQVVRHAMCFLLGSLNKEEFAFVQFPQMFYD-LKDDPF  226

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKST---------D  334
             G+     ++Y+ RG AG+QG FY GTGCFHRRKVIYG+ P  +    K+          D
Sbjct  227   GH----TLQYIGRGIAGLQGYFYGGTGCFHRRKVIYGLCPDDLGTQAKALTPVSACNLGD  282

Query  335   KDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLL  514
              +    FG S  F  S  Q L G    +  +  N +EAA +VA   YE+ TAWG +VG  
Sbjct  283   NELLNIFGNSMEFIKSADQALQGKTSTQRNL-SNLVEAAYQVAGYSYEYRTAWGTEVGWQ  341

Query  515   YGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICK  694
             YGS  ED  TG++IH +GW+S YC P+ P FLG SP+  P ++TQQKRW T  L+IL+ K
Sbjct  342   YGSTTEDMLTGLNIHSRGWRSAYCTPDLPAFLGCSPSCVPVSMTQQKRWATGMLEILVGK  401

Query  695   KSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIV  874
               PI+  +  +L FRQCLAYL+++ W +R   E+CY +LPAYCII+ S+F PKL+E A++
Sbjct  402   NCPIVATITAKLQFRQCLAYLYLLVWGLRSIPELCYMVLPAYCIISKSNFLPKLHEPAMI  461

Query  875   IPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAV  1054
             +                                                     G+S+  
Sbjct  462   L-----------------------------------------------------GISKTT  468

Query  1055  FEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSW  1234
             FEVT+KD S+D A D      VG+FTFD SP FVPGTTILL+ LAA+ +  L F +    
Sbjct  469   FEVTQKDQSTDAAGD------VGKFTFDGSPFFVPGTTILLIQLAAVVM-ILFFSRLLQS  521

Query  1235  SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
              LGE +CS++V++++W F KGLFGKGK+GIPL T+  S  LAL F H CK
Sbjct  522   HLGEILCSLFVVILFWPFAKGLFGKGKYGIPLPTICMSIMLALSFVHFCK  571



>ref|XP_007049093.1| Cellulose synthase-like B3, putative isoform 2 [Theobroma cacao]
 gb|EOX93250.1| Cellulose synthase-like B3, putative isoform 2 [Theobroma cacao]
Length=676

 Score =   371 bits (953),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 207/406 (51%), Positives = 262/406 (65%), Gaps = 20/406 (5%)
 Frame = +2

Query  209   YLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDN--------NEKSTDKDQWETFGKS  364
             Y+ RG AGIQGPFY GTGCFHRRKVIYG+WP   +N        N KS D      FG S
Sbjct  278   YMCRGIAGIQGPFYGGTGCFHRRKVIYGVWPRDRENEARNCTSINGKSVDDTLLNEFGNS  337

Query  365   KTFALSTTQILSGSL-YPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             +    S  Q L G   +P      NSLEAA +VASC YE+GT+WG K G +YG+  ED  
Sbjct  338   EELINSAVQALKGKKGFPNN--LSNSLEAACKVASCSYEYGTSWGTKCGWIYGATAEDLL  395

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGW S    P  PGF+G +P+GGP A+ QQKRW T   +IL+ K  PII  L 
Sbjct  396   TGLKIHAKGWNSALHMPELPGFMGCTPSGGPEAMAQQKRWATGLAEILVGKNCPIIATLT  455

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
              +L FR CLAYLWI+ W +R   ++CY+ LPAYCI+ NSHF PK+ E AI IP + F+ Y
Sbjct  456   AKLQFRMCLAYLWILFWGLRSIPQLCYAALPAYCILANSHFLPKVEEPAIWIPIATFVTY  515

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
             NL+ L EY++ G S+RAWWNN RM  + A+ ++LFG  + ++K+  +SE VFEVT+KD S
Sbjct  516   NLHTLREYLKAGLSIRAWWNNLRMGSITATSAYLFGLFAAILKLLRISETVFEVTQKDQS  575

Query  1082  SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDF----KQNKSWSLGEA  1249
              D      DD  V +FTF+ES +FVPGTT+LLV+L +L                  LGE 
Sbjct  576   CD-----GDDPDVTKFTFNESAVFVPGTTLLLVHLISLLCLSSKLPTPVHDMHGVGLGEV  630

Query  1250  ICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
              CS+WV+L +W FL GLF +GK+GIPLST+LKS  LALLF H C++
Sbjct  631   FCSLWVVLCFWPFLNGLFERGKYGIPLSTILKSAALALLFVHFCRT  676



>ref|XP_002447842.1| hypothetical protein SORBIDRAFT_06g016750 [Sorghum bicolor]
 gb|EES12170.1| hypothetical protein SORBIDRAFT_06g016750 [Sorghum bicolor]
Length=819

 Score =   375 bits (962),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 211/521 (40%), Positives = 292/521 (56%), Gaps = 63/521 (12%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGV+TNAP +LN+DCD   N+P+V LHAMC L+G  D+  + FVQ PQ FYG LKDDP+
Sbjct  294   VSGVVTNAPIVLNVDCDMFANNPQVALHAMCLLMGFDDDVHSGFVQVPQKFYGALKDDPF  353

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTD-----KDQW  346
             GNQM+++ + +  G AG+QG +Y GTGCFHRRKV+YG+ P+    +  S       K+  
Sbjct  354   GNQMQVMFEKIGYGVAGLQGIYYCGTGCFHRRKVMYGVPPYHATTSSSSMKDSPSYKELQ  413

Query  347   ETFGKSKTFALSTTQILSGSLYPE----IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLL  514
               FG+S     S   I+SG ++      +    + +EAAK+V++C YE GT+WGQ+ G  
Sbjct  414   NRFGRSNELIESARSIISGDMFKAPTTLVADLTSRIEAAKQVSACRYETGTSWGQEAGCW  473

Query  515   YGSAGE-----------------DTKTGVSIH--------------------GKGWKSVY  583
             +G  G                  +T T  + H                    G       
Sbjct  474   HGHEGRAIGGEEKRALPPPDVLTNTATTTASHLVNLPRHAGSSHQGSGSGYPGPDQHCAS  533

Query  584   CDP---NPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRLHFRQCLAY  754
               P   +PP FLG +PTGGPA+LTQ KRW T  L+IL+ + +P + + F RL FRQC+AY
Sbjct  534   TPPAGGDPPAFLGGAPTGGPASLTQYKRWATGLLEILLSRHNPCLVSAFKRLDFRQCVAY  593

Query  755   LWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLYGLFEYIET  934
             L I  WP+R  FE+CY+LL  YC+I N  F PK +E + +IP ++F+ YN Y L EY + 
Sbjct  594   LVIDVWPVRAPFELCYALLGPYCLIANHSFLPKASEPSFLIPLALFLGYNAYNLGEYKDC  653

Query  935   GESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKD-HSSDEALDKDDD  1111
               S RAWWNN RM R+ +S +WL  FL+ V+K+ GLSE VFEVT+K+  SS +    D  
Sbjct  654   RLSARAWWNNHRMQRIVSSSAWLLAFLTVVLKMLGLSETVFEVTRKEQQSSSDGGAGDGA  713

Query  1112  SKVGRFTFDESPLFVPGTTILLVNLAALFIGF-----------LDFKQNKSWSLGEAICS  1258
                GRFTFD SP+FVP T + ++++ A+ +G                      +GE  C 
Sbjct  714   DPAGRFTFDSSPVFVPPTALTVLSIVAIAVGAWRAVVAGAVEGRVPTTGGGPGVGELACC  773

Query  1259  VWVILMYW--AflkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
             VW++L +W         G+G +GIP S  LK+  L   F H
Sbjct  774   VWLVLCFWPFVRGLVAVGRGSYGIPWSVRLKAALLVAAFVH  814



>ref|XP_002447843.1| hypothetical protein SORBIDRAFT_06g016760 [Sorghum bicolor]
 gb|EES12171.1| hypothetical protein SORBIDRAFT_06g016760 [Sorghum bicolor]
Length=756

 Score =   368 bits (944),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 208/483 (43%), Positives = 285/483 (59%), Gaps = 49/483 (10%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGV+TNAP MLN+DCD   N+P+V LHAMC LLG  D+  + FVQ PQ FYG LKDDP+
Sbjct  293   VSGVVTNAPIMLNVDCDMFANNPQVALHAMCLLLGFDDDVHSGFVQAPQKFYGALKDDPF  352

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTD--------K  337
             GNQ+++I                     F   KV+YG+ P   DN   +T         K
Sbjct  353   GNQLQVI---------------------FEVTKVMYGVPP---DNAAATTTSMKDSPSYK  388

Query  338   DQWETFGKSKTFALSTTQILSGSLYP------EIPIFPNSLEAAKEVASCVYEFGTAWGQ  499
             +    FG+S     S   I+SG ++        +P   + +EAAK+V++C YE GT+WGQ
Sbjct  389   ELQNRFGRSNELIESARSIISGDMFRIRTPTVVVPDLTSRIEAAKQVSACSYETGTSWGQ  448

Query  500   KVGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALD  679
             +VG +YGS  ED  TG  IH  GW+S   +P+PP FLG +PTGGPA+LTQ KRW T  L+
Sbjct  449   EVGWVYGSMTEDVLTGQRIHAAGWRSAILNPDPPAFLGGAPTGGPASLTQYKRWATGLLE  508

Query  680   ILICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKL-  856
             IL+ + +PI+ + F RL FRQC+AYL I  WP+R  FE+CY+LL  YCII N  F PK+ 
Sbjct  509   ILLSRHNPILLSAFKRLDFRQCVAYLVIDVWPVRAPFEVCYALLGPYCIIANHSFLPKVT  568

Query  857   -NEAAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKV  1033
              +E   +I   +F+ YN+Y L EY +   S+RAWWNN RM R+ +S +WL  FL+ V+K 
Sbjct  569   ASEPGFLILLVLFLGYNVYNLGEYKDCRLSVRAWWNNHRMQRIVSSSAWLLAFLTVVLKT  628

Query  1034  FGLSEAVFEVTKKDHS-SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
              GLSE VFEVT+K+   S +     DD+  GRFTFD SP+FVP T + ++++ A+ +G  
Sbjct  629   LGLSETVFEVTRKEQKSSSDGGADADDADPGRFTFDSSPVFVPPTALTMLSIVAVAVGAW  688

Query  1211  DFKQNKSWSLGEA-------ICSVWVILMYWAflk-glfgkgkfgIPLSTVLKSGGLALL  1366
                                 +C  W++L +W F++  + G+G + IP S  LK+  L   
Sbjct  689   RLVAGAGEEGVSGGSGVGELVCCGWLVLCFWPFVRGLVGGRGSYSIPWSVRLKAALLVAA  748

Query  1367  FFH  1375
             F H
Sbjct  749   FVH  751



>ref|XP_006582369.1| PREDICTED: cellulose synthase-like protein H1-like isoform X3 
[Glycine max]
Length=683

 Score =   355 bits (911),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 193/405 (48%), Positives = 256/405 (63%), Gaps = 17/405 (4%)
 Frame = +2

Query  209   YLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS----TDKDQWETFGKSKTFA  376
             YL  G  G+QGPFY GT CFHRRKVIYG+ P  ++ ++ S    ++++  + FG SK   
Sbjct  278   YLAAGIGGLQGPFYGGTNCFHRRKVIYGLSPENIEKDKFSGNSISEEELKQKFGTSKEIM  337

Query  377   LSTTQILSGSLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTKTGVS  553
              S    L G  Y    I   N ++ A +VA C YE+GT WG+++  +YGS  ED  TG++
Sbjct  338   KSVACTLEGRTYSYNDINISNVVDVASQVAGCAYEYGTGWGKQMAWIYGSVTEDVLTGLT  397

Query  554   IHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRLH  733
             IH KGW+S +C P+P GF G +P GGP ++ QQKRW T  L++  CK  PII  LF +L 
Sbjct  398   IHKKGWRSEFCMPSPIGFTGFAPGGGPNSMAQQKRWATGLLEMFFCKHCPIISTLFHKLT  457

Query  734   FRQCLAYLWIMG-WPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLY  910
              RQCLAY+WI+  W +   FE+CY+ L AYCII NS+F P+  +  I IPA+  +IY +Y
Sbjct  458   LRQCLAYMWIINHWGLMSVFEVCYACLLAYCIITNSNFLPQ--DLGICIPAAFLVIYKIY  515

Query  911   GLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDE  1090
                EY+  G S+RAWWNNQRM R+    +    FLS ++K+F +SE VF++TKKD  S  
Sbjct  516   TASEYLAEGLSIRAWWNNQRMSRITPMNAGFCAFLSVLLKLFRISETVFDITKKDLPS--  573

Query  1091  ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ-------NKSWSLGEA  1249
             A D  DD   GR+TFDES +F+PGTTILLV L A+ I  L F+             LGE 
Sbjct  574   AKDVGDDKDAGRYTFDESVVFLPGTTILLVQLTAMVIKLLGFQPPVATQSGKHGCGLGEI  633

Query  1250  ICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
              CSV++I+ YW FL+GLF  GK+ IPLST+LKS  L  LF H C+
Sbjct  634   FCSVYLIICYWPFLRGLFETGKYRIPLSTILKSAILTCLFVHLCQ  678



>ref|XP_010522355.1| PREDICTED: cellulose synthase-like protein B4 isoform X1 [Tarenaya 
hassleriana]
Length=753

 Score =   356 bits (914),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 202/471 (43%), Positives = 285/471 (61%), Gaps = 27/471 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAP+MLN+DCD +VN+P V+   MC  LG K + +  FVQ PQ FY     D +
Sbjct  282   VSGLMTNAPYMLNVDCDMYVNNPDVLRQGMCLFLGSKTQNEYAFVQSPQLFY-----DTF  336

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWE----  349
             G+++ ++  Y+ RG  GI GP Y G+G  HRR++IYG+ PH +D++   +   + E    
Sbjct  337   GDEIVVLQTYIGRGMVGIDGPIYAGSGGIHRRRIIYGLSPHHLDDDGNLSSIAKVELLGE  396

Query  350   -----TFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLL  514
                   +G  K    S  + L G   P+  +   SLEAA  V +C YE+ T WG+ +G L
Sbjct  397   GKLEREYGDCKEMVKSAVEALRGKSTPQNDL-TISLEAAHRVGACDYEYTTNWGKTIGWL  455

Query  515   YGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICK  694
             YGS  ED  T VSIH KGWKS+Y  P+PP FLG  P GGPA + QQ+RW T  L++L  K
Sbjct  456   YGSTTEDANTSVSIHSKGWKSLYNSPDPPAFLGCMPAGGPAVMGQQRRWATGLLEVLFNK  515

Query  695   KSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIV  874
             +SP+I  L+ +L FR  L YL++  W IR   E+CYSLLPAYCI++NS F PK    +IV
Sbjct  516   QSPVIGMLYRKLGFRTGLCYLYLFIWGIRSIPELCYSLLPAYCILHNSAFLPKGPCLSIV  575

Query  875   IPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAV  1054
             +  ++ ++++LY L+EYI  G  +++W       R+  + +WLF     ++K  G+S  +
Sbjct  576   V--ALVVMHSLYNLWEYINLGLPIQSWLVTLLFARIKTTCAWLFSIPDIILKSLGISNTI  633

Query  1055  FEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL------DF  1216
             F +TKK   S     +  D   G+F FD+S  F+PGT ILLVNLAAL +GFL        
Sbjct  634   FILTKKTAPSSS---RHRDEVPGKFVFDDSVYFLPGTVILLVNLAAL-LGFLVGMRPPPA  689

Query  1217  KQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
                  + +GE +  V V++ +W FLKGLF KGK+GIP++T+ K+  LA  F
Sbjct  690   DNGGGYGVGEVLACVSVVMSFWIFLKGLFEKGKYGIPVATISKAAFLAFSF  740



>ref|XP_007049095.1| Cellulose synthase-like B4, putative isoform 1 [Theobroma cacao]
 gb|EOX93252.1| Cellulose synthase-like B4, putative isoform 1 [Theobroma cacao]
Length=714

 Score =   352 bits (903),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 176/348 (51%), Positives = 229/348 (66%), Gaps = 3/348 (1%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD   ++PK++LHA+C L+GV DE++  FVQ PQ FY  LKDDP+
Sbjct  279   VSGVMTNAPFMLNVDCDMFASNPKIILHAVCLLVGVDDEQECAFVQCPQIFYDALKDDPF  338

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
             GN+M +       G AGIQGP Y GTGCFHRRK IYG+ P+   + +    K   E FGK
Sbjct  339   GNRMTVPFTIFVGGMAGIQGPPYAGTGCFHRRKAIYGLPPN--HDFDIKDCKILEERFGK  396

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLE-AAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
             S  F+ S  +IL GS     P   +S+  +A  VA+C YE  T WG +VGL YGS  ED 
Sbjct  397   STEFSESVAEILFGSGEKHFPCDISSITGSACRVANCSYENNTCWGIEVGLTYGSVTEDV  456

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              TG+ IH  GWKSV   P+PP F+G +P GGP ++TQ KRWGT  L++L  K SPI+ A 
Sbjct  457   LTGLRIHTMGWKSVLLMPSPPAFMGCAPPGGPVSMTQMKRWGTGLLEVLFSKHSPILSAF  516

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
               +LHFRQ LAYL I+ W  R   + CY++L AYCI  +S F PK++E    IP S  +I
Sbjct  517   STKLHFRQALAYLQIVMWASRSIPQFCYNMLSAYCITTDSQFLPKVHEPFFYIPVSFSLI  576

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGL  1042
              NL+ L +Y++ GES++AWWN+QRM R++A  S LF  L+  + + GL
Sbjct  577   SNLHSLSQYLQYGESIQAWWNHQRMERIHAVSSMLFACLALAIWLLGL  624



>gb|ABR17468.1| unknown [Picea sitchensis]
Length=785

 Score =   342 bits (877),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 197/480 (41%), Positives = 268/480 (56%), Gaps = 31/480 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTN+PF+LNLDCD  VN+ K + HAMCF L  K E+D  FVQFPQ FY  +KDDP+
Sbjct  305   VSGVMTNSPFILNLDCDMFVNNSKAIQHAMCFFLDCKSERDCGFVQFPQLFYRSIKDDPF  364

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEK------------  325
             GNQMKI +  L RG  G+QGP Y GTGCFHRRK +YG  P     N K            
Sbjct  365   GNQMKIFLSTLARGMNGLQGPVYCGTGCFHRRKALYGAPPAADQYNNKDVREFHNHAKVY  424

Query  326   -STDKDQW------ETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFG  484
              S     W        FG S   A S    +  + +  +    ++++ A  VASC YE  
Sbjct  425   HSLKASSWSLGALSSIFGSSSALAASAQTTMRNTQFGVLSSPSSTIDEALNVASCRYETN  484

Query  485   TAWGQKVGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWG  664
             TAWG++VG +YGS  ED  TG  +H  GW SV+C P  P F+G++P  GP  L Q KRW 
Sbjct  485   TAWGKEVGWMYGSTVEDVMTGFKVHCLGWHSVFCVPEQPAFMGTAPANGPDCLVQMKRWV  544

Query  665   TAALDILICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHF  844
             T  L+I + K  P +  +   +  RQ + Y +   W I       Y++LPA+C+++   F
Sbjct  545   TGLLEIFLSKLCPFL-GIHRNIMVRQRMMYAYFTLWGILSVATFFYAILPAFCLLSGKSF  603

Query  845   QPKLNEAAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGV  1024
              P +++ +  I  ++F+    + L+E++  G S+R WWNNQRM  +     +L      +
Sbjct  604   LPGISKPSFAIAVTLFVSIYGFKLWEFLRIGGSIREWWNNQRMRLIQCLSPFLLATFDVL  663

Query  1025  VKVFGLSEAVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIG  1204
             +K+ G+S+ VF VT K        D+DD  +V  FTFD S LF+P TT+L +NLAA+  G
Sbjct  664   MKLLGVSDTVFVVTPKGSG-----DEDDCGEVD-FTFDSSSLFIPPTTVLFINLAAIVSG  717

Query  1205  FLDFKQN-----KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
              + F        +     E  CSVWV++  W F+KGL  KGK GIP S ++KS  LALL 
Sbjct  718   SVVFVAGRDDIFRDKLFAEYFCSVWVVINLWPFVKGLVRKGKRGIPWSVLMKSAALALLL  777



>ref|XP_010413985.1| PREDICTED: cellulose synthase-like protein B3 isoform X2 [Camelina 
sativa]
Length=759

 Score =   341 bits (874),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 201/476 (42%), Positives = 288/476 (61%), Gaps = 27/476 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLL--GVKDEKDAEFVQFPQNFYGGLKDD  175
             VSG+MTNAP+MLN+DCD +VN+  VV  AMC  L   + + K   FVQFPQ+FY     D
Sbjct  282   VSGLMTNAPYMLNVDCDMYVNEADVVRQAMCIFLQNSILNSKSCAFVQFPQDFY-----D  336

Query  176   PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGM-WPHVVDNNEKST--DKDQW  346
                +++ ++  Y+ RG AGIQGP Y G+GCFH R+V+YG+    + D+   S+   ++  
Sbjct  337   SNADELTVLQSYVGRGIAGIQGPTYAGSGCFHTRRVMYGISLDDLGDDGSLSSVATRNLA  396

Query  347   ETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSA  526
               FG SK    S    L     P+     +SLEAA+EV  C YE  T+WG+ +G LYGS 
Sbjct  397   REFGNSKEMVTSVVNALQRKPNPQHSSLTDSLEAAQEVGHCHYENQTSWGKTIGWLYGST  456

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG+ IH +GW S Y  P+PP FLG+ P GGP A+ QQ+RW    L+IL  K+SP+
Sbjct  457   TEDVHTGLGIHSRGWTSSYISPDPPAFLGAMPPGGPEAMVQQRRWAAGMLEILFNKRSPL  516

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
             I   F +L FRQ LAYL+I+ W +R   E+ Y LLPAYC+++N+   PK     I++  +
Sbjct  517   IGTFFRKLRFRQSLAYLYILTWGLRSIPELFYCLLPAYCLLHNTALFPKGVYLGIIV--T  574

Query  887   IFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
             +  I+ LY L+E++  G S+++W+ +Q   R+ ++ SWLF  L  +++  G+SE VF VT
Sbjct  575   LVGIHCLYTLWEFMSLGFSVQSWFISQSFWRIKSTCSWLFSILDIILQFLGISENVFIVT  634

Query  1067  KK-------DHSSDEALDKDD--DSKVGRFTFDESPLFVPGTTILLVNLAALF---IG--  1204
             KK       +  S ++  + D  +   G+F FD S  F+PGT I+LV LAAL    +G  
Sbjct  635   KKTMPETRSESGSRKSQQEGDFPNQDCGKFEFDGSLYFLPGTFIVLVTLAALVGCSVGPQ  694

Query  1205  -FLDFKQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
                   +  S  + EA   V V++++  FLKG+F KGK+GIPLST+ K+  LA+LF
Sbjct  695   RLSHSHRGNSSGMAEACGCVLVVVLFLPFLKGMFEKGKYGIPLSTLSKAAFLAVLF  750



>emb|CDM80574.1| unnamed protein product [Triticum aestivum]
Length=619

 Score =   336 bits (861),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 166/330 (50%), Positives = 212/330 (64%), Gaps = 6/330 (2%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VS VMTNAP +LN+DCD  VN+P+VVLHA C LLG  DE  + FVQ PQ FYG LKDDP+
Sbjct  279  VSAVMTNAPIILNVDCDMFVNNPQVVLHATCLLLGFDDETCSGFVQVPQRFYGKLKDDPF  338

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH----VVDNNEKSTD-KDQW  346
            GNQM+++ + LF G AG+QG FY+GTGCFHRRK+IYG+ P     +    E S   +D  
Sbjct  339  GNQMEVLREKLFGGLAGLQGIFYLGTGCFHRRKIIYGVAPASFAAIKHEREGSLSYEDLL  398

Query  347  ETFGKSKTFALSTTQILSGSLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
              FG S     S+  I S  + P+  I   + ++ AK+V++C YE GT WG+++G  YGS
Sbjct  399  TKFGASMELVESSRNIYSVEIPPKPMIDITSRIQVAKQVSTCNYETGTHWGEEIGWSYGS  458

Query  524  AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
              ED  TG  IH  GWK+   D NPP FLG +PTGGPA+LTQ KRW T  L+IL+ + +P
Sbjct  459  MAEDILTGQRIHSAGWKTTLLDTNPPAFLGCAPTGGPASLTQYKRWATGVLEILLGQNNP  518

Query  704  IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
            II   F RL FRQCLAYL +  W +R  FE+CY+LL  +C+  N  F  K +     I  
Sbjct  519  IIATTFKRLQFRQCLAYLVLYIWSMRAPFELCYALLGPFCLFRNHSFLLKASNHGFSIQL  578

Query  884  SIFIIYNLYGLFEYIETGESLRAWWNNQRM  973
            ++F+ YN+Y   EY E G S R WWNN RM
Sbjct  579  ALFLSYNIYNFVEYKECGLSARTWWNNMRM  608



>ref|XP_006592807.1| PREDICTED: cellulose synthase-like protein H1-like isoform X2 
[Glycine max]
Length=679

 Score =   337 bits (863),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 192/394 (49%), Positives = 249/394 (63%), Gaps = 19/394 (5%)
 Frame = +2

Query  245   FYMGTGCFHRRKVIYGMWP-HVVDNNEKSTD------KDQWETFGKSKTFALSTTQILSG  403
             FY+GT C HRRKVIYG+ P H + N +K          ++   FG SK F  S T  L G
Sbjct  291   FYLGTNCMHRRKVIYGLSPYHGIQNGKKDHGVSNGKFSEKKTIFGTSKGFVESATHALEG  350

Query  404   SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTKTGVSIHGKGWKSVY  583
               +        SLEAA EV+SC YE+GTAWG++VG +YGS  ED  TG+ IH KGW+S  
Sbjct  351   KTFTPNNNICKSLEAASEVSSCEYEYGTAWGKQVGWMYGSTSEDLLTGLKIHTKGWRSEV  410

Query  584   CDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRLHFRQCLAYLWI  763
             C P    F+G SP      + QQKRW +  LDIL+ K  PI   LFG+L FRQCL YLWI
Sbjct  411   CSPELSPFMGCSPQDILVVIGQQKRWISGLLDILLSKHCPIFGTLFGKLQFRQCLGYLWI  470

Query  764   MGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLYGLFEYIETGES  943
               W +RP  EICY+ LPAYCIINNS F PK  E    IPA++ +IYN+  L E ++ G S
Sbjct  471   TTWSLRPVPEICYAALPAYCIINNSSFLPK--ELGQWIPATLLVIYNVSTLLENLKIGLS  528

Query  944   LRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS-SDEALDKDDDSKV  1120
             +R W NNQRM R+    SW FGFL+ ++K   +S   FE+T+KD + S+E  +++D    
Sbjct  529   IRTWCNNQRMARITTMNSWFFGFLAILLKRLRISNIGFEITRKDETFSNEGANEND----  584

Query  1121  GRFTFDESPLFVPGTTILLVNLAALFIGFLDF----KQNKSWS-LGEAICSVWVILMYWA  1285
             GRF F++SP+F+PGTTILL+ L AL   +L +    + N   S +GE  CS ++++ YW 
Sbjct  585   GRFIFNKSPVFIPGTTILLIQLTALVTMWLGWQPPVRNNGHGSGVGEVFCSTYLVVCYWP  644

