BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25481_g1_i3 len=1602 path=[1:0-122 124:123-193 195:194-260
262:261-283 285:284-406 3851:407-440 442:441-617 4968:618-707
709:708-716 718:717-777 779:778-798 800:799-839 5061:840-844
846:845-859 861:860-920 922:921-941 943:942-1021 1023:1022-1029
1031:1030-1093 1095:1094-1107 1109:1108-1216 3998:1217-1219
1219:1220-1243 4024:1244-1284 1284:1285-1383 5269:1384-1384
5270:1385-1601]

Length=1602
                                                                      Score     E

ref|XP_006360159.1|  PREDICTED: calumenin-A-like isoform X1             425   6e-142   
ref|XP_009791546.1|  PREDICTED: calumenin-A                             420   6e-140   
ref|XP_004240960.1|  PREDICTED: reticulocalbin-1                        416   2e-138   
ref|XP_009588656.1|  PREDICTED: calumenin-A                             369   1e-120   
emb|CDP05036.1|  unnamed protein product                                346   5e-111   
ref|XP_008381116.1|  PREDICTED: calumenin-B-like                        333   2e-106   
ref|XP_009351974.1|  PREDICTED: calumenin                               328   5e-104   
ref|XP_007221135.1|  hypothetical protein PRUPE_ppa019586mg             327   2e-103   
ref|XP_007039100.1|  Calcium-binding EF hand family protein, puta...    326   2e-103   
ref|XP_002526254.1|  Reticulocalbin-2 precursor, putative               325   9e-103   Ricinus communis
ref|XP_002869541.1|  calcium-binding EF hand family protein             323   3e-102   
ref|XP_004309124.1|  PREDICTED: calumenin-like                          319   9e-101   
ref|XP_008234704.1|  PREDICTED: calumenin                               318   5e-100   
ref|XP_008376764.1|  PREDICTED: calumenin-like                          317   2e-99    
ref|XP_009143986.1|  PREDICTED: calumenin-A                             315   3e-99    
ref|XP_002321392.1|  calcium-binding EF hand family protein             315   4e-99    Populus trichocarpa [western balsam poplar]
emb|CDY19023.1|  BnaC01g20450D                                          315   4e-99    
ref|NP_194508.1|  Calcium-binding EF hand family protein                315   5e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285134.1|  hypothetical protein CARUB_v10006475mg             313   3e-98    
emb|CDX89226.1|  BnaA01g16670D                                          313   4e-98    
ref|XP_011044675.1|  PREDICTED: reticulocalbin-2                        311   2e-97    
ref|XP_010438550.1|  PREDICTED: calumenin-B                             310   3e-97    
gb|KFK29297.1|  hypothetical protein AALP_AA7G115000                    310   3e-97    
ref|XP_006441145.1|  hypothetical protein CICLE_v10023659mg             310   8e-97    
ref|XP_006413028.1|  hypothetical protein EUTSA_v10025621mg             309   1e-96    
gb|KGN57652.1|  hypothetical protein Csa_3G238180                       307   7e-96    
ref|XP_010448080.1|  PREDICTED: calumenin-B-like                        306   9e-96    
ref|XP_008455987.1|  PREDICTED: reticulocalbin-2                        305   3e-95    
ref|XP_010520959.1|  PREDICTED: calumenin-A                             303   2e-94    
ref|XP_006492006.1|  PREDICTED: 45 kDa calcium-binding protein-like     302   7e-94    
gb|KDP37385.1|  hypothetical protein JCGZ_08570                         301   1e-93    
ref|XP_010038464.1|  PREDICTED: calumenin-A                             297   3e-92    
ref|XP_010433306.1|  PREDICTED: calumenin-B-like                        296   7e-92    
ref|XP_002272030.1|  PREDICTED: reticulocalbin-2                        286   9e-88    Vitis vinifera
gb|KHN16271.1|  45 kDa calcium-binding protein                          286   1e-87    
gb|KHM99213.1|  Reticulocalbin-3                                        285   2e-87    
ref|XP_003544051.2|  PREDICTED: LOW QUALITY PROTEIN: reticulocalb...    286   3e-87    
ref|XP_007161500.1|  hypothetical protein PHAVU_001G074400g             285   3e-87    
ref|XP_004498505.1|  PREDICTED: reticulocalbin-2-like                   281   6e-86    
ref|XP_007039101.1|  Calcium-binding EF hand family protein, puta...    280   1e-85    
gb|AES58744.2|  calcium-binding EF-hand protein                         274   3e-82    
ref|XP_010267532.1|  PREDICTED: reticulocalbin-1                        268   9e-81    
ref|XP_009383122.1|  PREDICTED: calumenin-B                             263   6e-79    
ref|XP_003588493.1|  Calumenin-B                                        270   6e-78    
ref|XP_004146270.1|  PREDICTED: calumenin-B-like                        259   3e-77    
ref|XP_010671407.1|  PREDICTED: calumenin-A                             258   5e-77    
ref|XP_008810466.1|  PREDICTED: calumenin-B                             259   2e-76    
ref|XP_010934862.1|  PREDICTED: calumenin-B                             243   4e-71    
ref|XP_010091199.1|  hypothetical protein L484_000423                   224   2e-66    
ref|XP_010109239.1|  hypothetical protein L484_011861                   211   2e-61    
ref|XP_001782563.1|  predicted protein                                  203   6e-56    
ref|XP_007223340.1|  hypothetical protein PRUPE_ppa007408mg             201   3e-55    
ref|XP_004297713.1|  PREDICTED: calumenin-B-like                        199   1e-54    
ref|XP_008221087.1|  PREDICTED: calumenin                               199   2e-54    
ref|XP_002970407.1|  hypothetical protein SELMODRAFT_93701              199   2e-54    
ref|XP_004497251.1|  PREDICTED: calumenin-like                          199   2e-54    
gb|KEH44432.1|  calcium-binding EF hand-like protein                    198   3e-54    
ref|XP_002978486.1|  hypothetical protein SELMODRAFT_443827             198   4e-54    
ref|XP_004169833.1|  PREDICTED: calumenin-B-like                        197   9e-54    
ref|XP_008465196.1|  PREDICTED: calumenin-B-like                        197   1e-53    
ref|XP_008360001.1|  PREDICTED: calumenin-A-like                        196   3e-53    
ref|XP_006853843.1|  hypothetical protein AMTR_s00036p00074650          195   5e-53    
ref|XP_009351755.1|  PREDICTED: calumenin                               194   8e-53    
ref|XP_007142746.1|  hypothetical protein PHAVU_007G013600g             194   1e-52    
gb|EEE61919.1|  hypothetical protein OsJ_16654                          193   2e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008340424.1|  PREDICTED: calumenin                               193   3e-52    
emb|CAE03423.2|  OSJNBa0032F06.6                                        192   3e-52    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054290.1|  Os04g0681500                                       192   4e-52    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009403489.1|  PREDICTED: calumenin-like                          191   1e-51    
ref|XP_010924990.1|  PREDICTED: LOW QUALITY PROTEIN: calumenin-B-...    191   1e-51    
ref|XP_002513128.1|  Reticulocalbin-2 precursor, putative               189   1e-50    Ricinus communis
ref|XP_009783341.1|  PREDICTED: calumenin                               188   2e-50    
ref|XP_002267285.1|  PREDICTED: reticulocalbin-2                        187   7e-50    Vitis vinifera
ref|XP_007043214.1|  Calcium-binding EF hand family protein isofo...    186   8e-50    
ref|XP_003571745.1|  PREDICTED: reticulocalbin-2                        186   1e-49    
gb|KDP40477.1|  hypothetical protein JCGZ_24476                         186   2e-49    
gb|KDO59625.1|  hypothetical protein CISIN_1g0485991mg                  180   3e-49    
ref|XP_010688637.1|  PREDICTED: reticulocalbin-2                        185   7e-49    
gb|KHN37354.1|  Calumenin                                               180   1e-48    
ref|XP_010546283.1|  PREDICTED: reticulocalbin-2                        183   2e-48    
ref|XP_003536755.1|  PREDICTED: calumenin-B-like isoform X1             182   3e-48    
ref|XP_001782092.1|  predicted protein                                  183   3e-48    
ref|XP_010915272.1|  PREDICTED: calumenin-like isoform X1               182   3e-48    
ref|XP_003555827.1|  PREDICTED: calumenin-B-like                        182   4e-48    
emb|CDX78345.1|  BnaA03g02570D                                          181   7e-48    
ref|XP_010279470.1|  PREDICTED: calumenin                               181   9e-48    
emb|CDX81115.1|  BnaC03g03690D                                          181   9e-48    
gb|EYU35555.1|  hypothetical protein MIMGU_mgv1a008053mg                181   1e-47    
ref|XP_006437651.1|  hypothetical protein CICLE_v10031861mg             181   1e-47    
ref|XP_006484483.1|  PREDICTED: calumenin-like isoform X1               181   1e-47    
ref|XP_009131091.1|  PREDICTED: calumenin-A-like                        181   1e-47    
ref|XP_010547693.1|  PREDICTED: reticulocalbin-2-like                   181   2e-47    
ref|XP_010452869.1|  PREDICTED: calumenin-A-like                        181   2e-47    
dbj|BAK00840.1|  predicted protein                                      180   2e-47    
ref|XP_010423050.1|  PREDICTED: calumenin-A-like                        181   2e-47    
ref|XP_010491505.1|  PREDICTED: calumenin-A-like                        181   2e-47    
ref|NP_001141343.1|  uncharacterized protein LOC100273434               179   3e-47    Zea mays [maize]
ref|XP_008681444.1|  PREDICTED: uncharacterized protein LOC100273...    180   3e-47    
ref|XP_008681446.1|  PREDICTED: uncharacterized protein LOC100273...    180   4e-47    
ref|XP_002451795.1|  hypothetical protein SORBIDRAFT_04g007870          179   5e-47    Sorghum bicolor [broomcorn]
ref|XP_002310630.2|  calcium-binding EF hand family protein             179   5e-47    Populus trichocarpa [western balsam poplar]
ref|XP_006286619.1|  hypothetical protein CARUB_v10002410mg             179   6e-47    
ref|XP_002447340.1|  hypothetical protein SORBIDRAFT_06g033220          178   7e-47    Sorghum bicolor [broomcorn]
ref|XP_006399364.1|  hypothetical protein EUTSA_v10013753mg             177   3e-46    
ref|NP_001046324.2|  Os02g0221800                                       176   4e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008782525.1|  PREDICTED: calumenin                               176   4e-46    
ref|XP_004951461.1|  PREDICTED: reticulocalbin-1-like isoform X1        176   6e-46    
ref|XP_010031375.1|  PREDICTED: reticulocalbin-2                        175   1e-45    
ref|XP_011021981.1|  PREDICTED: reticulocalbin-2-like                   175   2e-45    
ref|XP_011013553.1|  PREDICTED: reticulocalbin-2-like                   174   2e-45    
ref|XP_011070474.1|  PREDICTED: calumenin                               175   2e-45    
ref|XP_011009182.1|  PREDICTED: reticulocalbin-2-like                   174   2e-45    
gb|EEC72762.1|  hypothetical protein OsI_06410                          174   3e-45    Oryza sativa Indica Group [Indian rice]
ref|XP_002873373.1|  calcium-binding EF hand family protein             174   3e-45    
gb|KHG01010.1|  Calumenin-A                                             172   6e-45    
emb|CDX69937.1|  BnaA10g22860D                                          173   6e-45    
ref|XP_004963374.1|  PREDICTED: calumenin-A-like                        172   1e-44    
ref|XP_010249102.1|  PREDICTED: reticulocalbin-2-like isoform X3        172   2e-44    
ref|XP_002307146.1|  hypothetical protein POPTR_0005s08980g             171   3e-44    Populus trichocarpa [western balsam poplar]
ref|NP_568202.1|  EF-hand, calcium binding motif-containing protein     171   4e-44    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004253257.1|  PREDICTED: calumenin-B                             171   5e-44    
gb|EEE56578.1|  hypothetical protein OsJ_05929                          174   7e-44    Oryza sativa Japonica Group [Japonica rice]
gb|KHG18826.1|  Calumenin-A                                             169   1e-43    
ref|XP_009385791.1|  PREDICTED: reticulocalbin-2-like                   168   2e-43    
ref|XP_009122475.1|  PREDICTED: calumenin-A                             169   3e-43    
ref|XP_008661643.1|  PREDICTED: uncharacterized protein LOC100274...    168   4e-43    
ref|XP_009415362.1|  PREDICTED: calumenin-like                          166   2e-42    
ref|XP_006345305.1|  PREDICTED: calumenin-B-like isoform X1             166   2e-42    
emb|CDY21552.1|  BnaC09g47400D                                          166   2e-42    
ref|XP_010103594.1|  hypothetical protein L484_023091                   165   1e-41    
gb|KEH44431.1|  calcium-binding EF hand-like protein                    163   1e-41    
ref|XP_004147104.1|  PREDICTED: calumenin-B-like                        163   2e-41    
ref|XP_008445899.1|  PREDICTED: calumenin-B                             162   3e-41    
gb|EPS67553.1|  hypothetical protein M569_07223                         162   5e-41    
ref|NP_001142054.1|  uncharacterized protein LOC100274210 precursor     161   1e-40    Zea mays [maize]
ref|XP_006589743.1|  PREDICTED: calumenin-B-like isoform X2             158   8e-40    
ref|XP_006589744.1|  PREDICTED: calumenin-B-like isoform X3             157   1e-39    
ref|XP_010915273.1|  PREDICTED: calumenin-like isoform X2               157   2e-39    
ref|XP_010915275.1|  PREDICTED: calumenin-like isoform X4               156   3e-39    
ref|XP_010915274.1|  PREDICTED: calumenin-like isoform X3               156   3e-39    
ref|XP_009407305.1|  PREDICTED: reticulocalbin-2-like                   155   8e-39    
gb|EAZ12410.1|  hypothetical protein OsJ_02298                          155   3e-38    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006648466.1|  PREDICTED: calumenin-like                          150   5e-38    
gb|EAY74626.1|  hypothetical protein OsI_02514                          152   2e-37    Oryza sativa Indica Group [Indian rice]
emb|CBI23033.3|  unnamed protein product                                145   9e-37    
ref|XP_008661644.1|  PREDICTED: uncharacterized protein LOC100274...    148   2e-36    
dbj|BAK03620.1|  predicted protein                                      149   3e-36    
emb|CDM83219.1|  unnamed protein product                                149   3e-36    
ref|XP_003569237.2|  PREDICTED: developmentally-regulated G-prote...    150   1e-35    
ref|XP_004510451.1|  PREDICTED: calumenin-B-like isoform X1             145   2e-35    
gb|KDO69932.1|  hypothetical protein CISIN_1g017306mg                   145   2e-35    
ref|XP_004969021.1|  PREDICTED: calumenin-like isoform X1               146   2e-35    
ref|XP_004173689.1|  PREDICTED: uncharacterized protein LOC101225663    140   3e-35    
ref|XP_004150198.1|  PREDICTED: calumenin-like                          144   3e-35    
gb|EMT28085.1|  Developmentally-regulated GTP-binding protein 2         147   1e-34    
gb|EMS62241.1|  Developmentally-regulated GTP-binding protein 2         147   2e-34    
ref|XP_002458033.1|  hypothetical protein SORBIDRAFT_03g025800          141   1e-33    Sorghum bicolor [broomcorn]
gb|KDO59624.1|  hypothetical protein CISIN_1g0485992mg                  133   2e-33    
ref|XP_004510449.1|  PREDICTED: calumenin-B-like isoform X1             139   2e-33    
ref|XP_008654569.1|  PREDICTED: uncharacterized protein LOC100273...    140   4e-33    
gb|ACR34935.1|  unknown                                                 140   4e-33    Zea mays [maize]
ref|XP_006646020.1|  PREDICTED: calumenin-like                          139   8e-33    
ref|XP_003627249.1|  Calumenin                                          136   1e-32    
gb|EEC78266.1|  hypothetical protein OsI_17954                          136   3e-32    Oryza sativa Indica Group [Indian rice]
emb|CAJ86276.1|  H0901F07.13                                            130   3e-30    Oryza sativa [red rice]
ref|NP_001043383.1|  Os01g0572700                                       127   6e-30    Oryza sativa Japonica Group [Japonica rice]
dbj|BAD17628.1|  calcium-binding EF hand family protein-like            130   7e-30    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007043215.1|  Calcium-binding EF hand family protein isofo...    127   1e-29    
ref|XP_010249086.1|  PREDICTED: reticulocalbin-2-like isoform X1        122   1e-27    
emb|CAN69014.1|  hypothetical protein VITISV_032830                     117   4e-27    Vitis vinifera
dbj|BAD45102.1|  calcium binding protein-like                           116   2e-26    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009613610.1|  PREDICTED: calumenin-like                          118   2e-26    
ref|XP_008661645.1|  PREDICTED: uncharacterized protein LOC100274...    117   1e-25    
ref|XP_008809951.1|  PREDICTED: calumenin-B-like                        114   5e-25    
gb|KDO69934.1|  hypothetical protein CISIN_1g017306mg                   112   1e-24    
ref|XP_006827761.1|  hypothetical protein AMTR_s00009p00264050          110   4e-24    
gb|AFW59927.1|  hypothetical protein ZEAMMB73_452013                    111   5e-24    
gb|AFW59933.1|  hypothetical protein ZEAMMB73_452013                    110   3e-23    
ref|NP_001141242.1|  uncharacterized protein LOC100273329               103   2e-21    Zea mays [maize]
gb|AFW83088.1|  hypothetical protein ZEAMMB73_495027                    104   3e-21    
ref|XP_004510452.1|  PREDICTED: calumenin-B-like isoform X2             102   6e-21    
gb|ACU23329.1|  unknown                                               96.7    1e-19    Glycine max [soybeans]
ref|XP_007508412.1|  predicted protein                                98.6    5e-19    
ref|XP_004510503.1|  PREDICTED: uncharacterized protein LOC101494856  97.8    5e-19    
gb|AFW59932.1|  hypothetical protein ZEAMMB73_452013                  97.1    7e-19    
ref|XP_004510450.1|  PREDICTED: calumenin-B-like isoform X2           95.1    1e-18    
ref|XP_004168209.1|  PREDICTED: uncharacterized LOC101225663          93.2    2e-18    
ref|XP_010249093.1|  PREDICTED: reticulocalbin-2-like isoform X2      88.2    8e-16    
ref|XP_002129310.1|  PREDICTED: reticulocalbin-2-like                 82.4    6e-14    Ciona intestinalis [sea vase]
ref|XP_002157829.2|  PREDICTED: 45 kDa calcium-binding protein-like   78.2    1e-12    
ref|NP_001187699.1|  calumenin precursor                              77.4    3e-12    
ref|XP_003385607.1|  PREDICTED: calumenin-B-like                      76.3    9e-12    
ref|XP_009602532.1|  PREDICTED: calumenin-B-like                      73.2    2e-11    
gb|KHJ96096.1|  EF hand                                               74.3    2e-11    
ref|XP_010754283.1|  PREDICTED: reticulocalbin-3 isoform X2           74.3    3e-11    
gb|AFW59934.1|  hypothetical protein ZEAMMB73_452013                  73.2    3e-11    
gb|ACO12502.1|  Calumenin precursor                                   73.9    5e-11    Lepeophtheirus salmonis
gb|EHJ77301.1|  hypothetical protein KGM_10065                        73.9    5e-11    
ref|XP_008288435.1|  PREDICTED: reticulocalbin-3 isoform X3           74.3    5e-11    
ref|XP_010754282.1|  PREDICTED: reticulocalbin-3 isoform X1           73.6    6e-11    
ref|XP_001641982.1|  predicted protein                                72.4    7e-11    Nematostella vectensis
emb|CAP24846.2|  Protein CBG04054                                     72.4    8e-11    Caenorhabditis briggsae
emb|CCD81718.1|  putative ef hand containing protein                  72.0    1e-10    
ref|NP_491936.3|  Protein CALU-2                                      71.6    2e-10    Caenorhabditis elegans [roundworm]
gb|AAW27305.1|  SJCHGC06047 protein                                   71.2    2e-10    Schistosoma japonicum
ref|XP_005164069.1|  PREDICTED: reticulocalbin-3 isoform X1           71.2    3e-10    
emb|CDJ97399.1|  reticulocalbin                                       70.9    4e-10    
ref|XP_001753027.1|  predicted protein                                72.4    4e-10    
ref|XP_008288434.1|  PREDICTED: reticulocalbin-3 isoform X2           70.9    5e-10    
ref|XP_007251119.1|  PREDICTED: calumenin-like isoform X2             70.5    5e-10    
ref|XP_008288433.1|  PREDICTED: reticulocalbin-3 isoform X1           70.9    6e-10    
ref|XP_005230921.1|  PREDICTED: reticulocalbin-3-like                 71.2    8e-10    
gb|KIH67675.1|  EF hand                                               68.9    2e-09    
gb|EYB90169.1|  hypothetical protein Y032_0223g2687                   69.7    2e-09    
gb|EYB90170.1|  hypothetical protein Y032_0223g2687                   68.6    2e-09    
ref|XP_004562935.1|  PREDICTED: reticulocalbin-1-like isoform X1      68.9    2e-09    
gb|ELT88564.1|  hypothetical protein CAPTEDRAFT_89350                 68.9    2e-09    
emb|CDJ86334.1|  calumenin                                            68.9    2e-09    
gb|EYB90171.1|  hypothetical protein Y032_0223g2687                   68.6    2e-09    
gb|EYU26422.1|  hypothetical protein MIMGU_mgv1a016838mg              65.9    2e-09    
ref|XP_010765101.1|  PREDICTED: reticulocalbin-3 isoform X2           68.6    2e-09    
ref|XP_001623269.1|  predicted protein                                67.8    3e-09    Nematostella vectensis
ref|XP_006805088.1|  PREDICTED: reticulocalbin-1-like isoform X2      68.6    3e-09    
gb|KFM74065.1|  Calumenin-A                                           68.2    3e-09    
ref|XP_005926821.1|  PREDICTED: reticulocalbin-1-like isoform X2      68.2    4e-09    
ref|XP_008413286.1|  PREDICTED: calumenin-like isoform X2             67.8    4e-09    
ref|XP_002644617.1|  C. briggsae CBR-CALU-1 protein                   67.8    5e-09    Caenorhabditis briggsae
ref|XP_007251118.1|  PREDICTED: calumenin-like isoform X1             67.8    5e-09    
gb|EMS64995.1|  hypothetical protein TRIUR3_25358                     68.2    5e-09    
ref|XP_002610904.1|  hypothetical protein BRAFLDRAFT_126288           67.8    5e-09    Branchiostoma floridae
ref|NP_001002158.1|  reticulocalbin-3 precursor                       67.8    6e-09    Danio rerio [leopard danio]
ref|XP_009022215.1|  hypothetical protein HELRODRAFT_185810           67.4    7e-09    
gb|KGB36528.1|  Ubiquinone biosynthesis protein COQ7-like protein     68.2    8e-09    
ref|XP_003704568.1|  PREDICTED: calumenin-B-like                      67.4    8e-09    
emb|CDJ90877.1|  45 kDa calcium-binding protein                       67.4    8e-09    
ref|XP_003111447.1|  hypothetical protein CRE_03758                   66.6    8e-09    
ref|XP_007575667.1|  PREDICTED: reticulocalbin-3 isoform X1           67.0    8e-09    
gb|KFB38128.1|  AGAP010392-PA-like protein                            67.0    9e-09    
ref|XP_001607801.2|  PREDICTED: calumenin                             67.4    1e-08    Nasonia vitripennis
gb|ETN61842.1|  reticulocalbin                                        67.0    1e-08    
ref|XP_005464990.1|  PREDICTED: reticulocalbin-1-like isoform X2      66.6    1e-08    
ref|XP_003118182.1|  CRE-CALU-1 protein                               66.6    1e-08    
ref|XP_002109885.1|  hypothetical protein TRIADDRAFT_20674            66.2    2e-08    Trichoplax adhaerens
ref|XP_002407941.1|  calumenin, putative                              66.2    2e-08    Ixodes scapularis [blacklegged tick]
ref|XP_011058992.1|  PREDICTED: calumenin-B                           65.9    2e-08    
gb|EKC18995.1|  45 kDa calcium-binding protein                        65.9    2e-08    
ref|XP_004072082.1|  PREDICTED: reticulocalbin-3-like                 63.9    3e-08    
gb|ABN14961.1|  calumenin                                             63.9    3e-08    Taenia asiatica [Asian tapeworm]
gb|KHN83833.1|  Calumenin-A                                           65.1    4e-08    
ref|XP_004562936.1|  PREDICTED: reticulocalbin-1-like isoform X2      65.1    4e-08    
gb|EGT30349.1|  CBN-CALU-1 protein                                    65.1    4e-08    
ref|XP_005738156.1|  PREDICTED: reticulocalbin-1-like                 65.1    4e-08    
ref|XP_005811794.1|  PREDICTED: calumenin-like                        65.1    4e-08    
ref|NP_001024806.1|  Protein CALU-1, isoform a                        65.1    4e-08    Caenorhabditis elegans [roundworm]
ref|XP_002118306.1|  hypothetical protein TRIADDRAFT_33976            64.7    5e-08    Trichoplax adhaerens
ref|XP_007084686.1|  PREDICTED: reticulocalbin-2                      64.3    5e-08    
gb|EUB59098.1|  Calumenin-A                                           63.5    5e-08    
ref|XP_003986981.2|  PREDICTED: reticulocalbin-2                      65.5    5e-08    
ref|XP_005176773.1|  PREDICTED: calumenin-B-like                      64.7    6e-08    
ref|XP_007545744.1|  PREDICTED: calumenin-B isoform X2                64.3    6e-08    
ref|XP_007545743.1|  PREDICTED: calumenin-B isoform X1                64.7    6e-08    
ref|XP_006805087.1|  PREDICTED: reticulocalbin-1-like isoform X1      64.3    6e-08    
ref|XP_008410678.1|  PREDICTED: calumenin-B                           64.3    6e-08    
ref|XP_002162407.1|  PREDICTED: calumenin-A-like                      63.9    8e-08    
gb|ACO10964.1|  Calumenin precursor                                   64.3    8e-08    Caligus rogercresseyi
ref|XP_006261418.1|  PREDICTED: reticulocalbin-2                      63.9    8e-08    
gb|EFN86308.1|  Calumenin                                             64.3    8e-08    
ref|XP_005926820.1|  PREDICTED: reticulocalbin-1-like isoform X1      63.9    8e-08    
gb|KFP88026.1|  45 kDa calcium-binding protein                        64.3    9e-08    
ref|NP_001006302.1|  45 kDa calcium-binding protein                   63.9    1e-07    Gallus gallus [bantam]
sp|Q5ZKE5.2|CAB45_CHICK  RecName: Full=45 kDa calcium-binding pro...  63.9    1e-07    Gallus gallus [bantam]
ref|XP_009866980.1|  PREDICTED: 45 kDa calcium-binding protein        63.9    1e-07    
ref|XP_005995702.1|  PREDICTED: reticulocalbin-2 isoform X3           63.5    1e-07    
ref|XP_010721083.1|  PREDICTED: 45 kDa calcium-binding protein        63.5    1e-07    
ref|XP_007426302.1|  PREDICTED: 45 kDa calcium-binding protein is...  63.5    1e-07    
ref|XP_008328736.1|  PREDICTED: reticulocalbin-3                      61.6    1e-07    
gb|EFZ19208.1|  hypothetical protein SINV_02991                       63.5    1e-07    
ref|XP_010765098.1|  PREDICTED: reticulocalbin-3 isoform X1           63.2    2e-07    
ref|XP_008538868.1|  PREDICTED: reticulocalbin-2                      63.9    2e-07    
emb|CDS27565.1|  calumenin                                            63.5    2e-07    
ref|XP_004660480.1|  PREDICTED: reticulocalbin-2                      63.2    2e-07    
ref|XP_005995700.1|  PREDICTED: reticulocalbin-2 isoform X1           63.2    2e-07    
ref|XP_010976145.1|  PREDICTED: reticulocalbin-2                      63.5    2e-07    
ref|XP_004023606.1|  PREDICTED: LOW QUALITY PROTEIN: reticulocalb...  63.9    2e-07    
ref|XP_003977855.1|  PREDICTED: 45 kDa calcium-binding protein-like   63.5    2e-07    
ref|NP_001087007.1|  reticulocalbin 2 precursor                       63.2    2e-07    
ref|XP_010741260.1|  PREDICTED: 45 kDa calcium-binding protein        63.2    2e-07    
ref|XP_311555.3|  AGAP010392-PA                                       63.2    2e-07    
gb|EZA62433.1|  Calumenin-B                                           63.2    2e-07    
ref|NP_001130779.1|  uncharacterized protein LOC100191883             63.2    2e-07    
ref|XP_002928759.1|  PREDICTED: reticulocalbin-2-like                 62.8    2e-07    
ref|XP_004594670.1|  PREDICTED: reticulocalbin-2                      62.8    2e-07    
gb|EDL95577.1|  reticulocalbin 2                                      63.5    2e-07    
ref|XP_003459438.1|  PREDICTED: reticulocalbin-1-like isoform X1      62.8    2e-07    
emb|CDI98589.1|  calumenin                                            62.4    2e-07    
emb|CAF94652.1|  unnamed protein product                              62.8    2e-07    
ref|XP_006029441.1|  PREDICTED: reticulocalbin-2                      62.4    2e-07    
ref|XP_002167284.1|  PREDICTED: calumenin-B-like                      62.8    2e-07    
sp|B5X186.1|CALUA_SALSA  RecName: Full=Calumenin-A; Flags: Precursor  62.8    2e-07    
ref|XP_005603367.1|  PREDICTED: reticulocalbin-2                      62.0    2e-07    
ref|XP_006142654.1|  PREDICTED: reticulocalbin-2                      62.0    3e-07    
gb|AAA80197.1|  taipoxin-associated calcium binding protein-49 pr...  62.8    3e-07    
ref|XP_010953514.1|  PREDICTED: reticulocalbin-2                      62.4    3e-07    
ref|NP_058828.2|  reticulocalbin-2 precursor                          62.4    3e-07    
ref|XP_008706856.1|  PREDICTED: reticulocalbin-2                      62.4    3e-07    
ref|XP_003728895.1|  PREDICTED: calumenin-like isoform 2              62.4    3e-07    
gb|KFM58050.1|  Reticulocalbin-2                                      62.4    3e-07    
gb|ERG83583.1|  calumenin-a                                           62.4    3e-07    
ref|XP_009575313.1|  PREDICTED: 45 kDa calcium-binding protein        62.8    3e-07    
ref|XP_005514348.1|  PREDICTED: 45 kDa calcium-binding protein        62.8    3e-07    
gb|KFV91958.1|  45 kDa calcium-binding protein                        62.4    3e-07    
gb|EMC79341.1|  45 kDa calcium-binding protein                        62.4    4e-07    
emb|CDQ78671.1|  unnamed protein product                              62.0    4e-07    
emb|CDJ86206.1|  GF14160                                              62.0    4e-07    
ref|XP_005316892.1|  PREDICTED: reticulocalbin-2 isoform X2           62.0    4e-07    
emb|CAJ82889.1|  reticulocalbin 2, EF-hand calcium binding domain     61.6    4e-07    
ref|XP_006173576.1|  PREDICTED: reticulocalbin-2                      62.4    4e-07    
sp|B5X4E0.1|CALUB_SALSA  RecName: Full=Calumenin-B; Flags: Precursor  62.0    4e-07    
gb|KFB43554.1|  AGAP002810-PA-like protein                            62.0    4e-07    
emb|CDJ94404.1|  CBN-CALU-1 protein                                   60.1    4e-07    
ref|XP_008413285.1|  PREDICTED: reticulocalbin-1-like isoform X1      62.0    5e-07    
gb|EGT35425.1|  hypothetical protein CAEBREN_28648                    60.5    5e-07    
gb|KFO73108.1|  45 kDa calcium-binding protein                        62.0    5e-07    
ref|XP_001956702.1|  GF24450                                          62.0    5e-07    
emb|CDS20243.1|  calumenin                                            61.2    5e-07    
ref|NP_001116488.1|  reticulocalbin 2 precursor                       61.6    5e-07    
ref|XP_007119286.1|  PREDICTED: reticulocalbin-2                      61.2    5e-07    
gb|KFW82370.1|  45 kDa calcium-binding protein                        61.6    5e-07    
ref|XP_005985064.1|  PREDICTED: reticulocalbin-2                      61.6    5e-07    
dbj|BAE41353.1|  unnamed protein product                              62.0    5e-07    
gb|KFU95377.1|  45 kDa calcium-binding protein                        61.6    6e-07    
ref|XP_006127202.1|  PREDICTED: 45 kDa calcium-binding protein        62.0    6e-07    
gb|KFV18809.1|  45 kDa calcium-binding protein                        61.6    6e-07    
gb|KFQ35733.1|  45 kDa calcium-binding protein                        61.6    6e-07    
ref|XP_003966417.1|  PREDICTED: calumenin-B-like                      61.6    6e-07    
ref|XP_009669800.1|  PREDICTED: 45 kDa calcium-binding protein is...  62.0    6e-07    
ref|XP_544790.2|  PREDICTED: reticulocalbin-2 isoform X2              61.6    6e-07    
ref|XP_008923851.1|  PREDICTED: 45 kDa calcium-binding protein        61.6    6e-07    
gb|KFP49760.1|  45 kDa calcium-binding protein                        61.6    6e-07    
ref|XP_005292954.1|  PREDICTED: 45 kDa calcium-binding protein        61.6    6e-07    
ref|XP_009555017.1|  PREDICTED: 45 kDa calcium-binding protein        61.6    6e-07    
gb|EMP27757.1|  Reticulocalbin-2                                      61.2    6e-07    
ref|XP_010134568.1|  PREDICTED: 45 kDa calcium-binding protein        61.6    6e-07    
ref|XP_005143697.1|  PREDICTED: 45 kDa calcium-binding protein        61.6    6e-07    
gb|KFO89802.1|  45 kDa calcium-binding protein                        61.6    6e-07    
ref|XP_010003465.1|  PREDICTED: 45 kDa calcium-binding protein        61.6    6e-07    
ref|XP_004276394.1|  PREDICTED: reticulocalbin-2                      61.6    6e-07    
gb|ERE75090.1|  reticulocalbin-2-like protein                         60.8    6e-07    
ref|XP_007068427.1|  PREDICTED: reticulocalbin-2                      61.2    7e-07    
ref|XP_003376324.1|  calumenin                                        61.2    7e-07    
gb|KFV79519.1|  45 kDa calcium-binding protein                        61.6    7e-07    
ref|XP_010182843.1|  PREDICTED: 45 kDa calcium-binding protein        61.6    7e-07    
ref|XP_009985825.1|  PREDICTED: 45 kDa calcium-binding protein        61.6    7e-07    
ref|XP_004327714.1|  PREDICTED: reticulocalbin-2-like                 61.2    7e-07    
ref|XP_005238028.1|  PREDICTED: 45 kDa calcium-binding protein-like   61.6    7e-07    
ref|XP_008889538.1|  calcium binding protein precursor, putative      61.2    7e-07    
ref|XP_004414128.1|  PREDICTED: reticulocalbin-2                      61.2    7e-07    
gb|KFP83978.1|  45 kDa calcium-binding protein                        61.2    8e-07    
ref|XP_006080771.1|  PREDICTED: reticulocalbin-2 isoform X3           60.8    8e-07    
gb|KFQ36625.1|  45 kDa calcium-binding protein                        61.2    8e-07    
gb|KFP26177.1|  45 kDa calcium-binding protein                        61.2    8e-07    
gb|KFP65307.1|  45 kDa calcium-binding protein                        61.2    8e-07    
ref|XP_007575669.1|  PREDICTED: reticulocalbin-3 isoform X2           60.8    8e-07    
ref|XP_002093101.1|  GE21140                                          61.2    9e-07    
emb|CDW56113.1|  EF hand family protein                               60.8    9e-07    
gb|KFV07717.1|  45 kDa calcium-binding protein                        61.2    9e-07    
gb|KFM04114.1|  45 kDa calcium-binding protein                        61.2    9e-07    
ref|XP_010072738.1|  PREDICTED: 45 kDa calcium-binding protein        61.2    9e-07    
ref|XP_009699021.1|  PREDICTED: 45 kDa calcium-binding protein        61.2    9e-07    
ref|XP_005069624.1|  PREDICTED: reticulocalbin-2 isoform X2           60.8    9e-07    
ref|XP_002190266.1|  PREDICTED: 45 kDa calcium-binding protein        61.2    9e-07    
ref|XP_010885247.1|  PREDICTED: calumenin-A                           60.8    9e-07    
ref|XP_003740997.1|  PREDICTED: calumenin-A-like                      60.8    9e-07    
ref|XP_008988404.1|  PREDICTED: reticulocalbin-2 isoform X2           60.8    9e-07    
ref|NP_569096.2|  45 kDa calcium-binding protein                      61.2    9e-07    
ref|XP_006794092.1|  PREDICTED: 45 kDa calcium-binding protein-li...  61.2    9e-07    
ref|XP_008945808.1|  PREDICTED: 45 kDa calcium-binding protein        61.2    9e-07    
ref|XP_008821656.1|  PREDICTED: reticulocalbin-2 isoform X1           61.2    1e-06    
ref|XP_005656340.1|  PREDICTED: reticulocalbin 2, EF-hand calcium...  60.8    1e-06    
ref|XP_009076631.1|  PREDICTED: 45 kDa calcium-binding protein        61.2    1e-06    
gb|KFV72322.1|  45 kDa calcium-binding protein                        60.8    1e-06    
ref|NP_998252.1|  45 kDa calcium-binding protein precursor            61.2    1e-06    
ref|NP_036122.2|  reticulocalbin-2 isoform 1 precursor                60.8    1e-06    
ref|XP_005069623.1|  PREDICTED: reticulocalbin-2 isoform X1           61.2    1e-06    
ref|XP_009959116.1|  PREDICTED: 45 kDa calcium-binding protein        61.2    1e-06    
ref|XP_009272462.1|  PREDICTED: 45 kDa calcium-binding protein        61.2    1e-06    
ref|XP_010202282.1|  PREDICTED: 45 kDa calcium-binding protein        61.2    1e-06    
ref|XP_005316891.1|  PREDICTED: reticulocalbin-2 isoform X1           60.8    1e-06    
gb|KFR16410.1|  45 kDa calcium-binding protein                        60.8    1e-06    
gb|KFV40760.1|  45 kDa calcium-binding protein                        60.8    1e-06    
gb|EDL15064.1|  stromal cell derived factor 4, isoform CRA_a          61.2    1e-06    
ref|XP_006164151.1|  PREDICTED: 45 kDa calcium-binding protein is...  60.8    1e-06    
ref|XP_005638716.1|  PREDICTED: reticulocalbin-2 isoform X1           60.8    1e-06    
ref|XP_006239578.1|  PREDICTED: 45 kDa calcium-binding protein is...  61.2    1e-06    
ref|XP_009970309.1|  PREDICTED: 45 kDa calcium-binding protein        60.8    1e-06    
ref|XP_009940164.1|  PREDICTED: 45 kDa calcium-binding protein        60.8    1e-06    
gb|EMP25993.1|  45 kDa calcium-binding protein                        60.1    1e-06    
ref|XP_005347451.1|  PREDICTED: reticulocalbin-2 isoform X1           60.5    1e-06    
ref|XP_004560407.1|  PREDICTED: 45 kDa calcium-binding protein-like   60.8    1e-06    
gb|EDL15065.1|  stromal cell derived factor 4, isoform CRA_b          60.8    1e-06    
ref|XP_005347452.1|  PREDICTED: reticulocalbin-2 isoform X2           60.5    1e-06    
gb|ELW70665.1|  Reticulocalbin-2                                      61.2    1e-06    
sp|Q91ZS3.1|CAB45_RAT  RecName: Full=45 kDa calcium-binding prote...  60.8    1e-06    
gb|KFD55520.1|  hypothetical protein M513_03572                       60.1    1e-06    
gb|AGX25154.1|  calumenin precursor                                   58.9    1e-06    
ref|XP_009905088.1|  PREDICTED: 45 kDa calcium-binding protein        60.5    1e-06    
ref|XP_006629098.1|  PREDICTED: reticulocalbin-2-like                 60.1    1e-06    
gb|KGL78306.1|  45 kDa calcium-binding protein                        60.5    1e-06    
gb|ELV12783.1|  45 kDa calcium-binding protein                        60.5    1e-06    
ref|XP_003463622.1|  PREDICTED: reticulocalbin-2                      60.5    1e-06    
ref|XP_002083195.1|  GD13605                                          60.5    1e-06    
ref|XP_005816427.1|  PREDICTED: calumenin-B-like                      60.1    2e-06    
gb|KFQ58242.1|  45 kDa calcium-binding protein                        60.5    2e-06    
ref|XP_006871823.1|  PREDICTED: 45 kDa calcium-binding protein        60.5    2e-06    
ref|XP_010592076.1|  PREDICTED: reticulocalbin-2                      60.1    2e-06    
ref|XP_009896961.1|  PREDICTED: reticulocalbin-2                      60.5    2e-06    
ref|XP_007905117.1|  PREDICTED: 45 kDa calcium-binding protein        60.5    2e-06    
gb|ACO14884.1|  Calumenin precursor                                   60.1    2e-06    
ref|XP_008576381.1|  PREDICTED: 45 kDa calcium-binding protein        60.8    2e-06    
gb|EHJ69265.1|  DNA supercoiling factor                               60.1    2e-06    
ref|XP_010214523.1|  PREDICTED: 45 kDa calcium-binding protein        60.5    2e-06    
ref|XP_007070263.1|  PREDICTED: LOW QUALITY PROTEIN: 45 kDa calci...  60.1    2e-06    
ref|XP_009491347.1|  PREDICTED: 45 kDa calcium-binding protein        60.5    2e-06    
gb|KFM77593.1|  Calumenin-A                                           60.1    2e-06    
gb|ETN61851.1|  supercoiling factor                                   60.1    2e-06    
ref|XP_010348670.1|  PREDICTED: 45 kDa calcium-binding protein is...  60.5    2e-06    
ref|XP_004628764.1|  PREDICTED: reticulocalbin-2                      60.1    2e-06    
ref|NP_001087611.1|  45 kDa calcium-binding protein precursor         60.1    2e-06    
gb|KFQ37557.1|  Reticulocalbin-2                                      59.3    2e-06    
ref|XP_004599606.1|  PREDICTED: 45 kDa calcium-binding protein        60.1    2e-06    
ref|NP_035471.1|  45 kDa calcium-binding protein isoform 1 precursor  60.1    2e-06    
ref|XP_010184689.1|  PREDICTED: reticulocalbin-2                      59.3    2e-06    
ref|XP_006018871.1|  PREDICTED: 45 kDa calcium-binding protein        60.1    2e-06    
gb|KHJ48354.1|  EF hand                                               60.1    2e-06    
ref|NP_001025582.1|  45 kDa calcium-binding protein precursor         60.1    2e-06    
ref|XP_003464533.2|  PREDICTED: reticulocalbin-1                      60.1    2e-06    
ref|XP_009031860.1|  hypothetical protein HELRODRAFT_186226           59.7    2e-06    
sp|J3S9D9.1|RCN2V_CROAD  RecName: Full=Reticulocalbin-2; AltName:...  59.7    2e-06    
ref|XP_002026136.1|  GL16174                                          59.7    2e-06    
ref|XP_783813.2|  PREDICTED: 45 kDa calcium-binding protein-like      60.1    2e-06    
ref|XP_008013952.1|  PREDICTED: reticulocalbin-2                      60.1    2e-06    
ref|XP_001843856.1|  calumenin                                        59.7    2e-06    
gb|KFW06585.1|  45 kDa calcium-binding protein                        59.7    2e-06    
ref|XP_002763507.2|  PREDICTED: reticulocalbin-2 isoform X1           59.7    3e-06    
gb|KFO64808.1|  45 kDa calcium-binding protein                        59.7    3e-06    
gb|KDR14829.1|  Reticulocalbin-2                                      59.7    3e-06    
ref|XP_008048249.1|  PREDICTED: 45 kDa calcium-binding protein is...  59.7    3e-06    
ref|XP_006277854.1|  PREDICTED: 45 kDa calcium-binding protein        59.7    3e-06    
ref|XP_010888758.1|  PREDICTED: calumenin-B                           59.3    3e-06    
ref|XP_005368760.1|  PREDICTED: LOW QUALITY PROTEIN: 45 kDa calci...  59.7    3e-06    
ref|XP_004070950.1|  PREDICTED: 45 kDa calcium-binding protein-like   59.7    3e-06    
ref|XP_005986055.1|  PREDICTED: 45 kDa calcium-binding protein        59.7    3e-06    
ref|XP_008283457.1|  PREDICTED: 45 kDa calcium-binding protein        59.7    3e-06    
ref|XP_004384405.1|  PREDICTED: 45 kDa calcium-binding protein        59.7    3e-06    
ref|XP_006971618.1|  PREDICTED: reticulocalbin-2                      59.3    3e-06    
ref|XP_001352458.1|  GA21575                                          59.7    3e-06    
ref|XP_004421908.1|  PREDICTED: reticulocalbin-2                      59.3    3e-06    
ref|XP_006080770.1|  PREDICTED: reticulocalbin-2 isoform X2           59.3    3e-06    
ref|XP_003439085.1|  PREDICTED: 45 kDa calcium-binding protein-li...  59.7    3e-06    
ref|XP_005393534.1|  PREDICTED: reticulocalbin-2                      60.1    3e-06    
ref|NP_001027627.1|  calumenin homologue precursor                    59.3    3e-06    
ref|XP_006886010.1|  PREDICTED: 45 kDa calcium-binding protein        60.1    3e-06    
ref|XP_008639381.1|  PREDICTED: 45 kDa calcium-binding protein        59.7    3e-06    
ref|XP_001652843.1|  reticulocalbin                                   59.3    3e-06    
ref|XP_003754943.1|  PREDICTED: reticulocalbin-2                      60.1    3e-06    
ref|NP_001037337.1|  DNA supercoiling factor precursor                59.3    3e-06    
ref|XP_004611918.1|  PREDICTED: reticulocalbin-2                      60.1    3e-06    
ref|XP_010151316.1|  PREDICTED: 45 kDa calcium-binding protein        59.7    3e-06    
gb|AAB01813.1|  Cab45b                                                59.7    3e-06    
ref|XP_008587979.1|  PREDICTED: reticulocalbin-2                      59.3    3e-06    
ref|XP_008117393.1|  PREDICTED: reticulocalbin-2                      59.3    3e-06    
ref|XP_010570552.1|  PREDICTED: reticulocalbin-2                      59.3    3e-06    
ref|NP_001231113.1|  reticulocalbin 2, EF-hand calcium binding do...  59.3    3e-06    
ref|XP_003497959.1|  PREDICTED: reticulocalbin-2 isoform X1           58.9    4e-06    
ref|XP_005290653.1|  PREDICTED: reticulocalbin-2                      58.9    4e-06    
ref|XP_001105360.2|  PREDICTED: reticulocalbin-2                      59.7    4e-06    
gb|ERG81497.1|  calumenin-a                                           57.8    4e-06    
ref|XP_007469220.1|  PREDICTED: reticulocalbin-2                      58.9    4e-06    
ref|XP_001376054.1|  PREDICTED: 45 kDa calcium-binding protein is...  59.3    4e-06    
ref|XP_008246679.1|  PREDICTED: reticulocalbin-2                      58.9    4e-06    
ref|XP_005221987.1|  PREDICTED: reticulocalbin-2 isoform X1           58.9    4e-06    
ref|XP_005656339.1|  PREDICTED: reticulocalbin 2, EF-hand calcium...  58.9    4e-06    
ref|XP_005530498.1|  PREDICTED: 45 kDa calcium-binding protein        59.3    4e-06    
ref|XP_006618186.1|  PREDICTED: calumenin-like                        58.9    4e-06    
ref|XP_003696572.1|  PREDICTED: calumenin-like                        58.9    4e-06    
ref|XP_010371579.1|  PREDICTED: reticulocalbin-2                      58.9    4e-06    
gb|ADD38402.1|  Calumenin-A                                           58.9    4e-06    
ref|XP_006126305.1|  PREDICTED: reticulocalbin-2 isoform X2           58.9    4e-06    
ref|XP_002423469.1|  Calumenin precursor, putative                    58.9    4e-06    
ref|XP_004758590.1|  PREDICTED: reticulocalbin-1-like                 59.7    4e-06    
ref|XP_003901296.1|  PREDICTED: reticulocalbin-2                      58.9    4e-06    
ref|XP_624357.1|  PREDICTED: calumenin                                58.9    4e-06    
ref|XP_006126304.1|  PREDICTED: reticulocalbin-2 isoform X1           58.9    4e-06    
emb|CDQ82253.1|  unnamed protein product                              58.5    5e-06    
ref|XP_005419838.1|  PREDICTED: reticulocalbin-2                      58.5    5e-06    
ref|XP_006992405.1|  PREDICTED: 45 kDa calcium-binding protein is...  58.9    5e-06    
ref|XP_003765231.1|  PREDICTED: 45 kDa calcium-binding protein        58.9    5e-06    
ref|XP_002122894.1|  PREDICTED: reticulocalbin-2-like                 58.2    5e-06    
ref|XP_004807874.1|  PREDICTED: reticulocalbin-1-like                 59.3    6e-06    
gb|EFN63774.1|  Calumenin                                             58.2    6e-06    



>ref|XP_006360159.1| PREDICTED: calumenin-A-like isoform X1 [Solanum tuberosum]
 ref|XP_006360160.1| PREDICTED: calumenin-A-like isoform X2 [Solanum tuberosum]
Length=342

 Score =   425 bits (1093),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 215/344 (63%), Positives = 266/344 (77%), Gaps = 15/344 (4%)
 Frame = +2

Query  65    MTKVVAYTIAAAFV--ILLLSQDHNKLFRKD--YSPRGLSRRLGTQGTAPPIFDPIVA--  226
             M+KVV  TI  AFV  ++L++Q   KL  KD  Y+P GLSRRLG + +  PIFDP+VA  
Sbjct  1     MSKVVVSTIITAFVFLVVLVTQLFIKLNHKDGYYTPNGLSRRLGLK-SRDPIFDPLVAEL  59

Query  227   --RRKGLANPEKS-----DDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEY  385
               + KG +N   S      +D++YF++ GRL T LRLMVLFPILD  P DGF++ KELE 
Sbjct  60    EQKTKGKSNDNSSRRSRKKEDEKYFDNDGRLKTSLRLMVLFPILDVAPKDGFIEYKELEI  119

Query  386   WNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQF  565
             WNTQQAI+RL+YRT R +  RDKDGDG+ISF EY PQFT+ED+E+NET HGDAGWWM QF
Sbjct  120   WNTQQAIDRLHYRTWREMEFRDKDGDGAISFFEYLPQFTNEDLEKNETSHGDAGWWMAQF  179

Query  566   KNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAY  745
             +NAD D++GTLNLYEFRDF+HPEDSRN+ I+RWLL EK+RQMDVNKD  L+ LEF  GAY
Sbjct  180   RNADADQSGTLNLYEFRDFMHPEDSRNEQIQRWLLREKIRQMDVNKDNMLNRLEFSNGAY  239

Query  746   ETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTY  925
               YKTY E+E+ G ++P+  + F  LD D D FLRVEELKPI  YL PGELSYA+ YTTY
Sbjct  240   NIYKTYLEYESQGTNIPTPFQAFANLDYDGDEFLRVEELKPILQYLCPGELSYAKVYTTY  299

Query  926   LIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             LIREADD+ DGKLTLDE++NH+++FY T+YDN ++E DI+H+EL
Sbjct  300   LIREADDDKDGKLTLDEILNHESIFYSTVYDNGRNE-DIFHEEL  342



>ref|XP_009791546.1| PREDICTED: calumenin-A [Nicotiana sylvestris]
Length=344

 Score =   420 bits (1080),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 221/350 (63%), Positives = 266/350 (76%), Gaps = 25/350 (7%)
 Frame = +2

Query  65    MTKVVAY-TIAAAFV---ILLLSQ---DHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIV  223
             M+KVV   TI  AFV   ILL++Q   + N      Y+PRGLSRRLG + T  PIFDP+V
Sbjct  1     MSKVVVISTIITAFVFLVILLITQLKLNENAY----YTPRGLSRRLGLK-TRDPIFDPLV  55

Query  224   A----RR--KGLANPEKSD------DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVD  367
             A    RR  KG    E+S       +DD+YF+  G+L T LRLMVLFPILD  P DGF++
Sbjct  56    AELDQRRQPKGNNRAEQSSRRSHKKEDDQYFDYDGKLKTSLRLMVLFPILDVAPKDGFIE  115

Query  368   VKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAG  547
              KELE WN QQAI+RL+YRT+R L  RD +GDG+ISFSEY P FT++DIE+NET HG+AG
Sbjct  116   YKELEAWNMQQAIDRLHYRTRRELEFRDNNGDGAISFSEYLPHFTNQDIEKNETSHGEAG  175

Query  548   WWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLE  727
             WWM QF+NADVDRNGTL+LYEFRDFLHPEDSRN+NI++WLL EK+RQMDVN+D KL+ LE
Sbjct  176   WWMEQFRNADVDRNGTLSLYEFRDFLHPEDSRNENIQKWLLREKIRQMDVNRDHKLNRLE  235

Query  728   FERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYA  907
             F  GAY  YKTY E+E+ G ++P+  E F  LD D D FLR EELKPI HYL PGELSYA
Sbjct  236   FSNGAYNIYKTYLEYESRGANIPTPLEAFAKLDVDGDKFLREEELKPILHYLCPGELSYA  295

Query  908   RYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             + YTTYLIREADDN DGKLTLDE++NH+++FY TIYDN ++E D+ HDEL
Sbjct  296   KVYTTYLIREADDNQDGKLTLDEILNHESIFYSTIYDNGRNE-DLSHDEL  344



>ref|XP_004240960.1| PREDICTED: reticulocalbin-1 [Solanum lycopersicum]
Length=338

 Score =   416 bits (1069),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 210/340 (62%), Positives = 259/340 (76%), Gaps = 11/340 (3%)
 Frame = +2

Query  65    MTKVVAYTIAAAFV--ILLLSQDHNKLFRKD--YSPRGLSRRLGTQGTAPPIFDPIVA--  226
             M+KVV  TI  AFV  ++L  Q   K   KD  Y+P GLSRRLG + T  PIFDP+VA  
Sbjct  1     MSKVVVSTIITAFVFLVVLFIQLTIKFNHKDGYYTPNGLSRRLGLK-TRDPIFDPLVAEL  59