Query  1286  flkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
             FLKGLF KGK+GIPLST+ KS  LA LF + CK+
Sbjct  645   FLKGLFEKGKYGIPLSTICKSMALAFLFVYLCKA  678



>gb|KCW46973.1| hypothetical protein EUGRSUZ_K00781 [Eucalyptus grandis]
Length=479

 Score =   330 bits (847),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/294 (54%), Positives = 203/294 (69%), Gaps = 8/294 (3%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VSG+MTNAP MLN+DCD + N+P++VLHA+C LLG K E+D  FVQ  Q FY G KDDP+
Sbjct  186  VSGLMTNAPLMLNVDCDMYANNPQIVLHALCLLLGTKYERDCAFVQCLQYFYDGAKDDPF  245

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS-------TDKD  340
            GNQ+ +  +YL +G  GIQGP+Y GTGCFHRRKVIYG WP  +   +KS       T  +
Sbjct  246  GNQLVVRNEYLGQGIVGIQGPYYEGTGCFHRRKVIYGSWPEDMKTEKKSLISNGELTKVE  305

Query  341  QWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYG  520
                FG SK F  S    L G+      ++ +SLEAA +V+SC YE+ T  G+++G +YG
Sbjct  306  SLNGFGISKQFINSVAHALQGNSDNPKDLW-SSLEAAYQVSSCTYEYNTDRGKEIGWMYG  364

Query  521  SAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKS  700
            S  ED  TG++IH KGW+S+ C PNPP FLG +P+GGPA++TQQKRW T  L+IL+ K+S
Sbjct  365  STTEDILTGLAIHTKGWRSLCCLPNPPAFLGCAPSGGPASMTQQKRWATGLLEILVSKRS  424

Query  701  PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE  862
            PI   LF  LHFRQCLAYLW++   +R   E  Y+LLPAYCI+ NSHF PK+  
Sbjct  425  PIYGTLFMNLHFRQCLAYLWLLTRALRSIPEFLYALLPAYCIMTNSHFLPKVRR  478



>ref|XP_010413984.1| PREDICTED: cellulose synthase-like protein B3 isoform X1 [Camelina 
sativa]
Length=765

 Score =   338 bits (866),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 201/482 (42%), Positives = 288/482 (60%), Gaps = 33/482 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLL--GVKDEKDAEFVQFPQNFYGGLKDD  175
             VSG+MTNAP+MLN+DCD +VN+  VV  AMC  L   + + K   FVQFPQ+FY     D
Sbjct  282   VSGLMTNAPYMLNVDCDMYVNEADVVRQAMCIFLQNSILNSKSCAFVQFPQDFY-----D  336

Query  176   PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGM-WPHVVDNNEKST-------  331
                +++ ++  Y+ RG AGIQGP Y G+GCFH R+V+YG+    + D+   S+       
Sbjct  337   SNADELTVLQSYVGRGIAGIQGPTYAGSGCFHTRRVMYGISLDDLGDDGSLSSVATRNYL  396

Query  332   -DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVG  508
              + +    FG SK    S    L     P+     +SLEAA+EV  C YE  T+WG+ +G
Sbjct  397   AEGNLAREFGNSKEMVTSVVNALQRKPNPQHSSLTDSLEAAQEVGHCHYENQTSWGKTIG  456

Query  509   LLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILI  688
              LYGS  ED  TG+ IH +GW S Y  P+PP FLG+ P GGP A+ QQ+RW    L+IL 
Sbjct  457   WLYGSTTEDVHTGLGIHSRGWTSSYISPDPPAFLGAMPPGGPEAMVQQRRWAAGMLEILF  516

Query  689   CKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAA  868
              K+SP+I   F +L FRQ LAYL+I+ W +R   E+ Y LLPAYC+++N+   PK     
Sbjct  517   NKRSPLIGTFFRKLRFRQSLAYLYILTWGLRSIPELFYCLLPAYCLLHNTALFPKGVYLG  576

Query  869   IVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSE  1048
             I++  ++  I+ LY L+E++  G S+++W+ +Q   R+ ++ SWLF  L  +++  G+SE
Sbjct  577   IIV--TLVGIHCLYTLWEFMSLGFSVQSWFISQSFWRIKSTCSWLFSILDIILQFLGISE  634

Query  1049  AVFEVTKK-------DHSSDEALDKDD--DSKVGRFTFDESPLFVPGTTILLVNLAALF-  1198
              VF VTKK       +  S ++  + D  +   G+F FD S  F+PGT I+LV LAAL  
Sbjct  635   NVFIVTKKTMPETRSESGSRKSQQEGDFPNQDCGKFEFDGSLYFLPGTFIVLVTLAALVG  694

Query  1199  --IG---FLDFKQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLAL  1363
               +G        +  S  + EA   V V++++  FLKG+F KGK+GIPLST+ K+  LA+
Sbjct  695   CSVGPQRLSHSHRGNSSGMAEACGCVLVVVLFLPFLKGMFEKGKYGIPLSTLSKAAFLAV  754

Query  1364  LF  1369
             LF
Sbjct  755   LF  756



>ref|XP_010556995.1| PREDICTED: cellulose synthase-like protein B3 isoform X1 [Tarenaya 
hassleriana]
Length=751

 Score =   337 bits (864),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 204/468 (44%), Positives = 281/468 (60%), Gaps = 20/468 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAP+MLN+DCD +VN+P V+  AMC  LG        FVQ PQ FY     D +
Sbjct  279   VSGVMTNAPYMLNVDCDMYVNNPDVIRQAMCLFLGSASRNQFAFVQSPQLFY-----DSF  333

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH-VVDNNEKSTDKDQWE---  349
             G+ + + + Y+ RG AGI  P Y G+G   RR VIYG+ PH + D+   S+ K   E   
Sbjct  334   GDDLVLFLTYIGRGMAGIGTPLYAGSGGILRRNVIYGLSPHDLQDDGSLSSGKLLEEGNL  393

Query  350   --TFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
                +G  +    S    L G   P+  +  +SLEAA  VA C YE  T WG+  G +Y S
Sbjct  394   KREYGNCEEMVTSAADALQGKSNPKNGL-TSSLEAAHRVADCDYEHCTNWGKTFGWIYDS  452

Query  524   AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
               ED  T V+IH KGWKS Y  P PP FLG  P GGPAA+ QQ+RW T  L++L  K+SP
Sbjct  453   TAEDINTSVNIHAKGWKSYYNSPEPPAFLGCMPPGGPAAMGQQRRWATGLLEVLFNKESP  512

Query  704   IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPA  883
             +I  L+  L FR   +YL+I  W ++   E+CY LLPAYCI+++S F PK    +IV+  
Sbjct  513   VIGMLWRELGFRSGCSYLYICTWGLKSIPELCYCLLPAYCILHDSAFLPKGPCLSIVM--  570

Query  884   SIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEV  1063
             ++ +++ LY L+E+I  G S++ W+ +    RV  + +WLFG    ++KV G+S  VF +
Sbjct  571   ALVVMHCLYSLWEFINLGLSIQRWFASLLFARVKTTCAWLFGISDIILKVLGISNTVFIL  630

Query  1064  TKKD--HSSDEALDKDDD---SKVGRFTFDESPLFVPGTTILLVNLAALF-IGFLDFKQN  1225
             TKK+   +S + +D DDD   S   +F FD+S  F+PGTTILLVNL AL    F   +  
Sbjct  631   TKKNAPSTSRQDVDHDDDVSGSDSEKFIFDDSVYFLPGTTILLVNLVALIGFSFRAGQGG  690

Query  1226  KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
               + +GE    V V++ +W F KGLFG+GK+GIP+ST+ K+  LA+ F
Sbjct  691   GGYGVGEIFGCVSVVISFWLFFKGLFGRGKYGIPISTISKASLLAIAF  738



>emb|CBI28830.3| unnamed protein product [Vitis vinifera]
Length=395

 Score =   325 bits (833),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/298 (52%), Positives = 204/298 (68%), Gaps = 3/298 (1%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VSG MTNAPF+LN+DCD + N+ ++V HAMC LLG K+ +D  F Q PQ F+ GLKDDP 
Sbjct  87   VSGAMTNAPFILNVDCDMYANNSQIVFHAMCLLLGCKNGQDFAFAQSPQIFHDGLKDDPL  146

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH-VVDNNEKSTDKDQWETFG  358
            GNQ+    KYL  G +G+QGP+Y GTGCFHRRK +YG+WP   ++   +S +    ++FG
Sbjct  147  GNQLVATQKYLGEGISGLQGPYYSGTGCFHRRKFLYGLWPDGCMETGGRSPNCGLRQSFG  206

Query  359  KSKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             SK F+ +  +ILSG S   + P    +S EAA +VA C YE GT+WG K G +YG   E
Sbjct  207  HSKEFSKTVERILSGLSGKADCPYDLSSSAEAANQVADCGYECGTSWGTKNGWIYGYTSE  266

Query  533  DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
            D  TG+ IH +GW+S  C P+PP FLG SP+GGPA+LTQQKRW T  L+IL  K +P I 
Sbjct  267  DVLTGLKIHARGWRSAECKPDPPAFLGCSPSGGPASLTQQKRWVTGLLEILFSKNNPFIA  326

Query  713  ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
             L  +L FRQCLAY++I+ W +R   E+CY+ LPAYCII NSHF PK+   +++  +S
Sbjct  327  TLTAKLQFRQCLAYMYILSWGLRLIPELCYTALPAYCIIANSHFLPKVEGTSLLDTSS  384



>ref|XP_010510001.1| PREDICTED: cellulose synthase-like protein B3 [Camelina sativa]
Length=766

 Score =   336 bits (861),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 196/485 (40%), Positives = 288/485 (59%), Gaps = 37/485 (8%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLL--GVKDEKDAEFVQFPQNFYGGLKDD  175
             VSG+MTNAP+MLN+DCD +VN+  VV  AMC  L   + +  +  FVQ+PQ+FY     D
Sbjct  280   VSGLMTNAPYMLNVDCDMYVNEADVVRQAMCIFLQNSISNSNNCAFVQYPQDFY-----D  334

Query  176   PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS---------  328
                +++ ++  Y+ RG AGIQG  Y G+GC H R+V+YG+    ++++ +S         
Sbjct  335   SNADELAVLQSYIGRGVAGIQGSIYAGSGCLHTRRVMYGISLDDLEDDGRSLSSVATRNY  394

Query  329   -TDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKV  505
               +++    FG SK    S    L     P+     + LEAA+EV  C YE  T+WG+ +
Sbjct  395   LAEENLAREFGNSKEMVTSVVNALQRKSNPQHSSLTDFLEAAQEVGHCDYENQTSWGKTI  454

Query  506   GLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDIL  685
             G LYGS  ED  T + IH +GW S Y  P+PP FLG  P+GGP A+ QQ+RW    L++L
Sbjct  455   GWLYGSTTEDVHTSLGIHSRGWTSSYISPDPPAFLGVMPSGGPEAMVQQRRWAAGLLEVL  514

Query  686   ICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEA  865
               K+SP+I   FG+L FRQ LAYL+I+ W +R   E+ Y LLPAYC+++ S   PK    
Sbjct  515   FNKRSPLIGVFFGKLRFRQSLAYLYILTWGLRSIPELFYCLLPAYCLLHTSALFPKGVYL  574

Query  866   AIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLS  1045
              I++  ++  ++ LY L+E++  G S+++W+ +Q   R+ ++ SWLFG    ++K  G+S
Sbjct  575   GIIV--TLVGMHCLYTLWEFMSLGFSIQSWFVSQSFWRIKSTCSWLFGIPDIILKFLGIS  632

Query  1046  EAVFEVTKK-------DHSSDEALDKDD--DSKVGRFTFDESPLFVPGTTILLVNLAALF  1198
             E VF VTKK       +  S ++  +DD  +   G+F FD S  F+PGT I+ VNLAAL 
Sbjct  633   ETVFVVTKKTMPEIRSESESGKSQQEDDCPNQNSGKFEFDGSFYFLPGTFIIFVNLAAL-  691

Query  1199  IGF-LDFKQN-------KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGG  1354
             +GF +D  Q         S  + EA   V V++++  FL G+F KGK+GIPLST+  +  
Sbjct  692   VGFSVDLLQQLSYSHGGSSSGMAEACGCVLVVMLFHPFLMGMFEKGKYGIPLSTLSIAAF  751

Query  1355  LALLF  1369
             LA+LF
Sbjct  752   LAVLF  756



>ref|XP_006410386.1| hypothetical protein EUTSA_v10016289mg [Eutrema salsugineum]
 gb|ESQ51839.1| hypothetical protein EUTSA_v10016289mg [Eutrema salsugineum]
Length=761

 Score =   334 bits (856),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 202/483 (42%), Positives = 288/483 (60%), Gaps = 35/483 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC FL G  ++    FVQFPQ+FY     D 
Sbjct  280   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCVFLEGSMNQDHCAFVQFPQDFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKST---------  331
                ++ ++  YL RG AGIQGP Y G+GCFH R+V+YG+ P+ +++N   +         
Sbjct  335   NAGELVVLQTYLVRGIAGIQGPIYAGSGCFHTRRVMYGLSPNDLEDNISLSSFATRKFLA  394

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             ++     FG SK    S    L     P+  +  NSLE AK V  C YE+ T+WG+ +G 
Sbjct  395   EESLARVFGNSKEMVTSVVDALQRKSNPQNSL-TNSLEVAKAVGHCNYEYQTSWGKTIGW  453

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  ED  T + IH +GW S Y  P PP FLG  P GGP A+ QQ+RW T  L++L  
Sbjct  454   LYDSTSEDVNTSIGIHSRGWTSSYLLPEPPAFLGCMPPGGPEAMLQQRRWATGLLEVLFN  513

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP+I     ++ FRQ LAYL+I+ W +R   E+ Y LLPAYC+++NS   PK     I
Sbjct  514   KQSPLIGMFCKKIRFRQSLAYLYILTWGLRSIPELVYCLLPAYCLLHNSSLFPKGVCLGI  573

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
             ++  ++  ++ LY L+E++  G S+++W+ +Q   R+  + SWLF  L  ++K+ G+S+ 
Sbjct  574   IV--TLVGMHCLYTLWEFMSLGFSVQSWYVSQSFWRIKTTSSWLFSILDIILKLLGVSKT  631

Query  1052  VFEVTKKDHSSDE--------ALDKDDD---SKVGRFTFDESPLFVPGTTILLVNLAALF  1198
             VF VTKK  S  +          DKDDD   +  G+F FD S  F+PGT I+L+NL A+ 
Sbjct  632   VFIVTKKTISETKLDSKDGSSQRDKDDDGPKADSGKFEFDGSLYFLPGTFIVLINLTAIA  691

Query  1199  IGFLDFKQ-NKSW-----SLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLA  1360
                +  ++ N S+     SL E    V V++++  FLKGLF KGK+GIPLST+ K+  LA
Sbjct  692   GFSMGLQRLNPSYKGGGSSLAEVCVCVLVVMLFLPFLKGLFEKGKYGIPLSTLSKASLLA  751

Query  1361  LLF  1369
             +LF
Sbjct  752   VLF  754



>ref|XP_010252474.1| PREDICTED: cellulose synthase-like protein H1 isoform X2 [Nelumbo 
nucifera]
Length=582

 Score =   328 bits (841),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 160/298 (54%), Positives = 204/298 (68%), Gaps = 11/298 (4%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VSGVMTN+PF+LN+DCD  VN+P+ +LHAMC LLG + EK++ FVQFPQ FY  LKDDP+
Sbjct  279  VSGVMTNSPFILNVDCDMFVNNPQTILHAMCLLLGFEQEKESGFVQFPQIFYRSLKDDPF  338

Query  182  GNQMKIIM-KYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFG  358
            GN   I+  K++  G  GIQGPFY GTGCFHRRKVIYG+ P     +E +       TFG
Sbjct  339  GNNQFIVFWKFIMPGIVGIQGPFYGGTGCFHRRKVIYGLSP-----DEATIQGAMETTFG  393

Query  359  KSKTFALSTTQILSGSLYPEIPIFPNSL----EAAKEVASCVYEFGTAWGQKVGLLYGSA  526
             S  F  S  QILSG +  +    P  L    EAA EVASCVYE+ T+WG++VG +YGSA
Sbjct  394  NSVHFMKSVPQILSG-IKDKTDCQPADLSSTEEAANEVASCVYEYNTSWGERVGWVYGSA  452

Query  527  GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
             ED  TG+ IH KGW+S YC P+PP FLG +P+GGPA LTQQKRW T  L+IL+   +PI
Sbjct  453  TEDVLTGLRIHSKGWRSGYCTPDPPAFLGDTPSGGPAILTQQKRWATGLLEILVSNYNPI  512

Query  707  IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIP  880
            +  + G+L  RQCL YL ++ WP+R   E+CY+LLP YCI+  ++F P +N  +   P
Sbjct  513  LGVIKGKLLIRQCLVYLSVIIWPLRALPELCYALLPPYCILTTTYFLPTVNSPSTSRP  570



>ref|XP_008342033.1| PREDICTED: cellulose synthase-like protein H1 isoform X3 [Malus 
domestica]
Length=680

 Score =   330 bits (846),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 183/396 (46%), Positives = 249/396 (63%), Gaps = 11/396 (3%)
 Frame = +2

Query  221   GTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN-EKSTDKDQWETFGKSKTFALSTTQIL  397
             G AGIQGP Y GTGCFHRRKVIYG+   + DN    ++++   E FG S     S TQIL
Sbjct  281   GLAGIQGPIYAGTGCFHRRKVIYGL--SLTDNEGNLTSERLNKECFGNSPELIRSATQIL  338

Query  398   SGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTKTGVSIHGKGWKS  577
                   ++     ++E A +VA   YE  T WG+KVG +YGS  ED  TG+ IH +GWKS
Sbjct  339   LEENIDQLDDLSCAVEIAYQVAGSEYEDDTLWGKKVGWVYGSVSEDVLTGMKIHARGWKS  398

Query  578   VYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRLHFRQCLAYL  757
             + C P PPGFLG+ P+     L Q+KRW T  L+IL  K  PI   L+ +L FRQCLAYL
Sbjct  399   ILCTPEPPGFLGTGPSTTHVMLIQRKRWITGLLEILFSKNCPIFATLYAKLEFRQCLAYL  458

Query  758   WIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLYGLFEYIETG  937
              I+ W +    ++CY+LLPAYCII NSHF PK+ E  ++I A++F+I +LY L  Y+++G
Sbjct  459   RILIWGLLSVPDLCYALLPAYCIITNSHFLPKVEEPTLIIFAALFLIKHLYTLHSYLDSG  518

Query  938   ESLRAWWNNQRM---LRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKD-HSSDEALDKD  1105
              S+RAWWN   +    ++    + LFG ++ V K+ G+SE  FEVT+K+ +SS    +  
Sbjct  519   RSIRAWWNQLTVGPWSKITTLTASLFGLVTVVFKLLGISEVTFEVTQKEQNSSSSDQEAT  578

Query  1106  DDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN----KSWSLGEAICSVWVIL  1273
              D+  GRFTFD + +FVP T +L +   AL    L  +          +GE +CSVWV+L
Sbjct  579   YDANAGRFTFDGTTIFVPATALLFLQFTALVTAALGLEPPALGVNGAGIGEMMCSVWVVL  638

Query  1274  MYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
              +W F+KGLFGKGK+GIP+ T++KS  LALLF H+C
Sbjct  639   CFWPFVKGLFGKGKYGIPMVTIVKSAVLALLFMHSC  674



>ref|XP_010469575.1| PREDICTED: cellulose synthase-like protein B3 [Camelina sativa]
Length=756

 Score =   332 bits (851),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 196/474 (41%), Positives = 277/474 (58%), Gaps = 25/474 (5%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLL--GVKDEKDAEFVQFPQNFYGGLKDD  175
             VSG+MTNAP+MLN+DCD +VN+  VV  AMC  L   + +  +  FVQ+PQ+FY     D
Sbjct  280   VSGLMTNAPYMLNVDCDMYVNEADVVRQAMCIFLQNSILNSNNCAFVQYPQDFY-----D  334

Query  176   PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGM-WPHVVDNNEKST-------  331
                +++ ++  YL RG AGIQG    G+GCF  R+V+YG+    + D+   S+       
Sbjct  335   SNADELAVLQSYLGRGIAGIQGSLCAGSGCFLSRRVMYGISLDDLEDDGSLSSVATRNYL  394

Query  332   -DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVG  508
              +K+    FG SK    S    L     P+     +SLEAA+EV  C YE  T+WG+ +G
Sbjct  395   AEKNLAREFGNSKEMVTSVVNALQRKPNPQHSSLTDSLEAAEEVGHCHYENQTSWGKTIG  454

Query  509   LLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILI  688
              LYGS  ED  T + IH +GW S +  P+PP FLG+ P+GGP A+ QQ+RW    L+IL 
Sbjct  455   WLYGSTTEDVHTSLGIHSRGWTSSFISPDPPAFLGAMPSGGPEAMLQQRRWAAGMLEILF  514

Query  689   CKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAA  868
              K+SP+I   FG+L FRQ LAYL+   W +R   E+ Y LLPAYC+++NS   PK     
Sbjct  515   SKRSPLIGVFFGKLRFRQSLAYLYAFTWGLRSIPELLYCLLPAYCLLHNSALFPKGVYLG  574

Query  869   IVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSE  1048
             I+I  ++  I+ LY L+E++  G S+++W+ +Q   R+  + SWLF     ++K  G+SE
Sbjct  575   III--TLVGIHCLYTLWEFMSLGFSVQSWFVSQSCGRIKTTCSWLFSIPDIILKFLGISE  632

Query  1049  AVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALF---IGFLD--  1213
              VF VT K      + D   +   G+F FD S  F+PGT I+LVNL AL    +G L   
Sbjct  633   TVFVVTTKTMPKSRSSDDCPNQDSGKFEFDGSLYFLPGTFIVLVNLTALVGCSVGLLQQL  692

Query  1214  --FKQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
                 +  S  L E    V V++++  FLKG+F KGK+GIP ST+ K+  LA+LF
Sbjct  693   SRSHRGGSSGLAEVCGCVLVVILFLPFLKGMFEKGKYGIPSSTLYKAAFLAVLF  746



>ref|XP_009107681.1| PREDICTED: cellulose synthase-like protein B6 [Brassica rapa]
Length=758

 Score =   332 bits (850),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 198/481 (41%), Positives = 282/481 (59%), Gaps = 34/481 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC FL   K      FVQFPQ FY     D 
Sbjct  280   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCVFLQKSKSPDRCAFVQFPQEFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN-------EKSTDK  337
               +++ ++  YL RG AGIQGP Y G+GCFH R+V+YG+ P  ++NN        K  D+
Sbjct  335   NSDELAVVQSYLGRGVAGIQGPLYCGSGCFHTRRVMYGLSPDNLENNGDLSSSATKFLDE  394

Query  338   DQW-ETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLL  514
             D     FG SK   +S  + L G   P+  +  + +EAA+ V  C YE  T WG+ +G L
Sbjct  395   DSLARKFGSSKELVISIVEALQGKSNPKTSL-TDFIEAAQMVGHCHYEHQTNWGKTLGCL  453

Query  515   YGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICK  694
             Y S  ED  T + IH +GW S Y  P+PP FLGS+P+ G  A+ QQ+RWGT A+++L  K
Sbjct  454   YDSVAEDMNTSIGIHLRGWSSSYICPDPPAFLGSTPSVGFEAIVQQRRWGTGAIEVLFNK  513

Query  695   KSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIV  874
             +SP+      ++ FRQ LAYLW++   +R   E+ Y LLPAYC++ N+   PK     + 
Sbjct  514   QSPLRGMFSSKIRFRQRLAYLWVL-MCLRSIPELFYCLLPAYCLLRNTALYPK--GPCLA  570

Query  875   IPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAV  1054
             I  +I +++ LY L+++I  G S+R+W+ +Q + R+ A+  WLF     ++K+ G+S   
Sbjct  571   ITVTIVVMHCLYTLWQFINNGFSVRSWYVSQSLWRILATCGWLFSIHDILLKLLGISNVG  630

Query  1055  FEVTKKDH------SSDEALDKDDDSK----VGRFTFDESPLFVPGTTILLVNLAALFIG  1204
             F V KK        S  E + + DD      + +F FD S  FVPGT I+LVN+AAL   
Sbjct  631   FVVAKKTTPKTMPISGYEPIQRQDDGPNSCYIHKFEFDNSCHFVPGTFIMLVNMAALASN  690

Query  1205  FLDFKQNKSWS------LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALL  1366
             F+  +++          L E    + VIL++  FLKGLF KGK+GIPLST+ K+  LA++
Sbjct  691   FVGLQRSCCHHEGGRSGLAENCACILVILLFLPFLKGLFAKGKYGIPLSTLSKAAVLAMI  750

Query  1367  F  1369
             F
Sbjct  751   F  751



>ref|XP_002879394.1| hypothetical protein ARALYDRAFT_902308 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55653.1| hypothetical protein ARALYDRAFT_902308 [Arabidopsis lyrata subsp. 
lyrata]
Length=757

 Score =   331 bits (849),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 199/484 (41%), Positives = 286/484 (59%), Gaps = 39/484 (8%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC FL    + K   FVQ+PQ+FY     D 
Sbjct  280   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCIFLQKSVNSKHCAFVQYPQDFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS----------  328
               +++ ++  YL +G AGIQGP Y G+GCFH R+V+YG+    +D+ E+           
Sbjct  335   NADELTVLQSYLGQGIAGIQGPIYAGSGCFHTRRVMYGL---SIDDLEEDGSLSSVAARK  391

Query  329   --TDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQK  502
                +++    FG SK    S  + L     P+     NSLEAA+EV  C YE+ T WG+ 
Sbjct  392   YLAEENLEREFGNSKEMVKSVVEALQRKPNPQ-NTLANSLEAAQEVGHCHYEYQTIWGKT  450

Query  503   VGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDI  682
             +G LY S  ED  T + IH +GW S Y  P PP FLG+ P GGP A+ QQ+RW T  L++
Sbjct  451   IGWLYESTAEDANTSIGIHSRGWTSSYISPEPPAFLGAMPPGGPEAMLQQRRWATGLLEV  510

Query  683   LICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE  862
             L  K+SP+I     ++ FRQ LAYL+I  W +R   E+ Y LLPAYC+++NS   PK   
Sbjct  511   LFNKQSPLIGMFCRKIRFRQTLAYLYIFTWGLRSIPELFYCLLPAYCLLHNSALFPKGVY  570

Query  863   AAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGL  1042
               I++  ++  ++ LY L+E++  G S+++W+ +Q   R+  + SWLF     ++K+ G+
Sbjct  571   LGIIV--TLVGMHCLYTLWEFMSLGFSVQSWFVSQSFWRIKTTCSWLFSIPDIILKLLGI  628

Query  1043  SEAVFEVTKKD-------HSSDEALDKDD--DSKVGRFTFDESPLFVPGTTILLVNLAAL  1195
             S+ VF VTKK          S ++  +DD  +   G+F FD S  F+PGT I+LVNLAA+
Sbjct  629   SKTVFIVTKKTMPKTMSGSGSGKSQREDDCPNKDSGKFEFDGSLYFLPGTFIVLVNLAAI  688

Query  1196  F---IGFLDFKQNK---SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGL  1357
                 +G           S  L EA  S+ V++++  FLKG+FGKGK+GIPLST+ K+  L
Sbjct  689   AGFSVGLHRLSHRHGGGSSGLAEACGSILVVMLFLPFLKGMFGKGKYGIPLSTISKAAFL  748

Query  1358  ALLF  1369
             A+LF
Sbjct  749   AVLF  752



>ref|XP_006427966.1| hypothetical protein CICLE_v10027629mg [Citrus clementina]
 ref|XP_006427967.1| hypothetical protein CICLE_v10027629mg [Citrus clementina]
 ref|XP_006427968.1| hypothetical protein CICLE_v10027629mg [Citrus clementina]
 gb|ESR41206.1| hypothetical protein CICLE_v10027629mg [Citrus clementina]
 gb|ESR41207.1| hypothetical protein CICLE_v10027629mg [Citrus clementina]
 gb|ESR41208.1| hypothetical protein CICLE_v10027629mg [Citrus clementina]
Length=394

 Score =   319 bits (818),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 176/386 (46%), Positives = 231/386 (60%), Gaps = 18/386 (5%)
 Frame = +2

Query  266   FHRRKVIYGMWPHVVDN--------NEKSTDKDQWETFGKSKTFALSTTQILSGSLYPEI  421
             F    +  G+WP  VD+        N K  D +  + FG SK F  S    L G  Y   
Sbjct  7     FIDEMLCMGLWPGEVDHQGKYVNEFNGKVADDELLKKFGNSKEFINSAAHALKGKAY-FT  65

Query  422   PIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPP  601
              I   SL+   +VA C YE  + WG+KVG LYGS  ED  TG+ IH KGW+S YC P+P 
Sbjct  66    SILSKSLDVVHQVAGCDYEHSSDWGKKVGFLYGSITEDMITGMMIHAKGWRSGYCSPDPR  125

Query  602   GFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRLHFRQCLAYLWIMGWPIR  781
              FLG      PAA++QQKRW T  L+IL  K +PI      +L FRQCLAYLWI+ W +R
Sbjct  126   AFLGCGALADPAAMSQQKRWATGFLEILFSKTNPIFACFTSKLQFRQCLAYLWILIWGLR  185

Query  782   PFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLYGLFEYIETGESLRAWWN  961
                E+CY+ LPAYCII NS F PK+ E  I IP ++ +IY +Y L +YI  G  + +WW 
Sbjct  186   SIPEVCYAALPAYCIITNSSFLPKIQELGICIPVTLIVIYKVYTLSDYIRIGFPIDSWWV  245

Query  962   NQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDEALD---KDDDSKVGRFT  1132
             N  M R++A+G+W  G L+ ++K  GLSE +FE+T+K H      D   +DDD    +  
Sbjct  246   NSCMERIFATGAWFLGLLNVILKFLGLSETIFEITQKFHQPRTPADDCGEDDD----KMI  301

Query  1133  FDESPLFVPGTTILLVNLAALFIGFLDFKQN--KSWSLGEAICSVWVILMYWAflkglfg  1306
             FDESP+F+PGTTILLV++ AL +  L  +    +   LGE  CS +V+L +  FL+GLF 
Sbjct  302   FDESPVFIPGTTILLVHVTALAMALLGLEAQGGQGTGLGEFFCSTYVVLCFLPFLQGLFR  361

Query  1307  kgkfgIPLSTVLKSGGLALLFFHACK  1384
             +GK+GIPL T+ KS  LALLF H CK
Sbjct  362   RGKYGIPLPTICKSSALALLFVHLCK  387



>ref|XP_010469576.1| PREDICTED: cellulose synthase-like protein B3 [Camelina sativa]
Length=766

 Score =   328 bits (840),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 193/484 (40%), Positives = 278/484 (57%), Gaps = 35/484 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLL--GVKDEKDAEFVQFPQNFYGGLKDD  175
             VSG+MTNAP+MLN+DCD +VN+  VV  AMC  L   + +  +  FVQ+PQ FY     D
Sbjct  280   VSGLMTNAPYMLNVDCDMYVNEADVVRQAMCIFLQNSISNSNNCAFVQYPQGFY-----D  334

Query  176   PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS---------  328
                + + ++  Y+ RG AGIQG  Y G+GCFH R+V+YG+    ++++ +S         
Sbjct  335   SNADGLAVLQSYIGRGIAGIQGSIYAGSGCFHTRRVMYGISFDDLEDDGRSLSSVATRNY  394

Query  329   -TDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKV  505
               +++    FG SK    S    L   L P+     + LEAA++V  C YE  T+WG+ +
Sbjct  395   LAEENLAREFGSSKEMVTSVVNALQRKLNPQHSSLTDFLEAAQKVGHCHYENQTSWGKTI  454

Query  506   GLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDIL  685
             G LYGS  ED  T + IH +GW S +  P+PP FLG+ P GGP A+ QQ+RW    L++L
Sbjct  455   GWLYGSTTEDVHTSLGIHSRGWTSSFISPDPPAFLGAMPPGGPEAMVQQRRWAAGMLEVL  514

Query  686   ICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEA  865
               K+SP+I   FG+L FRQ LAYL+I+ W +R   E+ Y LLPAYC++ NS   PK    
Sbjct  515   FNKRSPLIGVFFGKLRFRQSLAYLYILTWGLRSIPELFYCLLPAYCLLYNSALFPKGVYL  574

Query  866   AIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLS  1045
              I+    +  ++ LY L+E++  G S+++W+  Q   R+  + SWLF     ++K  G+S
Sbjct  575   GIIF--MLLGMHCLYTLWEFMNLGFSVQSWFVCQSCGRINTTCSWLFSIPDIILKFLGIS  632

Query  1046  EAVFEVTKK---------DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALF  1198
             E VF VTKK         ++   +  D   +   G+F FD S  F+PGT I+ VNLAAL 
Sbjct  633   ETVFVVTKKTMPEIRSESEYGKSQQEDDCPNQDSGKFEFDGSLYFLPGTFIVFVNLAALV  692

Query  1199  ---IGFLD----FKQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGL  1357
                +G L          S  + EA   V V++++  FL G+F KGK+GIPLST+ K+  L
Sbjct  693   GFSVGLLQRLSHSHGGSSSGMAEACGCVLVVMLFHPFLMGIFEKGKYGIPLSTLSKAAFL  752

Query  1358  ALLF  1369
             A+LF
Sbjct  753   AVLF  756



>gb|AAC25935.1| putative cellulose synthase [Arabidopsis thaliana]
Length=712

 Score =   326 bits (836),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 196/482 (41%), Positives = 281/482 (58%), Gaps = 39/482 (8%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC FL    +     FVQFPQ FY     D 
Sbjct  237   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCIFLQKSMNSNHCAFVQFPQEFY-----DS  291

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS----------  328
               +++ ++  YL RG AGIQGP Y G+GCFH R+V+YG+    +D+ E            
Sbjct  292   NADELTVLQSYLGRGIAGIQGPTYAGSGCFHTRRVMYGL---SIDDLEDDGSLSSLATRK  348

Query  329   --TDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQK  502
                +++    FG S     S  + L     P+     NSLEAA+EV  C +E+ T+WG+ 
Sbjct  349   YLAEENLAREFGNSNEMVTSVVEALQRKPNPQ-NTLANSLEAAQEVGHCHFEYQTSWGKT  407

Query  503   VGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDI  682
             +G LY S  ED  T + IH +GW S Y  P PP FLG+ P GGP A+ QQ+RW T  L++
Sbjct  408   IGWLYESTAEDANTSIGIHSRGWTSSYISPKPPAFLGAMPPGGPEAMLQQRRWATGLLEV  467

Query  683   LICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE  862
             L  K+SP+I     ++ FRQ LAYL+I  W +R   E+ Y LLPAYC+++N+   PK   
Sbjct  468   LFNKQSPLIGMFCRKIRFRQSLAYLYIFTWGLRSIPELIYCLLPAYCLLHNAALFPKGVY  527

Query  863   AAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGL  1042
               IV+  ++  ++ LY L+E++  G S+++W+ +Q   R+  + SWLF     ++K+ G+
Sbjct  528   LGIVV--TLVGMHCLYSLWEFMSLGFSVQSWFASQSFWRIKTTCSWLFSIPDIILKLLGI  585

Query  1043  SEAVFEVTKK-----------DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLA  1189
             S+ VF VTKK           + S  E    + DS  G+F FD S  F+PGT ILLVNLA
Sbjct  586   SKTVFIVTKKTMPKTMSGSGSEKSQREVDCPNQDS--GKFEFDGSLYFLPGTFILLVNLA  643

Query  1190  ALFIGFLDFKQNK--SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLAL  1363
             AL    +  ++++     L EA   + V++++  FLKG+F KGK+GIP ST+ K+  LA+
Sbjct  644   ALAGCSVGLQRHRGGGSGLAEACGCILVVILFLPFLKGMFEKGKYGIPWSTLSKAAFLAV  703

Query  1364  LF  1369
             LF
Sbjct  704   LF  705



>ref|NP_850190.1| cellulose synthase-like protein B3 [Arabidopsis thaliana]
 sp|Q8RX83.1|CSLB3_ARATH RecName: Full=Cellulose synthase-like protein B3; Short=AtCslB3 
[Arabidopsis thaliana]
 gb|AAL90907.1| At2g32530/T26B15.9 [Arabidopsis thaliana]
 gb|AAN72301.1| At2g32530/T26B15.9 [Arabidopsis thaliana]
 gb|AEC08697.1| cellulose synthase-like protein B3 [Arabidopsis thaliana]
 gb|AHL38821.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=755

 Score =   327 bits (838),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 196/482 (41%), Positives = 281/482 (58%), Gaps = 39/482 (8%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC FL    +     FVQFPQ FY     D 
Sbjct  280   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCIFLQKSMNSNHCAFVQFPQEFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS----------  328
               +++ ++  YL RG AGIQGP Y G+GCFH R+V+YG+    +D+ E            
Sbjct  335   NADELTVLQSYLGRGIAGIQGPTYAGSGCFHTRRVMYGL---SIDDLEDDGSLSSLATRK  391

Query  329   --TDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQK  502
                +++    FG S     S  + L     P+     NSLEAA+EV  C +E+ T+WG+ 
Sbjct  392   YLAEENLAREFGNSNEMVTSVVEALQRKPNPQ-NTLANSLEAAQEVGHCHFEYQTSWGKT  450

Query  503   VGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDI  682
             +G LY S  ED  T + IH +GW S Y  P PP FLG+ P GGP A+ QQ+RW T  L++
Sbjct  451   IGWLYESTAEDANTSIGIHSRGWTSSYISPKPPAFLGAMPPGGPEAMLQQRRWATGLLEV  510

Query  683   LICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE  862
             L  K+SP+I     ++ FRQ LAYL+I  W +R   E+ Y LLPAYC+++N+   PK   
Sbjct  511   LFNKQSPLIGMFCRKIRFRQSLAYLYIFTWGLRSIPELIYCLLPAYCLLHNAALFPKGVY  570

Query  863   AAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGL  1042
               IV+  ++  ++ LY L+E++  G S+++W+ +Q   R+  + SWLF     ++K+ G+
Sbjct  571   LGIVV--TLVGMHCLYSLWEFMSLGFSVQSWFASQSFWRIKTTCSWLFSIPDIILKLLGI  628

Query  1043  SEAVFEVTKK-----------DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLA  1189
             S+ VF VTKK           + S  E    + DS  G+F FD S  F+PGT ILLVNLA
Sbjct  629   SKTVFIVTKKTMPKTMSGSGSEKSQREVDCPNQDS--GKFEFDGSLYFLPGTFILLVNLA  686

Query  1190  ALFIGFLDFKQNK--SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLAL  1363
             AL    +  ++++     L EA   + V++++  FLKG+F KGK+GIP ST+ K+  LA+
Sbjct  687   ALAGCSVGLQRHRGGGSGLAEACGCILVVILFLPFLKGMFEKGKYGIPWSTLSKAAFLAV  746

Query  1364  LF  1369
             LF
Sbjct  747   LF  748



>ref|XP_006296344.1| hypothetical protein CARUB_v10025516mg [Capsella rubella]
 gb|EOA29242.1| hypothetical protein CARUB_v10025516mg [Capsella rubella]
Length=751

 Score =   327 bits (837),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 195/475 (41%), Positives = 282/475 (59%), Gaps = 28/475 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP++LN+DCD + N+  VV  AMC FL    +     FVQFPQ+FY     D 
Sbjct  279   VSGLMTNAPYILNVDCDMYANEADVVRLAMCVFLEKSLNPNHCAFVQFPQHFY-----DS  333

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---------EKST  331
               +Q+ ++  YL RG AGIQGP Y+GTGCFH R+ +Y + P  ++++         E   
Sbjct  334   NTDQLTVLQSYLVRGIAGIQGPMYVGTGCFHTRRAMYNLSPDDLEDDGSLSSVATRELLC  393

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             +      FG SK    S    L     P+  +  NS+EAA+EV  C YE  T+WG+ +G 
Sbjct  394   EDKLARGFGNSKEMMKSVADALQRKPNPQNNL-TNSIEAAQEVGHCHYEHQTSWGKTIGW  452

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  ED  T + IH +GW S Y  P+ P FLGS+P GGP A+ QQ+RW T  +++L  
Sbjct  453   LYDSVAEDLNTSIGIHSRGWTSSYISPDTPAFLGSTPPGGPEAMLQQRRWATGWIEVLFN  512

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP++     +L FRQ LAYL +    +R   E+ Y LLP+YC+++NS   PK     I
Sbjct  513   KQSPLLGMFRRKLRFRQRLAYLCV-SVCLRSIPELLYCLLPSYCLLHNSTLFPKGLYLGI  571

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
              I  ++  ++ +Y L+E++  G S+R+W+ +Q + R+ A+ SWLF  +  ++K+ G+S+ 
Sbjct  572   TI--TLVGMHCIYTLWEFMSLGYSVRSWYVSQSLWRIIATSSWLFSIVDIILKLLGISKT  629

Query  1052  VFEVTKK---DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ  1222
             VF  TKK   +     ++ KDD S  G+F FD S  F+PGT I+LVNLAAL +  +  +Q
Sbjct  630   VFFTTKKTLPETKCGPSIRKDDGSNSGKFEFDGSLYFLPGTFIVLVNLAALAVFSMRLQQ  689

Query  1223  NKSWS------LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
             +          L EA   + V+ ++  FLKGLF KGK+GIPLST+ K+  LA+LF
Sbjct  690   SGCSHGRGGSGLAEACGCILVVTLFLPFLKGLFTKGKYGIPLSTLCKAAFLAVLF  744



>ref|XP_010413973.1| PREDICTED: cellulose synthase-like protein B2 [Camelina sativa]
Length=749

 Score =   327 bits (837),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 196/473 (41%), Positives = 279/473 (59%), Gaps = 27/473 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC FL G  +     FVQ+PQ  Y     D 
Sbjct  280   VSGLMTNAPYMLNVDCDVYANEADVVRQAMCVFLQGSSNPNHCAFVQYPQESY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWET--  352
               + + +   ++ RG AGIQGP Y+G+GCFH R+V+YG+ P  V+ N   +     E   
Sbjct  335   TTDTLTVFQSFMVRGLAGIQGPIYLGSGCFHTRRVMYGLSPEDVEANGSLSSLATRELLA  394

Query  353   -------FGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
                    FG SK    S  + L     P+  I  NS+EAA+EV  C YE+ T WG+ +G 
Sbjct  395   ADSLPRGFGNSKEMVKSVVEALQIKSNPQ-HILTNSIEAAQEVGHCDYEYQTNWGKTIGW  453

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  ED  T + IH +GW S Y  PNPP FLGS P     AL QQ+RW T ++++L  
Sbjct  454   LYDSMTEDLNTSIDIHSRGWTSSYVSPNPPAFLGSMPAEVSEALLQQRRWLTGSMEVLFN  513

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP++     +L FRQ LAYL ++   +R   E+ Y LLPAYC+++NS   PK     I
Sbjct  514   KQSPLLGMFRRKLRFRQRLAYLCVLVC-LRSIPELFYCLLPAYCLLHNSVLFPKGACLGI  572

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
             +I  ++  +++LY L+E++  G S+++W  +Q + R+ A+ SWLF      +K+FG+S+ 
Sbjct  573   II--TLLGMHSLYTLWEFMSLGYSIQSWLVSQSLWRIIATSSWLFSIFDITLKLFGISKT  630

Query  1052  VFEVTKKDHSSD-------EALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
             VF +TKK  S          +  +DD    G+F FD S  F+PGT I+LVNLAAL +  +
Sbjct  631   VFIITKKTMSETIEGSGLRPSQGEDDGPNSGKFEFDGSVYFLPGTFIVLVNLAALAVFSV  690

Query  1211  DFKQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
              +       L EA   + V+++++ FLKGLF KGK+GIPLST+ K+  LA+LF
Sbjct  691   GYSLGNP-GLAEACGCILVVILFFPFLKGLFEKGKYGIPLSTLCKAAFLAVLF  742



>ref|XP_006293362.1| hypothetical protein CARUB_v10022674mg, partial [Capsella rubella]
 gb|EOA26260.1| hypothetical protein CARUB_v10022674mg, partial [Capsella rubella]
Length=785

 Score =   325 bits (832),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 196/480 (41%), Positives = 278/480 (58%), Gaps = 31/480 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLL--GVKDEKDAEFVQFPQNFYGGLKDD  175
             +SG+MTNAP+MLN+DCD + N+  VV  AMC  L     +  D  FVQ+PQ+FY     D
Sbjct  306   LSGMMTNAPYMLNVDCDMYANEADVVGQAMCIFLQKSTMNSNDCAFVQYPQDFY-----D  360

Query  176   PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHV---------VDNNEKS  328
                +++ ++  Y+ RG AGIQGP Y G+GCFH R+V+YG++            V   +  
Sbjct  361   SNADELIVLQAYVSRGIAGIQGPSYAGSGCFHTRRVMYGIYLDDLDDDGSLSSVATRDYL  420

Query  329   TDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVG  508
              + +    FG SK    S    L      ++    +SLEAA+EV  C YE  T+WG+ VG
Sbjct  421   AEDNLAREFGNSKEMVTSVVNALQRKSNRQLSSLTDSLEAAREVGHCHYENQTSWGKTVG  480

Query  509   LLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILI  688
              LYGS  ED  T V IH +GW S Y  P+PP FLG+ P GG  A+ QQ+RW    L+IL 
Sbjct  481   WLYGSTTEDVHTSVGIHSRGWTSSYISPDPPAFLGAMPPGGQEAMAQQRRWAAGMLEILF  540

Query  689   CKK-SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEA  865
              K+ +P +   F +L FRQCLAYL+++ W +R   E+ Y LLPAYC+++NS   PK    
Sbjct  541   NKRTTPFVGMFFRKLRFRQCLAYLYVLVWGLRSIPELFYCLLPAYCLLHNSALFPKGVYL  600

Query  866   AIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLS  1045
              ++I  ++  IY LY L+E++  G ++++W+ +Q   R+  +  WLF     ++K FG+S
Sbjct  601   GVII--AVVGIYCLYTLWEFMILGFTVQSWFISQSFGRIKITCGWLFSIPDIILKFFGIS  658

Query  1046  EAVFEVTKK----DHSSDEALDKDD--DSKVGRFTFDESPLFVPGTTILLVNLAALF---  1198
             + VF VTKK      S   +  K D  D   G+F F +S  F+PGT I+LVNLAAL    
Sbjct  659   KTVFIVTKKTMPETRSESRSGSKADCPDQDSGKFEFGDSLYFLPGTFIMLVNLAALAGWS  718

Query  1199  --IGFLDFKQNKSWS-LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
               +  L     +  S L EA   V V+ +++ FLKG+F KGK+GIP ST+ K+  LA+LF
Sbjct  719   AGLQRLGHSHKEGGSGLAEACGCVLVVTLFFPFLKGMFEKGKYGIPFSTLSKAAFLAVLF  778



>ref|NP_180813.1| cellulose synthase-like protein B4 [Arabidopsis thaliana]
 sp|O80891.1|CSLB4_ARATH RecName: Full=Cellulose synthase-like protein B4; Short=AtCslB4 
[Arabidopsis thaliana]
 gb|AAC25936.1| putative cellulose synthase [Arabidopsis thaliana]
 gb|AEC08698.1| cellulose synthase-like protein B4 [Arabidopsis thaliana]
 gb|AHL38820.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=755

 Score =   323 bits (829),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 199/480 (41%), Positives = 279/480 (58%), Gaps = 35/480 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD +VN+  VV  AMC FL    D     FVQ+PQ+FY     D 
Sbjct  280   VSGLMTNAPYMLNVDCDMYVNEADVVRQAMCIFLQKSMDSNHCAFVQYPQDFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGM-WPHVVDNNEKST--------  331
                ++ ++  YL RG AGIQGP Y G+GCFH R+V+YG+    + D+   S+        
Sbjct  335   NVGELTVLQLYLGRGIAGIQGPQYAGSGCFHTRRVMYGLSLDDLGDDGSLSSIATRKYLA  394

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             ++     FG SK    S    L    +P+  +  +SLE A+E+  C YE+ T+WG+ +G 
Sbjct  395   EESLTREFGNSKEMVKSVVDALQRKPFPQKNL-KDSLETAQEMGHCHYEYQTSWGKNIGW  453

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  ED  T + IH +GW S Y  P+PP FLG  P GGP  + QQ+RW T  L+IL  
Sbjct  454   LYDSTTEDVNTSIGIHSRGWTSSYIFPDPPAFLGCMPQGGPEVMVQQRRWATGLLEILFN  513

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP+I     ++ FRQ LAYL++  W +R   E+ Y LLPAYC+++NS   PK     I
Sbjct  514   KQSPLIGMFCRKIRFRQSLAYLYVFSWGLRSIPELFYCLLPAYCLLHNSALFPKGVYLGI  573

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
             +I  ++  I+ LY L+E++  G S+++W+  Q   R+  + SWLF  L  ++K+ G+S+ 
Sbjct  574   II--TLVGIHCLYTLWEFMNLGFSIQSWYVTQSFGRIKTTCSWLFSVLDVILKLLGISKT  631

Query  1052  VFEVTKK-----------DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAAL-  1195
             VF VTKK             S  E    + DS  G+F FD S  F+PGT I+LVNLAAL 
Sbjct  632   VFIVTKKTMPETKSGSGSKKSQREVDCPNQDS--GKFEFDGSLYFLPGTFIVLVNLAALA  689

Query  1196  --FIGFLDFKQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
                +G L  +      L EA   + V++++  FLKG+F KGK+GIP ST+ K+  LA LF
Sbjct  690   GCLVG-LQSRGGGGSGLAEACGCILVVILFLPFLKGMFEKGKYGIPFSTLSKAAFLAALF  748



>ref|XP_002879400.1| hypothetical protein ARALYDRAFT_320998 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55659.1| hypothetical protein ARALYDRAFT_320998 [Arabidopsis lyrata subsp. 
lyrata]
Length=750

 Score =   323 bits (828),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 202/475 (43%), Positives = 280/475 (59%), Gaps = 29/475 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP++LN+DCD + ND  VV  A+C FL    + K   FVQF Q FY     D 
Sbjct  281   VSGLMTNAPYILNVDCDMYANDADVVRQAICIFLEKSLNPKHCAFVQFLQEFY-----DS  335

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH---------VVDNNEKST  331
               +Q+ ++  YL RG AGIQGP Y+G+GC H R+V+YG+ P          +V   E   
Sbjct  336   NTSQIVVLQSYLGRGIAGIQGPIYIGSGCVHTRRVMYGLSPDDLEGDGSLSLVATREFLV  395

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             +      FG SK    S    +  +  P+  I  NS+EAA+EV  C YE+ T+WG  +G 
Sbjct  396   EDSLARRFGNSKEMVKSVVGAIQRNPNPQ-NILTNSIEAAQEVGHCHYEYQTSWGNTIGW  454

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  ED  T + IH +GW S Y  P+ P FLGS P G P AL QQ+RW T  ++IL  
Sbjct  455   LYDSVAEDLNTSIGIHSRGWTSSYISPDTPAFLGSMPQGVPEALLQQRRWATGWIEILFN  514

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP+      ++ FRQ LAYL I+   +R   E+ Y LLPAYC+++NS   PK     I
Sbjct  515   KQSPLRGMFCKKIRFRQRLAYLCIIT-SLRSIPELIYCLLPAYCLLHNSALFPKGTYLGI  573

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
              I  ++  ++ LY L+E++  G S+++W  +Q + R+ A+ SWLF      +K+ G+SE 
Sbjct  574   TI--TLVGMHCLYTLWEFVNLGYSVQSWLVSQSVWRIVATSSWLFSIFDITLKLLGISET  631

Query  1052  VFEVTKKDHSSDEALDKDD--DSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN  1225
             VF +TKK   +  +  +DD  +S   +F FD S  F+PGT I+LVNLAAL + F    Q 
Sbjct  632   VFIITKKTVPAGPSEGEDDGPNSDSSKFEFDGSLHFLPGTFIVLVNLAALAV-FTVGLQR  690

Query  1226  KSWSLG-------EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
              S+S G       EA   V V+++++ FLKGLF KGK+GIPLST+ K+G LA+LF
Sbjct  691   SSYSHGRGSSGMAEACVCVLVMMLFFPFLKGLFEKGKYGIPLSTLSKAGFLAVLF  745



>ref|XP_002879395.1| hypothetical protein ARALYDRAFT_482180 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55654.1| hypothetical protein ARALYDRAFT_482180 [Arabidopsis lyrata subsp. 
lyrata]
Length=758

 Score =   322 bits (826),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 198/482 (41%), Positives = 282/482 (59%), Gaps = 36/482 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC FL    +     FVQ+PQ+FY     D 
Sbjct  280   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCIFLQKSMNSNHCAFVQYPQDFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGM-WPHVVDNNEKST--------  331
               +++ ++  YL RG AGIQGP Y G+GCFH R+V+YG+    + D+   S+        
Sbjct  335   NADELTVLQLYLGRGIAGIQGPLYGGSGCFHTRRVMYGLSLDDLEDDGSLSSIATRKYLA  394

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKV--  505
             ++     FGKSK    S    L    Y       +SLEAA+EV  C YE+ T+WG  V  
Sbjct  395   EESLAREFGKSKEMVKSVVDALQRKSYLH-NTLKDSLEAAQEVGHCHYEYQTSWGNTVIN  453

Query  506   -GLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDI  682
              G LY S  ED  T + IH +GW S Y  P+PP FLG  P GGP A+ QQ+RW T  L++
Sbjct  454   IGWLYDSTAEDVNTSIGIHSRGWTSSYILPDPPAFLGCMPQGGPEAMVQQRRWATGLLEV  513

Query  683   LICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE  862
             L  K+SP+I     ++ FRQ +AYL++  W +R   E+ Y LLPAYC+++NS   PK   
Sbjct  514   LFNKQSPLIGMFRRKIRFRQSMAYLYVFSWGLRSIPELFYCLLPAYCVLHNSALFPKGVY  573

Query  863   AAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGL  1042
               I++  ++  ++ LY L+E++  G S+++W+ +Q   R+  + SWLF  L  ++K+ G+
Sbjct  574   LGIIV--TLVGMHCLYTLWEFMSLGFSVQSWYVSQSFGRIKTTCSWLFSILDIILKLLGI  631

Query  1043  SEAVFEVTKK-----------DHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLA  1189
             S+ VF VTKK           + S  E    + DS  G+F FD S  F+PGT I+LVNLA
Sbjct  632   SKTVFIVTKKTMPETKSGSGSEKSQGEVDCPNKDS--GKFEFDGSLYFLPGTFIVLVNLA  689