Query  227   --RRKGLANPE-KSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQ  397
               +R G +N   +  +D+RYF++ GRL T LRLMVLFPILD  P DGF++ KELE WNTQ
Sbjct  60    EQKRSGKSNDGWRKKEDERYFDNDGRLKTSLRLMVLFPILDVAPNDGFIEYKELEIWNTQ  119

Query  398   QAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNAD  577
             QAI+RL+YRT   +  RDKDGDG+ISF EY PQFT+ED+E+NET HGDAGWWM QF+NAD
Sbjct  120   QAIDRLHYRTSSEMEFRDKDGDGAISFFEYLPQFTNEDLEKNETSHGDAGWWMAQFRNAD  179

Query  578   VDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYK  757
              D +GTLNLYE RDF+HPEDSRN+ I+RWLL EK+RQMDVNKD  L+ LEF  GAY  YK
Sbjct  180   ADLSGTLNLYELRDFMHPEDSRNEQIQRWLLREKIRQMDVNKDNMLNRLEFNNGAYNIYK  239

Query  758   TYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIRE  937
             TY E+E+ G ++P+  + F  LD D D FL VEELKPI  YL PGELSYA+ YTTYLIRE
Sbjct  240   TYLEYESQGTNIPTPFQAFANLDYDGDGFLTVEELKPILQYLSPGELSYAKVYTTYLIRE  299

Query  938   ADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             ADD+ D KLTLDE++NH+++FY+T+YDN ++E +I+H+EL
Sbjct  300   ADDDKDSKLTLDEILNHESIFYNTVYDNSRNE-EIFHEEL  338



>ref|XP_009588656.1| PREDICTED: calumenin-A [Nicotiana tomentosiformis]
Length=313

 Score =   369 bits (948),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 228/309 (74%), Gaps = 18/309 (6%)
 Frame = +2

Query  65   MTKVVAY-TIAAAFVILLLSQDHNKLFRKD--YSPRGLSRRLGTQGTAPPIFDPIVA---  226
            M+KVV   TI  AFV L++         ++  Y+PRGLSRRLG + T  PIFDP+VA   
Sbjct  1    MSKVVVISTIITAFVFLVIPLIVQLKLNENAYYTPRGLSRRLGLK-TRDPIFDPLVAELE  59

Query  227  RRKGLANPEKS----------DDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKE  376
            +R+   N E            ++DD+YF+  GRL T LRLMVLFPILD  P DGF++ KE
Sbjct  60   QRQPKGNKEDQSSRRSHNNYKEEDDQYFDYDGRLKTSLRLMVLFPILDVAPKDGFIEYKE  119

Query  377  LEYWNTQQAINRLNYRTQRALS-LRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWW  553
            LE WNTQQAI+RL+YRT+R L   RD +GDG+ISFSEY P FT+EDIERNET HG+AGWW
Sbjct  120  LEAWNTQQAIDRLHYRTRRELEYFRDNNGDGAISFSEYLPHFTNEDIERNETSHGEAGWW  179

Query  554  MIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFE  733
            M QF+NAD DRNGTLNLYEFRDFLHPEDSRN+NI+RWLL EK+RQMDVN+D KL+ LEF 
Sbjct  180  MEQFRNADADRNGTLNLYEFRDFLHPEDSRNENIQRWLLREKIRQMDVNRDHKLNRLEFS  239

Query  734  RGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARY  913
             GAY  YKTY E+E+ G ++P+  E F  LD D D FLR EELKPI HYL PGELSYA+ 
Sbjct  240  NGAYNIYKTYLEYESRGTNIPTPLEAFAKLDVDSDKFLREEELKPILHYLCPGELSYAKV  299

Query  914  YTTYLIREA  940
            YTTYLIREA
Sbjct  300  YTTYLIREA  308



>emb|CDP05036.1| unnamed protein product [Coffea canephora]
Length=351

 Score =   346 bits (888),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 195/354 (55%), Positives = 239/354 (68%), Gaps = 29/354 (8%)
 Frame = +2

Query  68    TKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVAR--RKGL  241
             +K V  ++ A  ++LL+    N           LSRRLG+     PIFDPIVA+  RK  
Sbjct  3     SKAVVCSLLATALVLLIVLSKNSKPDDHRKHDALSRRLGS-----PIFDPIVAKAHRKAE  57

Query  242   ANPEK-----------------SDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDV  370
              N  +                 + +D +Y+++ G L+  LRLMVLFP+LD  P DG VD 
Sbjct  58    ENTSRDTKAAAAAAASSSYINAAKEDMKYYDEDGTLNLRLRLMVLFPVLDVAPQDGMVDS  117

Query  371   KELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGW  550
             KELE W TQQA++RL+ RT+R L LRDKDGD SISF EY PQFT EDIERN+T +G+AGW
Sbjct  118   KELEAWLTQQAVDRLDCRTRRELELRDKDGDASISFYEYLPQFTKEDIERNDTRYGEAGW  177

Query  551   WMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEF  730
             WM QF ++DVDRNG LNLYEFRDFLHPEDSRN+ I+R LL EKLRQMD + DQ+LSLLEF
Sbjct  178   WMEQFNDSDVDRNGNLNLYEFRDFLHPEDSRNERIQRRLLREKLRQMDKDNDQRLSLLEF  237

Query  731   ERGAYETYKTYKEFE-TSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYA  907
             E GAY  YK Y ++E  S  ++ S    F  LD D D  LRVEELKP+F YL PGEL YA
Sbjct  238   EVGAYNDYKFYLDYESGSAANISSAAAVFDKLDVDHDKLLRVEELKPLFKYLKPGELVYA  297

Query  908   RYYTTYLIREAD--DNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDI--YHDEL  1057
             +YYT YLI+EA      DGKLTLDEM+NH+ +FY+T+YDN K E++   YHDEL
Sbjct  298   KYYTNYLIQEASFCIAIDGKLTLDEMLNHEHIFYNTVYDNGKHENEYYSYHDEL  351



>ref|XP_008381116.1| PREDICTED: calumenin-B-like [Malus domestica]
Length=330

 Score =   333 bits (855),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 160/309 (52%), Positives = 219/309 (71%), Gaps = 12/309 (4%)
 Frame = +2

Query  164   GLSRRLGTQGTAPPIFDPIVARRK---------GLANPEKSDDDDRYFNDKGRLDTGLRL  316
             GL+RRLG  G AP IFDP+VA+ +         G  N  + ++   Y  ++G+L+  LRL
Sbjct  23    GLNRRLGYTGHAP-IFDPLVAKMERYAKENGFPGGMNASEVEEVHEYIGNEGKLNLTLRL  81

Query  317   MVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQ  496
             + LFP++D+ P DGF+  KELE W  QQ + RLNY TQ+ +   DKDGDG+ISF+EY P+
Sbjct  82    INLFPLIDQAPKDGFISSKELEQWVMQQTLERLNYSTQKEMESHDKDGDGTISFAEYLPK  141

Query  497   FTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTE  676
             F+ +D+ +N+  HG+AGWW  QF+NAD D+NG LN  E +D LHPEDS N+ I +WLL E
Sbjct  142   FSTKDLAKNKMEHGEAGWWKQQFENADADKNGLLNFNELKDLLHPEDSNNEEIHKWLLRE  201

Query  677   KLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVE  856
             K+++MD +KD K++ +EF   AY+ YK+Y EFET G +VPS E+ FT LD +K+  L VE
Sbjct  202   KMKRMDKDKDGKMNFMEFLHNAYDNYKSYVEFETGGKNVPSPEQKFTELDVNKNKHLEVE  261

Query  857   ELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDE-  1033
             ELKPI HY+ PGELSYA+YY ++L+ EAD N DGKLTL+EM++HD +FY+T+YD   +E 
Sbjct  262   ELKPILHYIHPGELSYAKYYASFLMLEADGNKDGKLTLEEMLDHDYVFYNTVYDGSINEN  321

Query  1034  -DDIYHDEL  1057
              D+  HDE 
Sbjct  322   LDEDLHDEF  330



>ref|XP_009351974.1| PREDICTED: calumenin [Pyrus x bretschneideri]
Length=364

 Score =   328 bits (842),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 171/365 (47%), Positives = 234/365 (64%), Gaps = 35/365 (10%)
 Frame = +2

Query  65    MTKVVAYTI-AAAFVILLL-------SQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPI  220
             M K V Y + A AF+ LL+            +     +   GL+RRLG  G AP IFDP+
Sbjct  1     MAKAVVYALLATAFIFLLVMLPSKQRGPHPRRRRHHPHPLPGLNRRLGYTGHAP-IFDPL  59

Query  221   VARRK----------------GLA--------NPEKSDDDDRYFNDKGRLDTGLRLMVLF  328
             VA+ +                GLA        +  + ++   Y  D+G+L+  LRL+ LF
Sbjct  60    VAKMERYAKENGFPRGMNNLMGLAAHNDHPMMHLSEVEEVHEYIGDEGKLNLTLRLINLF  119

Query  329   PILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDE  508
             P++D+ P DGF+  KELE W T+Q + RLNY TQ+ +   DKDGDG+ISF+EY P+F+ +
Sbjct  120   PLIDQAPKDGFISSKELEQWVTKQTLERLNYSTQKEMESHDKDGDGTISFAEYLPKFSTK  179

Query  509   DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQ  688
             D+ +N   HG+AGWW  QF+NAD D+NG LN  E +D LHPEDS N+ I +WLL EK+++
Sbjct  180   DLAKNRMEHGEAGWWKQQFENADADKNGLLNFNELKDLLHPEDSNNEEIHKWLLREKMKR  239

Query  689   MDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKP  868
             MD +KD K++  EF   AY+ YK+Y EFET G +VPS E+ FT LD +K+  L VEELKP
Sbjct  240   MDKDKDGKMNFREFLHNAYDNYKSYVEFETGGKNVPSPEQKFTELDVNKNRLLEVEELKP  299

Query  869   IFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDE--DDI  1042
             I HY+ PGELSYA+YY ++L+ EAD N DGKLTL+EM++HD +FY+T+YD   +E  D+ 
Sbjct  300   ILHYIHPGELSYAKYYASFLMLEADGNKDGKLTLEEMLDHDYVFYNTVYDGSINENLDED  359

Query  1043  YHDEL  1057
              HDE 
Sbjct  360   LHDEF  364



>ref|XP_007221135.1| hypothetical protein PRUPE_ppa019586mg [Prunus persica]
 gb|EMJ22334.1| hypothetical protein PRUPE_ppa019586mg [Prunus persica]
Length=352

 Score =   327 bits (837),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 169/356 (47%), Positives = 239/356 (67%), Gaps = 29/356 (8%)
 Frame = +2

Query  65    MTKVVAYTI-AAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARRKGL  241
             M K V Y + A AF+++++     +    D+   GL+RRLG +   P +FDP+VA+ +  
Sbjct  1     MAKAVVYALLATAFILVMVFCPSKQHGHHDH--LGLNRRLGFRDHVP-VFDPLVAKMERY  57

Query  242   A---------------------NPEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDG  358
             A                     +  + ++   YF+D+G+L+  LRL+ LFP++D+ P D 
Sbjct  58    AEENGLGGQTHNLDLVEHSPMMDTSEVEEVHEYFSDEGKLNLTLRLLSLFPLIDQAPKDS  117

Query  359   FVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHG  538
             ++   EL++W TQQA+ RLNYRTQ+ +   DKDGDG+ISFSEY P+F+ +DI++N   HG
Sbjct  118   YISSNELKHWLTQQAVERLNYRTQKEMESYDKDGDGNISFSEYQPKFSSQDIKKNGMEHG  177

Query  539   DAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLS  718
             +AGWW  QF NAD D+NGTL   EF+D LHPEDS N +I +WLL EK+++MD + D KL+
Sbjct  178   EAGWWKQQFDNADADKNGTLTFNEFKDLLHPEDSNNSDIHKWLLAEKMKRMDQDDDGKLN  237

Query  719   LLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGEL  898
              +EF   AY+++K+Y EFET G+  P+ EE F  LD +KD+ L VEELKP+ HYL PGEL
Sbjct  238   FMEFSHNAYDSFKSYVEFETGGVKAPTAEEKFAELDLNKDNLLEVEELKPLLHYLHPGEL  297

Query  899   SYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYD---NEKDEDDIYHDEL  1057
             SY+ YY ++L+ EADDN DGKLTLDEM++HD +FY T+YD   N+ +E+D YHDE 
Sbjct  298   SYSNYYASFLMSEADDNKDGKLTLDEMLDHDYVFYSTVYDAGVNDDNEED-YHDEF  352



>ref|XP_007039100.1| Calcium-binding EF hand family protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY23601.1| Calcium-binding EF hand family protein, putative isoform 1 [Theobroma 
cacao]
Length=344

 Score =   326 bits (836),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 166/333 (50%), Positives = 227/333 (68%), Gaps = 21/333 (6%)
 Frame = +2

Query  65    MTKVVAYT-IAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVAR----  229
             M K V YT +A AF+IL +   + +     ++  GLSRRLG +    P FDP+VAR    
Sbjct  1     MAKAVVYTFLATAFIILFVFFQNKR--HGHHTRSGLSRRLGYKA---PHFDPLVARLERS  55

Query  230   --RKGLA---NPE------KSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKE  376
                KGL+   +PE      +  D D +F D G L+T LRLM+LFP+LD  P DG +  KE
Sbjct  56    AEEKGLSYHVDPEHISYVPEVADADEFFGDDGTLNTTLRLMILFPLLDSAPKDGLISAKE  115

Query  377   LEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWM  556
             L  W  QQA++RL++RT + +S  DK+GDG+ISFSEY P F + DI +N   HG+AGWWM
Sbjct  116   LGAWIGQQAMDRLSFRTNKVMSWHDKNGDGAISFSEYLPHFNENDIAKNRKEHGEAGWWM  175

Query  557   IQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFER  736
              QF NAD++ NGTL+  EF+DFLHPEDS N+ I++WLL EK+++MD + D KL+  EF  
Sbjct  176   EQFNNADLNSNGTLDFNEFKDFLHPEDSDNEEIQKWLLREKMKRMDDDHDGKLNFKEFLD  235

Query  737   GAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYY  916
              AY  YK+Y EFET+    P+ EE F  LD ++D +L ++EL+PI  YL PGEL YA+YY
Sbjct  236   YAYNIYKSYAEFETAAALAPTAEEKFVELDINEDKYLELDELRPILRYLYPGELFYAKYY  295

Query  917   TTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             T+YLI EADDN DG LT++E++NH+++FY+++Y
Sbjct  296   TSYLIYEADDNKDGNLTMEEILNHESIFYNSLY  328



>ref|XP_002526254.1| Reticulocalbin-2 precursor, putative [Ricinus communis]
 gb|EEF36123.1| Reticulocalbin-2 precursor, putative [Ricinus communis]
Length=348

 Score =   325 bits (832),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 175/339 (52%), Positives = 221/339 (65%), Gaps = 26/339 (8%)
 Frame = +2

Query  65    MTKVVAY-TIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAP-PIFDPIV-----  223
             M KVVA+  +A AFVIL+++   NK      S  GL+RRLG   T P P FDP+V     
Sbjct  1     MAKVVAFPVLATAFVILIITSRINK--HNSPSIFGLNRRLGY--TFPIPTFDPLVVKIQR  56

Query  224   -ARRKGL---ANPEKSDDDD-----------RYFNDKGRLDTGLRLMVLFPILDRDPCDG  358
              A  KGL    NP  S++ +            Y ++ G L+  LRLM +FP+LD    DG
Sbjct  57    AAEAKGLIKKGNPIGSEERNSNIVVETENAYEYLSENGTLNMTLRLMFIFPLLDNASKDG  116

Query  359   FVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHG  538
              V  +EL+ WN +QAI RL YRT + + L DKDGDG I+FSEY PQF+ EDI+ N T HG
Sbjct  117   KVSFEELQQWNKEQAIERLTYRTDKEMELHDKDGDGMINFSEYLPQFSKEDIDENSTAHG  176

Query  539   DAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLS  718
             +AGWWM+QFKNAD+D+NG L+  EF DFLHPED+ ND I+RW+L EK+R MD + D KL+
Sbjct  177   EAGWWMLQFKNADIDQNGFLDYDEFNDFLHPEDTNNDKIQRWMLREKIRLMDDDGDGKLN  236

Query  719   LLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGEL  898
               EF    Y  YK Y EFE S  ++ + +E F  LD +KD FL V+EL PI  YL PGEL
Sbjct  237   FAEFSMHVYSIYKIYGEFEASRSNLATAKEKFEELDTNKDEFLEVKELLPILCYLKPGEL  296

Query  899   SYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             SYA+YY +YLI+EADDN D  LTLDEM+NH+  FY T+Y
Sbjct  297   SYAKYYASYLIQEADDNGDNYLTLDEMLNHENTFYTTMY  335



>ref|XP_002869541.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45800.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=345

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 166/346 (48%), Positives = 228/346 (66%), Gaps = 16/346 (5%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARRKGLA  244
             M KVV Y I AA  I+L+   H K  R       +SRR+G +    P+FDP+V R + L+
Sbjct  1     MAKVVVYAILAATFIVLVLFAHKKQNRTQSIEGLISRRIGRR-LEMPVFDPLVTRIERLS  59

Query  245   NPE----------KSDDDDR---YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEY  385
             N +          K ++DD    YF  + RL+T +R+  LFP+LD  P DGFV +KEL+ 
Sbjct  60    NEKEAGTKTVEAAKEEEDDMFEGYFAQERRLNTTMRIKFLFPLLDAAPRDGFVSLKELQT  119

Query  386   WNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQF  565
             W  QQ  + + YRT + L L+DKD DG I+F EY PQF+ +DIE+NE GHG+AGWWM QF
Sbjct  120   WMMQQTEDNMGYRTAKELELQDKDKDGVITFEEYLPQFSKQDIEKNEKGHGEAGWWMEQF  179

Query  566   KNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAY  745
             KN+D D NG+L++ EF +FLHPEDSRN + +RW+LTE++  MD N D KL   EF +  Y
Sbjct  180   KNSDFDHNGSLDIEEFNNFLHPEDSRNGDTQRWVLTERMTGMDTNGDGKLEYREFVQNTY  239

Query  746   ETYKTYKEFET-SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTT  922
             E YK + +FET    +VP+ +  F  LD +KD FL   EL+PI HYL PGE+SYA+YY+T
Sbjct  240   EMYKEFAKFETEEDENVPTAQLLFAELDRNKDRFLVANELRPILHYLQPGEMSYAKYYST  299

Query  923   YLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY-HDEL  1057
             +L  EAD++ DGKL+L+EM+ H+ +FY  ++  E D++D + HDEL
Sbjct  300   FLCHEADEDKDGKLSLEEMLRHEDVFYKAVHHEELDDEDYFDHDEL  345



>ref|XP_004309124.1| PREDICTED: calumenin-like [Fragaria vesca subsp. vesca]
Length=342

 Score =   319 bits (818),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 221/340 (65%), Gaps = 32/340 (9%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPR--GLSRRLGTQGTAPPIFDPIVAR---  229
             M K V    AAA V L++           + PR  G  RRLG  G  P IFDP+V++   
Sbjct  1     MAKGVYLLFAAAIVALIV--------LSPFKPRHHGHHRRLGFTGHVP-IFDPLVSKMER  51

Query  230   ---RKGLANPEKSDDDD-------------RYFNDKGRLDTGLRLMVLFPILDRDPCDGF  361
                 KGL +   + D +             +Y N+ G L+  +RL+ LFP+LD  P DGF
Sbjct  52    YVEEKGLEDHNHTIDTEHDLVIANDVEEAQQYLNEAGNLNLTMRLVNLFPLLDVAPEDGF  111

Query  362   VDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGD  541
             V   EL++W   QA+ R+ YRT+R ++  D+DGD +ISF EY PQF+ EDI+RN+  HG+
Sbjct  112   VSYDELKHWIVAQAMERMIYRTRRVMAENDRDGDRAISFREYLPQFSIEDIDRNDMEHGE  171

Query  542   AGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSL  721
             AGWW  QF NAD DRNG L   E +DFLHPEDS ND I+RWLLTEK+++MD +KD KLS 
Sbjct  172   AGWWKQQFDNADADRNGLLTFSELKDFLHPEDSSNDRIQRWLLTEKMKRMDHDKDGKLSF  231

Query  722   LEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELS  901
             +EF   AY  +K Y EFETS  D+P  +E F  LD +K+ FL  EEL+PI HYL PGEL+
Sbjct  232   VEFSDNAYNVFKNYVEFETS--DLPIAKEKFAELDVNKNKFLEAEELRPILHYLYPGELT  289

Query  902   YARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDN  1021
             YA YYT++LI EADDN DGKLTL+EM++H+ +FY+T+Y++
Sbjct  290   YATYYTSFLIHEADDNKDGKLTLEEMLHHEDVFYNTVYES  329



>ref|XP_008234704.1| PREDICTED: calumenin [Prunus mume]
Length=352

 Score =   318 bits (814),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 169/359 (47%), Positives = 231/359 (64%), Gaps = 35/359 (10%)
 Frame = +2

Query  65    MTKVVAYTI-AAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVA-----  226
             M K V Y + A AF+++++     +    D+   GL+RRLG  G   P+FDP+VA     
Sbjct  1     MAKAVVYALLATAFILVMVFCPSKQHGHHDH--LGLNRRLGF-GDHVPVFDPLVANMERY  57

Query  227   -RRKGLA---------------NPEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDG  358
                 GL                +  + ++   Y +D+G+L+  LRL+ LFP++D+ P D 
Sbjct  58    AEENGLGGQTHNLDLVEHSPMMDTSEVEEVHEYLSDEGKLNLTLRLLSLFPLIDQAPKDS  117

Query  359   FVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHG  538
             ++   EL++W TQQA+ RLN RTQ+ +   DKDGDG+ISFSEY P+F+ +D+E+N   HG
Sbjct  118   YISSNELKHWLTQQAVVRLNNRTQKEMESYDKDGDGTISFSEYQPKFSSQDLEKNGMEHG  177

Query  539   DAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLS  718
             +AGWW  QF NAD D+NGTL   EF+D LHPEDS N  I +WLL EK+++MD + D KL+
Sbjct  178   EAGWWKQQFDNADADKNGTLTFNEFKDLLHPEDSNNSEIHKWLLAEKMKRMDQDNDGKLN  237

Query  719   LLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGEL  898
              +EF   AY+++K+Y EFET G   P+ EE F  LD +KD+ L VEELKP+ HYL PGEL
Sbjct  238   FMEFSHNAYDSFKSYVEFETGGAKAPTAEEKFAELDLNKDNLLEVEELKPLLHYLHPGEL  297

Query  899   SYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY------DNEKDEDDIYHDEL  1057
             SY  YY ++L+ EADDN DGKLTLDEM++HD +FY T+Y      DNE+D    YHDE 
Sbjct  298   SYTNYYASFLMSEADDNKDGKLTLDEMLDHDYIFYSTVYYTGVNDDNEED----YHDEF  352



>ref|XP_008376764.1| PREDICTED: calumenin-like [Malus domestica]
Length=359

 Score =   317 bits (812),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 171/360 (48%), Positives = 227/360 (63%), Gaps = 30/360 (8%)
 Frame = +2

Query  65    MTKVVAYTI-AAAFVILLLSQDHNKLFRKDYSPR-GLSRRLGTQGTAPPIFDPIVAR---  229
             M K V Y + A AF+ LL+             P  GL+RRLG  G +P IFDP+ A+   
Sbjct  1     MAKAVVYALLATAFIFLLVMLPSKHRGPNHPHPHLGLNRRLGYMGQSP-IFDPLAAKMEW  59

Query  230   --------------RKGLA--------NPEKSDDDDRYFNDKGRLDTGLRLMVLFPILDR  343
                           R GL+        N  + ++   Y  D+G+L+  LRL  LFP++D+
Sbjct  60    YAKESGGFRGETNSRVGLSEHNNNPVMNASEVEEVHEYLGDEGKLNLTLRLNTLFPLIDQ  119

Query  344   DPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERN  523
              P DG ++  ELE W  +Q + RLNYRTQ+ +   DKDGDG+ISF EY P+F+ +D+E N
Sbjct  120   APKDGLINSNELEDWVMKQTVERLNYRTQKEMESYDKDGDGTISFMEYLPKFSTKDLEEN  179

Query  524   ETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNK  703
                HG+AGWW  QF NAD D+NG LN  EF+D LHPEDS N+ I +WLLTEK+++MD + 
Sbjct  180   GMEHGEAGWWKQQFDNADADKNGLLNFNEFKDLLHPEDSNNEEIHKWLLTEKMKRMDQDN  239

Query  704   DQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYL  883
             D KL+  EF   AY+ YKTY EFE  G +VP+ EE F  LD +K+  L VEELKP+ HY+
Sbjct  240   DGKLNFEEFLHNAYDNYKTYVEFERGGKNVPTPEEKFAELDVNKNKLLEVEELKPMLHYI  299

Query  884   DPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDE--DDIYHDEL  1057
              PGE SYA+YY T+L+ EADDN DGKLTL+EM++HD +FY T+YD+  +E  D  +HDE 
Sbjct  300   HPGEFSYAKYYATFLMSEADDNKDGKLTLEEMLDHDYVFYSTVYDDGMNEDFDGDFHDEF  359



>ref|XP_009143986.1| PREDICTED: calumenin-A [Brassica rapa]
Length=347

 Score =   315 bits (808),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 167/351 (48%), Positives = 223/351 (64%), Gaps = 24/351 (7%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVIL-----LLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVAR  229
             M KVV YT+     I+     L    HN+          ++RRLG +    P+FDPIV R
Sbjct  1     MAKVVVYTLLTTIFIIGVLLFLTPCKHNE---AQSVEALITRRLGRR-LVTPVFDPIVTR  56

Query  230   -------------RKGLANPEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDV  370
                           + +A  EK D  D YF+ + RL+T +R+  LFP+LD  P DGFV +
Sbjct  57    IERLSHEKEANTTVEAVAKEEKDDMFDEYFSQERRLNTTMRIKFLFPLLDGAPRDGFVSL  116

Query  371   KELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGW  550
             KEL+ W  QQ  + + YRT   L L+DKD DG I+F EY PQF+ EDIE+NE  HG AGW
Sbjct  117   KELQTWMMQQTEDNMGYRTANELELQDKDKDGVITFEEYLPQFSREDIEKNEKSHGGAGW  176

Query  551   WMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEF  730
             WM QFKNAD D NG L++ EF +FLHPEDSRN +++RW+L E++  MD N D KL   EF
Sbjct  177   WMEQFKNADFDHNGYLDIEEFNNFLHPEDSRNGDVQRWVLRERMTGMDTNGDGKLEYKEF  236

Query  731   ERGAYETYKTYKEFET-SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYA  907
              + AYE YK + +FET    +VP+ +  F  LD DKD FL  +EL+PI HYL PGELSYA
Sbjct  237   VKNAYEMYKEFAKFETEEDENVPTAQLLFAELDRDKDRFLVADELRPILHYLQPGELSYA  296

Query  908   RYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY-HDEL  1057
             +YY+T+L  EAD++ DGKL+L+EM+NH+ +FY  ++  + D++D + HDEL
Sbjct  297   KYYSTFLCHEADEDKDGKLSLEEMLNHEDVFYKAVHHEDLDDEDYFDHDEL  347



>ref|XP_002321392.1| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEF05519.1| calcium-binding EF hand family protein [Populus trichocarpa]
Length=347