Query  1190  ALFIGFLDFKQN--KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLAL  1363
             AL    +  +++      L EA   + V++++  FLKG+F KGKFGIPLST+ K+  LA+
Sbjct  690   ALAGCLVGLQRHGGGGSGLAEACGCILVVILFLPFLKGMFEKGKFGIPLSTLSKAAFLAV  749

Query  1364  LF  1369
             LF
Sbjct  750   LF  751



>ref|XP_010451508.1| PREDICTED: cellulose synthase-like protein B6 [Camelina sativa]
Length=756

 Score =   322 bits (824),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 196/481 (41%), Positives = 285/481 (59%), Gaps = 36/481 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC FL   K+  +  FVQFPQ FY     D 
Sbjct  280   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCVFLQNAKNSNNCAFVQFPQEFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---------EKST  331
             Y ++  ++  YL RG  GIQGP Y G+GCFH R+V+YG+    + +N         E   
Sbjct  335   YASEFSVLQSYLGRGVGGIQGPIYCGSGCFHIRRVMYGLSTDDLKDNGSLSSLATSEFLA  394

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             ++     +G SK    S T  L     P+  +  N +EAA+EV  C YE+ T+WG  +G 
Sbjct  395   EESLVRKYGTSKELLKSVTDALQRKSNPQSSL-TNFIEAAQEVGHCHYEYNTSWGN-LGW  452

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LYGS G+D KT + IH KGW S +  P+PP FLGS+P+ G   + QQ+RW T A ++L  
Sbjct  453   LYGSVGDDIKTSIEIHMKGWTSSFISPDPPAFLGSTPSVGLETIVQQRRWATGATEVLFS  512

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP+I     ++ FRQ LAY WI+   IR   E+ Y LLPAYC+++NS   PK     I
Sbjct  513   KQSPLI-GFRRKIIFRQRLAYFWIL-MCIRSTPELIYCLLPAYCLLHNSTLFPKGPCLGI  570

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
             ++  ++  ++ L  L+++++ G S+++W+ +Q + R+ A+ SWLF     ++K+FG+SE 
Sbjct  571   IV--TLVGMHCLNSLWQFMKLGFSVQSWYVSQSLWRIIATSSWLFSIQDIILKLFGISEV  628

Query  1052  VFEVTKKDHSSDEALD-------KDD--DSKVGRFTFDESPLFVPGTTILLVNLAALFIG  1204
              F + KK     +++D       +DD   S +G+F FD S  F+PGT I+LVNLAAL   
Sbjct  629   GFVIAKKTMPDSKSVDGSKPSQGEDDGPKSDLGKFEFDSSCHFIPGTFIMLVNLAALAEF  688

Query  1205  FLDFKQNKSWSLG------EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALL  1366
              +   Q+     G      EA   + V+++++ FLKGLF  GK+GIPLST+ K+  L LL
Sbjct  689   LVRLLQSSCSHGGDGSGFVEACGCIVVVMLFFPFLKGLFEHGKYGIPLSTLFKAAFLTLL  748

Query  1367  F  1369
             F
Sbjct  749   F  749



>ref|XP_002868214.1| hypothetical protein ARALYDRAFT_329979 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44473.1| hypothetical protein ARALYDRAFT_329979 [Arabidopsis lyrata subsp. 
lyrata]
Length=755

 Score =   321 bits (823),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 195/480 (41%), Positives = 279/480 (58%), Gaps = 35/480 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+P VV  AMC FL   K+     FVQFPQ FY     D 
Sbjct  280   VSGLMTNAPYMLNVDCDMYANEPDVVRQAMCVFLENSKNSNHCAFVQFPQEFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWE---  349
             Y N+  ++  YL RG AGIQGP Y G+GCFH R+V+YG+    +++N   +    WE   
Sbjct  335   YTNEFAVLQSYLGRGVAGIQGPIYCGSGCFHTRRVMYGLSSDDLEDNGSLSSVATWEFLD  394

Query  350   ------TFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
                    +G SK    S    L    YP+  +    +EAA+EV  C YE+ T+WG  +G 
Sbjct  395   EDSLVRKYGSSKEMVKSVVGALQLKSYPQKSL-TYFIEAAQEVGHCHYEYQTSWGN-LGW  452

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  ED  T + IH +GW S +  P+PP FLGS+P+ G  A+ QQ+RW T A+++L  
Sbjct  453   LYDSVAEDINTSIGIHLRGWTSSFVSPDPPAFLGSTPSVGLEAIVQQRRWATGAIEVLFN  512

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP+I    G++ FRQ LAY W++   +    E+ Y LLPAYC+++NS   PK     +
Sbjct  513   KQSPLIGMFRGKIKFRQRLAYFWVLIC-LSSIPELIYFLLPAYCLLHNSALFPK--GPCL  569

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
              + A++  ++ LY L++++  G S+++W+  Q + R+ A+ SWLF     ++K+  +S+ 
Sbjct  570   CLTATLVGMHCLYSLWQFMNLGFSVQSWYVAQSIWRIIATSSWLFSIQDIILKLLRISKI  629

Query  1052  VFEVTKKD-------HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
              F + KK        + S +  D    S +G+F FD S  F+PGT I+LVNLAAL  GFL
Sbjct  630   GFVIAKKTMPETRSVYESSQGEDDVPKSDLGKFEFDSSCHFIPGTFIMLVNLAAL-AGFL  688

Query  1211  DFKQN-------KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
                Q            L EA   + VI+++  FLKGLF  GK+GIPLST+ K+  L +LF
Sbjct  689   VRLQRSSCSHGGGGSGLAEACGCILVIMLFHPFLKGLFEHGKYGIPLSTLSKAAFLTVLF  748



>sp|O23386.2|CSLB6_ARATH RecName: Full=Cellulose synthase-like protein B6; Short=AtCslB6 
[Arabidopsis thaliana]
Length=757

 Score =   321 bits (823),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 194/485 (40%), Positives = 287/485 (59%), Gaps = 41/485 (8%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+P VV  AMC FL   K+     FVQFPQNFY     D 
Sbjct  280   VSGLMTNAPYMLNVDCDMYANEPDVVRQAMCVFLQNSKNSNHCAFVQFPQNFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---------EKST  331
             Y N++ ++  Y+ RG AGIQGP Y+G+GCFH R+V+YG+    ++++         E  +
Sbjct  335   YTNELVVLQHYMKRGVAGIQGPIYIGSGCFHTRRVMYGLSSDDLEDDGSLSSVASREFLS  394

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             +      +G SK    S    L     P+  +  N +EAA+EV  C YE+ T+WG  +G 
Sbjct  395   EDSLVRKYGSSKELVKSVVDALQRKSNPQKSL-ANLVEAAQEVGHCHYEYQTSWGN-LGW  452

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  EDT T + IH +GW S +  P+PP FLGS+P+ GP A+ Q +RW T ++++L  
Sbjct  453   LYDSVAEDTNTSIGIHLRGWTSSFISPDPPAFLGSTPSVGPEAIVQHRRWATGSIEVLFN  512

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP+I     ++ FRQ LAY W++   IR   E+ Y LLPAYC++NNS   PK     I
Sbjct  513   KQSPLI-GFRRKIKFRQRLAYFWVL-MCIRSIPELVYCLLPAYCLLNNSALFPKGPCLGI  570

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
             ++  ++  ++ LY L++++  G S+++W+ +Q + R+ A+ SWLF     ++K+ G+S+ 
Sbjct  571   IV--TLVGMHCLYTLWQFMILGFSVKSWYVSQSLWRIIATSSWLFSIQDIILKLLGISKI  628

Query  1052  VFEVTKKD--------HSSDEALDKDDDS---KVGRFTFDESPLFVPGTTILLVNLAALF  1198
              F V KK+         S  +    +DD    ++G+F FD S  F+PGT I+LVNLAAL 
Sbjct  629   GFIVAKKNMPETRSGYESKSKPSQGEDDGLKLELGKFEFDSSCHFIPGTFIMLVNLAAL-  687

Query  1199  IGFLDFKQN--------KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGG  1354
              GFL   Q            +L E      ++++++ FLKGLF  GK+GIPLST+ K+  
Sbjct  688   AGFLVRLQRSSYSHGGGGGSALAETCGCAMIVMLFFPFLKGLFEHGKYGIPLSTLSKAAF  747

Query  1355  LALLF  1369
             L +LF
Sbjct  748   LTVLF  752



>gb|AAQ22621.1| At4g15290 [Arabidopsis thaliana]
Length=661

 Score =   318 bits (816),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 193/486 (40%), Positives = 280/486 (58%), Gaps = 37/486 (8%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+ LN+DCD + N+P VV  AMC FL   K+     FVQFPQ FY     D 
Sbjct  184   VSGLMTNAPYTLNVDCDTYANEPDVVRQAMCVFLQNSKNSNHCAFVQFPQKFY-----DS  238

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---------EKST  331
             Y N++ ++   L RG AGIQGPFY+GTGCFH R+V+YG+    +++N         E   
Sbjct  239   YTNELAVLQSILGRGVAGIQGPFYIGTGCFHTRRVMYGLSSDDLEDNGNISQVATREFLA  298

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             +      +G SK    S    L     P+  +  N +EAA+EV  C YE+ T+WG  +G 
Sbjct  299   EDSLVRKYGNSKELVKSVVDALQRKSNPQKSL-ANLIEAAQEVGHCHYEYQTSWGN-LGW  356

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             +Y S  ED  T V IH +GW S +  P+PP F+GS+PT G  A+ QQ+RW T A+++L  
Sbjct  357   MYDSVAEDINTSVGIHLRGWTSSFISPDPPAFIGSTPTLGLEAIVQQRRWATGAIEVLFN  416

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP +    G++ FRQ LAY W +   +R   E+ Y LLPAYC++++S   PK     +
Sbjct  417   KQSPFMGMFHGKIKFRQRLAYFWAL-MCLRSIPELIYCLLPAYCLLHDSALFPK--GPCL  473

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
                 ++  ++ LY L++++  G S+++W+  Q + R+ A+ SWLF     ++K+ G+S+ 
Sbjct  474   CTIVTLVGMHCLYSLWQFMSLGFSVQSWYVVQSLWRIIATSSWLFSIQDIILKLLGISQI  533

Query  1052  VFEVTKKD-------HSSDEALDKDDDSK--VGRFTFDESPLFVPGTTILLVNLAALFIG  1204
              F + KK        + S  +  +DD  K  +G+F FD S LF+PGT I+LVNLAAL  G
Sbjct  534   GFVIAKKTIPETKSVYESKPSQGEDDVPKLNLGKFEFDSSGLFIPGTFIMLVNLAAL-AG  592

Query  1205  FLDFKQN-------KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLAL  1363
             +L   Q            L EA   + V++++  FLKGLF  GK+ IPLST+ K+  L +
Sbjct  593   YLVRLQRSSCSHGGGGSGLAEACGCILVVMLFLPFLKGLFEHGKYSIPLSTLSKAAFLTV  652

Query  1364  LFFHAC  1381
             LF   C
Sbjct  653   LFVFFC  658



>ref|XP_009141247.1| PREDICTED: cellulose synthase-like protein B3 [Brassica rapa]
Length=759

 Score =   320 bits (820),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 200/485 (41%), Positives = 275/485 (57%), Gaps = 41/485 (8%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC F+ G  +     FVQFPQ FY     D 
Sbjct  280   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCIFMEGSMNPNHCAFVQFPQKFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWET--  352
               +++ ++  Y+ RG AGIQGP Y G+GCFH R+V+YG+    VD+ E+  +     T  
Sbjct  335   NSDEIVVLQSYVGRGFAGIQGPVYAGSGCFHTRRVMYGL---SVDDLEEDRNLSSVATRK  391

Query  353   ----------FGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQK  502
                       FGKSK    S    L     P+  +  NS E A+ V  C YE+ T+WG+ 
Sbjct  392   LLAAERLERDFGKSKEMVKSVVDALQRKSNPQDTLI-NSSEPAQAVGHCHYEYQTSWGKT  450

Query  503   VGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDI  682
             VG LY S  ED  T + IH +GW S Y  P PP FLG  P GGP A+ QQ+RW T  L+I
Sbjct  451   VGWLYDSTTEDAHTSIGIHSRGWTSSYISPEPPAFLGCMPPGGPEAMLQQRRWATGLLEI  510

Query  683   LICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE  862
             L  K++P+  +   ++ FRQ LAYL+I  W +R   E+ Y LLPAYC+++ S   PK   
Sbjct  511   LFTKQNPLNGSSCKKIRFRQSLAYLYIFTWGLRSIPELFYCLLPAYCVLHGSALFPKGVC  570

Query  863   AAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGL  1042
               IV   ++  ++ LY L+E++  G S+ +W+ +Q   R+  +GSWLF     ++K+ G+
Sbjct  571   LGIVF--TLVGMHCLYTLWEFMSLGFSVHSWYASQSFWRIKTTGSWLFSIPDIILKLLGV  628

Query  1043  SEAVFEVTKKD------HSSDEALDKDDDSK---VGRFTFDESPLFVPGTTILLVNLAAL  1195
             S  +F VTKK        S D    K+DD       +F FD S  F+PGT ILLVNL A+
Sbjct  629   SNTIFIVTKKTISKTRLESGDRPSQKEDDGSNPDSNKFEFDGSLYFLPGTFILLVNLTAI  688

Query  1196  FIGFLDFKQNKSWSLG-------EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGG  1354
               GF    Q  S S G       +A   + V++++  FL GLF KGK+GIPLST+ K+  
Sbjct  689   -AGFSMGLQRSSRSYGGNGSSMIDACGCILVVILFLPFLIGLFEKGKYGIPLSTLSKAAF  747

Query  1355  LALLF  1369
             LA+LF
Sbjct  748   LAVLF  752



>gb|ABB47240.2| Cellulose synthase family protein, expressed [Oryza sativa Japonica 
Group]
Length=570

 Score =   315 bits (806),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 190/286 (66%), Gaps = 1/286 (0%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VS +MTNAPFMLNLDCD  VN+P+VVLHAMC LLG  DE    FVQ PQ FYG LKDDP+
Sbjct  281  VSALMTNAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPF  340

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
            GNQ+++ +  + RG AG+QG FY GTGCFHRRKVIYGM          S++K+    FG 
Sbjct  341  GNQLEVSLMKVGRGIAGLQGIFYCGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGS  400

Query  362  SKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
            S  F  S   ++ G+L  E I    + ++ AKEVA+C YE GT WGQ+VG +YGS  ED 
Sbjct  401  SNNFKESARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDV  460

Query  539  KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
             TG  IH  GW+S   +  PP F+G +P GGPA LTQ KRW +  L+ILI + +PI+   
Sbjct  461  LTGQRIHAAGWRSTLMEIEPPAFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTT  520

Query  719  FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKL  856
            F  L FRQCLAYL    WP+R  FE+CY+LL  YC+++N  F PK+
Sbjct  521  FKSLQFRQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPKV  566



>gb|ABB47241.1| Cellulose synthase family protein, expressed [Oryza sativa Japonica 
Group]
Length=572

 Score =   314 bits (805),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 189/285 (66%), Gaps = 1/285 (0%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VS +MTNAPFMLNLDCD  VN+P+VVLHAMC LLG  DE    FVQ PQ FYG LKDDP+
Sbjct  281  VSALMTNAPFMLNLDCDMFVNNPRVVLHAMCLLLGFDDEISCAFVQTPQKFYGALKDDPF  340

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
            GNQ+++ +  + RG AG+QG FY GTGCFHRRKVIYGM          S++K+    FG 
Sbjct  341  GNQLEVSLMKVGRGIAGLQGIFYCGTGCFHRRKVIYGMRTGREGTTGYSSNKELHSKFGS  400

Query  362  SKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
            S  F  S   ++ G+L  E I    + ++ AKEVA+C YE GT WGQ+VG +YGS  ED 
Sbjct  401  SNNFKESARDVIYGNLSTEPIVDISSCVDVAKEVAACNYEIGTCWGQEVGWVYGSLTEDV  460

Query  539  KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
             TG  IH  GW+S   +  PP F+G +P GGPA LTQ KRW +  L+ILI + +PI+   
Sbjct  461  LTGQRIHAAGWRSTLMEIEPPAFMGCAPNGGPACLTQLKRWASGFLEILISRNNPILTTT  520

Query  719  FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPK  853
            F  L FRQCLAYL    WP+R  FE+CY+LL  YC+++N  F PK
Sbjct  521  FKSLQFRQCLAYLHSYVWPVRAPFELCYALLGPYCLLSNQSFLPK  565



>dbj|BAE99708.1| cellulose synthase like protein [Arabidopsis thaliana]
Length=757

 Score =   319 bits (818),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 193/486 (40%), Positives = 280/486 (58%), Gaps = 37/486 (8%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+ LN+DCD + N+P VV  AMC FL   K+     FVQFPQ FY     D 
Sbjct  280   VSGLMTNAPYTLNVDCDMYANEPDVVRQAMCVFLQNSKNSNHCAFVQFPQKFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---------EKST  331
             Y N++ ++   L RG AGIQGPFY+GTGCFH R+V+YG+    +++N         E   
Sbjct  335   YTNELAVLQSILGRGVAGIQGPFYIGTGCFHTRRVMYGLSSDDLEDNGNISQVATREFLA  394

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             +      +G SK    S    L     P+  +  N +EAA+EV  C YE+ T+WG  +G 
Sbjct  395   EDSLVRKYGNSKELVKSVVDALQRKSNPQKSL-ANLIEAAQEVGHCHYEYQTSWGN-LGW  452

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             +Y S  ED  T V IH +GW S +  P+PP F+GS+PT G  A+ QQ+RW T A+++L  
Sbjct  453   MYDSVAEDINTSVGIHLRGWTSSFISPDPPAFIGSTPTLGLEAIVQQRRWATGAIEVLFN  512

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP +    G++ FRQ LAY W +   +R   E+ Y LLPAYC++++S   PK     +
Sbjct  513   KQSPFMGMFHGKIKFRQRLAYFWAL-MCLRSIPELIYCLLPAYCLLHDSALFPK--GPCL  569

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
                 ++  ++ LY L++++  G S+++W+  Q + R+ A+ SWLF     ++K+ G+S+ 
Sbjct  570   CTIVTLVGMHCLYSLWQFMSLGFSVQSWYVVQSLWRIIATSSWLFSIQDIILKLLGISQI  629

Query  1052  VFEVTKKD-------HSSDEALDKDDDSK--VGRFTFDESPLFVPGTTILLVNLAALFIG  1204
              F + KK        + S  +  +DD  K  +G+F FD S LF+PGT I+LVNLAAL  G
Sbjct  630   GFVIAKKTIPETKSVYESKPSQGEDDVPKLNLGKFEFDSSGLFIPGTFIMLVNLAAL-AG  688

Query  1205  FLDFKQN-------KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLAL  1363
             +L   Q            L EA   + V++++  FLKGLF  GK+ IPLST+ K+  L +
Sbjct  689   YLVRLQRSSCSHGGGGSGLAEACGCILVVMLFLPFLKGLFEHGKYSIPLSTLSKAAFLTV  748

Query  1364  LFFHAC  1381
             LF   C
Sbjct  749   LFVFFC  754



>ref|NP_193264.3| cellulose synthase-like protein B5 [Arabidopsis thaliana]
 sp|Q0WT40.2|CSLB5_ARATH RecName: Full=Cellulose synthase-like protein B5; Short=AtCslB5 
[Arabidopsis thaliana]
 gb|AEE83581.1| cellulose synthase-like protein B5 [Arabidopsis thaliana]
 gb|AHL38695.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=757

 Score =   319 bits (818),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 193/486 (40%), Positives = 280/486 (58%), Gaps = 37/486 (8%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+ LN+DCD + N+P VV  AMC FL   K+     FVQFPQ FY     D 
Sbjct  280   VSGLMTNAPYTLNVDCDMYANEPDVVRQAMCVFLQNSKNSNHCAFVQFPQKFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---------EKST  331
             Y N++ ++   L RG AGIQGPFY+GTGCFH R+V+YG+    +++N         E   
Sbjct  335   YTNELAVLQSILGRGVAGIQGPFYIGTGCFHTRRVMYGLSSDDLEDNGNISQVATREFLA  394

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             +      +G SK    S    L     P+  +  N +EAA+EV  C YE+ T+WG  +G 
Sbjct  395   EDSLVRKYGNSKELVKSVVDALQRKSNPQKSL-ANLIEAAQEVGHCHYEYQTSWGN-LGW  452

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             +Y S  ED  T V IH +GW S +  P+PP F+GS+PT G  A+ QQ+RW T A+++L  
Sbjct  453   MYDSVAEDINTSVGIHLRGWTSSFISPDPPAFIGSTPTLGLEAIVQQRRWATGAIEVLFN  512

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP +    G++ FRQ LAY W +   +R   E+ Y LLPAYC++++S   PK     +
Sbjct  513   KQSPFMGMFHGKIKFRQRLAYFWAL-MCLRSIPELIYCLLPAYCLLHDSALFPK--GPCL  569

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
                 ++  ++ LY L++++  G S+++W+  Q + R+ A+ SWLF     ++K+ G+S+ 
Sbjct  570   CTIVTLVGMHCLYSLWQFMSLGFSVQSWYVVQSLWRIIATSSWLFSIQDIILKLLGISQI  629

Query  1052  VFEVTKKD-------HSSDEALDKDDDSK--VGRFTFDESPLFVPGTTILLVNLAALFIG  1204
              F + KK        + S  +  +DD  K  +G+F FD S LF+PGT I+LVNLAAL  G
Sbjct  630   GFVIAKKTIPETKSVYESKPSQGEDDVPKLNLGKFEFDSSGLFIPGTFIMLVNLAAL-AG  688

Query  1205  FLDFKQN-------KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLAL  1363
             +L   Q            L EA   + V++++  FLKGLF  GK+ IPLST+ K+  L +
Sbjct  689   YLVRLQRSSCSHGGGGSGLAEACGCILVVMLFLPFLKGLFEHGKYSIPLSTLSKAAFLTV  748

Query  1364  LFFHAC  1381
             LF   C
Sbjct  749   LFVFFC  754



>ref|XP_007049094.1| Cellulose synthase-like B3, putative isoform 3 [Theobroma cacao]
 gb|EOX93251.1| Cellulose synthase-like B3, putative isoform 3 [Theobroma cacao]
Length=587

 Score =   313 bits (802),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 180/374 (48%), Positives = 236/374 (63%), Gaps = 14/374 (4%)
 Frame = +2

Query  287   YGMWPHVVDNNEKSTDKDQ--WETFGKSKTFALSTTQILSGSL-YPEIPIFPNSLEAAKE  457
             + ++  V   N  +  KD      FG S+    S  Q L G   +P      NSLEAA +
Sbjct  221   FAVFCDVERRNHPTIIKDDTLLNEFGNSEELINSAVQALKGKKGFPNN--LSNSLEAACK  278

Query  458   VASCVYEFGTAWGQKVGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPA  637
             VASC YE+GT+WG K G +YG+  ED  TG+ IH KGW S    P  PGF+G +P+GGP 
Sbjct  279   VASCSYEYGTSWGTKCGWIYGATAEDLLTGLKIHAKGWNSALHMPELPGFMGCTPSGGPE  338

Query  638   ALTQQKRWGTAALDILICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPA  817
             A+ QQKRW T   +IL+ K  PII  L  +L FR CLAYLWI+ W +R   ++CY+ LPA
Sbjct  339   AMAQQKRWATGLAEILVGKNCPIIATLTAKLQFRMCLAYLWILFWGLRSIPQLCYAALPA  398

Query  818   YCIINNSHFQPKLNEAAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGS  997
             YCI+ NSHF PK+ E AI IP + F+ YNL+ L EY++ G S+RAWWNN RM  + A+ +
Sbjct  399   YCILANSHFLPKVEEPAIWIPIATFVTYNLHTLREYLKAGLSIRAWWNNLRMGSITATSA  458

Query  998   WLFGFLSGVVKVFGLSEAVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILL  1177
             +LFG  + ++K+  +SE VFEVT+KD S D      DD  V +FTF+ES +FVPGTT+LL
Sbjct  459   YLFGLFAAILKLLRISETVFEVTQKDQSCD-----GDDPDVTKFTFNESAVFVPGTTLLL  513

Query  1178  VNLAALFIGFLDF----KQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLK  1345
             V+L +L                  LGE  CS+WV+L +W FL GLF +GK+GIPLST+LK
Sbjct  514   VHLISLLCLSSKLPTPVHDMHGVGLGEVFCSLWVVLCFWPFLNGLFERGKYGIPLSTILK  573

Query  1346  SGGLALLFFHACKS  1387
             S  LALLF H C++
Sbjct  574   SAALALLFVHFCRT  587



>ref|NP_180821.1| cellulose synthase-like protein B2 [Arabidopsis thaliana]
 sp|O80899.1|CSLB2_ARATH RecName: Full=Cellulose synthase-like protein B2; Short=AtCslB2 
[Arabidopsis thaliana]
 gb|AAC25944.1| putative cellulose synthase [Arabidopsis thaliana]
 gb|AEC08706.1| cellulose synthase-like protein B2 [Arabidopsis thaliana]
Length=757

 Score =   317 bits (811),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 195/480 (41%), Positives = 281/480 (59%), Gaps = 33/480 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC FL   +++    FVQFPQ FY     D 
Sbjct  280   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCIFLQKSQNQNHCAFVQFPQEFY-----DS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---------EKST  331
                ++ +I  Y+ RG AGIQGP  +G+GCFH R+V+YG+ P  +++N         E   
Sbjct  335   NTIKLTVIKSYMGRGIAGIQGPINVGSGCFHSRRVMYGLSPDELEDNGSLSSVATRELLA  394

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             +      FG SK    S  + L     P+  I  NS+EAA+EV  C YE  T+WG+ +G 
Sbjct  395   EDSLSSGFGNSKEMVTSVVEALQRKPNPQ-NILTNSIEAAQEVGHCDYESQTSWGKTIGW  453

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  ED  T + IH +GW S Y  P+PP FLGS P GG  A+ QQ+RW T ++++L  
Sbjct  454   LYDSMSEDMNTSIGIHSRGWTSSYIAPDPPAFLGSMPPGGLEAMIQQRRWATGSIEVLFN  513

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP++     +L FRQ +AYL +    +R   E+ Y LLPAYC+++NS   PK     +
Sbjct  514   KQSPLLGLFCRKLRFRQRVAYLCV-SICVRSIPELIYCLLPAYCLLHNSALFPK--GLCL  570

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
              I   +  ++ LY L+E++  G S+++W+ +Q   R+ A+ SWLF     ++K+ GLS+ 
Sbjct  571   GITMLLAGMHCLYTLWEFMCLGHSIQSWYVSQSFWRIVATSSWLFSIFDIILKLLGLSKN  630

Query  1052  VFEVTKKDHSSDE--------ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGF  1207
             VF V+KK    +         +  +DD    G+  FD S  F+PGT I+LVNLAAL   F
Sbjct  631   VFLVSKKTMPVETMSGSGIGPSQREDDGPNSGKTEFDGSLYFLPGTFIVLVNLAALVGVF  690

Query  1208  LDFKQ------NKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
             +  ++           LGEA   + V+++++ FLKGLF KGK+GIPLST+ K+G LA+ F
Sbjct  691   VGLQRSSYSHGGGGSGLGEACACILVVMLFFPFLKGLFAKGKYGIPLSTLSKAGFLAVSF  750



>ref|XP_009141249.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
B3 [Brassica rapa]
Length=753

 Score =   317 bits (811),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 198/487 (41%), Positives = 283/487 (58%), Gaps = 45/487 (9%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD +VN+  VV  AMC FL    +     FVQFPQ+FY     D 
Sbjct  274   VSGLMTNAPYMLNVDCDMYVNEADVVRQAMCVFLQKPMNPNHCAFVQFPQDFY-----DS  328

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN----EKSTDKDQW  346
               ++  I+  YL RG AGIQGP + G+GCFH RKV+YG+    +D++      +T +   
Sbjct  329   NADEFIILQSYLGRGIAGIQGPIFTGSGCFHTRKVMYGLSIDDLDDSGSLSSVATKRMLA  388

Query  347   E-----TFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             E      FG SK    S  + L G   P+  I  NS+E AKEV +C YE+ T+WG+ +G 
Sbjct  389   EGSLAREFGSSKEIVKSVVEALQGKSNPQQTI-TNSIEIAKEVGNCHYEYQTSWGKTIGW  447

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  +D  T + IH +GW S Y  P+PP FLG  P  GP A+ Q +RWGT  L++   
Sbjct  448   LYDSMADDVNTSIGIHSRGWTSSYISPDPPAFLGCMPPMGPVAMVQWQRWGTGMLEVFFN  507

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP++     ++ FRQ LAY+ I  W +R   E+ Y LLPAYC+++NS   PK     I
Sbjct  508   KQSPLMGLFHQKMRFRQRLAYISISMWGLRSIPELFYCLLPAYCLLHNSALFPKGLCLGI  567

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
             ++  ++  +++LY L+E++  G S+++W+ +Q + R+ A+  WLF  L   +K+ G+S+ 
Sbjct  568   IV--TLLGMHSLYTLWEFMRVGFSVQSWYVSQSIWRIKATSCWLFSILDITLKLLGISKV  625

Query  1052  VFEVTKK------DHSSDEA---LDKDDDSKVGRFTFDESPLFVPGTTILLVNLAAL---  1195
             V  VT+K        S DE    +D       G+F  D S  F+PGT I+LVNLAA+   
Sbjct  626   VLIVTQKTIPESRSGSGDEPPQHIDHGLSPSSGKFEIDGSLYFLPGTFIVLVNLAAIAGY  685

Query  1196  FIGFLDFKQNKSWS---------LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKS  1348
             ++G       +SWS         L EA   V V+++++ FL GLF KGK+GIPLST+ K+
Sbjct  686   WVGL------QSWSCKHGGGGSGLAEACICVLVVIIFYPFLMGLFKKGKYGIPLSTLSKA  739

Query  1349  GGLALLF  1369
               L  LF
Sbjct  740   VFLTALF  746



>ref|XP_006293730.1| hypothetical protein CARUB_v10022692mg [Capsella rubella]
 gb|EOA26628.1| hypothetical protein CARUB_v10022692mg [Capsella rubella]
Length=763

 Score =   316 bits (810),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 195/484 (40%), Positives = 273/484 (56%), Gaps = 36/484 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLL--GVKDEKDAEFVQFPQNFYGGLKDD  175
             VSG+MTNAP+MLN+DCD +VN+  VV  AMC  L     +  D  FVQ+PQ+FY     D
Sbjct  281   VSGMMTNAPYMLNVDCDMYVNEADVVRQAMCIFLQKSTMNSNDCAFVQYPQDFY-----D  335

Query  176   PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGM----------WPHVVDNNEK  325
                +++ ++  Y+ RG AGIQG    G+GCF  R+V+YG+             V   +  
Sbjct  336   SNVDELIVLQAYMGRGIAGIQGSLCAGSGCFQSRRVMYGISLDDLGADGKLSSVATRDYL  395

Query  326   STDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKV  505
             + D    E FG SK    S    L   L P+      S+EAA+EV  C +E  T+WG+ V
Sbjct  396   AEDLLARE-FGNSKEMVASVVNALQRKLNPQHSSLTVSIEAAQEVGHCDHENQTSWGKTV  454

Query  506   GLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDIL  685
             G LYGS  ED  T V IH +GW S Y  P+PP FLG+ P GGP  + QQ+RW    L+IL
Sbjct  455   GWLYGSTTEDVHTSVGIHSRGWTSSYISPDPPAFLGAMPPGGPEVMLQQRRWAAGMLEIL  514

Query  686   ICKK-SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE  862
               K+ +P +  +F +L FRQCLAYLW   W +R   E+ Y LLPAYC+++NS   PK   
Sbjct  515   FNKRTTPFVGMIFRKLTFRQCLAYLWAFTWGLRSIPELFYCLLPAYCLLHNSALFPKGVY  574

Query  863   AAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGL  1042
               ++I  +I  I+ LY L+E++  G S+++W+ +Q   R+ ++  WLF      +K  G+
Sbjct  575   LGVII--TIVGIHCLYTLWEFMSLGFSVQSWFISQSFGRIKSTCCWLFSIYDITLKFLGI  632

Query  1043  SEAVFEVTKK------DHSSDEALDKDD---DSKVGRFTFDESPLFVPGTTILLVNLAAL  1195
             S+  F VTKK        S      ++D   +   G+F FD S  F+PGT I+LVNLAAL
Sbjct  633   SKTNFVVTKKTMPETRSESGSAKSQREDGCPNQDSGKFEFDGSLCFLPGTFIVLVNLAAL  692

Query  1196  FIGFLDFKQNK------SWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGL  1357
                 +  +++          L EA   V V+ ++  FLKG+F KGK+GIPLST+ K+  L
Sbjct  693   VGHSMGLRRSSPSHKEGGSGLAEACGCVLVVTLFLPFLKGMFEKGKYGIPLSTLSKAASL  752

Query  1358  ALLF  1369
             A+LF
Sbjct  753   AVLF  756



>ref|XP_007132524.1| hypothetical protein PHAVU_011G101700g, partial [Phaseolus vulgaris]
 ref|XP_007132525.1| hypothetical protein PHAVU_011G101700g, partial [Phaseolus vulgaris]
 gb|ESW04518.1| hypothetical protein PHAVU_011G101700g, partial [Phaseolus vulgaris]
 gb|ESW04519.1| hypothetical protein PHAVU_011G101700g, partial [Phaseolus vulgaris]
Length=336

 Score =   302 bits (774),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/285 (51%), Positives = 186/285 (65%), Gaps = 2/285 (1%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VSG+MTNAPF+LN+DCD  VN+PKV+LHA+C LL  K EK+  F QFPQ FY  LKDDP+
Sbjct  43   VSGLMTNAPFILNVDCDMIVNNPKVLLHALCILLDSKGEKEVAFAQFPQQFYATLKDDPF  102

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
            GNQM I +KYL  G AG+QGPFY GT C  RRKVIYG  P+ ++N    +  +  + FG 
Sbjct  103  GNQMTIFIKYLTAGIAGLQGPFYGGTNCLLRRKVIYGNLPNRMENGNNLSKDELEQKFGD  162

Query  362  SKTFALSTTQILSGSLY-PEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
            SK    + T  L G  Y P       +++ A +VASC YE GT+WG++VG +YGS  ED 
Sbjct  163  SKEIMKTATHALEGKTYLPNDINISIAVDIAAQVASCGYEHGTSWGKQVGWIYGSITEDK  222

Query  539  KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              G+ IH KGW+S  C PNP  F G +P GGP A+ QQKRW    L+I   K  PI   +
Sbjct  223  LLGLKIHEKGWRSELCTPNPIAFTGFAPGGGPNAMAQQKRWAIGLLEIFFSKHCPIFGTI  282

Query  719  FGRLHFRQCLAYLWIMG-WPIRPFFEICYSLLPAYCIINNSHFQP  850
            F +L  RQCLAY+WI+  W ++P FE+CY+ L ++ II NS F P
Sbjct  283  FHKLTLRQCLAYMWIINYWGLKPLFEVCYACLLSHSIITNSTFLP  327



>tpg|DAA37783.1| TPA: hypothetical protein ZEAMMB73_545753, partial [Zea mays]
Length=530

 Score =   308 bits (790),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/294 (50%), Positives = 192/294 (65%), Gaps = 8/294 (3%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VS V+TNAP MLN+DCD   N+P+  LHAMC LLG  DE  + FVQ PQ FYGGL DDP+
Sbjct  7    VSAVLTNAPIMLNVDCDMFANNPQAALHAMCLLLGFDDEVHSGFVQAPQRFYGGLADDPF  66

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP-------HVVDNNEKSTDKD  340
            GNQM++I + +  G AG+QG FY GTGCFHRRKV+YG+ P         +   +  + K+
Sbjct  67   GNQMQVIFEKVGHGIAGLQGIFYCGTGCFHRRKVMYGVPPGSGTGATKALAAADSPSYKE  126

Query  341  QWETFGKSKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
              + FG SK    S   I++    P  +    + +E AK+V++C YE GT+WGQ+VG +Y
Sbjct  127  LQKKFGSSKELIESARSIITSKEAPAAVADLTSRVEVAKQVSACSYETGTSWGQEVGWVY  186

Query  518  GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
            GS  ED  TG  IH  GW+S    P+PP FLG +PTGGPA+LTQ KRW T  L+I++ + 
Sbjct  187  GSMTEDVLTGQRIHAAGWRSALLSPDPPAFLGGAPTGGPASLTQYKRWATGLLEIVLSRH  246

Query  698  SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLN  859
            +P + +   RL FRQCLAYL I  WP+R  FE+CY+LL  YC+I N  F PK+N
Sbjct  247  NPFLLSASKRLRFRQCLAYLVIDVWPVRAPFELCYALLGPYCLIANRSFLPKVN  300



>ref|XP_006410388.1| hypothetical protein EUTSA_v10017940mg, partial [Eutrema salsugineum]
 gb|ESQ51841.1| hypothetical protein EUTSA_v10017940mg, partial [Eutrema salsugineum]
Length=566

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 186/473 (39%), Positives = 271/473 (57%), Gaps = 28/473 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VS +MTNAP+MLN+DCD + N+  VV  AMC FL   K+ K   FVQFPQ+FY     D 
Sbjct  99    VSALMTNAPYMLNVDCDMYANEADVVRQAMCIFLQKSKNTKHCAFVQFPQDFY-----DS  153

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFG  358
               +++ I+  YL RG AGIQGP Y G+GCFH R+ +  ++  +   ++   +K+  +  G
Sbjct  154   NADEIIILQSYLGRGIAGIQGPIYEGSGCFHTRRKMMEVFLQL---SQILAEKNLAKEIG  210

Query  359   KSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
              SK    S    L     P+     NS+E AKEV +C YE  T+WG  +G LY S  +D 
Sbjct  211   NSKEMVKSVVDALQMKSNPQ-QTLTNSIEVAKEVGNCHYEHQTSWGNTIGWLYDSMADDV  269

Query  539   KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
              T + IH +GW S Y   +PP FLG  P  GP A+ Q +RWGT  L++   K+SP+I   
Sbjct  270   NTSIGIHARGWTSSYISLDPPAFLGVMPPLGPVAMVQWRRWGTGMLEVFFNKQSPMIGVF  329

Query  719   FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFII  898
               +L FRQ LAY+ I  W +R   E+ Y LLPAYC+++NS   PK     + +P  +  +
Sbjct  330   HQKLRFRQRLAYISITMWGLRSIPELVYCLLPAYCLLHNSALFPK--GLCLGMPGMLVGM  387

Query  899   YNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDH  1078
             + LY L+E++  G S+++W+ +Q + R+ A+  WLF      +K+ G+S+ V  +TKK  
Sbjct  388   HCLYTLWEFMSVGFSVQSWYVSQSIWRIKATSCWLFSIFDITLKLLGISKIVLIITKKTR  447

Query  1079  S-----SDEALDKDDDSKVG----RFTFDESPLFVPGTTILLVNLAALF---IGFLDFKQ  1222
             S     S E L + +D  +     +F  D S  F+PGT I+LVNLAA+    +G      
Sbjct  448   SEARLGSGEGLSQREDDGLNPHSDKFEIDGSLYFLPGTFIVLVNLAAIASYSVGLQKLSC  507

Query  1223  NKS----WSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
             ++       L EA   V V+++++ FLK LF KGK+ IPLST+ ++  LA+LF
Sbjct  508   HRHKGGGSGLAEACACVLVVMLFFPFLKALFEKGKYRIPLSTLSEAVFLAVLF  560



>gb|KEH39000.1| cellulose synthase H1-like protein [Medicago truncatula]
Length=595

 Score =   307 bits (787),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 153/304 (50%), Positives = 194/304 (64%), Gaps = 20/304 (7%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VSG+MTNAPFMLNLDCD +VN+ K+VLHA+C LL  K EK+  F Q PQ FY  +KDD Y
Sbjct  281  VSGLMTNAPFMLNLDCDMYVNNSKIVLHALCILLDSKGEKEVAFAQCPQRFYDAVKDDAY  340

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP-HVVDNNEKS---------T  331
            GNQ+  +  Y+  G AG+QG  Y GT CFHRRKV+YG+ P + + N +K          +
Sbjct  341  GNQLVALPMYIGSGFAGLQGIIYAGTNCFHRRKVMYGLSPPNEIQNAKKGQGFTNGTFLS  400

Query  332  DKDQWETFGKSKTFALSTTQILSG---SLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQK  502
            +K+  + FG SK F  S T IL G    L+  +      LEAA +VASC YE+ TAWG++
Sbjct  401  EKETMQKFGTSKGFVESATHILEGITSDLHKSL-----DLEAASKVASCDYEYNTAWGKQ  455

Query  503  VGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDI  682
            VG LYGS  ED  TG+  H KGW+S  C P+P  F+G SP      + Q KRW T  LDI
Sbjct  456  VGWLYGSTSEDVLTGLKFHTKGWRSELCSPDPIAFMGCSPQDNLGQMAQHKRWSTGLLDI  515

Query  683  LICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE  862
             + K  PI   LFG+L FR+CL+Y+WI  W +R   EICY+LLPAYCII NS F P  N+
Sbjct  516  FLSKHCPIFGTLFGKLQFRECLSYIWITNWALRSIPEICYALLPAYCIITNSSFLP--NK  573

Query  863  AAIV  874
             +I+
Sbjct  574  VSII  577



>gb|KGN63232.1| hypothetical protein Csa_2G416220 [Cucumis sativus]
Length=491

 Score =   303 bits (777),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 151/299 (51%), Positives = 198/299 (66%), Gaps = 8/299 (3%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVK-DEKDAEFVQFPQNFYGGLKDDP  178
            VSGV+TNAP++LN+DCD  VN+P+VVLHAMC  L  K D +D  +VQ PQ FY GLKDDP
Sbjct  190  VSGVLTNAPYILNVDCDMFVNNPQVVLHAMCVFLNSKYDLEDIGYVQTPQCFYDGLKDDP  249

Query  179  YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDN--NEKSTDKDQWET  352
            +GNQ+ ++ +Y  RG  G+QGPFY GTGCFHRRKV+Y  +PH      N K+++++  +T
Sbjct  250  FGNQLVVVFEYFGRGIMGLQGPFYGGTGCFHRRKVLYAQFPHHTAYFLNGKASEQELIKT  309

Query  353  FGKSKTFALSTTQIL----SGSLYPEIPIF-PNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
            FG SKTF  S T       + S YP   +F  N+L+AA  VA C YE  T WG K+G +Y
Sbjct  310  FGYSKTFTKSATYAFKDDQNTSGYPPKGLFNTNNLDAANHVAGCGYEISTTWGSKIGWIY  369

Query  518  GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
            GS  ED  TG+ I  +GW+S++   NPP FLG +P+   A+L QQKRW T  L +L  K 
Sbjct  370  GSTSEDVLTGLVIQTRGWRSIFLALNPPAFLGCAPSQLVASLNQQKRWATGFLQVLFNKH  429

Query  698  SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIV  874
             PI   LFG+L +RQC AYLW++ W +R   E+ Y+LLPAYC+I NS F P ++   I 
Sbjct  430  CPIFGTLFGKLQWRQCAAYLWMLTWGLRSIPELSYALLPAYCLITNSSFFPTVSTIHIT  488



>emb|CDY52052.1| BnaCnng21680D [Brassica napus]
Length=751

 Score =   311 bits (796),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 196/480 (41%), Positives = 271/480 (56%), Gaps = 36/480 (8%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC F+ G  +     FVQFPQ FY     D 
Sbjct  277   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCIFMEGSMNPNHCAFVQFPQKFY-----DS  331

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQW----  346
               +++ ++  Y+ RG AGIQGP Y G+GCF  R+V+YG+    VD+ E+  +        
Sbjct  332   NSDEIVVLQSYVGRGFAGIQGPVYAGSGCFLTRRVMYGL---SVDDLEEDRNLSSLLAAE  388

Query  347   ---ETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
                  FGKSK    S    L     P+  +  NS EAA+ V  C YE+ T+WG+ VG LY
Sbjct  389   RLERDFGKSKEMVKSVVDALQRKSNPQDTLI-NSSEAAQAVGHCHYEYQTSWGKTVGWLY  447

Query  518   GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
              S  ED  T + IH +GW S Y  P PP FL   P GGP A+ QQ+RW T  L+IL  K+
Sbjct  448   DSTTEDAHTSIGIHSRGWTSSYISPEPPAFLRCMPPGGPEAMLQQRRWATGLLEILFTKQ  507

Query  698   SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVI  877
             +P+  +   ++ FRQ LAYL+I  W +R   E+ Y LLPAYC+++ S   PK     I I
Sbjct  508   NPLNGSSCKKIRFRQSLAYLYIFTWGLRSIPELFYCLLPAYCVLHGSALFPK--GVCIGI  565

Query  878   PASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVF  1057
               ++  ++ LY L+E+   G S+ +W+ +Q   R+  +GSWLF     ++K+ G+S  +F
Sbjct  566   VVTLVGMHCLYTLWEFTSLGFSVHSWYASQSFWRIKTTGSWLFSIPDIILKLLGVSNTIF  625

Query  1058  EVTKKD------HSSDEALDKDDDSK---VGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
              VTKK        S D    K+DD       +F FD S  F+PGT ILLVNL A+  GF 
Sbjct  626   IVTKKTISKTRLESGDRPSQKEDDGSNPDSNKFEFDGSLYFLPGTFILLVNLTAI-AGFS  684

Query  1211  DFKQ-------NKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
                Q           S+ +A   + V++++  FL GLF KGK+GIPLST+ K+  LA+LF
Sbjct  685   MCLQRSSRSYGGSGSSMIDACGCILVVILFLPFLIGLFEKGKYGIPLSTLSKAAFLAVLF  744



>tpg|DAA37782.1| TPA: hypothetical protein ZEAMMB73_545753, partial [Zea mays]
Length=828

 Score =   310 bits (794),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/290 (51%), Positives = 191/290 (66%), Gaps = 4/290 (1%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VS V+TNAP MLN+DCD   N+P+  LHAMC LLG  DE  + FVQ PQ FYGGL DDP+
Sbjct  309  VSAVLTNAPIMLNVDCDMFANNPQAALHAMCLLLGFDDEVHSGFVQAPQRFYGGLADDPF  368

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTD---KDQWET  352
            GNQM++I + +  G AG+QG FY GTGCFHRRKV+YG+ P       K+     K+  + 
Sbjct  369  GNQMQVIFEKVGHGIAGLQGIFYCGTGCFHRRKVMYGVPPGSGTGATKADSPSYKELQKK  428

Query  353  FGKSKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAG  529
            FG SK    S   I++    P  +    + +E AK+V++C YE GT+WGQ+VG +YGS  
Sbjct  429  FGSSKELIESARSIITSKEAPAAVADLTSRVEVAKQVSACSYETGTSWGQEVGWVYGSMT  488

Query  530  EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
            ED  TG  IH  GW+S    P+PP FLG +PTGGPA+LTQ KRW T  L+I++ + +P +
Sbjct  489  EDVLTGQRIHAAGWRSALLSPDPPAFLGGAPTGGPASLTQYKRWATGLLEIVLSRHNPFL  548

Query  710  WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLN  859
             +   RL FRQCLAYL I  WP+R  FE+CY+LL  YC+I N  F PK+N
Sbjct  549  LSASKRLRFRQCLAYLVIDVWPVRAPFELCYALLGPYCLIANRSFLPKVN  598



>ref|NP_180820.2| cellulose synthase-like protein B1 [Arabidopsis thaliana]
 sp|O80898.2|CSLB1_ARATH RecName: Full=Cellulose synthase-like protein B1; Short=AtCslB1 
[Arabidopsis thaliana]
 gb|AEC08705.1| cellulose synthase-like protein B1 [Arabidopsis thaliana]
 gb|AHL38819.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=757

 Score =   308 bits (788),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 197/482 (41%), Positives = 276/482 (57%), Gaps = 36/482 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVK-DEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP++LN+DCD + ND  VV  AMC LL    + K   FVQF Q FY     D 
Sbjct  281   VSGLMTNAPYILNVDCDMYANDADVVRQAMCILLQESLNMKHCAFVQFRQEFY-----DS  335

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH--VVDNNEKSTDKDQW--  346
                 + ++  +L RG AGIQGP Y+G+GC H R+V+YG+ P    VD +  S    ++  
Sbjct  336   STELIVVLQSHLGRGIAGIQGPIYIGSGCVHTRRVMYGLSPDDFEVDGSLSSVATREFLV  395

Query  347   -----ETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
                    FG SK    S    +  +  P+  I  NS+EAA+EV  C YE+ T+WG  +G 
Sbjct  396   KDSLARRFGNSKEMMKSVVDAIQRNPNPQ-NILTNSIEAAREVGHCQYEYQTSWGNTIGW  454

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  ED  T + IH +GW S Y  P+ P FLGS P G P AL QQ+RW T  ++IL  
Sbjct  455   LYDSVAEDLNTSIGIHSRGWTSSYISPDTPAFLGSMPAGVPEALLQQRRWATGWIEILFN  514

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP+      ++ FRQ LAYL I+   +R   E+ Y LLPAYC+++NS   PK     I
Sbjct  515   KQSPLRGLFSKKIRFRQRLAYLCIITC-LRSIPELIYCLLPAYCLLHNSTLFPKGLYLGI  573

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
              +  ++  I+ LY L+E++  G S+++W  +Q + R+ A+ SWLF      +K+ G+SE 
Sbjct  574   TV--TLVGIHCLYTLWEFMSLGYSVQSWLVSQSVWRIVATSSWLFSIFDITLKLLGISET  631

Query  1052  VFEVTKKDHSSDEAL---------DKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIG  1204
             VF +TKK  +  ++          D   +S + +F FD S  F+PGT I+LVN+AAL + 
Sbjct  632   VFIITKKTVAGTKSALGSGPSQGEDVGPNSDLFKFEFDGSLCFLPGTFIVLVNIAALAV-  690

Query  1205  FLDFKQNKSWS-------LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLAL  1363
             F    Q  S+S       L EA   V V++++  FL GLF KGK+G PLST+  +G LA+
Sbjct  691   FSVGLQRSSYSHEGGGSGLAEACGCVLVMMLFLPFLMGLFKKGKYGTPLSTLSIAGFLAV  750

Query  1364  LF  1369
             LF
Sbjct  751   LF  752



>ref|XP_008455908.1| PREDICTED: cellulose synthase-like protein H1 isoform X3 [Cucumis 
melo]
Length=586

 Score =   303 bits (776),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/295 (50%), Positives = 203/295 (69%), Gaps = 9/295 (3%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDE-KDAEFVQFPQNFYGGLKDDP  178
            VSGV+TNAP++LN+DCD  VN+P+VVLHAMC  L  KD+ +D  +VQ PQ FY GLKDDP
Sbjct  286  VSGVLTNAPYILNVDCDMFVNNPQVVLHAMCVFLNSKDDLEDIGYVQTPQCFYDGLKDDP  345

Query  179  YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH--VVDNNEKSTDKDQWET  352
            +GNQ+ ++ +Y  RG  G+QGPFY GTGCFHRRKV+Y  +PH  +   + K+++++  +T
Sbjct  346  FGNQLVVVFEYSARGIMGLQGPFYSGTGCFHRRKVLYAQFPHHTIYFLDGKASEQELIKT  405

Query  353  FGKSKTFALSTT-----QILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
            FG SKTFA S T     Q  + S YP   +  N+LEAA +VA C YE  T+WG ++G +Y
Sbjct  406  FGYSKTFAKSATYAFKDQNTNTSGYPPKGLLNNNLEAANQVAGCGYEISTSWGSEIGWMY  465

Query  518  GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
            GS  ED  TG+ I  +GW+S++   NPP FLG +P+   A+LTQQKRW +  L +L+ ++
Sbjct  466  GSTSEDVLTGLVIQTRGWRSIFLALNPPAFLGCAPSQLVASLTQQKRWASGFLQVLLNRR  525

Query  698  S-PIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLN  859
              PI   LFG+L ++QC AYLWI+ W +R   E+ Y+LLP YC+I NS   P ++
Sbjct  526  HCPIFGTLFGKLQWKQCAAYLWILTWGLRSIPELSYTLLPPYCLITNSSIFPTID  580



>ref|XP_009141248.1| PREDICTED: LOW QUALITY PROTEIN: cellulose synthase-like protein 
B3 [Brassica rapa]
Length=753

 Score =   306 bits (784),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 194/479 (41%), Positives = 272/479 (57%), Gaps = 32/479 (7%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDE-KDAEFVQFPQNFYGGLKDD  175
             VSG+MTNAP+MLN+DCD  VN+  VV  AMC FL   K+      FVQ+PQ+FY     D
Sbjct  277   VSGLMTNAPYMLNVDCDMFVNEADVVRQAMCIFLQKSKNSINHCAFVQYPQDFY-----D  331

Query  176   PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVD--------NNEKST  331
                 ++ ++  +L RG AGIQG  Y G+GCFH R+V+YG+    ++        N  K  
Sbjct  332   SNCEELVVLQSHLSRGFAGIQGSIYSGSGCFHTRRVMYGLSVDDLEEDGSLSSVNARKFL  391

Query  332   DKDQW-ETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVG  508
             D++     FG SK    S    L      +  I  N L+ A+EV  C YE   +WG+ +G
Sbjct  392   DEESLARKFGSSKEIRKSVANALQRKSNSQ-NILTNFLDEAREVGHCQYESQKSWGKTIG  450

Query  509   LLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILI  688
              LY S  ED  T + IH +GW S Y  P+ P FLG  P GGP A+ QQ+RWGT  L++L 
Sbjct  451   WLYDSTAEDVNTSIDIHSRGWTSSYIYPDEPAFLGCMPPGGPEAMVQQRRWGTGMLEVLF  510

Query  689   CKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAA  868
              K SP+I     +L FRQ LAY+ I  W +R   E+ Y LLPAYC+++NS   PK   + 
Sbjct  511   NKHSPLIGIFSQKLRFRQRLAYIHIFTWGLRSIPELAYCLLPAYCLLHNSALFPKGLCSG  570

Query  869   IVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSE  1048
             I +  ++  ++ +Y L+E++  G S+ +W+ +Q   R+ A+  WLF  +  + K+ G+S 
Sbjct  571   ITV--TLVSMHCVYTLWEFMSLGFSVHSWYVSQSFWRIKATCIWLFSIIDIIFKLLGVSR  628

Query  1049  AVFEVTKKDHSSDEALDKD-----DDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLD  1213
              VF VTKK  +   +   D      D   G+F FD+S  F+PGT I+LVNLAA+  GF  
Sbjct  629   TVFIVTKKTFTETRSGTGDGPSCSADPNAGKFEFDDSVYFLPGTFIVLVNLAAI-AGFSV  687