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 176/351 (50%), Positives = 238/351 (68%), Gaps = 24/351 (7%)
 Frame = +2

Query  65    MTKVVAYT-IAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARRKGL  241
             M +VV Y  I  AF++ +     N   R   +  GL+RRLG++ + P  FDP+V + + L
Sbjct  1     MGRVVVYVLITIAFIVFMTFSPINNHGR---TTPGLNRRLGSKFSMPD-FDPLVVKMQRL  56

Query  242   AN------------------PEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVD  367
             A                    ++ +D D Y +D GRL+  LRL+VLFP+LD+ P DG + 
Sbjct  57    AEEKGYTGEGGAINLENNGYAKEVEDADEYLSDDGRLNITLRLLVLFPLLDKKPRDGLIS  116

Query  368   VKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAG  547
              +ELE WN +QA  RL YRTQR +  RDKDGDG+I+F EY PQF++EDIERNE GHG+AG
Sbjct  117   FEELEAWNVEQARERLAYRTQREIQSRDKDGDGAINFKEYLPQFSNEDIERNEMGHGEAG  176

Query  548   WWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLE  727
             WWM QF+NADVDRNGTL+  EF +FLHPEDS N +I++W+L EKL++MD ++D KL+L E
Sbjct  177   WWMQQFRNADVDRNGTLDFDEFNNFLHPEDSNNKDIQKWILREKLKRMDDDRDGKLNLAE  236

Query  728   FERGAYE-TYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSY  904
             F   AY+  YK+Y EFE +   V + EE F  LD +KD+FL  EEL P+  YL PGELSY
Sbjct  237   FSMYAYDGNYKSYAEFEPNVARVGTAEEKFLELDVNKDNFLSEEELIPMIPYLKPGELSY  296

Query  905   ARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             A++YT+YLI E D+N DG L++DEM+NH+  FY T + +++D DD +H+EL
Sbjct  297   AKHYTSYLIHETDENGDGYLSIDEMLNHEYTFYGTFFQDDEDYDDEFHEEL  347



>emb|CDY19023.1| BnaC01g20450D [Brassica napus]
Length=346

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 223/350 (64%), Gaps = 23/350 (7%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVIL-----LLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVAR  229
             M KVV YT+     I+     L    HN+          ++RRLG +    P+FDPIV R
Sbjct  1     MAKVVVYTLLTTIFIIGVLLFLTPCKHNE---AQSVEALITRRLGRR-LVMPVFDPIVTR  56

Query  230   ------------RKGLANPEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVK  373
                          + +A  EK D  D YF+ + RL+T +R+  LFP+LD  P DGFV +K
Sbjct  57    IERLSHEKEANTVEAVAKEEKDDMFDEYFSQERRLNTTMRIKFLFPLLDGAPRDGFVSLK  116

Query  374   ELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWW  553
             EL+ W  QQ  + + YRT   L L+DKD DG I+F EY PQF+ EDIE+NE  HG AGWW
Sbjct  117   ELQTWMMQQTEDNMGYRTANELELQDKDKDGVITFEEYLPQFSREDIEKNEKSHGGAGWW  176

Query  554   MIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFE  733
             M QFKNAD D NG L++ EF +FLHPEDSRN +++RW+L E++  MD N D KL   EF 
Sbjct  177   MEQFKNADFDHNGYLDIEEFNNFLHPEDSRNGDVQRWVLRERMTGMDTNGDGKLEYKEFV  236

Query  734   RGAYETYKTYKEFET-SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYAR  910
             + AYE YK + +FET    +VP+ +  F  LD DKD FL  +EL+PI HYL PGELSYA+
Sbjct  237   QNAYEMYKEFAKFETEEDENVPTAQLLFAELDRDKDRFLVADELRPILHYLQPGELSYAK  296

Query  911   YYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY-HDEL  1057
             YY+T+L  EAD++ DGKL+L+EM+NH+ +FY  ++  + D++D + HDEL
Sbjct  297   YYSTFLCHEADEDKDGKLSLEEMLNHEDVFYKAVHHEDLDDEDYFDHDEL  346



>ref|NP_194508.1| Calcium-binding EF hand family protein [Arabidopsis thaliana]
 emb|CAB43967.1| putative calcium binding protein [Arabidopsis thaliana]
 emb|CAB81428.1| putative calcium binding protein [Arabidopsis thaliana]
 gb|AEE85392.1| Calcium-binding EF hand family protein [Arabidopsis thaliana]
Length=345

 Score =   315 bits (807),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 160/346 (46%), Positives = 225/346 (65%), Gaps = 16/346 (5%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARRKGL-  241
             M KVV YTI  A +I L+   H K  +       ++RR+G +    P+FDP+V R + L 
Sbjct  1     MAKVVVYTILTATIIFLILLAHKKQNQTQSIEGLITRRIGRR-LEMPVFDPLVTRIERLS  59

Query  242   ------------ANPEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEY  385
                         A  EK D  + YF  + RL+T +R+  LFP+LD  P DGFV +KEL+ 
Sbjct  60    HEKEAGTKTVEAAKEEKDDMFEEYFAQERRLNTTMRIKFLFPLLDASPRDGFVSLKELQT  119

Query  386   WNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQF  565
             W  QQ  + + YRT + L L+DKD DG I+F EY PQF+ +DIE+NE GHG+AGWWM QF
Sbjct  120   WMMQQTEDNMVYRTAKELELQDKDKDGVITFEEYLPQFSKQDIEKNEKGHGEAGWWMEQF  179

Query  566   KNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAY  745
             KN+D D NG+L++ EF +FLHPEDSRN + +RW+L E++  MD N D KL   EF + AY
Sbjct  180   KNSDFDHNGSLDIEEFNNFLHPEDSRNGDTQRWVLKERMTGMDTNGDGKLEYKEFVKNAY  239

Query  746   ETYKTYKEFET-SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTT  922
             E YK + +FE     +VP+ +  F  +D DKD FL  +EL+PI  YL PGE+SYA++Y+T
Sbjct  240   EMYKEFAKFEKEEDENVPTPQLLFAEMDRDKDRFLVADELRPILQYLQPGEMSYAKFYST  299

Query  923   YLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY-HDEL  1057
             +L  EAD++ DGKL+L+EM++H+ +FY  ++  + D++D + HDEL
Sbjct  300   FLCHEADEDKDGKLSLEEMLHHEDVFYKAVHHEDLDDEDYFDHDEL  345



>ref|XP_006285134.1| hypothetical protein CARUB_v10006475mg [Capsella rubella]
 gb|EOA18032.1| hypothetical protein CARUB_v10006475mg [Capsella rubella]
Length=346

 Score =   313 bits (802),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 162/347 (47%), Positives = 228/347 (66%), Gaps = 17/347 (5%)
 Frame = +2

Query  65    MTKVVAY-TIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARRKGL  241
             M KVV Y  + A F++L+L     K  + +Y    +SRR+G +    P+FDP+V R + L
Sbjct  1     MAKVVVYGVLTATFIVLILLLAPEKQNQTEYIEGLISRRIGRR-LEMPVFDPLVTRIERL  59

Query  242   ANPE----------KSDDDD---RYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELE  382
             ++ +          K D DD    YF  + +L+T +R+  LFP+LD  P DGFV +KEL+
Sbjct  60    SHEKEAHTNTVEAAKEDKDDMFEEYFVQERKLNTTMRIKFLFPLLDASPRDGFVSLKELQ  119

Query  383   YWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQ  562
              W  QQ  + + YRT + L L+DKD DG I+F EY PQF+ +DIE+NE GHG+AGWWM Q
Sbjct  120   TWMMQQTEDNMGYRTAKELDLQDKDKDGVITFEEYLPQFSKQDIEKNEKGHGEAGWWMEQ  179

Query  563   FKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGA  742
             FKN+D D NG+L++ EF +FLHPEDSRN + +RW+L E++  MD N D KL   EF   A
Sbjct  180   FKNSDFDHNGSLDIEEFNNFLHPEDSRNGDTQRWVLRERMTGMDTNGDGKLEYKEFVVNA  239

Query  743   YETYKTYKEFET-SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYT  919
             YE YK + +FE     +VP+ +  F  LD DKD FL  +EL+PI  YL PGE+SYA+YY+
Sbjct  240   YEMYKEFAKFEKEEDENVPTAQLLFAELDRDKDRFLVADELRPILQYLQPGEMSYAKYYS  299

Query  920   TYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY-HDEL  1057
             T+L  EAD++ DGKL+L+EM++H+ +FY  ++  + DE+D + HDEL
Sbjct  300   TFLCHEADEDKDGKLSLEEMLHHEDVFYKAVHHEDLDEEDYFDHDEL  346



>emb|CDX89226.1| BnaA01g16670D [Brassica napus]
Length=347

 Score =   313 bits (801),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 227/351 (65%), Gaps = 24/351 (7%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVIL-----LLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVAR  229
             M KVV YT+     I+     L    HN+          ++RRLG +    P+FDPIV R
Sbjct  1     MAKVVVYTLLTTIFIIGVLLFLTPCKHNE---AQSVEALITRRLGRR-LVMPVFDPIVTR  56

Query  230   RKGLANPEKSD-----------DD--DRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDV  370
              + L++ ++++           DD  D YF+ + RL+T +R+  LFP+LD  P DGFV +
Sbjct  57    IERLSHEKEANTTVEAVAKEGKDDMFDEYFSQERRLNTTMRIKFLFPLLDGAPRDGFVSL  116

Query  371   KELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGW  550
             KEL+ W  QQ  + + YRT   L L+DKD DG I+F EY PQF+ EDIE+NE  HG AGW
Sbjct  117   KELQTWMMQQTEDNMGYRTANELELQDKDKDGVITFEEYLPQFSREDIEKNEKSHGGAGW  176

Query  551   WMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEF  730
             WM QFKNAD D NG L++ EF +FLHPEDSRN +++RW+L E++  MD N D KL   EF
Sbjct  177   WMEQFKNADFDHNGYLDIEEFNNFLHPEDSRNGDVQRWVLRERMTGMDTNGDGKLEYKEF  236

Query  731   ERGAYETYKTYKEFET-SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYA  907
              + AYE YK + +FET    +VP+ +  F  LD DKD FL  +EL+PI HYL PGELSYA
Sbjct  237   VKNAYEMYKEFAKFETEEDENVPTAQLLFAELDRDKDRFLVADELRPILHYLQPGELSYA  296

Query  908   RYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY-HDEL  1057
             +YY+T+L  EAD++ DGKL+L+EM+NH+ +FY  ++  + D++D + HDEL
Sbjct  297   KYYSTFLCHEADEDKDGKLSLEEMLNHEDVFYKAVHHEDLDDEDYFDHDEL  347



>ref|XP_011044675.1| PREDICTED: reticulocalbin-2 [Populus euphratica]
Length=348

 Score =   311 bits (797),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 177/352 (50%), Positives = 237/352 (67%), Gaps = 25/352 (7%)
 Frame = +2

Query  65    MTKVVAYT-IAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARRKGL  241
             M +VV Y  I  AF+I +     N   R   +  GL+RRLG++ + P  FDP+V + +  
Sbjct  1     MGRVVVYVLITVAFIIFITFSPINNHGR---TTPGLNRRLGSKFSMPD-FDPLVVKMQRF  56

Query  242   AN------------------PEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVD  367
             A                    ++ +D D Y +D GRL+  LRL+VLFP+LD+ P DG + 
Sbjct  57    AEEKGYTGEGETINLENNGYAKEVEDSDEYLSDDGRLNITLRLLVLFPLLDKKPRDGLIS  116

Query  368   VKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAG  547
              +ELE WN +QA  RL YRTQR +  RDKD DG+I F EY PQF++EDIERNETGHG+AG
Sbjct  117   FEELEAWNVEQARERLAYRTQREIQSRDKDRDGAIDFKEYLPQFSNEDIERNETGHGEAG  176

Query  548   WWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLE  727
             WWM QF+NADVDRNGTL+  EF +FLHPEDS N +I++W+L EKL++MD ++D KL+L E
Sbjct  177   WWMQQFRNADVDRNGTLDFDEFNNFLHPEDSTNKDIQKWILREKLKRMDDDRDGKLNLAE  236

Query  728   FERGAYE-TYKTYKEFETS-GIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELS  901
             F   AY+  Y++Y EFE +    V + EE F  LDA+KD+FL  EEL P+  YL PGELS
Sbjct  237   FSMYAYDGNYRSYAEFEPNVARSVRTAEEKFLELDANKDNFLSEEELIPMIPYLKPGELS  296

Query  902   YARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             YA++YT+YLI E DDN DG L++DEM+NH+  FY T + +++D DD +H+EL
Sbjct  297   YAKHYTSYLIHETDDNGDGYLSIDEMLNHEYTFYGTFFQDDEDYDDEFHEEL  348



>ref|XP_010438550.1| PREDICTED: calumenin-B [Camelina sativa]
Length=345

 Score =   310 bits (795),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 167/350 (48%), Positives = 229/350 (65%), Gaps = 24/350 (7%)
 Frame = +2

Query  65    MTKVVAY---TIAAAFVILLLSQDHNKLFRKDYSPRGL-SRRLGTQGTAPPIFDPIVARR  232
             M  VV Y   T+A  F+ILL  +  N+      S  GL SRR+G +    P+FDP+V R 
Sbjct  1     MAMVVVYVLLTVALIFLILLAPRKQNQT----ESIEGLISRRIGRR-LELPVFDPLVTRI  55

Query  233   KGLANPE----------KSDDDD---RYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVK  373
             + +++ +          K D DD    YF  + RL+T +R+  LFP+LD  P DGFV +K
Sbjct  56    ERVSHEKEANTNTVEAAKEDKDDTFAEYFVQERRLNTTMRIKFLFPLLDASPRDGFVSLK  115

Query  374   ELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWW  553
             EL+ W  QQ  + + YRT   L L+DKD DG I+F EY PQF+ +DIERNE GHG+AGWW
Sbjct  116   ELQTWMMQQTEDNMGYRTANELELQDKDKDGVITFEEYLPQFSKKDIERNEKGHGEAGWW  175

Query  554   MIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFE  733
             M +FKN+D D NG+L++ EF +FLHPEDSRN +I+RW+L E++  MD N D KL   EF 
Sbjct  176   MEKFKNSDFDHNGSLDIEEFNNFLHPEDSRNGDIQRWVLKERMTGMDTNGDGKLEYKEFV  235

Query  734   RGAYETYKTYKEFETSGID-VPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYAR  910
               AYE YK + +FE    + VP+ +  FT LD DKD FL  +EL+PI HYL PGE+SYA+
Sbjct  236   ENAYEMYKEFAKFEKEEDESVPTPQLLFTELDRDKDRFLVADELRPILHYLQPGEMSYAK  295

Query  911   YYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY-HDEL  1057
             YY+T+L  EAD++ DGKL+L+EM++H+ +FY  ++    D++D + HDEL
Sbjct  296   YYSTFLCHEADEDKDGKLSLEEMLHHEDVFYKAVHHEGLDDEDYFDHDEL  345



>gb|KFK29297.1| hypothetical protein AALP_AA7G115000 [Arabis alpina]
Length=344

 Score =   310 bits (795),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 164/347 (47%), Positives = 225/347 (65%), Gaps = 19/347 (5%)
 Frame = +2

Query  65    MTKVVAYTI-AAAFVILLLSQDHNKLFRKDYSPRGL-SRRLGTQGTAPPIFDPIVARRKG  238
             M K V  T+    F+IL L     +   +  S  GL SRRLG +    P+FDP+V R + 
Sbjct  1     MAKAVVLTLLTTTFIILFLLVPKTQ--NETQSMEGLISRRLGRR-LEMPVFDPLVTRIER  57

Query  239   LANPEKS-----------DDD--DRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKEL  379
             L++ +++           DDD  + YF  + RL+T +R+  LFP+LD  P DGFV  KEL
Sbjct  58    LSHEKEAHTNTIEGAKEKDDDMFEEYFAQERRLNTTMRIKFLFPLLDAAPRDGFVSFKEL  117

Query  380   EYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI  559
             + W  QQ  + + YRT + L L+DKD DG ++F EY PQF+ +DIE+N+ GHG+AGWWM 
Sbjct  118   QTWMMQQTEDNMGYRTAKELELQDKDKDGVVTFEEYLPQFSKQDIEKNDKGHGEAGWWME  177

Query  560   QFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERG  739
             QF N+D D NG+L++ EF +FLHPEDSRN +I+RW+L E++  MD N D KL   EF   
Sbjct  178   QFNNSDFDHNGSLDIEEFNNFLHPEDSRNGDIQRWVLRERMTGMDTNADGKLEYKEFVDN  237

Query  740   AYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYT  919
             AYE YK + +FET    VP  +  F  LD DKD  L  +EL+PI HYL PGELSYA+YY+
Sbjct  238   AYEMYKEFAKFETDDEGVPMAQLLFAELDKDKDRSLEADELRPILHYLQPGELSYAKYYS  297

Query  920   TYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY-HDEL  1057
             T+L  EADD+ DGKL+L+EM+NH+ +FY  ++  + D++D + HDEL
Sbjct  298   TFLCHEADDDKDGKLSLEEMLNHEDVFYKAVHHEDLDDEDYFDHDEL  344



>ref|XP_006441145.1| hypothetical protein CICLE_v10023659mg [Citrus clementina]
 gb|ESR54385.1| hypothetical protein CICLE_v10023659mg [Citrus clementina]
Length=354

 Score =   310 bits (793),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 165/348 (47%), Positives = 217/348 (62%), Gaps = 37/348 (11%)
 Frame = +2

Query  65    MTKVVAYTI-AAAFVILLL-----SQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVA  226
             M+K VAY +   AFV+  +       DHN           + RR G + + P  FDP+V 
Sbjct  1     MSKAVAYALLTTAFVLFFVFSPIQPHDHNDRLA------FIGRRFGYRYSVP-TFDPLVL  53

Query  227   RRKGLANPEKS----------------------DDDDRYFNDKGRLDTGLRLMVLFPILD  340
             +   +   +KS                      +D+  +F++ GRL+   RL+ LFP++D
Sbjct  54    KMNRVTEEKKSGSIKTRTNANDLENDSYDNEDFEDEYDFFSENGRLNITSRLIYLFPLID  113

Query  341   RDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIER  520
              +P DG + + EL+ WN + A++RL+Y TQ+ + L D+DGDG ISF EY PQF+ +DIE+
Sbjct  114   NEPKDGVLSLNELDNWNVELAVDRLSYTTQKQIELSDRDGDGEISFYEYLPQFSKQDIEK  173

Query  521   NETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVN  700
             N   HG AGWW  QF NADVD NG LN  EF +FLHPEDS N  I+RWLL EKL +MD +
Sbjct  174   NGMVHGQAGWWKEQFDNADVDSNGALNFDEFYNFLHPEDSNNTAIQRWLLREKLERMDDD  233

Query  701   KDQKLSLLEFERGAYETYKTYKEFE--TSGIDVPSVEETFTLLDADKDSFLRVEELKPIF  874
              D KL+L EF    Y TYK+Y EFE    G D PS EETF  LD +KD  L +EELKPIF
Sbjct  234   NDGKLNLDEFLENTYRTYKSYAEFEDDGDGTDFPSAEETFVELDTNKDKLLEIEELKPIF  293

Query  875   HYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYD  1018
              YL PGE+SYA+YY+ +LI EADDN DG LTLDEM+NH+ +FY+T+Y+
Sbjct  294   SYLHPGEISYAKYYSRHLIHEADDNRDGNLTLDEMLNHEYIFYNTVYN  341



>ref|XP_006413028.1| hypothetical protein EUTSA_v10025621mg [Eutrema salsugineum]
 gb|ESQ54481.1| hypothetical protein EUTSA_v10025621mg [Eutrema salsugineum]
Length=346

 Score =   309 bits (791),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 219/332 (66%), Gaps = 16/332 (5%)
 Frame = +2

Query  65    MTKVVAYTI-AAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARRKGL  241
             M KVV  ++  A F++++L     K  +       +SRRLG +    P+FDP+V R + L
Sbjct  1     MAKVVVCSLLTATFIVVVLFLGAKKQNQTQSIEGLISRRLGRR-LEMPVFDPLVTRIERL  59

Query  242   ANPEKS---------DDDDR----YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELE  382
             ++ ++          D++D     YF  + RL+T +R+  LFP+LD  P DGFV +KEL+
Sbjct  60    SHEKEGNTKTVEAAKDEEDHMFEEYFAQERRLNTTMRIKFLFPLLDAAPRDGFVSLKELQ  119

Query  383   YWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQ  562
              W  QQ  + + YRT + L L+DKD DG I+F EY PQF+ EDIE+NE GHG+AGWWM Q
Sbjct  120   TWMMQQTEDNMGYRTAKELELQDKDKDGVITFEEYLPQFSKEDIEKNEKGHGEAGWWMEQ  179

Query  563   FKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGA  742
             FKN+D D NG+L++ EF +FLHPEDSRN +++RW+L E++  MD N D KL   EF   A
Sbjct  180   FKNSDFDHNGSLDIEEFNNFLHPEDSRNGDVQRWVLRERMTGMDTNGDGKLEYKEFVENA  239

Query  743   YETYKTYKEFETSGID-VPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYT  919
             YE YK + +FET   + VP+ +  F  LD DKD FL  +EL+PI HYL PGELSYARYY+
Sbjct  240   YEMYKEFAKFETEEDETVPTAQLLFAELDRDKDRFLVADELRPILHYLQPGELSYARYYS  299

Query  920   TYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             T+L  EADD+ DGKL+L+EM+N + +FY  ++
Sbjct  300   TFLCHEADDDKDGKLSLEEMLNREDVFYKAVH  331



>gb|KGN57652.1| hypothetical protein Csa_3G238180 [Cucumis sativus]
Length=342

 Score =   307 bits (786),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 175/349 (50%), Positives = 226/349 (65%), Gaps = 21/349 (6%)
 Frame = +2

Query  53    MAGKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARR  232
             M   +  V+  T+ A F ++  S  HN+      S +  +RRLG +    P FDP+V   
Sbjct  1     MGKAVVYVLTATVFALFFLISPSNFHNR------SHQQATRRLGFK-FPNPTFDPLVTEM  53

Query  233   KGLANPEKSD-------------DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVK  373
             + LA  E+ +             D  R + D+GRL+  LRL+VLFP+LD  P DG +  +
Sbjct  54    ERLAAEERGENAIGVDNQNHKIIDSYRNYYDEGRLNISLRLLVLFPLLDNSPKDGVISYE  113

Query  374   ELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWW  553
             EL  W   QAI RLNYRT + L   DK+GD +ISF EY PQFT+EDI RNETG+G+AGWW
Sbjct  114   ELSDWINGQAIERLNYRTTKQLEFYDKNGDDAISFHEYLPQFTEEDIARNETGYGEAGWW  173

Query  554   MIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFE  733
               QF NADVD NG L   E +DFLHPEDS N  I+ WLL +K+++MD +KD KL+  EF 
Sbjct  174   RKQFTNADVDNNGLLYFDELKDFLHPEDSSNYRIQNWLLAQKMKRMDHDKDGKLNFDEFL  233

Query  734   RGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARY  913
                Y+ YK Y EFET G DVPS EE F  LD D+D  L  EEL+P+F YL PGE+SYA++
Sbjct  234   HHTYDIYKNYIEFETQGEDVPSAEEKFDELDLDEDEVLSTEELRPLFQYLHPGEVSYAQH  293

Query  914   YTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEK-DEDDIYHDEL  1057
             YT++LI EADDN DG LT+DEM+NH+ +FY T+Y+N+  D +D YHDEL
Sbjct  294   YTSHLINEADDNKDGYLTIDEMLNHEYVFYSTVYENQNGDYEDDYHDEL  342



>ref|XP_010448080.1| PREDICTED: calumenin-B-like [Camelina sativa]
Length=346

 Score =   306 bits (785),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 166/351 (47%), Positives = 227/351 (65%), Gaps = 25/351 (7%)
 Frame = +2

Query  65    MTKVVAY---TIAAAFVILLLSQDHNKLFRKDYSPRGL-SRRLGTQGTAPPIFDPIVARR  232
             M KVV Y   T+A  F+ILL  +      ++  S  GL SRR+G +    P+FDP+V R 
Sbjct  1     MAKVVVYVLLTVAFIFLILLAPRKQ----KQTESIEGLISRRIGRR-LELPVFDPLVTRI  55

Query  233   KGLANPE-----------KSDDDD---RYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDV  370
             + L++ +           K D DD    YF  + RL+T +R+  LFP+LD  P DGFV +
Sbjct  56    ERLSHEKEAGTNNTVEAAKDDKDDTFAEYFVQERRLNTTMRIKFLFPLLDASPRDGFVSL  115

Query  371   KELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGW  550
             KEL+ W  QQ  + + YRT   L L+DKD DG I+F EY PQF+ +DIERNE GHG+AGW
Sbjct  116   KELQTWMMQQTEDNMGYRTANELELQDKDKDGVITFEEYLPQFSKQDIERNEKGHGEAGW  175

Query  551   WMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEF  730
             WM +F N+D D NG+L++ EF +FLHPEDSRN +I+RW+L E++  MD N D KL   EF
Sbjct  176   WMEKFNNSDFDHNGSLDIEEFNNFLHPEDSRNGDIQRWVLKERMTGMDTNGDGKLDYKEF  235

Query  731   ERGAYETYKTYKEFETSGID-VPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYA  907
                AYE YK + +FE    + VP  +  F  LD DKD FL  +EL+PI HYL PGE+SYA
Sbjct  236   VENAYEMYKEFAKFEKEEDESVPMPQLLFAELDRDKDRFLVADELRPILHYLQPGEMSYA  295

Query  908   RYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY-HDEL  1057
             +YY+T+L  EAD++ DGKL+L+EM++H+ +FY  ++    D++D + HDEL
Sbjct  296   KYYSTFLCHEADEDKDGKLSLEEMLHHEDVFYKAVHHEGLDDEDYFDHDEL  346



>ref|XP_008455987.1| PREDICTED: reticulocalbin-2 [Cucumis melo]
Length=343

 Score =   305 bits (781),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 174/347 (50%), Positives = 223/347 (64%), Gaps = 20/347 (6%)
 Frame = +2

Query  65    MTKVVAYTIAA-AFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARRKGL  241
             M K V Y + A AF +  L    N   R    P   +RRLG +    P FDP+V   + L
Sbjct  1     MGKAVVYVLTATAFAVFFLISPSNFHSRNYQQP---TRRLGFK-FPNPTFDPLVTEMERL  56

Query  242   ANPEKSD-------------DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELE  382
                E+ +             D  R + D GRL+  LRL+VLFP+LD  P DG +  +EL 
Sbjct  57    EAEERGENAIGVENQNHKITDAYRNYYDDGRLNISLRLLVLFPLLDNSPKDGVISYEELS  116

Query  383   YWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQ  562
              W   QAI RLNYRT + L   DK+GD +ISF EY PQFT EDI RNETG+G+AGWW+ Q
Sbjct  117   DWINGQAIERLNYRTTKQLEFYDKNGDNAISFHEYLPQFTKEDIARNETGYGEAGWWIKQ  176

Query  563   FKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGA  742
             F NADVD+NG L+  E +DFLHPEDS N  I+ WLL +K+++MD ++D KL+  EF    
Sbjct  177   FTNADVDQNGLLHFDELKDFLHPEDSSNYRIQNWLLAQKMKRMDHDRDGKLNFDEFLHHT  236