Query  1214  FKQNKSWSLG-------EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
               Q  +   G       EA   + V++++  FLKGLF KGK+GIPLST+ K+  LA+LF
Sbjct  688   GLQPLTHIYGGGGSTFVEACACILVVMLFLPFLKGLFEKGKYGIPLSTLSKAAFLAVLF  746



>emb|CBI28828.3| unnamed protein product [Vitis vinifera]
Length=590

 Score =   299 bits (765),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 196/455 (43%), Positives = 249/455 (55%), Gaps = 85/455 (19%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVMTNAPFMLN+DCD +                                         
Sbjct  177   VSGVMTNAPFMLNVDCDMYA----------------------------------------  196

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH---VVDNNEKSTDKDQWET  352
               +  I+ KY+  G AG+QGP Y GTGCFHRRKVIYG+WP     +    K TD+   +T
Sbjct  197   --KTSILYKYVGSGIAGLQGPMYGGTGCFHRRKVIYGLWPEGRMEIKGRRKLTDERLEKT  254

Query  353   FGKSKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSA  526
             FG SK F  +  +ILSG S     P    N +EAA++VA+C YE+GT+WG K+G LYG+ 
Sbjct  255   FGNSKEFTTTAARILSGLSGISHCPYDLLNRVEAAQQVATCSYEYGTSWGTKIGWLYGTT  314

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG+ IH KGW+S YC  +PP FLG  P+GGP +LTQ+KRW T  L++   K SP 
Sbjct  315   AEDILTGMRIHAKGWRSTYCQRDPPAFLGCVPSGGPVSLTQRKRWATGLLEVQFSKNSPF  374

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
             I  L  +L FRQCLAY+WI+    R   E+ Y  LPAYCI+  SHF PK+ E     PA 
Sbjct  375   IATLTAKLQFRQCLAYMWILSRGRRSIPELGYIALPAYCIMARSHFLPKVQE-----PAM  429

Query  887   IFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
                  +LY L         L  +WN                       + GLS+ +FEVT
Sbjct  430   FDTDISLYHL--------PLLHYWNT----------------------LLGLSKTIFEVT  459

Query  1067  KKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS-LG  1243
             KKD S+    D D D+  GRFTFDES +FV  TT+ L++L AL    +        S +G
Sbjct  460   KKDQSTTPVEDNDKDA--GRFTFDESLIFVLATTLALLHLVALVAASIGPSHVGIESRIG  517

Query  1244  EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKS  1348
             E ICSVW++L ++ FL GLFGKGK+GIP ST+ KS
Sbjct  518   EVICSVWLVLCFFPFLTGLFGKGKYGIPTSTICKS  552



>ref|XP_006285915.1| hypothetical protein CARUB_v10007426mg [Capsella rubella]
 gb|EOA18813.1| hypothetical protein CARUB_v10007426mg [Capsella rubella]
Length=761

 Score =   303 bits (777),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 195/489 (40%), Positives = 277/489 (57%), Gaps = 50/489 (10%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAE----FVQFPQNFYGGLK  169
             VSG+MTNAP+MLN+DCD + N+  VV  AMC  L  +D K +     FVQFPQ FY    
Sbjct  283   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCVFL--QDSKQSNHHCAFVQFPQEFYNA--  338

Query  170   DDPYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---------E  322
                Y  ++  +  Y+ RG AGIQGP Y G+GCFH R+V+YG+    +++N         E
Sbjct  339   ---YTIELSFLQSYIGRGIAGIQGPIYCGSGCFHTRRVMYGLSTDDLEDNGSLSLVATRE  395

Query  323   KSTDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQK  502
                ++     +G SK    S    L     P+  +  N +EAA+EV  C YE  T+WG  
Sbjct  396   FLAEESLVRKYGSSKELVKSVVHALQRKSNPQSNL-TNFIEAAQEVGHCHYENQTSWGN-  453

Query  503   VGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDI  682
             +G LYGS G+DT T + IH +GW S +  PNPP FLGS P+ G   + QQ+RW T   +I
Sbjct  454   LGWLYGSVGDDTNTSIGIHMRGWTSSFVSPNPPAFLGSMPSVGLETIVQQRRWATGVAEI  513

Query  683   LICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE  862
             L  K+SP I     ++ FRQ LAY +++   +R   E+ YS+LPAYC+++NS   PK   
Sbjct  514   LFNKQSPFI-GFRRKIKFRQRLAYFFVL-VSLRSIPELIYSVLPAYCLLHNSTLFPK--G  569

Query  863   AAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGL  1042
               + I  ++  +Y  Y L++++  G SL++W+ +Q + R+ A+ SWLF     ++K+ G+
Sbjct  570   PCLGITVTLVGMYCQYSLWQFMRLGFSLQSWYVSQSLWRIVATSSWLFSIQDIILKLLGI  629

Query  1043  SEAVFEVTKKD--------HSSDEALDKDD--DSKVGRFTFDESPLFVPGTTILLVNLAA  1192
             S+  F + KK           S  +  +DD   S  G+F FD S LF+PGT I+LVNLAA
Sbjct  630   SKIGFVIAKKTMPDTKQVYDESKPSQGEDDVPKSDFGKFEFDSSSLFIPGTFIILVNLAA  689

Query  1193  LFIGFLDFKQNKSWSLG----------EAICSVWVILMYWAflkglfgkgkfgIPLSTVL  1342
             L     +F     WS G          EA   V V+L+++ FLKGLF  GK+GIPLST+ 
Sbjct  690   L----AEFLVRLLWSSGRHGRDGSGFIEACGCVMVVLLFFPFLKGLFEHGKYGIPLSTIS  745

Query  1343  KSGGLALLF  1369
             K+  L +LF
Sbjct  746   KAAFLTVLF  754



>ref|XP_010930911.1| PREDICTED: cellulose synthase-like protein H2 [Elaeis guineensis]
Length=293

 Score =   289 bits (740),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 151/288 (52%), Positives = 192/288 (67%), Gaps = 7/288 (2%)
 Frame = +2

Query  530   EDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             ED  TG+ IH  GWKSVY   +PP FLGS+PTGGPA+LTQ KRW T  L+IL  K  PII
Sbjct  3     EDILTGLRIHSMGWKSVYLILDPPAFLGSAPTGGPASLTQHKRWSTGLLEILFIKSGPII  62

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASI  889
                  +L FR CL YL ++ WP+R   EICY+LLPAYC++ N+ F PK +EA  VIP ++
Sbjct  63    ATFTKQLKFRMCLVYLIVIVWPLRSIGEICYALLPAYCLLANTSFLPKASEAVFVIPLAL  122

Query  890   FIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTK  1069
             F+I N++ L EY + G S RA WNNQRM R++A  +WLFG L+ ++K+ GLSE +FEVT+
Sbjct  123   FLISNIHSLIEYFQCGLSARACWNNQRMHRIFAMTAWLFGLLAVLLKILGLSETIFEVTR  182

Query  1070  KDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFK----QNKSWS  1237
             KD  SD     D D   GRFTFD SP+FV GT +LLVN+ AL +G L          S  
Sbjct  183   KDQQSDA---NDTDKDPGRFTFDNSPMFVSGTAVLLVNMVALAVGLLRLHGPVDGGPSPG  239

Query  1238  LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHAC  1381
             LGE  CSVWV+  +W F++GL G+G +GIPL  +LK+  LA LF   C
Sbjct  240   LGEFACSVWVVFSFWPFVRGLVGRGSYGIPLPVILKAAVLASLFMQFC  287



>ref|XP_007049097.1| Cellulose synthase-like B3, putative isoform 3 [Theobroma cacao]
 gb|EOX93254.1| Cellulose synthase-like B3, putative isoform 3 [Theobroma cacao]
Length=581

 Score =   297 bits (760),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 149/285 (52%), Positives = 187/285 (66%), Gaps = 3/285 (1%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VSGVMTNAPFMLN+DCD   ++PK++LHA+C L+GV DE++  FVQ PQ FY  LKDDP+
Sbjct  279  VSGVMTNAPFMLNVDCDMFASNPKIILHAVCLLVGVDDEQECAFVQCPQIFYDALKDDPF  338

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
            GN+M +       G AGIQGP Y GTGCFHRRK IYG+ P+   + +    K   E FGK
Sbjct  339  GNRMTVPFTIFVGGMAGIQGPPYAGTGCFHRRKAIYGLPPN--HDFDIKDCKILEERFGK  396

Query  362  SKTFALSTTQILSGSLYPEIPIFPNSLE-AAKEVASCVYEFGTAWGQKVGLLYGSAGEDT  538
            S  F+ S  +IL GS     P   +S+  +A  VA+C YE  T WG +VGL YGS  ED 
Sbjct  397  STEFSESVAEILFGSGEKHFPCDISSITGSACRVANCSYENNTCWGIEVGLTYGSVTEDV  456

Query  539  KTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWAL  718
             TG+ IH  GWKSV   P+PP F+G +P GGP ++TQ KRWGT  L++L  K SPI+ A 
Sbjct  457  LTGLRIHTMGWKSVLLMPSPPAFMGCAPPGGPVSMTQMKRWGTGLLEVLFSKHSPILSAF  516

Query  719  FGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPK  853
              +LHFRQ LAYL I+ W  R   + CY++L AYCI  +S F PK
Sbjct  517  STKLHFRQALAYLQIVMWASRSIPQFCYNMLSAYCITTDSQFLPK  561



>tpg|DAA37784.1| TPA: hypothetical protein ZEAMMB73_545753 [Zea mays]
Length=377

 Score =   290 bits (742),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/353 (43%), Positives = 214/353 (61%), Gaps = 6/353 (2%)
 Frame = +2

Query  335   KDQWETFGKSKTFALSTTQILSGSLYPE-IPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             K+  + FG SK    S   I++    P  +    + +E AK+V++C YE GT+WGQ+VG 
Sbjct  20    KELQKKFGSSKELIESARSIITSKEAPAAVADLTSRVEVAKQVSACSYETGTSWGQEVGW  79

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             +YGS  ED  TG  IH  GW+S    P+PP FLG +PTGGPA+LTQ KRW T  L+I++ 
Sbjct  80    VYGSMTEDVLTGQRIHAAGWRSALLSPDPPAFLGGAPTGGPASLTQYKRWATGLLEIVLS  139

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             + +P + +   RL FRQCLAYL I  WP+R  FE+CY+LL  YC+I N  F PK +E   
Sbjct  140   RHNPFLLSASKRLRFRQCLAYLVIDVWPVRAPFELCYALLGPYCLIANRSFLPKASEPGF  199

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
             V+P ++F+ YN Y L EY++   S RAWWNNQRM R+ +S +WL  FL+ V+K  GLSE 
Sbjct  200   VVPLALFLAYNAYNLGEYVDCRLSARAWWNNQRMQRITSSSAWLLAFLTVVLKTVGLSET  259

Query  1052  VFEVTKKDHSSDEALDKDD--DSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLD--FK  1219
             VFEVT+K+    +     D  D+  GRFTFD SP+FVP   + ++++ A+ +G       
Sbjct  260   VFEVTRKEQQQQQGSPDGDGADADPGRFTFDSSPVFVPPAALAMLSVVAVAVGAWRAVTG  319

Query  1220  QNKSWSLGEAICSVWVILMYWA-flkglfgkgkfgIPLSTVLKSGGLALLFFH  1375
                   +GE +C  W++L +W      + G+G +GIP S  +K+  L   F H
Sbjct  320   GGGGPGVGEFVCCAWLLLCFWPFVRGLVGGRGSYGIPWSVRIKAALLVAAFVH  372



>ref|XP_010657349.1| PREDICTED: putative cellulose synthase-like protein H3 [Vitis 
vinifera]
Length=283

 Score =   284 bits (726),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 158/285 (55%), Positives = 194/285 (68%), Gaps = 6/285 (2%)
 Frame = +2

Query  548   VSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGR  727
             + I  +GWKS  C P+PP FLG +P+GGPAALTQQKRW T  L+IL  K SP I A   +
Sbjct  1     MRIQARGWKSTDCRPDPPAFLGCAPSGGPAALTQQKRWATGLLEILFSKNSPFIAAFTAK  60

Query  728   LHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNL  907
             L FRQCLAYLW + W +R   E+CY  LPAYCI+  SHF PK+ E A++IP S+F+ YN 
Sbjct  61    LQFRQCLAYLWFISWALRSIPELCYLALPAYCIMAGSHFLPKVQEPAVLIPISLFVSYNF  120

Query  908   YGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSD  1087
             Y LFEY   G S+RA WNN RM R+ A  +WLFGF S ++K+ GLSE VFEVTKKD S+ 
Sbjct  121   YTLFEYYGAGFSIRACWNNLRMGRITAVTAWLFGFFSVILKLLGLSETVFEVTKKDQSTT  180

Query  1088  EALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAAL---FIGFLDFKQNKSWSLGEAICS  1258
                  D D+  GRFTFD S +FVP TT+LLV+L AL    +G  D    +S  +GE ICS
Sbjct  181   PGEGSDKDA--GRFTFDGSLIFVPATTLLLVHLMALVTALLGLFDHVGIES-RIGEIICS  237

Query  1259  VWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKSVH  1393
             VWV+L +  FLKGLFGKGK+GIP S++ KS  LALLF     +V 
Sbjct  238   VWVVLCFSPFLKGLFGKGKYGIPTSSISKSVALALLFLACTTTVR  282



>ref|XP_004165438.1| PREDICTED: cellulose synthase-like protein H1-like [Cucumis sativus]
Length=487

 Score =   288 bits (738),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 146/299 (49%), Positives = 193/299 (65%), Gaps = 18/299 (6%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDE-KDAEFVQFPQNFYGGLKDDP  178
            VS V+TNAP++LN+DCD  VN+P+VVLHAMC  L  KD+ KD  +VQ PQ FY GLKDDP
Sbjct  195  VSAVLTNAPYILNVDCDMFVNNPQVVLHAMCVFLNSKDDLKDIGYVQTPQCFYDGLKDDP  254

Query  179  YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDN--NEKSTDKDQWET  352
            +GNQ+ ++           +GPFY GTGCFHRRKV+Y  +PH   +  N K+++++  +T
Sbjct  255  FGNQLVVVF----------EGPFYGGTGCFHRRKVLYAQFPHHTAHFLNGKASEQELIKT  304

Query  353  FGKSKTFALSTTQIL----SGSLYPEIPIF-PNSLEAAKEVASCVYEFGTAWGQKVGLLY  517
            FG SKTF  S T       + S YP   +F  N+L+AA  VA C YE  T WG K+G +Y
Sbjct  305  FGYSKTFTKSATYAFKDDQNTSGYPPKGLFNTNNLDAANHVAGCGYEISTTWGSKIGWIY  364

Query  518  GSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKK  697
            GS  ED  TG+ I  +GW+S++   NPP FLG +P+   A+L QQKRW T  L +L  K 
Sbjct  365  GSTSEDVLTGLVIQTRGWRSIFLALNPPAFLGCAPSQLVASLNQQKRWATGFLQVLFNKH  424

Query  698  SPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIV  874
             PI   LFG+L +RQC AYLW++ W +R   E+ Y+LLPAYC+I NS F P ++   I 
Sbjct  425  CPIFGTLFGKLQWRQCAAYLWMLTWGLRSIPELSYALLPAYCLITNSSFFPTVSTIHIT  483



>emb|CAN60146.1| hypothetical protein VITISV_041923 [Vitis vinifera]
Length=1026

 Score =   299 bits (766),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 164/302 (54%), Positives = 203/302 (67%), Gaps = 6/302 (2%)
 Frame = +2

Query  497   QKVGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAAL  676
              ++G LYG+  ED  TG+ IH +GWKS  C P+PP FLG +P+GGPAALTQQKRW T  L
Sbjct  727   SQIGWLYGTTTEDVLTGMRIHARGWKSTDCRPDPPAFLGCAPSGGPAALTQQKRWATGXL  786

Query  677   DILICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKL  856
             +IL  K SP I     +L FRQCLAY W + W +R   E+CY  LPAYCI+  SHF PK+
Sbjct  787   EILFSKNSPFIAXFTAKLQFRQCLAYXWXISWALRSIPELCYLALPAYCIMAGSHFLPKV  846

Query  857   NEAAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVF  1036
              E A++IP S+F+ YN Y LFEY   G S+RA WNN RM R+ A  +WLFGF S ++K+ 
Sbjct  847   QEPAVLIPISLFVSYNFYXLFEYYGAGFSIRACWNNLRMGRITAVTAWLFGFFSVILKLL  906

Query  1037  GLSEAVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAAL---FIGF  1207
             GLSE VFEVTKKD S+      D D+  GRFTFD S +FVP TT+LLV+L AL    +G 
Sbjct  907   GLSETVFEVTKKDQSTTPGEGSDXDA--GRFTFDGSLIFVPATTLLLVHLMALXTALLGL  964

Query  1208  LDFKQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACKS  1387
              D    +S  +GE ICSVWV+L +  FL GLFGKGK+GIP S++ KS  LALLF     +
Sbjct  965   FDHVGIES-RIGEIICSVWVVLCFSPFLXGLFGKGKYGIPTSSISKSVALALLFLACTTT  1023

Query  1388  VH  1393
             V 
Sbjct  1024  VR  1025


 Score =   194 bits (492),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 119/173 (69%), Gaps = 6/173 (3%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VSG MTNAPFMLN+DCD + N+P +  HAMC LLG K+E+D  FVQ PQ FY GLKDDP+
Sbjct  215  VSGAMTNAPFMLNVDCDMYANNPLIFHHAMCLLLGSKNEQDCGFVQSPQCFYDGLKDDPF  274

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWP----HVVDNNEKSTDKDQWE  349
            GNQ+ ++ KYL  G AG+QGP Y GTGCFHRRKVIYG+ P     +   + K TD+   +
Sbjct  275  GNQLVVLYKYLGSGIAGLQGPTYSGTGCFHRRKVIYGLXPDGRMEIKGRSGKLTDERIQK  334

Query  350  TFGKSKTFALSTTQILSG-SLYPEIPI-FPNSLEAAKEVASCVYEFGTAWGQK  502
            TFG SK F  +  + LSG S     P    N +EAA+EVA+C YE+GT+WG K
Sbjct  335  TFGNSKEFTTTAARJLSGLSGISHCPYDLLNRVEAAQEVATCSYEYGTSWGTK  387



>emb|CDY19146.1| BnaA04g18860D [Brassica napus]
Length=712

 Score =   290 bits (742),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 176/448 (39%), Positives = 239/448 (53%), Gaps = 48/448 (11%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC F+ G  +     FVQFPQ FY     D 
Sbjct  289   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCIFMEGSMNPNHCAFVQFPQKFY-----DS  343

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWET--  352
               +++ ++  Y+ RG AGIQGP Y G+GCFH R+V+YG+    VD+ E+  +     T  
Sbjct  344   NSDEIVVLQSYVGRGFAGIQGPVYAGSGCFHTRRVMYGL---SVDDLEEDRNLSSVATRK  400

Query  353   ----------FGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQK  502
                       FGKSK    S    L     P+  +  NS E A+ V  C YE+ T+WG+ 
Sbjct  401   LLAAERLERDFGKSKEMVKSVVDALQRKSNPQDTLI-NSSEPAQAVGHCHYEYQTSWGKT  459

Query  503   VGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDI  682
             VG LY S  ED  T + IH +GW S Y  P PP FLG  P GGP A+ QQ+RW T  L+I
Sbjct  460   VGWLYDSTTEDAHTSIGIHSRGWTSSYISPEPPAFLGCMPPGGPEAMLQQRRWATGLLEI  519

Query  683   LICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE  862
             L  K++P+  +   ++ FRQ LAYL+I  W +R   E+ Y LLPAYC+++ S   PK   
Sbjct  520   LFTKQNPLNGSSCKKIRFRQSLAYLYIFTWGLRSIPELFYCLLPAYCVLHGSALFPKGVC  579

Query  863   AAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGL  1042
               IV   ++  ++ LY L+E++  G S+ +               WLF     ++K+ G+
Sbjct  580   LGIVF--TLVGMHCLYTLWEFMSLGFSVHS--------------CWLFSIPDIILKLLGV  623

Query  1043  SEAVFEVTKKD------HSSDEALDKDDDSK---VGRFTFDESPLFVPGTTILLVNLAAL  1195
             S  +F VTKK        S D    K+DD       +F FD S  F+PGT ILLVNL A+
Sbjct  624   SNTIFIVTKKTISKTRLESGDRPSQKEDDGSNPDSNKFEFDGSLYFLPGTFILLVNLTAI  683

Query  1196  FIGFLDFKQNKSWSLGEAICSVWVILMY  1279
               GF    Q  S S G     +W   +Y
Sbjct  684   -AGFSMGLQRSSRSYGGNEGKIWHPTVY  710



>emb|CAB10308.1| cellulose synthase like protein [Arabidopsis thaliana]
 emb|CAB78571.1| cellulose synthase like protein [Arabidopsis thaliana]
Length=710

 Score =   287 bits (735),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 185/494 (37%), Positives = 268/494 (54%), Gaps = 62/494 (13%)
 Frame = +2

Query  11    VMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDPYGN  187
             +MTNAP+ LN+DCD + N+P VV  AMC FL   K+     FVQFPQ FY     D Y N
Sbjct  239   LMTNAPYTLNVDCDMYANEPDVVRQAMCVFLQNSKNSNHCAFVQFPQKFY-----DSYTN  293

Query  188   QMKIIMKYLF-----------RGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN-----  319
             ++ ++    F           RG AGIQGPFY+GTGCFH R+V+YG+    +++N     
Sbjct  294   ELAVLQSVSFLLLFDQFNILGRGVAGIQGPFYIGTGCFHTRRVMYGLSSDDLEDNGNISQ  353

Query  320   ----EKSTDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGT  487
                 E   +      +G SK    S    L     P+  +  N +EAA+EV  C YE+ T
Sbjct  354   VATREFLAEDSLVRKYGNSKELVKSVVDALQRKSNPQKSL-ANLIEAAQEVGHCHYEYQT  412

Query  488   AWGQKVGLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGT  667
             +WG  +G +Y S  ED  T V IH +GW S +  P+PP F+GS+PT G  A+ QQ+RW T
Sbjct  413   SWGN-LGWMYDSVAEDINTSVGIHLRGWTSSFISPDPPAFIGSTPTLGLEAIVQQRRWAT  471

Query  668   AALDILICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQ  847
              A+++L  K+SP +    G++ FRQ LAY W +   +R   E+ Y LLPAYC++++S   
Sbjct  472   GAIEVLFNKQSPFMGMFHGKIKFRQRLAYFWAL-MCLRSIPELIYCLLPAYCLLHDSALF  530

Query  848   PKLNEAAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVV  1027
             PK     +    ++  ++ LY L++++  G S+++               WLF     ++
Sbjct  531   PK--GPCLCTIVTLVGMHCLYSLWQFMSLGFSVQS--------------CWLFSIQDIIL  574

Query  1028  KVFGLSEAVFEVTKKD-------HSSDEALDKDDDSK--VGRFTFDESPLFVPGTTILLV  1180
             K+ G+S+  F + KK        + S  +  +DD  K  +G+F FD S LF+PGT I+LV
Sbjct  575   KLLGISQIGFVIAKKTIPETKSVYESKPSQGEDDVPKLNLGKFEFDSSGLFIPGTFIMLV  634

Query  1181  NLAALFIGFLDFKQN-------KSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTV  1339
             NLAAL  G+L   Q            L EA   + V++++  FLKGLF  GK+ IPLST+
Sbjct  635   NLAAL-AGYLVRLQRSSCSHGGGGSGLAEACGCILVVMLFLPFLKGLFEHGKYSIPLSTL  693

Query  1340  LKSGGLALLFFHAC  1381
              K+  L +LF   C
Sbjct  694   SKAAFLTVLFVFFC  707



>emb|CDY34543.1| BnaA08g04980D [Brassica napus]
Length=850

 Score =   289 bits (739),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 183/476 (38%), Positives = 258/476 (54%), Gaps = 53/476 (11%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+  VV  AMC FL   K      FVQFPQ FY     D 
Sbjct  401   VSGLMTNAPYMLNVDCDMYANEADVVRQAMCVFLQKSKSPDRCAFVQFPQEFY-----DS  455

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKST--------D  334
               +++ ++  YL RG AGIQGP Y G+GCFH R+V+YG+ P  ++NN   +        D
Sbjct  456   NSDELAVVQSYLGRGVAGIQGPLYCGSGCFHTRRVMYGLSPDNLENNGDLSSSATIEFLD  515

Query  335   KDQW-ETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             +D     FG SK   +S  + L G   P+  +  + +EAA+ V  C YE  T WG+ +G 
Sbjct  516   EDSLARKFGSSKELVISIVEALQGKSNPKTSL-TDFIEAAQMVGHCHYEHQTNWGKTLGC  574

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  ED  T + IH +GW S Y  P+PP FLGS+P+ G  A+ QQ+RWGT A+++L  
Sbjct  575   LYDSVAEDMNTSIGIHLRGWSSSYICPDPPAFLGSTPSVGFEAIVQQRRWGTGAIEVLFN  634

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP+      ++ FRQ LAYLW++   +R   E+ Y LLPAYC++ N+   PK     +
Sbjct  635   KQSPLRGMFSSKIRFRQRLAYLWVLMC-LRSIPELFYCLLPAYCLLRNTALYPK--GPCL  691

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
              I  +I  ++ LY L+++   G S+R+W        + A+  WLF     ++K+ G+S  
Sbjct  692   AITVTIVAMHCLYTLWQFTNNGFSVRSW--------ILATCGWLFSIHDILLKLLGISNV  743

Query  1052  VFEVTKKDH------SSDEALDKDDDSK----VGRFTFDESPLFVPGTTILLVNLAALFI  1201
              F V KK        S  E + + DD      V +F FD S  F                
Sbjct  744   GFVVAKKTTPKTMPISGYEPIQRQDDGPNSCYVHKFEFDNSCHFRSSC------------  791

Query  1202  GFLDFKQNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
                   +     L E    + VIL++  FLKGLF KGK+GIPLST+ K+  LA++F
Sbjct  792   ----HHEGGRSGLAENCACILVILLFLPFLKGLFAKGKYGIPLSTLSKAALLAMIF  843



>ref|XP_004151938.1| PREDICTED: cellulose synthase-like protein B3-like [Cucumis sativus]
Length=638

 Score =   281 bits (720),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 157/368 (43%), Positives = 214/368 (58%), Gaps = 48/368 (13%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSG+MTNAP++LN+DCD  VN+   +L  +C  +   ++K+  +VQFPQ FY GLKDD Y
Sbjct  270   VSGLMTNAPYILNVDCDMFVNESTAILQGICPFIDPINDKEVAYVQFPQRFYDGLKDDLY  329

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQW-ETFG  358
             GNQ+ + M+Y+  G AG QGP YMGTGC HRRKV+YG  P+  + N +S  + +  +TFG
Sbjct  330   GNQLIVDMEYIVSGLAGSQGPSYMGTGCIHRRKVLYGHSPNDHNINGRSIQETKLRKTFG  389

Query  359   KSKTFALSTTQILSGSLYPEIPIFPNSL----EAAKEVASCVYEFGTAWGQKVGLLYGSA  526
              S+ F  S +    G+       +PNSL    EA   VA+  YE  T WG KVG  YGS 
Sbjct  390   NSEEFIKSVSFASMGT-----TPYPNSLQCSIEALHNVATSNYEQDTCWGAKVGWYYGSV  444

Query  527   GEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPI  706
              ED  TG+ I GKGWKS+Y +P P  FLG +PT GP+  TQ KRW T  L+IL+ K  PI
Sbjct  445   TEDIFTGMMIQGKGWKSIYLNPQPAAFLGCAPTNGPSTFTQLKRWTTGFLEILLTKNCPI  504

Query  707   IWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
               A+FG+L                                        K++E  I+IP  
Sbjct  505   FGAVFGKLDL--------------------------------------KIHEREILIPIL  526

Query  887   IFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
             + ++YNL  + +Y++ G+S+RA+WNNQRM R+     + FG +  V+K  GLSEA+FEVT
Sbjct  527   LVLLYNLQQVLQYLKMGQSIRAYWNNQRMARIKTMCPYFFGVVGIVLKFLGLSEALFEVT  586

Query  1067  KKDHSSDE  1090
             KK   +D+
Sbjct  587   KKGLITDD  594



>gb|AAC25943.1| putative cellulose synthase [Arabidopsis thaliana]
Length=748

 Score =   284 bits (726),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 191/482 (40%), Positives = 270/482 (56%), Gaps = 45/482 (9%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVK-DEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP++LN+DCD + ND  VV  AMC LL    + K   FVQF Q FY     D 
Sbjct  281   VSGLMTNAPYILNVDCDMYANDADVVRQAMCILLQESLNMKHCAFVQFRQEFY-----DS  335

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH--VVDNNEKSTDKDQW--  346
                 + ++  +L RG AGIQGP Y+G+GC H R+V+YG+ P    VD +  S    ++  
Sbjct  336   STELIVVLQSHLGRGIAGIQGPIYIGSGCVHTRRVMYGLSPDDFEVDGSLSSVATREFLV  395

Query  347   -----ETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
                    FG SK    S    +  +  P+  I  NS+EAA+EV   +         ++G 
Sbjct  396   KDSLARRFGNSKEMMKSVVDAIQRNPNPQ-NILTNSIEAAREVGHFM---------QIGW  445

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  ED  T + IH +GW S Y  P+ P FLGS P G P AL QQ+RW T  ++IL  
Sbjct  446   LYDSVAEDLNTSIGIHSRGWTSSYISPDTPAFLGSMPAGVPEALLQQRRWATGWIEILFN  505

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP+      ++ FRQ LAYL I+   +R   E+ Y LLPAYC+++NS   PK     I
Sbjct  506   KQSPLRGLFSKKIRFRQRLAYLCIITC-LRSIPELIYCLLPAYCLLHNSTLFPKGLYLGI  564

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
              +  ++  I+ LY L+E++  G S+++W  +Q + R+ A+ SWLF      +K+ G+SE 
Sbjct  565   TV--TLVGIHCLYTLWEFMSLGYSVQSWLVSQSVWRIVATSSWLFSIFDITLKLLGISET  622

Query  1052  VFEVTKKDHSSDEAL---------DKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIG  1204
             VF +TKK  +  ++          D   +S + +F FD S  F+PGT I+LVN+AAL + 
Sbjct  623   VFIITKKTVAGTKSALGSGPSQGEDVGPNSDLFKFEFDGSLCFLPGTFIVLVNIAALAV-  681

Query  1205  FLDFKQNKSWS-------LGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLAL  1363
             F    Q  S+S       L EA   V V++++  FL GLF KGK+G PLST+  +G LA+
Sbjct  682   FSVGLQRSSYSHEGGGSGLAEACGCVLVMMLFLPFLMGLFKKGKYGTPLSTLSIAGFLAV  741

Query  1364  LF  1369
             LF
Sbjct  742   LF  743



>ref|XP_010522356.1| PREDICTED: cellulose synthase-like protein B4 isoform X2 [Tarenaya 
hassleriana]
Length=630

 Score =   276 bits (707),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/293 (46%), Positives = 183/293 (62%), Gaps = 15/293 (5%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VSG+MTNAP+MLN+DCD +VN+P V+   MC  LG K + +  FVQ PQ FY     D +
Sbjct  282  VSGLMTNAPYMLNVDCDMYVNNPDVLRQGMCLFLGSKTQNEYAFVQSPQLFY-----DTF  336

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWE----  349
            G+++ ++  Y+ RG  GI GP Y G+G  HRR++IYG+ PH +D++   +   + E    
Sbjct  337  GDEIVVLQTYIGRGMVGIDGPIYAGSGGIHRRRIIYGLSPHHLDDDGNLSSIAKVELLGE  396

Query  350  -----TFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLL  514
                  +G  K    S  + L G   P+  +   SLEAA  V +C YE+ T WG+ +G L
Sbjct  397  GKLEREYGDCKEMVKSAVEALRGKSTPQNDL-TISLEAAHRVGACDYEYTTNWGKTIGWL  455

Query  515  YGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICK  694
            YGS  ED  T VSIH KGWKS+Y  P+PP FLG  P GGPA + QQ+RW T  L++L  K
Sbjct  456  YGSTTEDANTSVSIHSKGWKSLYNSPDPPAFLGCMPAGGPAVMGQQRRWATGLLEVLFNK  515

Query  695  KSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPK  853
            +SP+I  L+ +L FR  L YL++  W IR   E+CYSLLPAYCI++NS F PK
Sbjct  516  QSPVIGMLYRKLGFRTGLCYLYLFIWGIRSIPELCYSLLPAYCILHNSAFLPK  568



>gb|KEH39004.1| cellulose synthase H1-like protein [Medicago truncatula]
Length=573

 Score =   275 bits (702),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/288 (46%), Positives = 179/288 (62%), Gaps = 3/288 (1%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VSG+MTNAPFMLN+DCD  VN+PK++ HAMC L+  K+ KD  FVQ  Q FY G+KDDP+
Sbjct  282  VSGLMTNAPFMLNVDCDMVVNNPKIIQHAMCILMDSKNGKDVAFVQCFQQFYDGIKDDPF  341

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS--TDKDQWETF  355
            GNQ     +Y+ +G  G+QGPFY GT  FHRR  IYG++P  +    K   T+K   + F
Sbjct  342  GNQWVASFEYIIKGMGGLQGPFYGGTNTFHRRNAIYGLYPDEIQYGRKGKITEKMLIQQF  401

Query  356  GKSKTFALSTTQILSGSLYPEIPIFP-NSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
            G SK F  S T    GS      I P N L+ A +V+ C YE+GT+WG+++  LYGS  E
Sbjct  402  GSSKEFVKSVTHAFEGSGNSIDGISPSNLLDKAIQVSDCGYEYGTSWGKQMCWLYGSISE  461

Query  533  DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
            D  TG+++  KGW+S  C P P  F+G +P G    + QQKRW +    +   K SP++ 
Sbjct  462  DVPTGLNMQRKGWRSECCTPEPTAFMGCAPGGLLTTMIQQKRWSSGLTVVFFSKHSPVMC  521

Query  713  ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKL  856
             LFG++ FR  L+Y W+  W +R  FE+ Y+ L AYCII N+   PK+
Sbjct  522  TLFGKIQFRAGLSYCWLTNWGLRSVFEVSYAALVAYCIITNTSIFPKV  569



>ref|XP_006427963.1| hypothetical protein CICLE_v10027629mg [Citrus clementina]
 ref|XP_006427964.1| hypothetical protein CICLE_v10027629mg [Citrus clementina]
 ref|XP_006427965.1| hypothetical protein CICLE_v10027629mg [Citrus clementina]
 gb|ESR41203.1| hypothetical protein CICLE_v10027629mg [Citrus clementina]
 gb|ESR41204.1| hypothetical protein CICLE_v10027629mg [Citrus clementina]
 gb|ESR41205.1| hypothetical protein CICLE_v10027629mg [Citrus clementina]
Length=291

 Score =   263 bits (672),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 139/286 (49%), Positives = 185/286 (65%), Gaps = 9/286 (3%)
 Frame = +2

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+ IH KGW+S YC P+P  FLG      PAA++QQKRW T  L+IL  K +PI     
Sbjct  3     TGMMIHAKGWRSGYCSPDPRAFLGCGALADPAAMSQQKRWATGFLEILFSKTNPIFACFT  62

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
              +L FRQCLAYLWI+ W +R   E+CY+ LPAYCII NS F PK+ E  I IP ++ +IY
Sbjct  63    SKLQFRQCLAYLWILIWGLRSIPEVCYAALPAYCIITNSSFLPKIQELGICIPVTLIVIY  122

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
              +Y L +YI  G  + +WW N  M R++A+G+W  G L+ ++K  GLSE +FE+T+K H 
Sbjct  123   KVYTLSDYIRIGFPIDSWWVNSCMERIFATGAWFLGLLNVILKFLGLSETIFEITQKFHQ  182

Query  1082  SDEALD---KDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQN--KSWSLGE  1246
                  D   +DDD    +  FDESP+F+PGTTILLV++ AL +  L  +    +   LGE
Sbjct  183   PRTPADDCGEDDD----KMIFDESPVFIPGTTILLVHVTALAMALLGLEAQGGQGTGLGE  238

Query  1247  AICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLFFHACK  1384
               CS +V+L +  FL+GLF +GK+GIPL T+ KS  LALLF H CK
Sbjct  239   FFCSTYVVLCFLPFLQGLFRRGKYGIPLPTICKSSALALLFVHLCK  284



>ref|XP_010510006.1| PREDICTED: cellulose synthase-like protein B3 isoform X3 [Camelina 
sativa]
Length=572

 Score =   267 bits (683),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/296 (44%), Positives = 181/296 (61%), Gaps = 17/296 (6%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLL--GVKDEKDAEFVQFPQNFYGGLKDD  175
            VSG+MTNAP+MLN+DCD +VN+  VV  AMC  L   + +  +  FVQ+PQ+FY     D
Sbjct  280  VSGLMTNAPYMLNVDCDMYVNEADVVRQAMCIFLQNSISNSNNCAFVQYPQDFY-----D  334

Query  176  PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS---------  328
               +++ ++  Y+ RG AGIQG  Y G+GCFH R+V+YG+    ++++ +S         
Sbjct  335  SNADELVVLQSYIGRGIAGIQGSTYAGSGCFHTRRVMYGISLDDLEDDGRSLSSVATRSY  394

Query  329  -TDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKV  505
              +++    FG SK    S    L     P+     +SLEAA+EV  C YE  T+WG+ +
Sbjct  395  LAEENLAREFGNSKEMVTSVVNALQRKPNPQHSSLTDSLEAAQEVGHCHYENQTSWGKTI  454

Query  506  GLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDIL  685
            G LYGS  ED  TG+ IH +GW S Y  P+PP FLG+ P GGP A+ QQ+RW    L+IL
Sbjct  455  GWLYGSTTEDVHTGLGIHSRGWTSSYISPDPPAFLGAMPPGGPEAMVQQRRWAAGMLEIL  514

Query  686  ICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPK  853
              K+SP+I   F +L FRQ LAYL+I+ W +R   E+ Y LLPAYC+++NS   PK
Sbjct  515  FNKRSPLIGVFFRKLRFRQSLAYLYILTWGLRSIPELFYCLLPAYCLLHNSALFPK  570



>ref|XP_010510003.1| PREDICTED: cellulose synthase-like protein B3 isoform X1 [Camelina 
sativa]
Length=668

 Score =   268 bits (685),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 186/309 (60%), Gaps = 21/309 (7%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLL--GVKDEKDAEFVQFPQNFYGGLKDD  175
            VSG+MTNAP+MLN+DCD +VN+  VV  AMC  L   + +  +  FVQ+PQ+FY     D
Sbjct  280  VSGLMTNAPYMLNVDCDMYVNEADVVRQAMCIFLQNSISNSNNCAFVQYPQDFY-----D  334

Query  176  PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS---------  328
               +++ ++  Y+ RG AGIQG  Y G+GCFH R+V+YG+    ++++ +S         
Sbjct  335  SNADELVVLQSYIGRGIAGIQGSTYAGSGCFHTRRVMYGISLDDLEDDGRSLSSVATRSY  394

Query  329  -TDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKV  505
              +++    FG SK    S    L     P+     +SLEAA+EV  C YE  T+WG+ +
Sbjct  395  LAEENLAREFGNSKEMVTSVVNALQRKPNPQHSSLTDSLEAAQEVGHCHYENQTSWGKTI  454

Query  506  GLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDIL  685
            G LYGS  ED  TG+ IH +GW S Y  P+PP FLG+ P GGP A+ QQ+RW    L+IL
Sbjct  455  GWLYGSTTEDVHTGLGIHSRGWTSSYISPDPPAFLGAMPPGGPEAMVQQRRWAAGMLEIL  514

Query  686  ICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEA  865
              K+SP+I   F +L FRQ LAYL+I+ W +R   E+ Y LLPAYC+++NS   PK    
Sbjct  515  FNKRSPLIGVFFRKLRFRQSLAYLYILTWGLRSIPELFYCLLPAYCLLHNSALFPK----  570

Query  866  AIVIPASIF  892
             IV   S+F
Sbjct  571  QIVSRVSLF  579



>ref|XP_010510005.1| PREDICTED: cellulose synthase-like protein B3 isoform X2 [Camelina 
sativa]
Length=665

 Score =   268 bits (685),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/309 (43%), Positives = 186/309 (60%), Gaps = 21/309 (7%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLL--GVKDEKDAEFVQFPQNFYGGLKDD  175
            VSG+MTNAP+MLN+DCD +VN+  VV  AMC  L   + +  +  FVQ+PQ+FY     D
Sbjct  280  VSGLMTNAPYMLNVDCDMYVNEADVVRQAMCIFLQNSISNSNNCAFVQYPQDFY-----D  334

Query  176  PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKS---------  328
               +++ ++  Y+ RG AGIQG  Y G+GCFH R+V+YG+    ++++ +S         
Sbjct  335  SNADELVVLQSYIGRGIAGIQGSTYAGSGCFHTRRVMYGISLDDLEDDGRSLSSVATRSY  394

Query  329  -TDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKV  505
              +++    FG SK    S    L     P+     +SLEAA+EV  C YE  T+WG+ +
Sbjct  395  LAEENLAREFGNSKEMVTSVVNALQRKPNPQHSSLTDSLEAAQEVGHCHYENQTSWGKTI  454

Query  506  GLLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDIL  685
            G LYGS  ED  TG+ IH +GW S Y  P+PP FLG+ P GGP A+ QQ+RW    L+IL
Sbjct  455  GWLYGSTTEDVHTGLGIHSRGWTSSYISPDPPAFLGAMPPGGPEAMVQQRRWAAGMLEIL  514

Query  686  ICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEA  865
              K+SP+I   F +L FRQ LAYL+I+ W +R   E+ Y LLPAYC+++NS   PK    
Sbjct  515  FNKRSPLIGVFFRKLRFRQSLAYLYILTWGLRSIPELFYCLLPAYCLLHNSALFPK----  570

Query  866  AIVIPASIF  892
             IV   S+F
Sbjct  571  QIVSRVSLF  579



>emb|CDY15319.1| BnaC04g43040D [Brassica napus]
Length=490

 Score =   259 bits (662),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 187/476 (39%), Positives = 256/476 (54%), Gaps = 41/476 (9%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDE--KDAEFVQFPQNFYGGLKDD  175
             VSG+MTNAP+MLN+DCD  VN+  VV  AMC LL           FVQ+PQ+FY     D
Sbjct  29    VSGLMTNAPYMLNVDCDMFVNEADVVRQAMCILLQKSKNSINHCAFVQYPQDFY-----D  83

Query  176   PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMW---------PHVVDNNEKS  328
                 ++ ++  +L RG AGIQG  Y G+GCFH R+V+YG+          P  V+  +  
Sbjct  84    SNCEELVVLQSHLSRGFAGIQGSIYSGSGCFHTRRVMYGLSVDDLEEDGSPSSVNARKFL  143

Query  329   TDKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVG  508
              ++     FG SK    S    L         I  N L+ A+EV  C YE  T+WG+ +G
Sbjct  144   DEESLARKFGSSKEIRKSVANALQRKSNSH-NILTNFLDEAREVGQCQYESQTSWGKTIG  202

Query  509   LLYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGP--AALTQQKRWGTAALDI  682
              LY S  ED  T + IH +GW S Y  P  P FLG  P GGP   A+ QQ+RWGT  L++
Sbjct  203   WLYDSTAEDVNTSIDIHSRGWTSSYIYPVQPAFLGCMPPGGPEAKAMVQQRRWGTGMLEV  262

Query  683   LICKKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNE  862
             L  K SP+I     +L FRQ LAY+ I  W +R   E+ Y LLPA+C+++NS   PK   
Sbjct  263   LFNKHSPLIGIFSQKLRFRQRLAYIHIFTWGLRSIPELAYCLLPAFCLLHNSALFPKGLC  322

Query  863   AAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGL  1042
             + I +  ++  ++ LY L+E++    SL   + +  ++  Y+S        S + K   L
Sbjct  323   SGISV--TLVGMHCLYTLWEFV----SLCFRYIHVSLIS-YSSFLEFRKPCSLLQK--RL  373

Query  1043  SEAVFEVTKKDHSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ  1222
             S    +    DH+S  A     D   G+F FD+S  F+PGT I+LVNLAA+  GFL   Q
Sbjct  374   SPRQGQGLGMDHASCSA-----DPNAGKFEFDDSVYFLPGTFIVLVNLAAI-AGFLVGLQ  427

Query  1223  NKSWSLG-------EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
               S   G       EA   + V++++  FLKGLF KGK+GI LST  K+  LA+LF
Sbjct  428   PVSHIYGGGGSTFVEACACILVVMLFLPFLKGLFEKGKYGILLSTFSKAAFLAVLF  483



>ref|NP_193267.1| cellulose synthase-like protein B6 [Arabidopsis thaliana]
 emb|CAB10311.1| cellulose synthase like protein [Arabidopsis thaliana]
 emb|CAB78574.1| cellulose synthase like protein [Arabidopsis thaliana]
 gb|AEE83584.1| cellulose synthase-like protein B6 [Arabidopsis thaliana]
Length=828

 Score =   267 bits (682),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 145/368 (39%), Positives = 215/368 (58%), Gaps = 35/368 (10%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNAP+MLN+DCD + N+P VV  AMC FL   K+     FVQFPQNFY     D 
Sbjct  369   VSGLMTNAPYMLNVDCDMYANEPDVVRQAMCVFLQNSKNSNHCAFVQFPQNFY-----DS  423

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---------EKST  331
             Y N++ ++  Y+ RG AGIQGP Y+G+GCFH R+V+YG+    ++++         E  +
Sbjct  424   YTNELVVLQHYMKRGVAGIQGPIYIGSGCFHTRRVMYGLSSDDLEDDGSLSSVASREFLS  483

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             +      +G SK    S    L     P+  +  N +EAA+EV  C YE+ T+WG  +G 
Sbjct  484   EDSLVRKYGSSKELVKSVVDALQRKSNPQKSL-ANLVEAAQEVGHCHYEYQTSWGN-LGW  541

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  EDT T + IH +GW S +  P+PP FLGS+P+ GP A+ Q +RW T ++++L  
Sbjct  542   LYDSVAEDTNTSIGIHLRGWTSSFISPDPPAFLGSTPSVGPEAIVQHRRWATGSIEVLFN  601

Query  692   KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
             K+SP+I     ++ FRQ LAY W++   IR   E+ Y LLPAYC++NNS   PK     I
Sbjct  602   KQSPLI-GFRRKIKFRQRLAYFWVL-MCIRSIPELVYCLLPAYCLLNNSALFPKGPCLGI  659

Query  872   VIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEA  1051
             ++  ++  ++ LY L++++  G S+++               WLF     ++K+ G+S+ 
Sbjct  660   IV--TLVGMHCLYTLWQFMILGFSVKS--------------CWLFSIQDIILKLLGISKI  703

Query  1052  VFEVTKKD  1075
              F V KK+
Sbjct  704   GFIVAKKN  711



>gb|KFK31116.1| hypothetical protein AALP_AA6G070100 [Arabis alpina]
Length=627

 Score =   262 bits (669),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 141/324 (44%), Positives = 191/324 (59%), Gaps = 18/324 (6%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
            VSG+MTNAP+MLN+DCD +VN+  VV  AMC FL G  ++    FVQFPQ FY     D 
Sbjct  280  VSGLMTNAPYMLNVDCDMYVNEANVVRQAMCIFLQGSMNQNHCGFVQFPQFFY-----DS  334

Query  179  YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---------EKST  331
              +++ ++  YL RG AGIQGP   G+GCFH R+V+YG+    +++N         E   
Sbjct  335  NADELTVLQSYLGRGIAGIQGPVCAGSGCFHTRRVMYGLSLDDLEDNGSLSSVATREFLA  394

Query  332  DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
            ++D    FG SK    S    L     P+  I  NSL+AAKEV  C YE+ T+WG+ +G 
Sbjct  395  EEDLVRKFGNSKEMVNSVVVALQRKSNPQT-ILTNSLDAAKEVGHCPYEYQTSWGKTIGW  453

Query  512  LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
            LY S  ED  T + IH +GW S Y  PNPP FLG  P GGP A+ QQ+RW T  L+IL  
Sbjct  454  LYDSTSEDVHTSIGIHSRGWTSSYISPNPPSFLGCMPPGGPEAMLQQRRWATGLLEILFN  513

Query  692  KKSPIIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAI  871
            K+SP+I     ++ FRQ LAYL +  W +R   E+ Y LLPAYC+ +NS   PK     I
Sbjct  514  KQSPLIGMFHRKIRFRQRLAYLNLSVWGLRSIPELFYCLLPAYCLFHNSPLFPKGPCLGI  573

Query  872  VIPASIFIIYNLYGLFEYIETGES  943
            ++  ++  ++ LY  +E++  G S
Sbjct  574  IV--TLVGMHCLYTQWEFMSLGFS  595



>gb|KFK31114.1| hypothetical protein AALP_AA6G069800 [Arabis alpina]
Length=808

 Score =   263 bits (672),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 167/419 (40%), Positives = 228/419 (54%), Gaps = 38/419 (9%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             VSG+MTNA +MLN+DCD + ND  VV  AMC FL    +     FVQFPQ FY    D  
Sbjct  280   VSGLMTNALYMLNVDCDMYANDADVVRQAMCIFLQEPVNLNHCAFVQFPQAFY----DSN  335

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---------EKST  331
                ++     +L RG  GIQGP Y G+GCFH R+V+YG+ P  ++++         +  T
Sbjct  336   ASKRINFFRSHLERGIGGIQGPIYAGSGCFHTRRVMYGLSPSDLEDDGSLYSAATRDILT  395

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             ++     FG SK    S  + L     P   +  NS+EAAKEV +  YE+ T+WG+ +GL
Sbjct  396   EESLAREFGHSKEMVKSLVESLQRKSNPRNSLI-NSIEAAKEVGNVQYEYQTSWGKTIGL  454

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  ED  T + IH +GW S +   + P FLG  P  G  A+ Q++RW T  L+I   
Sbjct  455   LYDSIMEDVNTSIGIHSRGWTSSWICSDQPAFLGCMPPLGVDAMLQRRRWMTGLLEIFFN  514

Query  692   KKSPIIWALFGRLHFRQCLAYLWI--MGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEA  865
             K+SP+I     +L FRQ LAYL I   G    PF  + Y LLPAYC+++NS   PK    
Sbjct  515   KQSPLIGMFHHKLRFRQRLAYLSISMSGLSSIPF--LFYCLLPAYCLLHNSPLFPK--GF  570

Query  866   AIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLS  1045
              + I  ++  ++ LY L+E+++ G S++ W+       VY  GS LF      +K+ G+S
Sbjct  571   CLGITLTLVGMHCLYTLWEFMKPGFSVQVWY-------VYFCGS-LFSLFDITLKLLGIS  622

Query  1046  EAVFEVTKKDH------SSDEALDKDDDS---KVGRFTFDESPLFVPGTTILLVNLAAL  1195
             E VF VTKK        S D     DDD      G+F  ++S  F+P T ILLVNLA L
Sbjct  623   ETVFIVTKKTMPDTKSGSGDGPSQSDDDGLNLDSGKFEIEDSLFFLPSTFILLVNLAVL  681



>emb|CDY68738.1| BnaA04g28960D, partial [Brassica napus]
Length=447

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 182/471 (39%), Positives = 251/471 (53%), Gaps = 52/471 (11%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDE-KDAEFVQFPQNFYGGLKDD  175
             VSG+MTNAP+MLN+DCD  VN+  VV  AMC FL   K+      FVQ+PQ+FY     D
Sbjct  7     VSGLMTNAPYMLNVDCDMFVNEADVVRQAMCIFLQKSKNSINHCAFVQYPQDFY-----D  61

Query  176   PYGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQW-ET  352
                 ++ ++  +L RG AGIQG  Y G+G      V          N  K  D++     
Sbjct  62    SNCEELVVLQSHLSRGFAGIQGSIYSGSGYGSLSSV----------NARKFLDEESLARK  111

Query  353   FGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             FG SK    S    L      +  I  N L+ A+EV  C YE  T+WG+ +G LY S  E
Sbjct  112   FGSSKEIRKSVANALQRKSNSQ-NILTNFLDEAREVGQCQYESQTSWGKTIGWLYDSTAE  170

Query  533   DTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIW  712
             D  T + IH +GW S Y  P+ P FLG  P GGP A+ QQ+RWGT  L++L  K SP+I 
Sbjct  171   DVNTSIDIHSRGWTSSYIYPDEPAFLGCMPPGGPEAMVQQRRWGTGMLEVLFNKHSPLIG  230

Query  713   ALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIF  892
                 +L FRQ LAY+ I  W +R   E+ Y LLPAYC+++NS   PK   + I +  ++ 
Sbjct  231   IFSQKLRFRQRLAYIHIFTWGLRSIPELAYCLLPAYCLLHNSALFPKGLCSGITV--TLV  288

Query  893   IIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKK  1072
              ++ +Y L+E++  G S+ +                    +  + K+ G+S  VF VTKK
Sbjct  289   SMHCVYTLWEFMSLGFSVHSC------------------IIDIIFKLLGVSRTVFIVTKK  330

Query  1073  DHSSDEALDKDD-----DSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQNKSWS  1237
               +   +   D      D   G+F FD+S  F+PGT I+LVNLAA+  GF    Q  +  
Sbjct  331   TFTETRSGTGDGPSCSADPNAGKFEFDDSVYFLPGTFIVLVNLAAI-AGFSVGLQPLTHI  389

Query  1238  LG-------EAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGGLALLF  1369
              G       EA   + V++++  FLKGLF KGK+GIPLST+ K+  LA+LF
Sbjct  390   YGGGGSTFVEACACILVVMLFLPFLKGLFEKGKYGIPLSTLSKAAFLAVLF  440



>gb|ABR16035.1| unknown [Picea sitchensis]
Length=744

 Score =   257 bits (656),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 142/402 (35%), Positives = 215/402 (53%), Gaps = 18/402 (4%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGVM+NAPF+L LDCD + N+ + +  AMCF L  K   +  +VQFPQ F+G  K+D Y
Sbjct  286   VSGVMSNAPFILTLDCDMYTNNSEALRQAMCFFLEPKTGHEFGYVQFPQTFHGITKNDLY  345

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
              N +K +++  ++G  GI+GPFY+GTGC HRR V+ G               ++  +  K
Sbjct  346   ANNLKTLLEIKYKGLDGIEGPFYIGTGCIHRRDVLCG--------------SERRRSSPK  391

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
                 A S      GS+  +       L+ A+++A+C YE  T WG++VG++YG A ED  
Sbjct  392   YHKAAYSIVCTEDGSVAKDKASSSKMLKDARDLANCTYEDNTLWGKEVGMIYGCAVEDIL  451