Query  743   YETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTT  922
             Y+ YK Y EFET G D+P+ EE F  LD D+D  L VEE++P+F YL PGE+SYA++YT+
Sbjct  237   YDIYKNYIEFETQGDDIPTAEEKFDELDLDEDEVLSVEEIRPLFQYLHPGEVSYAQHYTS  296

Query  923   YLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKD--EDDIYHDEL  1057
             +LI EADDN DG LT+DEM+NH+  FY T+Y+N+    EDD YHDEL
Sbjct  297   HLINEADDNKDGYLTIDEMLNHEYAFYSTVYENQNGDYEDDYYHDEL  343



>ref|XP_010520959.1| PREDICTED: calumenin-A [Tarenaya hassleriana]
Length=354

 Score =   303 bits (776),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 163/339 (48%), Positives = 218/339 (64%), Gaps = 24/339 (7%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGL-SRRLGTQGTAPPIFDPIVARRKGL  241
             M K V YT+  A  ++ +     K  R   S  GL SRRLG +   PP FDP+V R + +
Sbjct  1     MAKAVVYTLLFAVFVVFVIFSPMKQ-RPSQSIEGLISRRLGHK-FHPPAFDPLVTRIERM  58

Query  242   -----ANPE--------------KSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFV  364
                  A+P               + D  + YF ++G+++T +R+  LFP+LD  P DGFV
Sbjct  59    SWEKEASPSNGTIHVDAAARVSAEEDMFEEYFAEEGKVNTTMRIKFLFPLLDAAPRDGFV  118

Query  365   DVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDA  544
              +KEL+ W  QQ  + + YRT + L LRDKD DGSISF EY PQF+ EDIERNE GHG+A
Sbjct  119   SLKELQTWMMQQTEDNMGYRTAKELDLRDKDRDGSISFEEYLPQFSKEDIERNEKGHGEA  178

Query  545   GWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLL  724
             GWW  QFKNAD D NG+L++ EF +FLHPEDSRN +I+RW+L E++  MD + D KL   
Sbjct  179   GWWKDQFKNADFDHNGSLDIEEFNNFLHPEDSRNGDIQRWVLKERITGMDKSGDGKLDYK  238

Query  725   EFERGAYETYKTYKEFETSGID--VPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGEL  898
             EF   AYE Y+ + +FET   D  VP+ +  F  LD DKD FL  +EL+PI  YL PGE+
Sbjct  239   EFLESAYEMYREFAKFETETEDDHVPTAQLLFAELDKDKDRFLVADELRPIVRYLQPGEM  298

Query  899   SYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             SYA+YY+++L  EADD+ DGKL+LDEM+NH+ +FY  ++
Sbjct  299   SYAKYYSSFLFHEADDDKDGKLSLDEMLNHEDVFYKAVH  337



>ref|XP_006492006.1| PREDICTED: 45 kDa calcium-binding protein-like [Citrus sinensis]
Length=356

 Score =   302 bits (773),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 166/350 (47%), Positives = 216/350 (62%), Gaps = 39/350 (11%)
 Frame = +2

Query  65    MTKVVAYTI-AAAFVILLL-----SQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVA  226
             M+K VAY +   AFV+  +       DHN           + RR G + + P  FDP V 
Sbjct  1     MSKAVAYALLTTAFVLFFVFSPIQPHDHNDRLA------FIGRRFGYRYSVP-TFDPFVL  53

Query  227   RRKGLANPEKS----------------------DDDDRYFNDKGRLDTGLRLMVLFPILD  340
             +   +   +KS                      +D+  +F++ GRL+   RL+ LFP++D
Sbjct  54    KMNRVTEEKKSGSIKTRTNTNDLEKDSYDTEDVEDEYDFFSENGRLNITSRLIYLFPLID  113

Query  341   RDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIER  520
              +P DG + + EL+ WN + A++RL+Y TQ+ + L D+DGDG ISF EY PQF+ +DIE 
Sbjct  114   NEPKDGVLSLNELDNWNVELAVDRLSYTTQKQIELSDRDGDGEISFYEYLPQFSKQDIEM  173

Query  521   NETG--HGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMD  694
              + G  HG AGWW  QF NADVD NGTLN  EF +FLHPEDS N  I+R LL EKL +MD
Sbjct  174   EKNGMVHGQAGWWKEQFDNADVDSNGTLNFDEFYNFLHPEDSNNTAIQRRLLREKLERMD  233

Query  695   VNKDQKLSLLEFERGAYETYKTYKEFE--TSGIDVPSVEETFTLLDADKDSFLRVEELKP  868
              + D KL+L EF    Y TYK+Y EFE    G D PS EETF  LD +KD  L VEELKP
Sbjct  234   DDNDGKLNLDEFLENTYRTYKSYAEFEDDGDGTDFPSAEETFVELDTNKDKLLEVEELKP  293

Query  869   IFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYD  1018
             IF YL PGE+SYA+YY+ +LI EADDN DG LTLDEM+NH+ +FY+T+Y+
Sbjct  294   IFSYLHPGEISYAKYYSRHLIHEADDNRDGNLTLDEMLNHEYIFYNTVYN  343



>gb|KDP37385.1| hypothetical protein JCGZ_08570 [Jatropha curcas]
Length=350

 Score =   301 bits (771),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/353 (46%), Positives = 226/353 (64%), Gaps = 25/353 (7%)
 Frame = +2

Query  65    MTKVVAYT-IAAAFVILLLSQDHNKLFRKDYSPR-GLSRRLGTQGTAPPIFDPIV-----  223
             MT+ V Y  +A AFV L++      + ++ ++ R   +RRLG     P  FDP+V     
Sbjct  1     MTRAVVYAFLATAFVFLMVCLP--IINKRGHNIRLSQNRRLGYTFLIPN-FDPLVVKMER  57

Query  224   -ARRKGLANPEKSDD--------------DDRYFNDKGRLDTGLRLMVLFPILDRDPCDG  358
              A  K L+N    D+              D  Y +D G+L+  LRL  LF ++D+ P DG
Sbjct  58    LAEEKDLSNESNFDNSKKNSNNFEAEDYADGEYISDDGKLNITLRLTTLFQLIDKAPKDG  117

Query  359   FVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHG  538
              ++ +EL+ WN +QA+ RL Y+TQ+ + L DKDGD  ISF+EYFPQF+ E+IER + GHG
Sbjct  118   RINFEELQTWNREQAVERLMYKTQKEMDLHDKDGDEEISFTEYFPQFSREEIERKDMGHG  177

Query  539   DAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLS  718
             +AGWWM QF+NADVD +GTLNL E  +FLHPEDS N  I++WLL +++R MD ++D K+S
Sbjct  178   EAGWWMEQFRNADVDGDGTLNLDELNNFLHPEDSSNKEIQKWLLRDRIRWMDDDQDGKIS  237

Query  719   LLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGEL  898
               EF+   Y  YK Y  FET   ++P+ ++ F  LD D++ FL V+EL P  HYL PGEL
Sbjct  238   FAEFQMYVYNIYKAYAGFETDVTNLPTAKQKFQKLDTDENLFLDVDELIPFLHYLKPGEL  297

Query  899   SYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             SYA YY +YLI+EADD+ D  L+LDEM+NH+  FY T++ +  ++ D + DEL
Sbjct  298   SYATYYASYLIQEADDDGDRHLSLDEMINHENTFYTTVFHDRNEDHDDFFDEL  350



>ref|XP_010038464.1| PREDICTED: calumenin-A [Eucalyptus grandis]
 gb|KCW46580.1| hypothetical protein EUGRSUZ_K00398 [Eucalyptus grandis]
Length=341

 Score =   297 bits (761),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 166/335 (50%), Positives = 217/335 (65%), Gaps = 25/335 (7%)
 Frame = +2

Query  65    MTKVVAYTIAA----AFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARR  232
             M K V Y +AA    AF+I       + + +K  +    +RRLG    + P FDP+V   
Sbjct  1     MAKAVVYALAATALMAFIIF------SPMGQKGRNHLRSNRRLGII-LSHPTFDPLVTEL  53

Query  233   KGLANPEKSDDDD--------------RYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDV  370
             +     E +D +D               Y  D+G L+T  RL+ LFP+LD  P DG V  
Sbjct  54    ERRREGEHADREDPPASTEIGSPISRNEYLTDEGELNTTSRLLFLFPLLDDAPKDGAVSF  113

Query  371   KELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGW  550
             KELE WN  QA  RL Y+TQ+ L+  DKDGDG+ISF EY PQF+DEDIERN + HG+AGW
Sbjct  114   KELEAWNVGQAHERLAYQTQKELAFFDKDGDGAISFREYLPQFSDEDIERNGSAHGEAGW  173

Query  551   WMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEF  730
             W  +F NADVD+NGTL+  EF DFLHPEDS N  I +WLL +KL+QMD + D KL+L EF
Sbjct  174   WKEKFLNADVDQNGTLSFNEFMDFLHPEDSNNTEIWKWLLWQKLKQMDYDGDGKLNLDEF  233

Query  731   ERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYAR  910
             +   Y+ YK Y EF+  G  VP+ E+ FT LD + +  L VEE+ PI HYL+PGELS+A+
Sbjct  234   KDHIYDIYKNYVEFDAHGGHVPTPEQKFTNLDVNNNKLLEVEEMIPILHYLNPGELSHAK  293

Query  911   YYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             YYT +LIREADDN DGKL+L+EM+NH+ +FY +++
Sbjct  294   YYTAFLIREADDNKDGKLSLEEMLNHEYMFYASLF  328



>ref|XP_010433306.1| PREDICTED: calumenin-B-like [Camelina sativa]
Length=334

 Score =   296 bits (758),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 164/349 (47%), Positives = 220/349 (63%), Gaps = 33/349 (9%)
 Frame = +2

Query  65    MTKVVAY---TIAAAFVILLLSQDHNKLFRKDYSPRGL-SRRLGTQGTAPPIFDPIVARR  232
             M KVV Y   T+A  F+IL   +  N+      S  GL S R+G +    P+FDP+V R 
Sbjct  1     MAKVVVYVLLTVAFIFLILFAPRKQNQT----ESIEGLISSRIGRR-LELPVFDPLVTRI  55

Query  233   KGLANPE----------KSDDDD---RYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVK  373
             + L++ +          K D DD    YF  + RL+T +R+  LFP+LD  P DGFV +K
Sbjct  56    ERLSHEKEAGTNTVEAAKEDKDDTFAEYFVQERRLNTTMRIKFLFPLLDASPRDGFVSLK  115

Query  374   ELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWW  553
             EL+ W  QQ  + + YRT   L L+DKD DG I+F EY PQF+ +DIERNE GHG+AGWW
Sbjct  116   ELQTWMMQQTEDNMGYRTANELELQDKDKDGVITFEEYLPQFSKQDIERNEKGHGEAGWW  175

Query  554   MIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFE  733
             M +FKN+D D NG+L++ EF +FLHPEDSRN +I+RW+L E++  MD N D KL   EF 
Sbjct  176   MEKFKNSDFDHNGSLDIEEFNNFLHPEDSRNGDIQRWVLKERMTGMDTNGDGKLEYKEFV  235

Query  734   RGAYETYKTYKEFETSGID-VPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYAR  910
               AY+ YK + +FE    + VP+ +  F  LD DKD FL  +EL+PI HYL PGE+SYA+
Sbjct  236   ENAYKMYKEFAKFEKEEDESVPTPQLLFAELDRDKDRFLVADELRPILHYLQPGEMSYAK  295

Query  911   YYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             YY+T+L  EAD++ DGKL+L+EM++H+            DED   HDEL
Sbjct  296   YYSTFLCHEADEDKDGKLSLEEMLHHEL----------DDEDYFDHDEL  334



>ref|XP_002272030.1| PREDICTED: reticulocalbin-2 [Vitis vinifera]
Length=338

 Score =   286 bits (731),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 154/350 (44%), Positives = 219/350 (63%), Gaps = 34/350 (10%)
 Frame = +2

Query  65    MTKVVA---YTIAAAFVI---LLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVA  226
             M+K V     TIA  F +   L   + HN  +        L+RRLG    A   F+P+V 
Sbjct  1     MSKAVVSGLLTIAFVFFVVFTLATQKGHNNFY--------LARRLGHNRVA---FNPLVE  49

Query  227   RRK-------------GLANPEKSDDDDRY--FNDKGRLDTGLRLMVLFPILDRDPCDGF  361
             + +              L+N   +D +D+Y   +    L+  +RLMVLFP+LD +P DGF
Sbjct  50    KIEEMARETSDHHFLFNLSNIFLNDVEDKYEFVSQVKNLNITMRLMVLFPLLDVEPRDGF  109

Query  362   VDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGD  541
             + +KELE+WN QQAI+RL+YRT + L L D++ DG+I+F EY P+ + + IE N   HG+
Sbjct  110   ISLKELEHWNMQQAIHRLSYRTHKELVLFDQNEDGAITFREYLPKISYQSIENNGMTHGE  169

Query  542   AGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSL  721
             AGWW  QFKNAD D NG L   EF+DFL+P+DS N  I++W+  EK++Q D + D KLS 
Sbjct  170   AGWWEDQFKNADFDNNGALGFEEFKDFLYPKDSDNATIQKWISREKIKQFDHDNDGKLSY  229

Query  722   LEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELS  901
             +EF+   +  YKTY  FE SG+     +E F  LDA+KD +L  EE+KPI HYL PGE +
Sbjct  230   IEFQEQPFNLYKTYVGFENSGLVAVEPKEKFAELDANKDRYLNEEEMKPILHYLHPGESA  289

Query  902   YARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHD  1051
             YA +Y+ YLI EAD+N DG+L+L E++N++ LFY+ +Y  E  +DD++H+
Sbjct  290   YAGFYSKYLIHEADENKDGRLSLQEIINNENLFYNIVY--EGTDDDLHHE  337



>gb|KHN16271.1| 45 kDa calcium-binding protein [Glycine soja]
Length=349

 Score =   286 bits (731),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 153/352 (43%), Positives = 215/352 (61%), Gaps = 24/352 (7%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTA-PPIFDPIVAR----  229
             M+K V Y + A+ V+  +      L +    P   +RR G +     P  DP+V      
Sbjct  1     MSKAVVYILIASLVLFFIFMSPLNLQKPKGRP---NRRFGYKLLERAPNLDPLVTNIEKE  57

Query  230   ----------RKGLANPEKSDDDD------RYFNDKGRLDTGLRLMVLFPILDRDPCDGF  361
                        + L+N + +          +Y    G+L+T LRL++LFP+LDR+P DG 
Sbjct  58    IEKKMYHEPAPRMLSNLDSTTSVSDVIETYQYLTSGGKLNTTLRLIILFPLLDREPKDGV  117

Query  362   VDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGD  541
             +   ELE W TQ+AI RL+Y TQ  L  +DK+GD +ISF EY PQF+++D+E+ E G+G+
Sbjct  118   IGFNELEAWITQRAIERLDYLTQVELDSKDKNGDLAISFKEYLPQFSEKDMEKKEMGYGE  177

Query  542   AGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSL  721
             AGWWM +F+ AD+D N  LN  E +DFLHPEDS+N  + +W+L ++L +MD   D KL+ 
Sbjct  178   AGWWMERFEVADIDHNRLLNFTELKDFLHPEDSKNQEMLKWMLKDRLMRMDNGNDGKLNF  237

Query  722   LEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELS  901
              EFE   Y TY++Y  FE +G  VPS ++ F  LD +KD FL  EEL PI  YL PGE +
Sbjct  238   NEFEGRLYSTYESYMNFEINGGHVPSPKDKFVKLDVNKDKFLSPEELIPILSYLYPGEEA  297

Query  902   YARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             YA+Y+T YL+ EADDN DGKLTL EM++H+  FY+T++ +   E D  HDEL
Sbjct  298   YAKYFTCYLMNEADDNGDGKLTLQEMLDHEFTFYNTVHADGHQESDDDHDEL  349



>gb|KHM99213.1| Reticulocalbin-3 [Glycine soja]
Length=348

 Score =   285 bits (729),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/352 (43%), Positives = 217/352 (62%), Gaps = 25/352 (7%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTA-PPIFDPIVARRKGL  241
             M++ V Y + AA +  +     N     + S   L+RR G +     P FDP+V   + +
Sbjct  1     MSRAVVYILIAAILFFIFRSPLNH----EESKGRLNRRFGYKLLERAPKFDPLVTNIERV  56

Query  242   --------------------ANPEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGF  361
                                 A+   + +  +Y    G+L+T LRL++LFP+LDR+P DG 
Sbjct  57    VENKMYHEPAPRMLSNLDSTASVSDAVETYQYLTSGGKLNTTLRLIILFPLLDREPKDGV  116

Query  362   VDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGD  541
             +D  ELE W +Q+A  RL+Y TQ  L  +DK+ D ++SF EY PQF++ DI + E GHG+
Sbjct  117   IDFNELEAWISQRATERLDYLTQAELDSKDKNRDLAVSFKEYLPQFSEMDIGKKEMGHGE  176

Query  542   AGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSL  721
             AGWWM +F+ AD++ NG LN  E +DFLHPEDS+N  + +W+L ++L++MD   D KL+ 
Sbjct  177   AGWWMERFEVADINHNGLLNFTELKDFLHPEDSKNQEMLKWMLKDRLKRMDNENDGKLNF  236

Query  722   LEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELS  901
              EFE   Y TY++Y +FET+G  V S ++ F  LD +KD FL  EEL PI  YL PGEL+
Sbjct  237   NEFEDHLYSTYESYMDFETNGGHVHSPKDKFVELDVNKDQFLSPEELIPILSYLYPGELA  296

Query  902   YARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             YA+Y+T YL+ EADD+ DGKLTL EM++H+  FY+T++ +   E D  HDEL
Sbjct  297   YAKYFTCYLMNEADDDGDGKLTLQEMLDHEFTFYNTVHADGYQESDDDHDEL  348



>ref|XP_003544051.2| PREDICTED: LOW QUALITY PROTEIN: reticulocalbin-3-like [Glycine 
max]
Length=405

 Score =   286 bits (733),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 153/365 (42%), Positives = 224/365 (61%), Gaps = 25/365 (7%)
 Frame = +2

Query  26    QISIKSHKAMAGKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTA-P  202
              +S+K+  A   KM++ V Y + A  ++  + +        + S   L+RR G +     
Sbjct  45    SLSLKTQXA-PXKMSRAVVYILIATAILFFIFRSP---LNHEESKGRLNRRFGYKLLERA  100

Query  203   PIFDPIVARRKGL--------------------ANPEKSDDDDRYFNDKGRLDTGLRLMV  322
             P FDP+V   + +                    A+   + +  +Y    G+L+T LRL++
Sbjct  101   PKFDPLVTNIERVVENKMYHEPAPRMLSNLDSTASVSDAVETYQYLTSGGKLNTTLRLII  160

Query  323   LFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFT  502
             LFP+LDR+P DG +D  ELE W +Q+A  RL+Y TQ  L  +DK+ D ++SF EY PQF+
Sbjct  161   LFPLLDREPKDGVIDFNELEAWISQRATERLDYLTQAELDSKDKNRDLAVSFKEYLPQFS  220

Query  503   DEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKL  682
             + DI + E GHG+AGWWM +F+ AD++ NG LN  E +DFLHPEDS+N  + +W+L ++L
Sbjct  221   EMDIGKKEMGHGEAGWWMERFEVADINHNGLLNFTELKDFLHPEDSKNQEMLKWMLKDRL  280

Query  683   RQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEEL  862
             ++MD   D KL+  EFE   Y TY++Y +FET+G  V S ++ F  LD +KD FL  EEL
Sbjct  281   KRMDNENDGKLNFNEFEDHLYSTYESYMDFETNGGHVHSPKDKFVELDVNKDQFLSPEEL  340

Query  863   KPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDI  1042
              PI  YL PGEL+YA+Y+T YL+ EADD+ DGKLTL EM++H+  FY+T++ +   E D 
Sbjct  341   IPILSYLYPGELAYAKYFTCYLMNEADDDGDGKLTLQEMLDHEFTFYNTVHADGYQESDD  400

Query  1043  YHDEL  1057
              HDEL
Sbjct  401   DHDEL  405



>ref|XP_007161500.1| hypothetical protein PHAVU_001G074400g [Phaseolus vulgaris]
 gb|ESW33494.1| hypothetical protein PHAVU_001G074400g [Phaseolus vulgaris]
Length=350

 Score =   285 bits (728),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 155/354 (44%), Positives = 218/354 (62%), Gaps = 27/354 (8%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRG-LSRRLGTQGTA-PPIFDPIVAR---  229
             M+K V Y + A  V+L        L     +P+  L+RR G +     P FDP+V     
Sbjct  1     MSKAVVYILIATAVLLYKCLSPLSLG----APKSRLNRRFGYKLLERAPSFDPLVTNNGR  56

Query  230   ---RKGLA---NPEKSDDDD------------RYFNDKGRLDTGLRLMVLFPILDRDPCD  355
                +K +    +P  S + D            +Y    G+L+T LRL++LFP+LDR+P D
Sbjct  57    EVVKKTIPQEPSPRTSSNLDSTTAPVDVAGTYQYLTSGGKLNTTLRLIILFPLLDREPKD  116

Query  356   GFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGH  535
             G V  +ELE W TQ+A +RL+Y TQ  L  +D +GD ++SF EY PQF+ + +E N   H
Sbjct  117   GVVGFEELEAWITQRATDRLDYLTQAELDSKDDNGDLAVSFKEYLPQFSQKHMEENNMLH  176

Query  536   GDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKL  715
             G+AGWW  +F  AD+D NG LN  E RDFLHPEDS+N   ++W+L ++L++MD  KD K+
Sbjct  177   GEAGWWNERFNVADIDHNGLLNFTELRDFLHPEDSQNQETQKWMLRDRLKRMDDEKDGKM  236

Query  716   SLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGE  895
             +  EFE   Y TY++Y  FET+G  VPS ++ F  LD +KD FL  EEL PI  Y+ PGE
Sbjct  237   NFGEFENHVYNTYESYMTFETNGGIVPSPKDKFLQLDVNKDQFLSPEELLPILSYIYPGE  296

Query  896   LSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             ++YA+Y+T YL+ EADDN D +LTL EM++H+T+FY T++ +   E D  HDEL
Sbjct  297   IAYAKYFTCYLMNEADDNGDRQLTLQEMLDHETIFYSTVHADGHQESDDDHDEL  350



>ref|XP_004498505.1| PREDICTED: reticulocalbin-2-like [Cicer arietinum]
Length=355

 Score =   281 bits (720),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 155/360 (43%), Positives = 224/360 (62%), Gaps = 34/360 (9%)
 Frame = +2

Query  65    MTKVVAYTIAAA---FVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTA-PPIFDPIVAR-  229
             M+K V Y+I A    F  ++LS     L+  + S   L+RR G +     PIFDP+V + 
Sbjct  1     MSKAVVYSIIATATLFFFIVLS-----LWNLEESKGSLNRRFGYKILERAPIFDPLVTKI  55

Query  230   ---RKGLANPEKSDDDD--------------------RYFNDKGRLDTGLRLMVLFPILD  340
                R+   + EK++ ++                     Y    G+L+T LR+++LFP+LD
Sbjct  56    ERERQQKIDDEKNNINNVVPRTSLGSTTSVSEVAETYLYLTSGGKLNTTLRIIILFPLLD  115

Query  341   RDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIER  520
             R+P DGFV   EL  W  Q+A+ RL+Y T   L  +DK+GD SIS  EY P  +++DIE+
Sbjct  116   REPKDGFVAFNELGSWINQRALERLDYVTHAELESKDKNGDLSISLREYLPYLSEKDIEK  175

Query  521   NETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVN  700
              E GHG+AGWW+ +F  AD D +G LN  E +DFLHPEDS+N  + +W++ +++++MD +
Sbjct  176   KEMGHGEAGWWIERFDIADSDHSGLLNFTELKDFLHPEDSQNKEMLKWMVRDRIKRMDDH  235

Query  701   K-DQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFH  877
             + D KL+  EFE   Y TY++Y +FETSG DVPS ++ F  LD +KD  L  EEL PI  
Sbjct  236   ETDGKLNFNEFEDHLYSTYESYVDFETSGGDVPSAKDKFADLDVNKDQLLSPEELLPILP  295

Query  878   YLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             YL PGE++YA+YYT YL+ E DDN D KL+L+EM+NH+ +FY+T++ +   E D  HDEL
Sbjct  296   YLYPGEIAYAKYYTCYLMNEGDDNEDKKLSLEEMLNHEFIFYNTVHADGHVESDDDHDEL  355



>ref|XP_007039101.1| Calcium-binding EF hand family protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY23602.1| Calcium-binding EF hand family protein, putative isoform 2 [Theobroma 
cacao]
Length=322

 Score =   280 bits (715),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 151/333 (45%), Positives = 208/333 (62%), Gaps = 43/333 (13%)
 Frame = +2

Query  65    MTKVVAYT-IAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVAR----  229
             M K V YT +A AF+IL +   + +     ++  GLSRRLG +    P FDP+VAR    
Sbjct  1     MAKAVVYTFLATAFIILFVFFQNKR--HGHHTRSGLSRRLGYKA---PHFDPLVARLERS  55

Query  230   --RKGLA---NPE------KSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKE  376
                KGL+   +PE      +  D D +F D G L+T LRLM+LFP+LD  P DG +  KE
Sbjct  56    AEEKGLSYHVDPEHISYVPEVADADEFFGDDGTLNTTLRLMILFPLLDSAPKDGLISAKE  115

Query  377   LEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWM  556
             L  W  QQA++RL++RT + +S  DK+GDG+ISFSEY P F + DI +N   HG+AGWWM
Sbjct  116   LGAWIGQQAMDRLSFRTNKVMSWHDKNGDGAISFSEYLPHFNENDIAKNRKEHGEAGWWM  175

Query  557   IQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFER  736
              QF NAD++ NGTL+  EF++                      +MD + D KL+  EF  
Sbjct  176   EQFNNADLNSNGTLDFNEFKE----------------------RMDDDHDGKLNFKEFLD  213

Query  737   GAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYY  916
              AY  YK+Y EFET+    P+ EE F  LD ++D +L ++EL+PI  YL PGEL YA+YY
Sbjct  214   YAYNIYKSYAEFETAAALAPTAEEKFVELDINEDKYLELDELRPILRYLYPGELFYAKYY  273

Query  917   TTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             T+YLI EADDN DG LT++E++NH+++FY+++Y
Sbjct  274   TSYLIYEADDNKDGNLTMEEILNHESIFYNSLY  306



>gb|AES58744.2| calcium-binding EF-hand protein [Medicago truncatula]
Length=421

 Score =   274 bits (700),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 157/374 (42%), Positives = 220/374 (59%), Gaps = 32/374 (9%)
 Frame = +2

Query  29    ISIKSHKAMAGKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTA-PP  205
             +S+        KM+K V YT+ A   +L+     + L  ++   R  +RR G +     P
Sbjct  49    VSLNLKTKAPYKMSKAVVYTVIATATLLIFIV-LSPLNLEESKGRLNNRRFGYKILERAP  107

Query  206   IFDPIV------------------------ARRKGLANPEKSDDDDR---YFNDKGRLDT  304
              FDP+V                        A R GL +     +      Y    G L+T
Sbjct  108   TFDPLVTKIERESEQKNQQHKNDFDNNKNVAPRTGLGSTTTVSEIKETYEYLTSGGTLNT  167