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG  I  +GWKS+YC P    FLG +P      L Q KRW    L++ + K  P +  + 
Sbjct  452   TGFVIQCRGWKSIYCTPRRKAFLGCAPNNLNDTLIQHKRWAAGHLELFLSKFCPYLHGI-  510

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
              R+   Q + Y +   W +     +CY L+P  C++      PK++ +   + AS+ +  
Sbjct  511   QRIRVAQRMCYSFCGLWSLSSMHILCYGLIPGLCMLRGLSLFPKVSSSYFFLFASLAVSG  570

Query  902   NLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHS  1081
               Y L E+I  G   ++WWN QRM  +    ++LF  +  V K+ G+SE  FEVT K   
Sbjct  571   YGYSLIEFIWNGGWFKSWWNEQRMWMIKGVSAYLFASIEVVGKMLGVSEVGFEVTSKVVD  630

Query  1082  SDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGF  1207
             S+ A  K  + ++  F    S LF+P TT+ ++NL +L  G 
Sbjct  631   SEAA--KRYEGEIFEFGV-ASALFIPLTTLAIINLISLVGGL  669



>ref|XP_010556996.1| PREDICTED: cellulose synthase-like protein B3 isoform X2 [Tarenaya 
hassleriana]
Length=568

 Score =   253 bits (646),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 132/290 (46%), Positives = 172/290 (59%), Gaps = 12/290 (4%)
 Frame = +2

Query  2    VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
            VSGVMTNAP+MLN+DCD +VN+P V+  AMC  LG        FVQ PQ FY     D +
Sbjct  279  VSGVMTNAPYMLNVDCDMYVNNPDVIRQAMCLFLGSASRNQFAFVQSPQLFY-----DSF  333

Query  182  GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPH-VVDNNEKSTDK-----DQ  343
            G+ + + + Y+ RG AGI  P Y G+G   RR VIYG+ PH + D+   S+ K     + 
Sbjct  334  GDDLVLFLTYIGRGMAGIGTPLYAGSGGILRRNVIYGLSPHDLQDDGSLSSGKLLEEGNL  393

Query  344  WETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGS  523
               +G  +    S    L G   P+  +  +SLEAA  VA C YE  T WG+  G +Y S
Sbjct  394  KREYGNCEEMVTSAADALQGKSNPKNGL-TSSLEAAHRVADCDYEHCTNWGKTFGWIYDS  452

Query  524  AGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSP  703
              ED  T V+IH KGWKS Y  P PP FLG  P GGPAA+ QQ+RW T  L++L  K+SP
Sbjct  453  TAEDINTSVNIHAKGWKSYYNSPEPPAFLGCMPPGGPAAMGQQRRWATGLLEVLFNKESP  512

Query  704  IIWALFGRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPK  853
            +I  L+  L FR   +YL+I  W ++   E+CY LLPAYCI+++S F PK
Sbjct  513  VIGMLWRELGFRSGCSYLYICTWGLKSIPELCYCLLPAYCILHDSAFLPK  562



>gb|ACD64451.1| cellulose synthase-like protein [Bahiopsis lanata]
Length=224

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 115/220 (52%), Positives = 145/220 (66%), Gaps = 2/220 (1%)
 Frame = +2

Query  551   SIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRL  730
             SIHG+GW+S    P+P  FLG +PT  P++LTQQKRW T   +IL   K+P+  A  G L
Sbjct  1     SIHGRGWRSAITSPDPLAFLGCAPTTFPSSLTQQKRWVTGLFEILFTDKNPLRLATKGNL  60

Query  731   HFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLY  910
              FRQ L Y     W +R   E+CY+ LPAYCII  SHF PK+NE A +I  SIF+IYN+Y
Sbjct  61    WFRQALGYFSFCLWAVRSVLELCYASLPAYCIITGSHFLPKINERAFLIFMSIFVIYNVY  120

Query  911   GLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDE  1090
               +E    G SLR WWN QRM RV    +WLFGFLS ++K  GLSE VFEVT+K+H  ++
Sbjct  121   VYWECKRVGVSLRMWWNLQRMERVNVMTAWLFGFLSVMLKFIGLSETVFEVTQKEHLLND  180

Query  1091  ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
                 +DD   GRFT+D+SP+ VPG  +LLVN+ AL  G L
Sbjct  181   G--DNDDKNAGRFTYDKSPIIVPGVVVLLVNMIALVNGVL  218



>ref|XP_004288455.1| PREDICTED: cellulose synthase-like protein G2-like [Fragaria 
vesca subsp. vesca]
Length=738

 Score =   246 bits (627),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 151/407 (37%), Positives = 219/407 (54%), Gaps = 23/407 (6%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VSGV++N+PF+L LDCD   NDP     AMCF L  K       VQFPQ F+   K+D Y
Sbjct  282   VSGVISNSPFILGLDCDMFCNDPSSARQAMCFHLDPKLSPSLALVQFPQKFHNISKNDIY  341

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWE---T  352
              +Q++     L++G  G+QGP   GTG + +R  +YG        + K   KD  E   +
Sbjct  342   DSQLRSTFTVLWQGFDGLQGPCVSGTGYYIKRLSLYG-------RSLKDDQKDLMELRQS  394

Query  353   FGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGE  532
             FG S  FA S    L G+  P++ +     E  +++ASC YE GT WG++ G LY S  E
Sbjct  395   FGSSNEFAKS----LDGNYKPDMKM-AQLAETQQQLASCTYEDGTKWGEEAGYLYASVVE  449

Query  533   DTKTG-VSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPII  709
             D  TG  S+H KGW SVYCDP  P FLGS  T     L Q  RW +  +D+ I K  P+I
Sbjct  450   DYFTGFASLHCKGWNSVYCDPPRPQFLGSGTTNLNDFLVQGTRWSSGLVDVAISKYCPLI  509

Query  710   WALFGRLHFRQCLAYLWIMGWPIRPFFEI-CYSLLPAYCIINNSHFQPKLNEAAIVIPAS  886
             + LF ++ F +C+ Y W+  +PI  FF + C + +P  C++N     P+++ +   I + 
Sbjct  510   YGLF-KMSFLECMCYAWLAIFPICYFFSLWCLATIPQLCLLNGISLYPEVSNSYFWIFSF  568

Query  887   IFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVT  1066
             +F+      L E + TGESL+ W   QR+  + +  S  +G L   +K FGL EA F  T
Sbjct  569   VFLSSVFRHLSEVLTTGESLQHWIYEQRIWMMKSVTSQFYGSLDAFMKKFGLREASFFPT  628

Query  1067  KKDHSSDEALDKDDDSKVGRFTFDESPLF-VPGTTILLVNLAALFIG  1204
              K     + +++      G F F  S LF VP  ++ ++N+A+L +G
Sbjct  629   NK----VDDVEQFKRYNAGIFDFQTSALFLVPLASLFILNMASLCVG  671



>gb|ACD64419.1| cellulose synthase-like protein [Helianthus petiolaris]
 gb|ACD64425.1| cellulose synthase-like protein [Helianthus petiolaris]
 gb|ACD64438.1| cellulose synthase-like protein [Helianthus petiolaris]
 gb|ACD64444.1| cellulose synthase-like protein [Helianthus petiolaris]
 gb|ACD64448.1| cellulose synthase-like protein [Helianthus petiolaris]
Length=224

 Score =   230 bits (587),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 149/220 (68%), Gaps = 2/220 (1%)
 Frame = +2

Query  551   SIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRL  730
             +IHG+GW+S    P+P  FLG S T  P++LTQQKRW T   +IL   K+P++  + G++
Sbjct  1     NIHGRGWRSAITSPDPLAFLGCSATTYPSSLTQQKRWFTGVFEILFTDKNPLLLTIEGKI  60

Query  731   HFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLY  910
              FRQ LAY +I  W +R   E+CY+ LPAYCII +SHF PK+NE A +I   IF+IYNLY
Sbjct  61    WFRQALAYFYICLWAVRSVPELCYASLPAYCIIKDSHFLPKVNERASLIFMGIFVIYNLY  120

Query  911   GLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDE  1090
               +E    G SLR WWN QRM RV    + LF F+S ++K+ GLS  VFEVT+K+H S++
Sbjct  121   AYWECKRIGVSLRMWWNLQRMERVNTLTARLFAFVSVMLKLIGLSNTVFEVTQKEHMSND  180

Query  1091  ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
               D +D+  VGRFT+D SP+ +PG  ILL+N+ AL  G L
Sbjct  181   --DDNDNVSVGRFTYDNSPMIMPGVVILLINIVALVNGML  218



>gb|ACD64436.1| cellulose synthase-like protein [Helianthus petiolaris]
 gb|ACD64441.1| cellulose synthase-like protein [Helianthus petiolaris]
 gb|ACD64442.1| cellulose synthase-like protein [Helianthus petiolaris]
Length=224

 Score =   229 bits (585),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 149/224 (67%), Gaps = 2/224 (1%)
 Frame = +2

Query  551   SIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRL  730
             +IHG+GW+S    P+P  FLG S T  P++LTQQKRW T   +IL   K+P++  + G +
Sbjct  1     NIHGRGWRSAITSPDPLAFLGCSATTYPSSLTQQKRWFTGVFEILFTHKNPLLLTIEGNI  60

Query  731   HFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLY  910
              FRQ LAY +I  W +R   E+CY+ LPAYCII +SHF PK+NE A +I   IF+IYNLY
Sbjct  61    WFRQALAYFYICLWAVRSVPELCYASLPAYCIIKDSHFLPKVNERASLIFMGIFVIYNLY  120

Query  911   GLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDE  1090
               +E    G SLR WWN QRM RV    + LF F+S ++K+ GLS  VFEVT+K+H S++
Sbjct  121   AYWECKRIGVSLRMWWNLQRMERVNTLTARLFAFVSVMLKLIGLSNTVFEVTQKEHMSND  180

Query  1091  ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ  1222
               D +D+  VGRFT+D SP+ +PG  ILL+N+ AL  G L   +
Sbjct  181   --DDNDNVSVGRFTYDNSPMIMPGVVILLINIMALVNGMLRLSK  222



>gb|ACD64421.1| cellulose synthase-like protein [Helianthus petiolaris]
Length=224

 Score =   229 bits (585),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 149/220 (68%), Gaps = 2/220 (1%)
 Frame = +2

Query  551   SIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRL  730
             +IHG+GW+S    P+P  FLG S T  P++LTQQKRW T   +IL   K+P++  + G++
Sbjct  1     NIHGRGWRSAITSPDPLAFLGCSATTYPSSLTQQKRWFTGIFEILFTDKNPLLLTIEGKI  60

Query  731   HFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLY  910
              FRQ LAY +I  W +R   E+CY+ LPAYCII +SHF PK+NE A +I   IF+IYNLY
Sbjct  61    WFRQALAYFYICLWAVRSVPELCYASLPAYCIIKDSHFLPKVNERASLIFMGIFVIYNLY  120

Query  911   GLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDE  1090
               +E    G SLR WWN QRM RV    + LF F+S ++K+ GLS  VFEVT+K+H S++
Sbjct  121   AYWECKRIGVSLRMWWNLQRMERVNTLTARLFAFVSVMLKLIGLSNTVFEVTQKEHMSND  180

Query  1091  ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
               D +D+  VGRFT+D SP+ +PG  ILL+N+ AL  G L
Sbjct  181   --DDNDNVSVGRFTYDNSPMIMPGVVILLINIVALVNGML  218



>ref|XP_006408795.1| hypothetical protein EUTSA_v10001915mg [Eutrema salsugineum]
 gb|ESQ50248.1| hypothetical protein EUTSA_v10001915mg [Eutrema salsugineum]
Length=745

 Score =   244 bits (622),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 173/485 (36%), Positives = 250/485 (52%), Gaps = 55/485 (11%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMC-FLLGVKDEKDAEFVQFPQNFYGGLKDDP  178
             V+G+MTNAP+MLN+DCD + N+  VV  AMC FL    +     FVQ   NF      D 
Sbjct  280   VTGLMTNAPYMLNVDCDMYANEADVVRQAMCIFLQESMNPNHIAFVQHSANF-----RDS  334

Query  179   YGNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNN---------EKST  331
               ++  I   Y+ RG AGIQG  Y G+GCFH RK++YG+ P  ++++         +  T
Sbjct  335   KADEFNIFPSYMERGVAGIQGAIYTGSGCFHTRKIMYGLTPDDLEDDGSLSSVATRKILT  394

Query  332   DKDQWETFGKSKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGL  511
             D +  + FG S     S    L G L  +  +   SLEAA+EV +  YE+ T+WG+ +G 
Sbjct  395   DDNLSKVFGHSIEMTKSVVSALRGKLNRQHSL-TYSLEAAREVGNLHYEYQTSWGKTIGW  453

Query  512   LYGSAGEDTKTGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILIC  691
             LY S  ED  T + IH +GW S     +PP F+G +P  G  A+ +++R  T  L+I+  
Sbjct  454   LYDSVLEDVNTSIEIHSRGWTSSLISSDPPAFIGCTPPVGLEAMLRKRRCFTGGLEIIFN  513

Query  692   KKSPIIWALFGRLHFRQCLAYLWI--MGWPIRPFFEICYSLLPAYCIINNSHFQPK----  853
             K+SP+I     ++ FRQ LAYL I  MG    P   + Y LLPAYC++NNS   PK    
Sbjct  514   KQSPLIGMFHQKIEFRQRLAYLSISMMGLGFLPV--LFYCLLPAYCLLNNSPLYPKGLRL  571

Query  854   -LNEAAIVIPASIFIIYNLYGLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVK  1030
              +N   + +P         Y L  +     S++ W  N         GS LF      +K
Sbjct  572   GINFTLLGMPC-------FYTLRGFTSPDFSVQLWCAN-------ICGS-LFSIFDITLK  616

Query  1031  VFGLSEAVFEVTKKDH------SSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAA  1192
             + G+S+ VF +TKK        S D    ++DD   G+ +  +  L++PGT ILLVNLAA
Sbjct  617   LLGISKTVFRITKKTMPDIKLGSKDRQSQQEDD---GQSSEIDGLLYLPGTFILLVNLAA  673

Query  1193  LFIGFLDFK------QNKSWSLGEAICSVWVILMYWAflkglfgkgkfgIPLSTVLKSGG  1354
             L    +  +      +    +L EA    +V++++   LK LF  GK GIP ST+ K+  
Sbjct  674   LADYLVGLQLWSRSDERDGSALAEASGCTFVVMVFLPLLKSLFYDGKSGIPSSTLYKAAF  733

Query  1355  LALLF  1369
             L + F
Sbjct  734   LVVFF  738



>gb|ACD64439.1| cellulose synthase-like protein [Helianthus petiolaris]
Length=224

 Score =   229 bits (584),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 148/224 (66%), Gaps = 2/224 (1%)
 Frame = +2

Query  551   SIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRL  730
             +IHG+GW+S    P P  FLG S T  P++LTQQKRW T   +IL   K+P++  + G +
Sbjct  1     NIHGRGWRSAITSPEPLAFLGCSATTYPSSLTQQKRWFTGVFEILFTHKNPLLLTIEGNI  60

Query  731   HFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLY  910
              FRQ LAY +I  W +R   E+CY+ LPAYCII +SHF PK+NE A +I   IF+IYNLY
Sbjct  61    WFRQALAYFYICLWAVRSVPELCYASLPAYCIIKDSHFLPKVNERASLIFMGIFVIYNLY  120

Query  911   GLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDE  1090
               +E    G SLR WWN QRM RV    + LF F+S ++K+ GLS  VFEVT+K+H S++
Sbjct  121   AYWECKRIGVSLRMWWNLQRMERVNTLTARLFAFVSVMLKLIGLSNTVFEVTQKEHMSND  180

Query  1091  ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ  1222
               D +D+  VGRFT+D SP+ +PG  ILL+N+ AL  G L   +
Sbjct  181   --DDNDNVSVGRFTYDNSPMIMPGVVILLINIMALVNGMLRLSK  222



>gb|ACD64422.1| cellulose synthase-like protein [Helianthus petiolaris]
 gb|ACD64424.1| cellulose synthase-like protein [Helianthus petiolaris]
Length=224

 Score =   229 bits (584),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 148/220 (67%), Gaps = 2/220 (1%)
 Frame = +2

Query  551   SIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRL  730
             +IHG+GW+S    P+P  FLG S T  P++LTQQKRW T   +IL   K+P++  + G +
Sbjct  1     NIHGRGWRSAITSPDPLAFLGCSATTYPSSLTQQKRWFTGVFEILFTHKNPLLLTIEGNI  60

Query  731   HFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLY  910
              FRQ LAY +I  W +R   E+CY+ LPAYCII +SHF PK+NE A +I   IF+IYNLY
Sbjct  61    WFRQALAYFYICLWAVRSVPELCYASLPAYCIIKDSHFLPKVNERASLIFMGIFVIYNLY  120

Query  911   GLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDE  1090
               +E    G SLR WWN QRM RV    + LF F+S ++K+ GLS  VFEVT+K+H S++
Sbjct  121   AYWECKRIGVSLRMWWNLQRMERVNTLTARLFAFVSVMLKLIGLSNTVFEVTQKEHMSND  180

Query  1091  ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
               D +D+  VGRFT+D SP+ +PG  ILL+N+ AL  G L
Sbjct  181   --DDNDNVSVGRFTYDNSPMIMPGVVILLINIMALVNGML  218



>gb|ACD64426.1| cellulose synthase-like protein [Helianthus petiolaris]
 gb|ACD64435.1| cellulose synthase-like protein [Helianthus petiolaris]
Length=224

 Score =   229 bits (583),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 148/220 (67%), Gaps = 2/220 (1%)
 Frame = +2

Query  551   SIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRL  730
             +IHG+GW+S    P+P  FLG S T  P++LTQQKRW T   +IL   K+P++  + G +
Sbjct  1     NIHGRGWRSAITSPDPLAFLGCSATTYPSSLTQQKRWFTGVFEILFTDKNPLLLTIEGNI  60

Query  731   HFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLY  910
              FRQ LAY +I  W +R   E+CY+ LPAYCII +SHF PK+NE A +I   IF+IYNLY
Sbjct  61    WFRQALAYFYICLWAVRSVPELCYASLPAYCIIKDSHFLPKVNERASLIFMGIFVIYNLY  120

Query  911   GLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDE  1090
               +E    G SLR WWN QRM RV    + LF F+S ++K+ GLS  VFEVT+K+H S++
Sbjct  121   AYWECKRIGVSLRMWWNLQRMERVNTLTARLFAFVSVMLKLIGLSNTVFEVTQKEHMSND  180

Query  1091  ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
               D +D+  VGRFT+D SP+ +PG  ILL+N+ AL  G L
Sbjct  181   --DDNDNVSVGRFTYDNSPMIMPGVVILLINIMALVNGML  218



>gb|ACD64423.1| cellulose synthase-like protein [Helianthus petiolaris]
Length=224

 Score =   229 bits (583),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 149/224 (67%), Gaps = 2/224 (1%)
 Frame = +2

Query  551   SIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRL  730
             +IHG+GW+S    P+P  FLG S T  P++LTQQKRW T   +IL   K+P++  + G +
Sbjct  1     NIHGRGWRSAITSPDPLAFLGCSATTYPSSLTQQKRWFTGVFEILFTHKNPLLLTIEGNI  60

Query  731   HFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLY  910
              FRQ LAY +I  W +R   E+CY+ LPAYCII +SHF PK+NE A +I   IF+IYNLY
Sbjct  61    WFRQALAYFYICLWAVRSVPELCYASLPAYCIIKDSHFLPKVNERASLIFMGIFVIYNLY  120

Query  911   GLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDE  1090
               +E    G SLR WWN QRM RV    + LF F+S ++K+ GLS  VFEVT+K+H S++
Sbjct  121   AYWECKRIGVSLRMWWNLQRMERVNTLTARLFAFVSVMLKLIGLSNTVFEVTQKEHMSND  180

Query  1091  ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFLDFKQ  1222
               D +D+  VGRFT+D SP+ +PG  +LL+N+ AL  G L   +
Sbjct  181   --DDNDNVSVGRFTYDNSPMIMPGVVLLLINIMALVNGMLRLSK  222



>gb|ACD64452.1| cellulose synthase-like protein [Bahiopsis lanata]
Length=224

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 144/220 (65%), Gaps = 2/220 (1%)
 Frame = +2

Query  551   SIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRL  730
             SIHG+GW+S    P+P  FLG +PT  P++LTQQKRW T   +IL   K+P+  A  G L
Sbjct  1     SIHGRGWRSAITSPDPLAFLGCAPTTFPSSLTQQKRWVTGLFEILFTDKNPLRLATKGNL  60

Query  731   HFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLY  910
              FRQ L Y     W +R   E+CY+ LPAYCII  SHF PK+NE A +I   IF+IYN+Y
Sbjct  61    WFRQALGYFSFCLWAVRSVLELCYASLPAYCIITGSHFLPKINERAFLIFMGIFVIYNVY  120

Query  911   GLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDE  1090
               +E    G SLR WWN QRM RV    +WLFGFLS ++K  GLSE VFEVT+K+H  ++
Sbjct  121   VYWECKRVGVSLRMWWNLQRMGRVNVMTAWLFGFLSVMLKFIGLSETVFEVTQKEHLLND  180

Query  1091  ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
                 +DD   GRFT+D+SP+ VPG  +LLV++ AL  G L
Sbjct  181   G--DNDDKNAGRFTYDKSPIIVPGVVVLLVDMVALVNGVL  218



>gb|ADE21152.1| cellulose synthase-like protein [Helianthus neglectus]
Length=224

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 111/220 (50%), Positives = 148/220 (67%), Gaps = 2/220 (1%)
 Frame = +2

Query  551   SIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRL  730
             +IHG+GW+S    P+P  FLG S T  P++LTQQKRW T   +IL   K+P++  + G +
Sbjct  1     NIHGRGWRSAITSPDPLAFLGCSATTYPSSLTQQKRWFTGVFEILFTDKNPLLLTIEGNI  60

Query  731   HFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLY  910
              FRQ LAY +I  W +R   E+CY+ LPAYCII +SHF PK+NE A +I   IF+IYNLY
Sbjct  61    WFRQALAYFYICLWAVRSVPELCYASLPAYCIIKDSHFLPKVNERASLIFMGIFVIYNLY  120

Query  911   GLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDE  1090
               +E    G SLR WWN QRM RV    + LF F+S ++K+ GLS  VFEVT+K+H S++
Sbjct  121   AYWECKRIGVSLRMWWNLQRMGRVNTLTARLFAFVSVMLKLIGLSNTVFEVTQKEHMSND  180

Query  1091  ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
               D +D+  VGRFT+D SP+ +PG  ILL+N+ AL  G L
Sbjct  181   --DDNDNVSVGRFTYDNSPMIMPGVVILLINIMALVNGML  218



>ref|XP_006857764.1| hypothetical protein AMTR_s00061p00199750 [Amborella trichopoda]
 gb|ERN19231.1| hypothetical protein AMTR_s00061p00199750 [Amborella trichopoda]
Length=529

 Score =   237 bits (605),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 141/404 (35%), Positives = 216/404 (53%), Gaps = 31/404 (8%)
 Frame = +2

Query  2     VSGVMTNAPFMLNLDCDFHVNDPKVVLHAMCFLLGVKDEKDAEFVQFPQNFYGGLKDDPY  181
             VS V++NAP +LN+DCD + ND K +  A+CFL+  +   D  FVQFPQNF    K++ Y
Sbjct  90    VSSVISNAPIILNVDCDMYSNDSKSIRDALCFLMDEETGHDIAFVQFPQNFDNMTKNELY  149

Query  182   GNQMKIIMKYLFRGTAGIQGPFYMGTGCFHRRKVIYGMWPHVVDNNEKSTDKDQWETFGK  361
                ++ I    F G  G+ G  Y+G+GCFHRR ++ G        NE+  ++     + K
Sbjct  150   DGFLRAIGVVDFPGMDGLGGTLYVGSGCFHRRSILGGKML-----NEEFKEELSGGNWSK  204

Query  362   SKTFALSTTQILSGSLYPEIPIFPNSLEAAKEVASCVYEFGTAWGQKVGLLYGSAGEDTK  541
             S+  A    +IL               E  K++A+C YE GT WG++VGL YG   ED  
Sbjct  205   SEEKA----KILE--------------ERGKDLATCTYELGTEWGKEVGLKYGCPVEDVI  246

Query  542   TGVSIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALF  721
             TG+SIH +GW+SVY +P    FLG + T     L Q KRW      IL+ K  P ++  +
Sbjct  247   TGLSIHCRGWRSVYYNPTRKAFLGVASTTLGDTLVQSKRWSEGDFQILLSKYCPFVYG-W  305

Query  722   GRLHFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIY  901
             G++     ++Y   + WP+      CY+L+P+ C++N     PK+  +   IP + F+  
Sbjct  306   GKMSVAHMMSYSIYLFWPVNSLPTWCYALVPSLCLLNGVPLYPKVT-SPWCIPFA-FVAI  363

Query  902   NLYG--LFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKD  1075
             + YG  L E +    +L++WWN +RM  +    S+LF F+  ++K+ GL E+ F++T K 
Sbjct  364   SSYGSSLHEMLLAKGTLKSWWNAERMWMIRRVSSYLFAFIDSILKLVGLGESGFDITTK-  422

Query  1076  HSSDEALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGF  1207
               SDE   +  + ++  F    SP+FV   T+ L NL A  +G 
Sbjct  423   -VSDEDAMRRHEQEIMEFG-GASPMFVILATLTLFNLIAFLLGL  464



>gb|ACD64453.1| cellulose synthase-like protein [Bahiopsis reticulata]
 gb|ACD64454.1| cellulose synthase-like protein [Bahiopsis reticulata]
Length=224

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 144/220 (65%), Gaps = 2/220 (1%)
 Frame = +2

Query  551   SIHGKGWKSVYCDPNPPGFLGSSPTGGPAALTQQKRWGTAALDILICKKSPIIWALFGRL  730
             SIHG+GW+S    P+P  FLG +PT  P++LTQQKRW T   +IL   K+P++ A  G L
Sbjct  1     SIHGRGWRSAITSPDPLAFLGCAPTTFPSSLTQQKRWVTGLFEILFTDKNPLLLATKGNL  60

Query  731   HFRQCLAYLWIMGWPIRPFFEICYSLLPAYCIINNSHFQPKLNEAAIVIPASIFIIYNLY  910
              FRQ L Y     W +R   E+CY+ LPAYCII  SHF PK+NE A +I   +F+IYNLY
Sbjct  61    WFRQALGYFSFCLWAVRSVLELCYASLPAYCIITGSHFLPKINERAFLIFMGVFVIYNLY  120

Query  911   GLFEYIETGESLRAWWNNQRMLRVYASGSWLFGFLSGVVKVFGLSEAVFEVTKKDHSSDE  1090
               +E    G SLR WWN QRM RV    +WLFG  S ++K  GLS+ VFEVT+K+H  ++
Sbjct  121   VYWECKRVGVSLRMWWNLQRMGRVNVMTAWLFGCFSVMLKFIGLSDTVFEVTQKEHMLND  180

Query  1091  ALDKDDDSKVGRFTFDESPLFVPGTTILLVNLAALFIGFL  1210
                 +DD  VGRFT+D+SP+ VPG  +LLVN+ AL  G L
Sbjct  181   G--DNDDKNVGRFTYDKSPMIVPGVVVLLVNMFALVNGVL  218



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4259140482240