Query  305   GLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
              LRL++LFP+LDRDP DGFV   ELE W TQ+A+ RL+Y TQ  L  +DK+GD ++SF E
Sbjct  168   TLRLIILFPLLDRDPKDGFVGFNELESWVTQRALERLDYATQVELESKDKNGDLALSFRE  227

Query  485   YFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRW  664
             Y P  +++DIE+    HG+AGW M +F  AD D NG LN  E RDFLHPEDS+N  + +W
Sbjct  228   YLPDLSEKDIEKKNMAHGEAGWLMEKFDVADYDHNGLLNFTELRDFLHPEDSQNKEMLKW  287

Query  665   LLTEKLRQM-DVNKDQKLSLLEFERGAYETYKTYKEFETSG-IDVPSVEETFTLLDADKD  838
             ++ +K + M D   D K++  +FE   Y TY++Y +FET+G  D+P+ ++ F  LD +KD
Sbjct  288   MVNDKFKHMDDYEHDGKINFNQFEDNVYVTYESYVDFETNGEGDIPTAKDKFAELDVNKD  347

Query  839   SFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY-  1015
              FL  EEL PI  Y+ PGEL+YA+YYT+YL+ EADDN D KLTLDEM++H+  F++T++ 
Sbjct  348   QFLSPEELFPIIPYVYPGELAYAKYYTSYLMNEADDNEDRKLTLDEMLDHEFAFFNTVHA  407

Query  1016  DNEKDEDDIYHDEL  1057
             D   + DD  HDEL
Sbjct  408   DGHVEIDDDDHDEL  421



>ref|XP_010267532.1| PREDICTED: reticulocalbin-1 [Nelumbo nucifera]
Length=351

 Score =   268 bits (684),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 148/336 (44%), Positives = 200/336 (60%), Gaps = 26/336 (8%)
 Frame = +2

Query  65    MTKVVAYTI-AAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVAR----  229
             M K V Y I A  FVI L++       RK      L RRLG +      FDP+VA     
Sbjct  1     MAKAVVYPIWATVFVIFLITSLPP---RKGPEHLRLGRRLGYRHVP---FDPLVAHLEKQ  54

Query  230   --RKGLAN------------PEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVD  367
                KGL++              +  D +   ND+G+L+   RL+VLFP+LD  P DG + 
Sbjct  55    TEEKGLSDWDSPTTWESALFSSEFGDMEELLNDEGKLNITDRLLVLFPLLDTSPDDGLIS  114

Query  368   VKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAG  547
             +KEL  WN QQA +RL+YRT + + +RD + DG IS  E   +F+ E+IE+N+   G AG
Sbjct  115   LKELVDWNVQQATDRLSYRTYKEMEVRDTNWDGVISLKECLYRFSQEEIEKNDMSTGQAG  174

Query  548   WWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLE  727
             W   QF NAD D + +LN  EF DFLHPEDS N  +RRWLL EK++ MD +KD +++  E
Sbjct  175   WLREQFSNADADGDESLNAVEFNDFLHPEDSNNHKVRRWLLREKIKAMDQDKDGRINFKE  234

Query  728   FERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYA  907
             F  GAY   K+Y E E  G + P   E F  LD + D FL  EEL P+ H+L PGE+SYA
Sbjct  235   FSHGAYGIIKSYMELEI-GYEAPGAGEKFAELDVNSDEFLTEEELVPVMHHLQPGEISYA  293

Query  908   RYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             ++Y +YL+ EADD+ DG LTL+EM+ H+ +FY T++
Sbjct  294   KHYASYLMHEADDDRDGSLTLEEMLRHEFVFYGTVF  329



>ref|XP_009383122.1| PREDICTED: calumenin-B [Musa acuminata subsp. malaccensis]
Length=361

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 154/349 (44%), Positives = 206/349 (59%), Gaps = 39/349 (11%)
 Frame = +2

Query  74    VVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPP---IFDPIV------A  226
             VVAY + A  +++LLS      F +  +P   SR   ++  A P    FDP++      A
Sbjct  6     VVAYLLLAVPILILLS------FSR--APHMASRHPRSRRLAHPHHVAFDPLLVQIERRA  57

Query  227   RRKGLANPE----KSDDD----------------DRYFNDKGRLDTGLRLMVLFPILDRD  346
               +GL + E    K DD                 D YF + GRL+   RL  LFP+LDR 
Sbjct  58    EERGLLDVETFKRKLDDIWARQDWSKMAEEIGILDEYFGEDGRLNLTERLAYLFPLLDRL  117

Query  347   PCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNE  526
             P DG +   EL+ WN +QA++RL Y T+R + L D DGDG+++  E+     DE+  RN 
Sbjct  118   PQDGGISRYELDVWNQRQALDRLIYHTERKMKLHDHDGDGAVTLPEFLSYLPDEETARNS  177

Query  527   TGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKD  706
               HG+ GWW  QF NAD D NG L+ +EF DFLHPEDS N  I+ WLL EKLR+MD NKD
Sbjct  178   KEHGEPGWWKEQFSNADRDGNGFLSAFEFNDFLHPEDSTNPKIQLWLLKEKLREMDENKD  237

Query  707   QKLSLLEFERGAYETYKTYKEFETSGIDVPS--VEETFTLLDADKDSFLRVEELKPIFHY  880
              KLS +EF   A E Y+TY +FE   +      VE+ F  LD ++D FL  EELKPI H 
Sbjct  238   GKLSFVEFGGRAQEIYQTYADFEEDDLRHHELDVEDEFRKLDINRDRFLTAEELKPIIHR  297

Query  881   LDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEK  1027
             L PGELS ++YYT YL+ +ADD+ DGKLTL+EM++H   FY T+++ ++
Sbjct  298   LYPGELSQSKYYTKYLLHKADDDGDGKLTLEEMVHHQYAFYSTVFEEQQ  346



>ref|XP_003588493.1| Calumenin-B [Medicago truncatula]
Length=681

 Score =   270 bits (690),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 149/348 (43%), Positives = 209/348 (60%), Gaps = 31/348 (9%)
 Frame = +2

Query  62    KMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTA-PPIFDPIV-----  223
             KM+K V YT+ A   +L+     + L  ++   R  +RR G +     P FDP+V     
Sbjct  60    KMSKAVVYTVIATATLLIFIV-LSPLNLEESKGRLNNRRFGYKILERAPTFDPLVTKIER  118

Query  224   -------------------ARRKGLANPEKSDDDDR---YFNDKGRLDTGLRLMVLFPIL  337
                                A R GL +     +      Y    G L+T LRL++LFP+L
Sbjct  119   ESEQKNQQHKNDFDNNKNVAPRTGLGSTTTVSEIKETYEYLTSGGTLNTTLRLIILFPLL  178

Query  338   DRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIE  517
             DRDP DGFV   ELE W TQ+A+ RL+Y TQ  L  +DK+GD ++SF EY P  +++DIE
Sbjct  179   DRDPKDGFVGFNELESWVTQRALERLDYATQVELESKDKNGDLALSFREYLPDLSEKDIE  238

Query  518   RNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQM-D  694
             +    HG+AGW M +F  AD D NG LN  E RDFLHPEDS+N  + +W++ +K + M D
Sbjct  239   KKNMAHGEAGWLMEKFDVADYDHNGLLNFTELRDFLHPEDSQNKEMLKWMVNDKFKHMDD  298

Query  695   VNKDQKLSLLEFERGAYETYKTYKEFETSG-IDVPSVEETFTLLDADKDSFLRVEELKPI  871
                D K++  +FE   Y TY++Y +FET+G  D+P+ ++ F  LD +KD FL  EEL PI
Sbjct  299   YEHDGKINFNQFEDNVYVTYESYVDFETNGEGDIPTAKDKFAELDVNKDQFLSPEELFPI  358

Query  872   FHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
               Y+ PGEL+YA+YYT+YL+ EADDN D KLTLDEM++H+  F++T++
Sbjct  359   IPYVYPGELAYAKYYTSYLMNEADDNEDRKLTLDEMLDHEFAFFNTVH  406



>ref|XP_004146270.1| PREDICTED: calumenin-B-like [Cucumis sativus]
Length=357

 Score =   259 bits (661),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 150/308 (49%), Positives = 193/308 (63%), Gaps = 20/308 (6%)
 Frame = +2

Query  53   MAGKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARR  232
            M   +  V+  T+ A F ++  S  HN+      S +  +RRLG +    P FDP+V   
Sbjct  1    MGKAVVYVLTATVFALFFLISPSNFHNR------SHQQATRRLGFK-FPNPTFDPLVTEM  53

Query  233  KGLANPEKSD-------------DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVK  373
            + LA  E+ +             D  R + D+GRL+  LRL+VLFP+LD  P DG +  +
Sbjct  54   ERLAAEERGENAIGVDNQNHKIIDSYRNYYDEGRLNISLRLLVLFPLLDNSPKDGVISYE  113

Query  374  ELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWW  553
            EL  W   QAI RLNYRT + L   DK+GD +ISF EY PQFT+EDI RNETG+G+AGWW
Sbjct  114  ELSDWINGQAIERLNYRTTKQLEFYDKNGDDAISFHEYLPQFTEEDIARNETGYGEAGWW  173

Query  554  MIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFE  733
              QF NADVD NG L   E +DFLHPEDS N  I+ WLL +K+++MD +KD KL+  EF 
Sbjct  174  RKQFTNADVDNNGLLYFDELKDFLHPEDSSNYRIQNWLLAQKMKRMDHDKDGKLNFDEFL  233

Query  734  RGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARY  913
               Y+ YK Y EFET G DVPS EE F  LD D+D  L  EEL+P+F YL PGE+SYA++
Sbjct  234  HHTYDIYKNYIEFETQGEDVPSAEEKFDELDLDEDEVLSTEELRPLFQYLHPGEVSYAQH  293

Query  914  YTTYLIRE  937
            YT++LI E
Sbjct  294  YTSHLINE  301



>ref|XP_010671407.1| PREDICTED: calumenin-A [Beta vulgaris subsp. vulgaris]
Length=357

 Score =   258 bits (660),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 147/349 (42%), Positives = 205/349 (59%), Gaps = 41/349 (12%)
 Frame = +2

Query  65    MTKVVA-YTI-AAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIV-----  223
             MTKVV  YTI   AFV+L+L    +K      S +G      + G     FDP+V     
Sbjct  1     MTKVVVIYTILTTAFVVLILLPPSSK------SHKGNRHIRLSNGVY---FDPLVMDIEH  51

Query  224   -ARRKGL-------ANPEKSDDDDRY----------------FNDKGRLDTGLRLMVLFP  331
                 KGL        NP  +     Y                F + G+L+  LRL  LFP
Sbjct  52    KVEEKGLNVNIYDDINPHINHASSHYVHEVIEEEVEEANKVYFGNYGKLNLTLRLKTLFP  111

Query  332   ILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDED  511
             ++D    DG+V+ +ELE WN  Q+   L Y T++ L   DK+ DG +SF E+FPQF+DED
Sbjct  112   MIDNLHIDGYVEFRELEAWNIMQSNMNLEYATRKELKFHDKNKDGLVSFHEFFPQFSDED  171

Query  512   IERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDS-RNDNIRRWLLTEKLRQ  688
             I++N+ GHG+ GWWM QF NAD +++G L   E +DFLHPE+S  N  ++ W + EK+R+
Sbjct  172   IKKNKMGHGETGWWMEQFMNADANQDGKLCFEELKDFLHPEESTENAKVQEWTIREKIRR  231

Query  689   MDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKP  868
             +D++KD KLSL EF   AY+T+KTY +F  +   VPS E  F+ LD +KD  L ++ELKP
Sbjct  232   LDLDKDGKLSLQEFCDNAYDTFKTYYQFSFAHNQVPSQELLFSNLDLNKDGLLTIQELKP  291

Query  869   IFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             I   L PG L +A YY+TYL+ E DDN+D  LT++E++NH+  FY ++Y
Sbjct  292   IKQLLFPGVLDHASYYSTYLMNEVDDNHDSLLTIEEILNHEDKFYKSVY  340



>ref|XP_008810466.1| PREDICTED: calumenin-B [Phoenix dactylifera]
Length=436

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 154/358 (43%), Positives = 203/358 (57%), Gaps = 39/358 (11%)
 Frame = +2

Query  41    SHKAMAGKMTK--VVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFD  214
             ++ A AGKM K  VV   +A AFVILL         +K    R   RRL     +   FD
Sbjct  64    ANTAAAGKMVKPGVVYLLLAIAFVILLSFSPTPHASQK----RRHGRRLAHHHAS---FD  116

Query  215   PIV------ARRKGLANPEKSDD------DDR-------------YFNDKGRLDTGLRLM  319
             P+V      A  +GL +P+   +      DDR             YF ++GRL+   RL 
Sbjct  117   PLVDKLERRAEEQGLLDPDTFQEKLNAIFDDRDWSKVPEFGVFEEYFGEEGRLNVTERLT  176

Query  320   VLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQF  499
              LFP+LDR P DG +  +ELE WN +QA++RL Y T+R + L DKDGDG+++  E+    
Sbjct  177   YLFPLLDRYPEDGTISFQELEVWNRRQALDRLIYSTERQIKLHDKDGDGAVTLEEFLSHL  236

Query  500   TDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEK  679
             + E+I+ +    G  GWW  QF NAD D +G+L+  EFRDFLHPEDSRN  I+ WL  EK
Sbjct  237   SKEEIDWDNKERGKGGWWKEQFLNADKDGSGSLDSTEFRDFLHPEDSRNPAIQLWLQKEK  296

Query  680   LRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPS-----VEETFTLLDADKDSF  844
             LR+MD N+D KLS +EF       Y ++   ET G D         +  F  LD +KD  
Sbjct  297   LREMDQNEDGKLSFVEFRDRLDGIYLSFASSETDGADDSKHHQDYAKRKFGELDVNKDKV  356

Query  845   LRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYD  1018
             L  EELKPI H+L PGE SYA ++T YL+ EADD+ DGKLTL EM+NH   FY  +++
Sbjct  357   LTAEELKPIIHHLQPGEFSYAMHFTKYLMHEADDDRDGKLTLKEMLNHHQAFYSAVFE  414



>ref|XP_010934862.1| PREDICTED: calumenin-B [Elaeis guineensis]
Length=362

 Score =   243 bits (620),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 144/343 (42%), Positives = 190/343 (55%), Gaps = 37/343 (11%)
 Frame = +2

Query  74    VVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIV------ARRK  235
             VV   +  AFVILL         +K    R   RRL     +   FDP+V      A  +
Sbjct  6     VVYLLLVIAFVILLSFSRTPHASQK----RQHGRRLAHHHAS---FDPLVDKLERRAEER  58

Query  236   GLANPEKSD--------DDDR-----------YFNDKGRLDTGLRLMVLFPILDRDPCDG  358
             GL + +           D +R           YF ++GR +   RLM LFP+LDR P DG
Sbjct  59    GLLDTDTFQEMLHAFFHDQNRSEVPEIGVFEEYFGEEGRFNVTERLMSLFPLLDRYPQDG  118

Query  359   FVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHG  538
              +  +ELE+WN +QA++RL Y T R + L DKD DG+++  E+      E+I+ +   HG
Sbjct  119   KISFQELEFWNRKQALDRLIYSTNRQMKLHDKDRDGAVTLEEFLSYLPKEEIDWDNKDHG  178

Query  539   DAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLS  718
               GWW +QF NAD D +G+L+  EFR+FLHPEDSRN  I+ WL  EKLR+MD N D KLS
Sbjct  179   KPGWWKVQFLNADKDASGSLDSEEFREFLHPEDSRNPAIQLWLQQEKLREMDQNGDGKLS  238

Query  719   LLEFERGAYETYKTYKEFETSGIDVPS-----VEETFTLLDADKDSFLRVEELKPIFHYL  883
              +EF     + Y  +   ET   D         E  F  LD +KD FL  +ELKPI H+L
Sbjct  239   FMEFHDRLNDMYLGFASSETDVADDSRHHQDYAERKFGELDVNKDGFLTADELKPIIHHL  298

Query  884   DPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTI  1012
              PGE SYA ++T YL+READD+ DGKLTL EM++H   FY  +
Sbjct  299   QPGEFSYATHFTKYLMREADDDKDGKLTLKEMLDHYQAFYSAV  341



>ref|XP_010091199.1| hypothetical protein L484_000423 [Morus notabilis]
 gb|EXC36788.1| hypothetical protein L484_000423 [Morus notabilis]
Length=178

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 136/178 (76%), Gaps = 3/178 (2%)
 Frame = +2

Query  530   GHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQ  709
             GHG+AGWW  QF NADVDRNG+L+  EF+DFLHPEDS N+ I++WLLTEKL +MD +KD 
Sbjct  2     GHGEAGWWKQQFVNADVDRNGSLSFDEFKDFLHPEDSDNEEIKKWLLTEKLERMDYDKDG  61

Query  710   KLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDP  889
             KLS +EF    Y+ YK Y E+ET+G  VP  EE F+ LD DKD FL VEEL PI  YL P
Sbjct  62    KLSFVEFCDHTYDIYKNYVEYETAGRRVPKPEEKFSELDLDKDRFLTVEELIPILGYLHP  121

Query  890   GELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYD--NEKDEDDIYHDEL  1057
             GELSYA+YY +YLI EADDN DG LTL+EM+NH+ +FY T+YD  +E  EDD+ HDEL
Sbjct  122   GELSYAKYYASYLIHEADDNKDGNLTLEEMLNHEYIFYSTVYDDSHENSEDDL-HDEL  178



>ref|XP_010109239.1| hypothetical protein L484_011861 [Morus notabilis]
 gb|EXC21419.1| hypothetical protein L484_011861 [Morus notabilis]
Length=178

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +2

Query  530   GHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQ  709
             GHG+AGWW  QF NAD  RNG+L+  EF+DFLHPEDS N+ I++WLLTEKL +MD +KD 
Sbjct  2     GHGEAGWWKQQFVNADDKRNGSLSFDEFKDFLHPEDSDNEEIKKWLLTEKLERMDYDKDG  61

Query  710   KLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDP  889
             KLS +EF    Y+ YK Y E+ET+G  VP  EE F+ LD DKD FL VEEL PI  YL P
Sbjct  62    KLSFVEFCDHTYDIYKNYVEYETAGRRVPKPEEKFSELDLDKDRFLTVEELIPILGYLHP  121

Query  890   GELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             GELSYA+YY +YLI EADDN DG LTL+EM+NH+ +FY T+Y
Sbjct  122   GELSYAKYYASYLIHEADDNKDGNLTLEEMLNHEYIFYSTVY  163



>ref|XP_001782563.1| predicted protein [Physcomitrella patens]
 gb|EDQ52638.1| predicted protein [Physcomitrella patens]
Length=390

 Score =   203 bits (517),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 131/377 (35%), Positives = 194/377 (51%), Gaps = 57/377 (15%)
 Frame = +2

Query  89    IAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTA-------PPIFDPIVA---RRK-  235
             + A   ++L+S D   L  + +      +R+  +          P  FDPIVA   RRK 
Sbjct  16    VVAFMTLVLVSHDPANLHSRSHRRTLPGKRIKVRTVHHDKKHHDPVAFDPIVAEFERRKE  75

Query  236   ------------------------------GLANPEKSDDD----DRYFNDKGRLDTGLR  313
                                           GL +P + D D    + Y ND+ + +   R
Sbjct  76    DRAWEKQYFEDQYKKWGEQAQNNEGVFHHEGLLDPHEVDPDFEDPEEYLNDEDQFNITHR  135

Query  314   LMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFP  493
             L VLFP+LD +P D FV + EL+ W+  Q    + +R+ R +   DK+ DG ISF EY P
Sbjct  136   LAVLFPLLDVNPRDDFVSLIELQEWHLVQGRKAMQHRSDREMEANDKNHDGLISFEEYLP  195

Query  494   QFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLT  673
               T+E+  +N T  G++GW+  QF+  D D++G LN  EF DFLHP+DS N  + +W   
Sbjct  196   HLTEEERGQNNTEFGESGWYKEQFEVCDRDKDGLLNSTEFNDFLHPDDSNNPRVLQWCRM  255

Query  674   EKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGID-VPSVEET--------FTLLD  826
             E++R  D NKD K++  EF  G ++  +   E +T  +     +EE         F+ +D
Sbjct  256   EQIRTHDTNKDGKINWDEFHHGMFDHLR--DEHDTEHLHPAEQLEEKKQVQSKHFFSEID  313

Query  827   ADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYD  1006
              +KD +L  +E+ P+   L PGEL YA+  + YL++EAD+N DG+LTLDEM+NH  +FY 
Sbjct  314   RNKDGYLTEDEIAPLMEKLRPGELYYAKQQSEYLLQEADENRDGRLTLDEMLNHPYIFYS  373

Query  1007  TIYDNEKDEDDIYHDEL  1057
             T YD E + D   HDE 
Sbjct  374   TAYD-EDEFDYSTHDEF  389



>ref|XP_007223340.1| hypothetical protein PRUPE_ppa007408mg [Prunus persica]
 gb|EMJ24539.1| hypothetical protein PRUPE_ppa007408mg [Prunus persica]
Length=369

 Score =   201 bits (511),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 133/375 (35%), Positives = 200/375 (53%), Gaps = 47/375 (13%)
 Frame = +2

Query  53    MAGKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGT-APPI-------  208
             MA     V+ Y   A  ++LL+S       +K  S R    +L +  T APP+       
Sbjct  1     MARASVSVIIYITIAVLILLLISHSP----KKGGSQRHRRLKLRSNFTFAPPLHHHNPIP  56

Query  209   FDPIVA---RR------------------KGLANPEKSD--DDDRYFNDKGRLDTGLRLM  319
             FDP+VA   RR                     + PE  D  + + Y ND+ R +   RL+
Sbjct  57    FDPLVADIERRLEDRKWEQQHFDLNDSAPAAESQPEWEDFMNAEDYLNDEERFNVTNRLL  116

Query  320   VLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQF  499
             +LFP +D DP DGF+   EL  WN +QA   + +RTQR + L DK+ DG +SF+EY P  
Sbjct  117   LLFPKVDVDPADGFITEDELTQWNLKQAQKEVLHRTQRDMELHDKNRDGFVSFAEYQPPS  176

Query  500   TDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTE  676
               ++ + N  G+ D GWW  +  NA D D +G LN+ EF DFLHP DS+N  + +WL  E
Sbjct  177   WVQNADNNSFGY-DMGWWKEEHFNASDADGDGLLNITEFNDFLHPADSKNPKLLQWLCKE  235

Query  677   KLRQMDVNKDQKLSLLEFERGAYETYKTYKE--------FETSGIDVPSVEETFTLLDAD  832
             ++R+ D +KD+K++  EF  G ++  + Y+E        F+ S ++ P+    F  LD D
Sbjct  236   EVRERDTDKDEKINFKEFFHGLFDLVRNYEEENHNSSHQFDDS-MEAPA-RNLFAQLDKD  293

Query  833   KDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTI  1012
              D +L   EL PI   + P E  YA+    Y+I +AD + DG+LTL EM+ +  +FY  I
Sbjct  294   GDGYLSDAELLPIIGKIHPSEHYYAKQQADYIISQADTDKDGRLTLTEMIENPYVFYSAI  353

Query  1013  YDNEKDEDDIYHDEL  1057
             ++++++ED  +HDE 
Sbjct  354   FNDDEEEDYEFHDEF  368



>ref|XP_004297713.1| PREDICTED: calumenin-B-like [Fragaria vesca subsp. vesca]
Length=364

 Score =   199 bits (506),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 130/363 (36%), Positives = 190/363 (52%), Gaps = 36/363 (10%)
 Frame = +2

Query  68    TKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLG---TQGTAPPIFDPIVA---R  229
               V+ Y   A  V+LL+SQ   K     +  R L  R          P  FDP+VA   R
Sbjct  4     ASVLIYITVALLVLLLISQSPKKS-GNHHRHRRLKLRSNFTFAHSRNPIPFDPLVADIER  62

Query  230   RK-----------------GLANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPC  352
             R+                   + PE  D  D + Y ND+ + +   RL++LFP +D +P 
Sbjct  63    RREDRKWEKEHLDLDSAPAAESQPEWEDFMDAEDYLNDEDKFNVTNRLVLLFPKVDVEPV  122

Query  353   DGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETG  532
             DGF+   EL  WN  QA   + +RTQR + L DK+GDG +SF EY P    ++ + N  G
Sbjct  123   DGFITEHELTLWNLNQAQREVLHRTQRDMELHDKNGDGFVSFQEYQPPSWVQNADNNSFG  182

Query  533   HGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQ  709
             + D GWW  +  NA D D +G LNL EF DFLHP DS+N  + +WL  E++R+ D +KD 
Sbjct  183   Y-DMGWWKEEHFNASDADGDGLLNLTEFNDFLHPADSKNPKLLQWLCKEEVRERDTDKDG  241

Query  710   KLSLLEFERGAYETYKTYKEFETSG-------IDVPSVEETFTLLDADKDSFLRVEELKP  868
             K++  EF  G ++  + Y E + +        ++ P+ +  F  LD D D +L   EL P
Sbjct  242   KVNFKEFFHGLFDLVRNYDEEDHNATHQSDDLMEAPA-KTLFAQLDKDGDGYLSDAELLP  300

Query  869   IFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYH  1048
             I   + P E  YA+    Y+I +AD + DG+L+L EM+ +  +FY  I+++E DED  +H
Sbjct  301   IIGKIHPSEHYYAKQQADYIISQADTDKDGRLSLSEMIENPYVFYSAIFNDEDDEDYGFH  360

Query  1049  DEL  1057
             DE 
Sbjct  361   DEF  363



>ref|XP_008221087.1| PREDICTED: calumenin [Prunus mume]
Length=369

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 132/375 (35%), Positives = 199/375 (53%), Gaps = 47/375 (13%)
 Frame = +2

Query  53    MAGKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGT-APPI-------  208
             MA     V+ Y   A  ++LL+S       +K  S R    +L +  T APP+       
Sbjct  1     MARPSVSVIIYITIAVLILLLISHSP----KKGGSQRHRRLKLRSNFTFAPPLHHHNPIP  56

Query  209   FDPIVA---RR------------------KGLANPEKSD--DDDRYFNDKGRLDTGLRLM  319
             FDP+VA   RR                     + PE  D  + + Y ND+ R +   RL+
Sbjct  57    FDPLVADIERRLEDRKWEQQHFDLNDSAPAAESQPEWEDFMNAEDYLNDEERFNVTNRLL  116

Query  320   VLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQF  499
             +LFP +D DP DGF+   EL  WN +QA   + +RTQR + L DK+ DG +SF+EY P  
Sbjct  117   LLFPKVDVDPADGFITEDELTQWNLKQAQKEVLHRTQRDMELHDKNRDGFVSFAEYQPPS  176

Query  500   TDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTE  676
               ++ + N  G+ D GWW  +  NA D D +G LN+ EF DFLHP DS+N  + +WL  E
Sbjct  177   WVQNADNNSFGY-DMGWWKEEHFNASDADGDGLLNITEFNDFLHPADSKNPKLLQWLCKE  235

Query  677   KLRQMDVNKDQKLSLLEFERGAYETYKTYKE--------FETSGIDVPSVEETFTLLDAD  832
             ++R+ D +KD+K++  EF  G ++  + Y+E        F+ S ++ P+    F  LD D
Sbjct  236   EVRERDTDKDEKINFKEFFHGLFDLVRNYEEENHNSSHQFDDS-MEAPA-RNLFAQLDKD  293

Query  833   KDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTI  1012
              D +L   EL PI   + P E  YA+    Y+  +AD + DG+LTL EM+ +  +FY  I
Sbjct  294   GDGYLSDAELLPIIGKIHPSEHYYAKQQADYITSQADTDKDGRLTLTEMIENPYVFYSAI  353

Query  1013  YDNEKDEDDIYHDEL  1057
             ++++++ED  +HDE 
Sbjct  354   FNDDEEEDYEFHDEF  368



>ref|XP_002970407.1| hypothetical protein SELMODRAFT_93701 [Selaginella moellendorffii]
 gb|EFJ28537.1| hypothetical protein SELMODRAFT_93701 [Selaginella moellendorffii]
Length=380

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 133/364 (37%), Positives = 176/364 (48%), Gaps = 56/364 (15%)
 Frame = +2

Query  89    IAAAFVILLLSQDHNKLF---RKDYSPRGLSRRLGTQGTAPP----------IFDPIVAR  229
             + A+ V  LL      LF   +KD    GL RRL  + T              FDP+VAR
Sbjct  2     VRASIVYTLLVLGFLSLFIFSKKDPRRHGLGRRLIVRSTLASKANVSHHESVAFDPVVAR  61

Query  230   RKGL-----------------------------------ANPEKSD----DDDRYFNDKG  292
              + L                                     P   D    D+D Y ND+ 
Sbjct  62    LEWLRENRDWERDHFQELYKSWNETGATHDGQHHAQGHEEQPSHWDGHEGDEDDYLNDEH  121

Query  293   RLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSI  472
             + +   RL +LFP+LD DP D  V + EL+ W+ QQA      RT R   LRD++ DG +
Sbjct  122   QFNISHRLELLFPLLDTDPRDNVVSLGELQDWHVQQARKLSKQRTDREFELRDRNKDGLV  181

Query  473   SFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDN  652
             S  +Y P  + E +    T HG+ GWW   F  AD + +G LN  EF DFLHPEDSRN  
Sbjct  182   SLLDYLPHLSAEALVNASTDHGEPGWWKEHFDMADANGDGFLNHTEFNDFLHPEDSRNPK  241

Query  653   IRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE---FETSGIDVPSVEETFTLL  823
             +  WL  E++R+ D +KD KLSL EF+   Y+  + Y E       G DV    + F  L
Sbjct  242   LHHWLRREQIRESDHDKDGKLSLDEFDH-VYDVLRYYGEDLSHLHQGHDVTDRRDKFKEL  300

Query  824   DADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFY  1003
             D + D FL  +EL+PI   L PGE  YAR    YL+++AD+N DG LTL EM+ H  +FY
Sbjct  301   DRNMDGFLTEDELEPIMGKLHPGESFYARQQAEYLVQQADENKDGVLTLHEMLEHPYVFY  360

Query  1004  DTIY  1015
              T +
Sbjct  361   STAF  364



>ref|XP_004497251.1| PREDICTED: calumenin-like [Cicer arietinum]
Length=368

 Score =   199 bits (505),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 127/368 (35%), Positives = 193/368 (52%), Gaps = 40/368 (11%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRR---------LGTQGTAPPIFDP  217
             +  V+AYT  A  ++L LS  H+ L   ++S      R         L      P  FDP
Sbjct  3     LGSVLAYTFIAVVILLFLSS-HSPLNNYNHSDSSHRHRRLKLRSNFTLSPSHHQPVPFDP  61

Query  218   IVARRK------------------GLANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPIL  337
             ++A  +                    + PE  D  + + + ND+ + +   RL +LFP +
Sbjct  62    LLAELERHREDKQWEQQHSPSAPAHESQPEWEDFMNAEDFINDEDKFNVTSRLFLLFPKI  121

Query  338   DRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIE  517
             D DP D F+ + EL +WN QQA   + +R+QR + L DK+ DG +SFSEY P    +  +
Sbjct  122   DVDPTDSFISLHELTHWNLQQAHREVLHRSQREMELHDKNHDGFVSFSEYDPPSWVKSAD  181

Query  518   RNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMD  694
              +  G+ D GWW  +  NA D D +G LNL EF DFLHP DS N  +++WL  E++R+ D
Sbjct  182   NDSFGY-DMGWWKEEHFNASDADGDGVLNLTEFNDFLHPADSTNRKLQQWLCREEIRERD  240

Query  695   VNKDQKLSLLEFERGAYETYKTYKE-------FETSGIDVPSVEETFTLLDADKDSFLRV  853
              ++D K++  EF  G ++  + Y E          + +DVP+  + F  LD D D +L  
Sbjct  241   TDRDGKVNFKEFFHGLFDLVRNYDEESHNDSHHSDNSMDVPA-RKLFAQLDQDGDGYLSD  299

Query  854   EELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDE  1033
              EL PI   L P E  YA+    Y+I +AD + DG+LTL EM+ +  +FY  I+++++DE
Sbjct  300   IELLPIIGKLHPSEHYYAKQQAEYIISQADVDKDGRLTLPEMIENPYVFYSAIFNDDEDE  359

Query  1034  DDIYHDEL  1057
              + YHDE 
Sbjct  360   YNDYHDEF  367



>gb|KEH44432.1| calcium-binding EF hand-like protein [Medicago truncatula]
Length=369

 Score =   198 bits (504),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 130/368 (35%), Positives = 192/368 (52%), Gaps = 39/368 (11%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQ-----DHNKLFR----KDYSPRGLSRRLGTQGTAPPIFDP  217
             +  V+ YTI A  V+  LS      +H+   R    K  S   LS         P  FDP
Sbjct  3     LGSVLIYTILALIVLFFLSSHSPFNNHHSSHRHRRLKLRSNFTLSPSRSHSSHQPVPFDP  62

Query  218   IVA-------------RRKGLANPEKSDDD-------DRYFNDKGRLDTGLRLMVLFPIL  337
             +VA             +    A P +S  +       + + ND+ + +   RL++LFP +
Sbjct  63    LVAELERHREDKQWEQQHIQHAPPHESQPEWEDFMNAEDFINDEDKFNVTSRLLLLFPKI  122

Query  338   DRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIE  517
             D DP D FVD+ EL  WN QQA   + +R+QR + L DK+ DG +SFSEY P    +  +
Sbjct  123   DVDPADQFVDLHELTMWNLQQAHREVLHRSQREMELHDKNHDGFVSFSEYDPPSWVKSAD  182

Query  518   RNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMD  694
             +   G+ D GWW  +  NA D D +G LNL EF DFLHP DS +  +++WL  E++R+ D
Sbjct  183   KESFGY-DMGWWKEEHFNASDADGDGVLNLTEFNDFLHPADSNSTKLQQWLCKEEIRERD  241

Query  695   VNKDQKLSLLEFERGAYETYKTYKE-------FETSGIDVPSVEETFTLLDADKDSFLRV  853
              ++D K++  EF  G ++  + Y E          + +D P+  + F  LD D D  L  
Sbjct  242   SDRDGKVNFKEFFHGLFDLVRNYDEESHNDSHHSDNSLDAPA-RKLFAQLDQDGDGLLSD  300

Query  854   EELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDE  1033
              EL PI   L P E  YA+  + Y+I +AD N DG+LTL EM+ +  +FY  I+++++DE
Sbjct  301   IELLPIIGKLHPSEHYYAKQQSEYIISQADVNKDGRLTLPEMIENPYVFYSAIFNDDEDE  360

Query  1034  DDIYHDEL  1057
              + YHDE 
Sbjct  361   YNDYHDEF  368



>ref|XP_002978486.1| hypothetical protein SELMODRAFT_443827 [Selaginella moellendorffii]
 gb|EFJ20472.1| hypothetical protein SELMODRAFT_443827 [Selaginella moellendorffii]
Length=380

 Score =   198 bits (504),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 132/364 (36%), Positives = 176/364 (48%), Gaps = 56/364 (15%)
 Frame = +2

Query  89    IAAAFVILLLSQDHNKLF---RKDYSPRGLSRRLGTQGTAPP----------IFDPIVAR  229
             + A+ V  LL      LF   +KD    GL RRL  + T              FDP+VAR
Sbjct  2     VRASIVYTLLVLGFLSLFIFSKKDPRRHGLGRRLIVRSTLASKANASHHESVAFDPVVAR  61

Query  230   RKGL-----------------------------------ANPEKSD----DDDRYFNDKG  292
              + L                                     P   D    D+D Y ND+ 
Sbjct  62    LEWLRENRDWERDHFQELYKSWNETGATHDGQHHAQGHEEQPSHWDGHEGDEDDYLNDEH  121

Query  293   RLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSI  472
             + +   RL +LFP+LD DP D  V + EL+ W+ QQA      RT R   +RD++ DG +
Sbjct  122   QFNISHRLELLFPLLDTDPRDNVVSLGELQDWHVQQARKLSKQRTDREFEMRDRNKDGLV  181

Query  473   SFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDN  652
             S  +Y P  + E +    T HG+ GWW   F  AD + +G LN  EF DFLHPEDSRN  
Sbjct  182   SLLDYLPHLSAEALVNASTDHGEPGWWKEHFDMADANGDGFLNHTEFNDFLHPEDSRNPK  241

Query  653   IRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE---FETSGIDVPSVEETFTLL  823
             +  WL  E++R+ D +KD KLSL EF+   Y+  + Y E       G DV    + F  L
Sbjct  242   LHHWLRREQIRESDHDKDGKLSLDEFDH-VYDVLRYYGEDLSHLHQGHDVTDRRDKFKEL  300

Query  824   DADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFY  1003
             D + D FL  +EL+PI   L PGE  YAR    YL+++AD+N DG LTL EM+ H  +FY
Sbjct  301   DRNMDGFLTEDELEPIMGKLHPGESFYARQQAEYLVQQADENKDGVLTLHEMLEHPYVFY  360

Query  1004  DTIY  1015
              T +
Sbjct  361   STAF  364



>ref|XP_004169833.1| PREDICTED: calumenin-B-like, partial [Cucumis sativus]
Length=370

 Score =   197 bits (501),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 119/275 (43%), Positives = 159/275 (58%), Gaps = 12/275 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y ND  R +   RLM+LFP +D DP DGFV V+EL  WN  QA    
Sbjct  96    SQPEWEDFADAEDYINDDNRFNVTDRLMLLFPKIDVDPVDGFVTVEELTEWNLHQAQRET  155

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR L   DK+ DG +SFSEY P     + + +  G+ D GWW ++  NA DVD +G
Sbjct  156   LHRTQRELETHDKNHDGFVSFSEYEPPSWVRNSDNSSFGY-DMGWWKLEHFNASDVDGDG  214

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LNL EF DFLHP DS+N  +  WL  E++R+ D +KD K++  EF  G ++  + Y E 
Sbjct  215   LLNLTEFNDFLHPADSKNPKLIHWLCEEEIRERDSDKDGKINFNEFFHGLFDMVRNYDEN  274

Query  773   ETSGI------DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               S        D P+    F +LD D D  L  EEL PI   + P E  YA+    Y+I+
Sbjct  275   HNSSHHSEDSRDGPA-RNLFAVLDKDNDGHLSNEELLPIIGKIHPSEHYYAKQQAEYIIQ  333

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDD  1039
             +AD + DG+LTL EM++H  +FY  I+ NE DEDD
Sbjct  334   QADADKDGRLTLAEMIDHPYVFYSAIF-NEDDEDD  367



>ref|XP_008465196.1| PREDICTED: calumenin-B-like [Cucumis melo]
Length=375

 Score =   197 bits (501),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 115/268 (43%), Positives = 156/268 (58%), Gaps = 11/268 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y ND  R +   RLM+LFP +D DP DGFV V+EL  WN QQA    
Sbjct  96    SQPEWEDFADAEDYINDDNRFNVTDRLMLLFPKIDVDPVDGFVTVEELTEWNLQQAQRET  155

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR L   DK+ DGS+SFSEY P     + + +  G+ D GWW ++  NA DVD +G
Sbjct  156   LHRTQRELETHDKNHDGSVSFSEYEPPSWVRNSDNSSFGY-DMGWWKLEHFNASDVDGDG  214

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LNL EF DFLHP DS+N  +  WL  E++R+ D +KD K++  EF  G ++  + Y E 
Sbjct  215   LLNLTEFNDFLHPADSKNPKLIHWLCEEEIRERDSDKDGKINFNEFFHGLFDMVRNYDEN  274

Query  773   ETSGI------DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               S        D P+    F +LD D D  L  EEL PI   + P E  YA+    Y+I+
Sbjct  275   HNSSHHSEDSRDGPA-RNLFAVLDKDNDGHLSNEELLPIIGKIHPSEHYYAKQQAEYIIQ  333

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYD  1018
             +AD + DG+LTL EM++H  +FY  I++
Sbjct  334   QADADKDGRLTLTEMIDHPYVFYSAIFN  361



>ref|XP_008360001.1| PREDICTED: calumenin-A-like [Malus domestica]
Length=374

 Score =   196 bits (497),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 133/376 (35%), Positives = 193/376 (51%), Gaps = 44/376 (12%)
 Frame = +2

Query  53    MAGKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAP-----PI-FD  214
             M      V+ Y   A  V+LL+S  H+     ++  R L  R     + P     PI FD
Sbjct  1     MVRPSVSVIIYXAIAVLVLLLIS--HSPKKPGNHRHRRLKLRSNFTFSPPLHHHNPIPFD  58

Query  215   PIVA---RRK-----------------------GLANPEKSD--DDDRYFNDKGRLDTGL  310
             P+VA   RR+                         + PE  D  D + Y ND  R +   
Sbjct  59    PLVADIERRREDRKWEQQHFDHAFNASHHSAPAAESQPEWEDFMDAEDYLNDDERFNVTS  118

Query  311   RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYF  490
             RL++LFP +D DP DGFV   EL  WN  QA   + +RTQR + L DK+ DG +SF+EY 
Sbjct  119   RLLLLFPKVDVDPADGFVTEHELTQWNLNQAQREVLHRTQRDMELHDKNXDGFVSFAEYQ  178

Query  491   PQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWL  667
             P    ++ + +  G+ D GWW  +  NA D + +G LNL EF DFLHP DS+N  +  WL
Sbjct  179   PPSWAQNADNSSFGY-DMGWWKEEHFNASDANGDGLLNLTEFNDFLHPADSKNPKLLTWL  237

Query  668   LTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVP--SVEET----FTLLDA  829
               E++R+ D +KD+K++  EF  G ++  + Y E + +       S+E      F  LD 
Sbjct  238   CREEVRERDTDKDEKINFKEFFHGLFDLVRNYDEEDHNSTHQSDDSMESXARNLFAQLDK  297

Query  830   DKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDT  1009
             D D +L  EE+ PI   + P E  YA+    Y+I +AD + DG+LTL EM+ +  +FY  
Sbjct  298   DGDGYLSDEEILPIIGKIHPSEHYYAKQQADYIISQADTDKDGRLTLGEMIENPYVFYSA  357

Query  1010  IYDNEKDEDDIYHDEL  1057
             I+ ++++ED  YHDE 
Sbjct  358   IFSDDEEEDYGYHDEF  373



>ref|XP_006853843.1| hypothetical protein AMTR_s00036p00074650 [Amborella trichopoda]
 gb|ERN15310.1| hypothetical protein AMTR_s00036p00074650 [Amborella trichopoda]
Length=376

 Score =   195 bits (496),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 130/382 (34%), Positives = 189/382 (49%), Gaps = 58/382 (15%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGT---------------QGTA  199
             M  V+ Y   A F++ L+    NK      + R L RR+G                +   
Sbjct  1     MKSVIIYISVALFLLFLIHYGPNK----SQTSRSLHRRVGPARLKLRSKFSFSSRDRKHD  56

Query  200   PPIFDPIVAR----------RKGL-----------------ANPEKSD--DDDRYFNDKG  292
             P  FDP VA            K L                 + PE  D  + + Y ND+ 
Sbjct  57    PVAFDPFVAEIERHREDREWEKKLIEQNYHELNHSSAPGEESQPEWEDFMNAEDYLNDEE  116

Query  293   RLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSI  472
             R +   RL++LFP +D  P DGF+  +EL  WN QQ+   + +RT+R + L DK+ DG +
Sbjct  117   RFNVTSRLVLLFPRIDIAPADGFLSTEELTQWNLQQSFREVMHRTERDMELHDKNRDGFV  176

Query  473   SFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLHPEDSRND  649
             SF+EY P       + N  G+ + GWW    F ++D D +G LN  EF +FLHP DS N 
Sbjct  177   SFAEYDPPSWARHADNNSYGY-EIGWWKEDHFNSSDEDGDGLLNRTEFNNFLHPADSNNP  235

Query  650   NIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF------ETSGIDVPSVEET  811
              + RWL  E++R+ D++KD KL+  EF  G ++  ++Y E       E+  +     ++ 
Sbjct  236   KLLRWLCKEEVRERDIDKDGKLNFQEFFHGLFDLIRSYDEIDSNYTHESDPLKETPAKKL  295

Query  812   FTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHD  991
             F  LD DKD FL  EEL P+   L PGE  YA+    Y+  +AD N DG+L+L EM+ + 
Sbjct  296   FDELDKDKDGFLSYEELLPVIAKLHPGEQYYAKQQADYIKMQADSNKDGRLSLQEMIENP  355

Query  992   TLFYDTIYDNEKDEDDIYHDEL  1057
              +FY  I+ +E D +  YHDE 
Sbjct  356   YVFYSAIFSDEDDYE--YHDEF  375



>ref|XP_009351755.1| PREDICTED: calumenin [Pyrus x bretschneideri]
Length=372

 Score =   194 bits (494),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 134/378 (35%), Positives = 199/378 (53%), Gaps = 50/378 (13%)
 Frame = +2

Query  53    MAGKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGT-APPI-------  208
             M      V+ Y IA AF++LLL     K   K  + R    +L +  T APP+       
Sbjct  1     MVRASVSVIIY-IAIAFLVLLLISHSPK---KPGNHRHRRLKLRSNFTFAPPLHHHNPIP  56

Query  209   FDPIVA---RRK-----------------------GLANPEKSD--DDDRYFNDKGRLDT  304
             FDP+VA   RR+                         + PE  D  D + Y N++ R + 
Sbjct  57    FDPLVADIERRREDRKWEQQHFDHAFNASHDSAPAAESQPEWEDYMDAEDYLNNEDRFNV  116

Query  305   GLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
               RL++LFP +D DP DGFV   EL  WN  QA   + +RTQR + L DK+ DG +SF+E
Sbjct  117   TNRLLLLFPKVDVDPADGFVTEDELTQWNLNQAQREVLHRTQRDMELHDKNRDGFVSFAE  176

Query  485   YFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRR  661
             Y P    ++ +    G+ D GWW  +  NA D + +G LN+ EF DFLHP DS+N  + +
Sbjct  177   YQPPSWVQNADNISFGY-DMGWWKEEHFNASDANGDGLLNITEFNDFLHPADSKNPKLLK  235

Query  662   WLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE------FETSGIDVPSVEETFTLL  823
             WL  E++R+ D +KD+K++  EF  G ++  + Y E       ++  ++ P+ +  F  L
Sbjct  236   WLCKEEVRERDTDKDEKINFKEFFHGLFDLVRNYDEQNHNSTHQSDDLESPA-KNLFAQL  294

Query  824   DADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFY  1003
             D D D +L  EE+ PI   + P E  YA+    Y+I +AD + DG+LTL EM+ +  +FY
Sbjct  295   DKDGDGYLSDEEILPIIGKIHPSEHYYAKQQADYIISQADTDKDGRLTLGEMIENPYVFY  354

Query  1004  DTIYDNEKDEDDIYHDEL  1057
               I+ N+ +E+D YHDE 
Sbjct  355   SAIF-NDDEEEDYYHDEF  371



>ref|XP_007142746.1| hypothetical protein PHAVU_007G013600g [Phaseolus vulgaris]
 gb|ESW14740.1| hypothetical protein PHAVU_007G013600g [Phaseolus vulgaris]
Length=370

 Score =   194 bits (493),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 116/296 (39%), Positives = 169/296 (57%), Gaps = 12/296 (4%)
 Frame = +2

Query  197   APPIFDPIVARRKGLANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDV  370
             A P  DP  A     + PE  D  D + Y ND+G+ +   RL++LFP +D DP D FV  
Sbjct  77    ANPELDPDPAPAHE-SQPEWEDFIDAEDYLNDEGKFNVTNRLILLFPKIDVDPADWFVTE  135

Query  371   KELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGW  550
              EL  WN  QA   + +RTQR + L DK+ DG +SFSEY P    ++ +    G+ D GW
Sbjct  136   HELTQWNLHQAQREVMHRTQREMELHDKNHDGFVSFSEYDPPSWVQNADNESFGY-DMGW  194

Query  551   WMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLE  727
             W  +  NA D D +G LNL EF DFLHP DS+N  + +WL  E++R+ D ++D K++  E
Sbjct  195   WKEEHFNASDADGDGVLNLTEFNDFLHPADSKNPKLYQWLCKEEVRERDTDRDGKVNFKE  254

Query  728   FERGAYETYKTYKE------FETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDP  889
             F  G ++  + Y E      +  + +D P+    F  LD D D +L   EL PI   L P
Sbjct  255   FFHGLFDLVRNYDEENHNDSYSDNSMDAPA-RMLFAQLDKDGDGYLSDIELLPIIGKLHP  313

Query  890   GELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
              E  YA+    Y+I +AD++ DG+LTL EM+ +  +FY  I+++++D++  YHDE 
Sbjct  314   SEHYYAKQQADYIISQADEDKDGRLTLTEMIENPYVFYSAIFNDDEDDEGDYHDEF  369



>gb|EEE61919.1| hypothetical protein OsJ_16654 [Oryza sativa Japonica Group]
Length=357

 Score =   193 bits (490),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/251 (42%), Positives = 147/251 (59%), Gaps = 5/251 (2%)
 Frame = +2

Query  269   DRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLR  448
             +RYF   G L+   RL+ LFP+LDR P DG V   ELE W  +QA +RL+   +R L   
Sbjct  89    ERYFGSDGELNVKERLLYLFPMLDRAPKDGGVSCGELEAWLRRQAADRLDAVARRELKRH  148

Query  449   DKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLH  628
             DKDGDG ++  EY     D+ I+  +T HG+ GWW+ +F +AD D +G ++  E  DFLH
Sbjct  149   DKDGDGVVTLREYLAVDHDQHIDWTDTEHGEPGWWLHKFISADRDHSGAMDFIELNDFLH  208

Query  629   PEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGID---VPS  799
             PEDS  + ++ WLL +KL  MD ++D KLSL EF    +         E S  D      
Sbjct  209   PEDSSQEKVKLWLLKDKLSGMDHDRDGKLSLDEF-ISQFHMIDHNSIVEHSADDDTSCAE  267

Query  800   VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEM  979
              E+ F  LD++ D +L VEE +P+   L  GE SYA+ +   L++ ADDN D KL+L+EM
Sbjct  268   AEKKFRELDSNNDGYLTVEEARPVIQSLISGEFSYAKSHAKLLMK-ADDNKDNKLSLEEM  326

Query  980   MNHDTLFYDTI  1012
             +NH   FY+ +
Sbjct  327   LNHYLSFYNIV  337



>ref|XP_008340424.1| PREDICTED: calumenin [Malus domestica]
Length=373

 Score =   193 bits (491),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 131/377 (35%), Positives = 194/377 (51%), Gaps = 47/377 (12%)
 Frame = +2

Query  53    MAGKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAP-----PI-FD  214
             M      V+ Y   A  V+LL+S  H+     ++  R L  R       P     PI FD
Sbjct  1     MVRASVSVIIYIAIAVLVLLLIS--HSPKKPGNHRHRRLKLRSNFTFXXPXHHHNPIPFD  58

Query  215   PIVA---RRK-----------------------GLANPEKSD--DDDRYFNDKGRLDTGL  310
             P+VA   RR+                         + PE  D  D + Y N++ R +   
Sbjct  59    PLVADIERRREDRKWEQQHFDHAFNASHDSAPAAESQPEWEDFMDAEDYLNNEDRFNVTN  118

Query  311   RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYF  490
             RL++LFP +D DP DGFV   EL  WN  QA   + +RTQR + L DK+ DG +SF+EY 
Sbjct  119   RLLLLFPKVDVDPADGFVTEDELTQWNLNQAQREVLHRTQRDMELHDKNSDGFVSFAEYQ  178

Query  491   PQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWL  667
             P    ++ + +  G+ D GWW  +  NA D + +G LN+ EF DFLHP DS+N  + +WL
Sbjct  179   PPSWVQNADNSSFGY-DMGWWKEEHFNASDANGDGLLNITEFNDFLHPADSKNLKLLKWL  237

Query  668   LTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSG-------IDVPSVEETFTLLD  826
               E++R+ D +KD+K++  EF  G ++  + Y E   +        ++ P+    F  LD
Sbjct  238   CKEEVRERDTDKDEKINFKEFFHGLFDLVRNYDEENHNSTHQSDDLMEFPA-RNLFAQLD  296

Query  827   ADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYD  1006
              D D +L  EE+ PI   + P E  YA+    Y+I +AD + DG+LTL EM+ +  +FY 
Sbjct  297   KDGDGYLSDEEMLPIIGKIHPSEHYYAKQQADYIISQADTDKDGQLTLGEMIENPYVFYS  356

Query  1007  TIYDNEKDEDDIYHDEL  1057
              I+ N+ +E+D YHDE 
Sbjct  357   AIF-NDDEEEDYYHDEF  372



>emb|CAE03423.2| OSJNBa0032F06.6 [Oryza sativa Japonica Group]
Length=358

 Score =   192 bits (489),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/251 (42%), Positives = 147/251 (59%), Gaps = 5/251 (2%)
 Frame = +2

Query  269   DRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLR  448
             +RYF   G L+   RL+ LFP+LDR P DG V   ELE W  +QA +RL+   +R L   
Sbjct  90    ERYFGSDGELNVKERLLYLFPMLDRAPKDGGVSCGELEAWLRRQAADRLDAVARRELKRH  149

Query  449   DKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLH  628
             DKDGDG ++  EY     D+ I+  +T HG+ GWW+ +F +AD D +G ++  E  DFLH
Sbjct  150   DKDGDGVVTLREYLAVDHDQHIDWTDTEHGEPGWWLHKFISADRDHSGAMDFIELNDFLH  209

Query  629   PEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGID---VPS  799
             PEDS  + ++ WLL +KL  MD ++D KLSL EF    +         E S  D      
Sbjct  210   PEDSSQEKVKLWLLKDKLSGMDHDRDGKLSLDEF-ISQFHMIDHNSIVEHSADDDTSCAE  268

Query  800   VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEM  979
              E+ F  LD++ D +L VEE +P+   L  GE SYA+ +   L++ ADDN D KL+L+EM
Sbjct  269   AEKKFRELDSNNDGYLTVEEARPVIQSLISGEFSYAKSHAKLLMK-ADDNKDNKLSLEEM  327

Query  980   MNHDTLFYDTI  1012
             +NH   FY+ +
Sbjct  328   LNHYLSFYNIV  338



>ref|NP_001054290.1| Os04g0681500 [Oryza sativa Japonica Group]
 dbj|BAF16204.1| Os04g0681500 [Oryza sativa Japonica Group]
 dbj|BAG97301.1| unnamed protein product [Oryza sativa Japonica Group]
Length=364

 Score =   192 bits (489),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/251 (42%), Positives = 147/251 (59%), Gaps = 5/251 (2%)
 Frame = +2

Query  269   DRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLR  448
             +RYF   G L+   RL+ LFP+LDR P DG V   ELE W  +QA +RL+   +R L   
Sbjct  96    ERYFGSDGELNVKERLLYLFPMLDRAPKDGGVSCGELEAWLRRQAADRLDAVARRELKRH  155

Query  449   DKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLH  628
             DKDGDG ++  EY     D+ I+  +T HG+ GWW+ +F +AD D +G ++  E  DFLH
Sbjct  156   DKDGDGVVTLREYLAVDHDQHIDWTDTEHGEPGWWLHKFISADRDHSGAMDFIELNDFLH  215

Query  629   PEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGID---VPS  799
             PEDS  + ++ WLL +KL  MD ++D KLSL EF    +         E S  D      
Sbjct  216   PEDSSQEKVKLWLLKDKLSGMDHDRDGKLSLDEF-ISQFHMIDHNSIVEHSADDDTSCAE  274

Query  800   VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEM  979
              E+ F  LD++ D +L VEE +P+   L  GE SYA+ +   L++ ADDN D KL+L+EM
Sbjct  275   AEKKFRELDSNNDGYLTVEEARPVIQSLISGEFSYAKSHAKLLMK-ADDNKDNKLSLEEM  333

Query  980   MNHDTLFYDTI  1012
             +NH   FY+ +
Sbjct  334   LNHYLSFYNIV  344



>ref|XP_009403489.1| PREDICTED: calumenin-like [Musa acuminata subsp. malaccensis]
Length=364

 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 115/291 (40%), Positives = 161/291 (55%), Gaps = 11/291 (4%)
 Frame = +2

Query  209   FDPIVARRKGLANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELE  382
             F  IV      A PE     D + Y ND+GR +   R+ +LFP +D  P DGF+  KEL 
Sbjct  76    FPSIVGAPPAEAQPEWEGFIDAEDYINDEGRFNVSHRISLLFPKIDVGPADGFLTSKELA  135

Query  383   YWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI-  559
              WN +Q+   + +RT+R + L DK+ DG ISF EY P      +  NET     GWW   
Sbjct  136   EWNLKQSEKEVLHRTRRDMKLHDKNRDGFISFQEYEPPSWVRRLIDNETD-DKFGWWKED  194

Query  560   QFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERG  739
              F  +D+D +  LNL EF DFLHP D+ N  +  WL  E++R+ D +KD KL+  E+  G
Sbjct  195   HFNASDMDGDSLLNLIEFNDFLHPADTSNPKLIEWLCQEEIRERDKDKDGKLNFEEYLTG  254

Query  740   AYETYKTYKEF-----ETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSY  904
              +   + Y E      ET   +    ++ FT LD D D FL  +ELKP+ H L P E  Y
Sbjct  255   LFHLIRNYDEVYSSTHETDASNEIPAKKLFTRLDLDNDGFLSADELKPVIHDLHPSERYY  314

Query  905   ARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             A+    Y++ +AD N DG L+L EM+++  +FY  I+  E++ D I+HDEL
Sbjct  315   AKQQADYVLSQADTNKDGHLSLQEMLDNPYVFYSAIF--EEENDFIHHDEL  363



>ref|XP_010924990.1| PREDICTED: LOW QUALITY PROTEIN: calumenin-B-like [Elaeis guineensis]
Length=368

 Score =   191 bits (485),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 117/312 (38%), Positives = 160/312 (51%), Gaps = 27/312 (9%)
 Frame = +2

Query  161   RGLSRRLGTQGTAPPIFDPIVA----RR-----------------KGLANPEKSD--DDD  271
             R  S   G +   P  FDP+++    RR                 +G A PE  D  + +
Sbjct  44    RPNSSTTGGRHHPPIPFDPVISDIEIRREDKQWEREHFSIPHHDGQGEAEPEWEDFMNAE  103

Query  272   RYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRD  451
              Y ND  R +   R+ +LFP +D  P DGFV   EL  WN QQA     +RTQR + L D
Sbjct  104   DYINDDERFNVTNRIALLFPKIDASPSDGFVSSDELVEWNLQQATKETMHRTQRDMELHD  163

Query  452   KDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLH  628
             K+ DG +SF EY     D   +       D GWW    F  +DVD NG LNL EF DFLH
Sbjct  164   KNNDGFVSFHEYEGPTWDRHSDDKTFSGNDVGWWKEDHFNASDVDGNGLLNLTEFNDFLH  223

Query  629   PEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF---ETSGIDVPS  799
             P DS N  + +WL  E++R+ D +KD KLS  E+  G ++  + Y E      S ++  S
Sbjct  224   PADSNNPKLIQWLCKEEIRERDKDKDGKLSFEEYFHGLFDAIQDYDEIYNHSDSSMEEAS  283

Query  800   VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEM  979
              ++ FT LD D D FL  +ELK +   L P E  YA+    Y++ +AD + DG+L+L EM
Sbjct  284   AKKLFTQLDRDNDGFLSDDELKAVIGILHPSERYYAKQQADYVVSQADSDKDGRLSLSEM  343

Query  980   MNHDTLFYDTIY  1015
             + H  +FY  I+
Sbjct  344   IEHPYVFYSAIF  355



>ref|XP_002513128.1| Reticulocalbin-2 precursor, putative [Ricinus communis]
 gb|EEF49631.1| Reticulocalbin-2 precursor, putative [Ricinus communis]
Length=376

 Score =   189 bits (479),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 115/300 (38%), Positives = 166/300 (55%), Gaps = 12/300 (4%)
 Frame = +2

Query  188   QGTAPPIFDPIVARRKGLANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGF  361
             + + P I   I A       PE  D  D + Y ND+ + +   RL++LFP +D DP DG 
Sbjct  78    ESSHPDILKDIDAAPGHEPQPEWEDFMDAEDYLNDEEKFNVTSRLLLLFPKIDVDPVDGH  137

Query  362   VDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGD  541
             V   EL  WN  QA   + +RTQR + + DK+ DG ISFSEY P     + ++N  G+ D
Sbjct  138   VSEHELTEWNMDQAKREVMHRTQREVEVHDKNHDGLISFSEYEPPSWVHNSDQNTFGY-D  196

Query  542   AGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLS  718
              GWW  +  NA D D +G LN+ EF DFLHP DS+N  + +WL  E++R+ D +KD K++
Sbjct  197   MGWWREEHFNASDADGDGLLNITEFNDFLHPADSKNPKLLQWLCMEEVRERDSDKDGKVN  256

Query  719   LLEFERGAYETYKTYKEFETSGIDVPS-------VEETFTLLDADKDSFLRVEELKPIFH  877
               EF  G ++  + Y E E+     P+        +  F+ LD D D +L   EL P+  
Sbjct  257   FKEFFHGLFDLVRNYDE-ESHNSSHPTDDSLEAPAKVLFSQLDKDGDGYLSDVELLPVIG  315

Query  878   YLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
              L P E  YA+    Y+I +AD + DG+L+L EM+ +  +FY  I+ +E DED  +HDE 
Sbjct  316   KLHPSERYYAKQQADYIISQADTDKDGRLSLTEMIENPFVFYSAIFSDEDDEDYDFHDEF  375



>ref|XP_009783341.1| PREDICTED: calumenin [Nicotiana sylvestris]
Length=375

 Score =   188 bits (477),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 128/372 (34%), Positives = 187/372 (50%), Gaps = 47/372 (13%)
 Frame = +2

Query  74    VVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRR--------LGTQGTAPPIFDPIVAR  229
             V+ Y   A  ++LL+SQ  +    K +  R L  R        +  +    P FDP+VA+
Sbjct  6     VIIYITIAVLLLLLISQSPSNKAGKRHGHRRLKLRSNFTFDQHIHHEHERIP-FDPLVAK  64

Query  230   RKGL---------------------------ANPEKSD--DDDRYFNDKGRLDTGLRLMV  322
              +                             + PE  D  D + Y ND+ + +   RL++
Sbjct  65    IERHREDKEWEKQYIDTHHPELHHEHAPGEESQPEWEDFMDAEDYLNDEDKFNVTDRLVL  124

Query  323   LFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFT  502
             LFP +D DP DGFV   EL  WN +Q+   + +RT+R + + DK+ DG +SFSEY P   
Sbjct  125   LFPKIDVDPSDGFVSEHELTEWNLEQSRKEVLHRTEREMEVHDKNHDGFVSFSEYEPPSW  184

Query  503   DEDIERNETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEK  679
               + + +  G+ D GWW    F  +DVD +G LN+ EF DFLHP D+ N N+  WL  E+
Sbjct  185   VRNSDNSSFGY-DMGWWKEDHFNASDVDGDGLLNITEFNDFLHPADTSNPNLLNWLCKEE  243

Query  680   LRQMDVNKDQKLSLLEFERGAYETYKTYKE------FETSGIDVPSVEETFTLLDADKDS  841
             +R+ D +KD K++  EF  G ++  + Y E        +        ++ FT LD D D 
Sbjct  244   IRERDSDKDGKVNFKEFFHGLFDLVRNYDEESHDSSHHSEDSQESPAKKLFTELDKDGDG  303

Query  842   FLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDN  1021
             +L   EL PI   L P E  YA+    Y+I++AD + DG LTL EM++   +FY  I+ N
Sbjct  304   YLSDAELLPIIGKLHPSERYYAKQQADYIIQQADADKDGGLTLKEMIDSPYVFYSAIF-N  362

Query  1022  EKDEDDIYHDEL  1057
             E DED  YHDE 
Sbjct  363   EDDEDYEYHDEF  374



>ref|XP_002267285.1| PREDICTED: reticulocalbin-2 [Vitis vinifera]
 emb|CBI35372.3| unnamed protein product [Vitis vinifera]
Length=372

 Score =   187 bits (474),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 129/362 (36%), Positives = 185/362 (51%), Gaps = 46/362 (13%)
 Frame = +2

Query  59    GKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAP--------PIFD  214
             GK++ VV Y   A  V  L+S   NK    D S    SRRL  + +            FD
Sbjct  2     GKVS-VVIYISVALLVFWLVSHSPNKSL--DRSHHHASRRLKLRSSYTFTGANDHRVAFD  58

Query  215   PIVA---RRK----------------------GLANPEKSD--DDDRYFNDKGRLDTGLR  313
             PIVA   RR+                        + PE  D  + + Y ND+ R +   R
Sbjct  59    PIVADIERRREDKEWEKLQFQNRHPEFDSAPAAESQPEWEDFMNAEDYLNDEDRFNITGR  118

Query  314   LMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFP  493
             L++LFP +D DP DGFV   EL  WN +Q+   + +RTQR + L DK+ DG +SFSEY  
Sbjct  119   LVLLFPKIDVDPEDGFVSESELTQWNLKQSEKEVLHRTQREMELHDKNKDGLVSFSEYEA  178

Query  494   QFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLL  670
                  + +    G+ D GWW  +  NA D D +G LN+ EF DFLHP DS+N  + +WL 
Sbjct  179   PSWVRNSDNTSFGY-DMGWWKEEHFNASDADGDGLLNITEFNDFLHPADSKNPKLVQWLC  237

Query  671   TEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE------FETSGIDVPSVEETFTLLDAD  832
              E++R+ D +KD K++  EF  G ++  + Y E       E+S +     ++ F+ LD D
Sbjct  238   KEEIRERDTDKDGKVNFNEFFHGLFDLVRNYNEEGHNSSHESSDLMEAPAKKLFSQLDKD  297

Query  833   KDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTI  1012
              D  L  +EL PI   L P E  YA+    Y+I +AD + DG+LTL EM+++  +FY  I
Sbjct  298   GDGLLSEDELLPIIGKLHPSEHYYAKQQADYIISQADADKDGRLTLTEMIDNPYVFYSAI  357

Query  1013  YD  1018
             ++
Sbjct  358   FN  359



>ref|XP_007043214.1| Calcium-binding EF hand family protein isoform 1 [Theobroma cacao]
 gb|EOX99045.1| Calcium-binding EF hand family protein isoform 1 [Theobroma cacao]
Length=373

 Score =   186 bits (473),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 129/367 (35%), Positives = 186/367 (51%), Gaps = 57/367 (16%)
 Frame = +2

Query  59    GKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGT---------APPIF  211
             GK++ VV Y   A  ++ L+S   NK     +S     RRL  + +          P  F
Sbjct  2     GKVSAVV-YITVALLILFLISYSPNK-----HSSHNRHRRLKLRTSYNFGKPTRHEPVAF  55

Query  212   DPIVA---RRKG----------LANPEKSDDD----------------DRYFNDKGRLDT  304
             DP+VA   RR+            ++PE + D                 + Y ND+ + + 
Sbjct  56    DPLVADIERRREDRQWEKQHFEYSHPEFTHDPAPAEESQPEWEDFMNAEDYLNDEEKFNV  115

Query  305   GLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
               RL++LFP +D DP DGFV   EL  WN QQA   + +RTQR + + DK+ DG IS+ E
Sbjct  116   TDRLVMLFPKIDVDPADGFVTENELTEWNLQQAAREVLHRTQREMEIHDKNHDGLISYKE  175

Query  485   YFPQFTDEDIERNETGHG-DAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIR  658
             Y P      ++ + T  G D GWW  +  NA D D +G LN+ EF DFLHP DS+N  + 
Sbjct  176   YEPPSW---VKNDNTSFGYDMGWWKEEHFNASDADGDGLLNITEFNDFLHPADSKNSKLL  232

Query  659   RWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPS-------VEETFT  817
             +WL  E++R+ D +KD K++  EF  G ++  + Y E E      PS        +  F+
Sbjct  233   KWLCKEEVRERDTDKDGKVNFNEFFHGLFDLVRNYDE-EGHNSSHPSDDSMEAPAKRLFS  291

Query  818   LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTL  997
              LD D D FL  EEL PI   L P E  YA+    Y+I +AD + DG+L+L EM++   +
Sbjct  292   QLDKDGDRFLSDEELLPIIGKLHPSERYYAKQQADYIISQADSDKDGRLSLVEMIDSPYV  351

Query  998   FYDTIYD  1018
             FY  I++
Sbjct  352   FYSAIFN  358



>ref|XP_003571745.1| PREDICTED: reticulocalbin-2 [Brachypodium distachyon]
 ref|XP_010234052.1| PREDICTED: reticulocalbin-2 [Brachypodium distachyon]
Length=377

 Score =   186 bits (473),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 153/272 (56%), Gaps = 9/272 (3%)
 Frame = +2

Query  257   SDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRA  436
             +D DD Y ND+ R +   R+ VLFP +D DP DG V   EL  WN   A   + +RT R 
Sbjct  109   ADSDDEYINDEARFNVTRRVEVLFPKIDVDPADGAVTAAELAAWNLASAAREVLHRTSRE  168

Query  437   LSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWM-IQFKNADVDRNGTLNLYEF  613
             L L D+D DG ++FSEY         + N + +   GWW    F  ADVD +G LNL EF
Sbjct  169   LELHDRDHDGRVAFSEYERPSWAWRFDDNNSTNDSMGWWKEGHFNAADVDGDGFLNLTEF  228

Query  614   RDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF----ETS  781
              DFLHP D+ N  +  WL  E++R+ D + D KL+  EF  G + + + + +     ++S
Sbjct  229   NDFLHPADTTNPKLIHWLCKEEVRERDKDNDGKLNFDEFYNGLFYSIRHHDDEASADDSS  288

Query  782   GIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGK  961
             G D P+  ++F+ LD D D  L  +ELKPI   L P E  YA+    Y+I +AD N DG+
Sbjct  289   GSDAPA-RKSFSQLDMDNDGLLSADELKPIIGKLHPAENFYAKQQAEYVISQADTNKDGQ  347

Query  962   LTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             L+L EM+ +  +FY +++    ++D   HDEL
Sbjct  348   LSLSEMIENPYVFYSSLF---TEDDYGSHDEL  376



>gb|KDP40477.1| hypothetical protein JCGZ_24476 [Jatropha curcas]
Length=381

 Score =   186 bits (471),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/270 (39%), Positives = 158/270 (59%), Gaps = 11/270 (4%)
 Frame = +2

Query  275   YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
             Y ND+ + +   RL++LFP +D DP DG+V   EL  WN  QA   + +RTQR + + DK
Sbjct  113   YLNDEEKFNVTSRLLLLFPKIDVDPIDGYVSEHELTEWNLNQAEREVLHRTQREMDVHDK  172

Query  455   DGDGSISFSEY-FPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLH  628
             + DG +SF+EY  P +     E++  G+ D GWW  +  NA D D +G LN+ EF DFLH
Sbjct  173   NHDGFVSFAEYEPPTWVHSAAEKDSFGY-DMGWWREEHFNASDADGDGLLNITEFNDFLH  231

Query  629   PEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE-------FETSGI  787
             P DS+N  + +WL  E++R+ D +KD K++  EF  G ++  + Y+E            +
Sbjct  232   PADSKNPKLLQWLCKEEVRERDSDKDGKVNFKEFFHGLFDLVRNYEEENQNSSHLSDDSM  291

Query  788   DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLT  967
             + P+ +  F  LD D D +L   EL PI   L P E  YA+    Y+I +AD + DG+L+
Sbjct  292   EAPA-KVLFAQLDKDGDGYLSDTELLPIIGKLHPSERYYAKQQADYIISQADTDKDGRLS  350

Query  968   LDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             L EM+ +  +FY  I+++E+DED  +HDE 
Sbjct  351   LTEMIENPYVFYSAIFNDEEDEDYDFHDEF  380



>gb|KDO59625.1| hypothetical protein CISIN_1g0485991mg, partial [Citrus sinensis]
Length=227

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/234 (42%), Positives = 135/234 (58%), Gaps = 35/234 (15%)
 Frame = +2

Query  65   MTKVVAYTI-AAAFVILLL-----SQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVA  226
            M+K VAY +   AFV+  +       DHN           + RR G + + P  FDP+V 
Sbjct  1    MSKAVAYALLTTAFVLFFVFSPIQPHDHNDRLA------FIGRRFGYRYSVP-TFDPLVL  53

Query  227  RRKGLANPEKS----------------------DDDDRYFNDKGRLDTGLRLMVLFPILD  340
            +   +   +KS                      +D+  +F++ GRL+   RL+ LFP++D
Sbjct  54   KMNRVTEEKKSGSIKTRTNANDLENDSYDNEDFEDEYDFFSENGRLNITSRLIYLFPLID  113

Query  341  RDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIER  520
             +P DG + + EL+ WN + A++RL+Y TQ+ + L D+DGDG ISF EY PQF+ +DIE+
Sbjct  114  NEPKDGVLSLNELDNWNVELAVDRLSYTTQKQIELSDRDGDGEISFYEYLPQFSKQDIEK  173

Query  521  NETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKL  682
            N   HG AGWW  QF NADVD NGTLN  EF +FLHPEDS N  I+RWLL EKL
Sbjct  174  NGMVHGQAGWWKEQFDNADVDSNGTLNFDEFYNFLHPEDSNNTAIQRWLLREKL  227



>ref|XP_010688637.1| PREDICTED: reticulocalbin-2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688639.1| PREDICTED: reticulocalbin-2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688640.1| PREDICTED: reticulocalbin-2 [Beta vulgaris subsp. vulgaris]
Length=406

 Score =   185 bits (469),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 107/269 (40%), Positives = 155/269 (58%), Gaps = 15/269 (6%)
 Frame = +2

Query  248   PEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNY  421
             PE  D  D + Y ND+ + +   RL+VLFP +D DP DG+V   EL  WN QQ    + +
Sbjct  127   PEWEDFMDAEDYLNDEEKFNVTNRLLVLFPKIDVDPIDGYVTENELIEWNLQQTEREVLH  186

Query  422   RTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTL  598
             RTQR + + DK+ DG +SFSEY P    +  + N  G+ + GWW  +  NA DV+ +G L
Sbjct  187   RTQREMEVHDKNRDGFVSFSEYDPPSWVKSADNNTFGY-EMGWWREEHFNASDVNGDGLL  245

Query  599   NLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFET  778
             N+ EF+DFLHP D++N  + +WL  E++R+ D +KD K++  EF  G ++  + Y+E E 
Sbjct  246   NITEFKDFLHPADTKNPKLHQWLCKEEIRERDTDKDGKVNFNEFFHGLFDLVRNYEE-EG  304

Query  779   SG----------IDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYL  928
              G          I+ P+  + F  LD D D  L   EL PI   L P E  YA+    Y+
Sbjct  305   HGHNSTHHTDDSIETPAARKLFNELDKDGDGLLTETELLPIIDKLHPSERHYAKQQADYI  364

Query  929   IREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             I +AD N DG+L+L EM+ +  +FY TI+
Sbjct  365   ISQADTNKDGRLSLAEMIENPYVFYSTIF  393



>gb|KHN37354.1| Calumenin [Glycine soja]
Length=270

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 102/257 (40%), Positives = 150/257 (58%), Gaps = 7/257 (3%)
 Frame = +2

Query  263   DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALS  442
             D + Y ND+ + +   RL++LFP +D DP D FV   EL  WN QQA   + +RTQR + 
Sbjct  2     DAEDYLNDEDKFNVTNRLILLFPKIDVDPTDWFVTEHELTQWNLQQAQREVLHRTQREME  61

Query  443   LRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYEFRD  619
             L DK+ DG +SFSEY P    ++ +    G+ D GWW  + F  +D D +G LNL EF D
Sbjct  62    LHDKNHDGFVSFSEYDPPSWVQNADNESFGY-DMGWWKEEHFNASDADGDGVLNLTEFND  120

Query  620   FLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFET----SGI  787
             FLHP DS+N  + +WL  E++R+ D ++D+K++  EF  G ++  + Y E       + +
Sbjct  121   FLHPADSKNPKLLQWLCKEEVRERDTDRDEKVNFKEFFHGLFDLVRNYDEESHNDTDNSM  180

Query  788   DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLT  967
             D P+    F  LD D D +L   EL PI   L P E  YA+    Y+I +AD++ DG+LT
Sbjct  181   DAPA-RGLFAQLDKDGDGYLSDVELLPIIGKLHPSEQYYAKQQADYIISQADEDKDGRLT  239

Query  968   LDEMMNHDTLFYDTIYD  1018
             L EM+ +  +FY  I++
Sbjct  240   LTEMIENPYVFYSAIFN  256



>ref|XP_010546283.1| PREDICTED: reticulocalbin-2 [Tarenaya hassleriana]
 ref|XP_010546284.1| PREDICTED: reticulocalbin-2 [Tarenaya hassleriana]
Length=382

 Score =   183 bits (464),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 128/383 (33%), Positives = 187/383 (49%), Gaps = 53/383 (14%)
 Frame = +2

Query  59    GKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGT--------APPIFD  214
             GK + ++  T+A   + L+      K     Y      RRL  + +         P  FD
Sbjct  2     GKASVIIYVTVAVLLLFLISHSPKKKTGHDQYHLH--HRRLKLRSSFNFKPNNHKPAPFD  59

Query  215   PIVA---RRK----------------------------GLANPEKSD--DDDRYFNDKGR  295
             P+VA   RR+                              + PE  D  D + Y ND+ +
Sbjct  60    PLVADIERRREDKEWERKYFDDAHPEFASHGHGDSAPGHESQPEWEDFMDAEDYLNDEDK  119

Query  296   LDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSIS  475
              +   RL++LFP +D DP DGFV   EL  WN + +   + +RTQR + + DK+ DG +S
Sbjct  120   FNVTGRLILLFPKIDVDPVDGFVTESELTDWNMRSSEKEVIHRTQREMDVHDKNKDGFVS  179

Query  476   FSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDN  652
             F EY P     + + N  G  D GWW  +  NA D D +G LN+ EF DFLHP D++N  
Sbjct  180   FYEYEPPSWVRNADNNTFG-NDMGWWKEEHFNASDADGDGLLNVTEFNDFLHPADTKNPK  238

Query  653   IRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE------FETSGIDVPSVEETF  814
             +  WL  E++R+ D +KD K+S  EF  G ++T   Y+E          G+     ++ F
Sbjct  239   LLMWLCKEEVRERDSDKDGKISFQEFFHGIFDTVSNYEEENQNSSHPLHGLPEGPAKQLF  298

Query  815   TLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDT  994
               LD + D FL  +EL P+   + P E  YA+    Y+I +AD + DG+LTL EM+ H  
Sbjct  299   GQLDKNGDGFLSDDELLPVITKIHPTERYYAKQQADYIISQADSDKDGRLTLAEMIEHPY  358

Query  995   LFYDTIYDNEKDEDDIY--HDEL  1057
             +FY  I++ E D+DD Y  HDE 
Sbjct  359   VFYSAIFNEEDDDDDDYGFHDEF  381



>ref|XP_003536755.1| PREDICTED: calumenin-B-like isoform X1 [Glycine max]
Length=368

 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 110/276 (40%), Positives = 158/276 (57%), Gaps = 12/276 (4%)
 Frame = +2

Query  212   DPIVARRKGLANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEY  385
             DP  A     + PE  D  D + Y ND+ + +   RL++LFP +D DP D FV   EL  
Sbjct  84    DPAPAHE---SQPEWEDFMDAEDYLNDEDKFNVTNRLILLFPKIDVDPTDWFVTEHELTQ  140

Query  386   WNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQF  565
             WN QQA   + +RTQR + L DK+ DG +SFSEY P    ++ + NE+   D GWW  + 
Sbjct  141   WNLQQAQREVLHRTQREMELHDKNHDGFVSFSEYDPPSWVQNAD-NESFGYDMGWWKEEH  199

Query  566   KNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGA  742
              NA D D +G LNL EF DFLHP DS+N  + +WL  E++R+ D ++D+K++  EF  G 
Sbjct  200   FNASDADGDGVLNLTEFNDFLHPADSKNPKLLQWLCKEEVRERDTDRDEKVNFKEFFHGL  259

Query  743   YETYKTYKEFET----SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYAR  910
             ++  + Y E       + +D P+    F  LD D D +L   EL PI   L P E  YA+
Sbjct  260   FDLVRNYDEESHNDTDNSMDAPA-RGLFAQLDKDGDGYLSDVELLPIIGKLHPSEHYYAK  318

Query  911   YYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYD  1018
                 Y+I +AD++ DG+LTL EM+ +  +FY  I++
Sbjct  319   QQADYIISQADEDKDGRLTLTEMIENPYVFYSAIFN  354



>ref|XP_001782092.1| predicted protein [Physcomitrella patens]
 gb|EDQ53086.1| predicted protein [Physcomitrella patens]
Length=403

 Score =   183 bits (464),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/273 (37%), Positives = 150/273 (55%), Gaps = 8/273 (3%)
 Frame = +2

Query  260   DDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRAL  439
             +D + Y ND+ + +   RL  LFP++D +P D +V   EL  W+  Q    + +R+ R +
Sbjct  131   EDPEEYLNDEDQFNITERLTSLFPLIDINPRDDYVTSLELLEWHLVQGKKAMLHRSDREM  190

Query  440   SLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRD  619
                DK+ DG +S  EY P     +   N T   DAGW+  QF+  D D +G LN  EF D
Sbjct  191   ESHDKNHDGLVSLEEYLPHVLGAEQGHNSTEFDDAGWYKQQFEVCDRDNDGLLNATEFND  250

Query  620   FLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI----  787
             FLHP+DS N  +R+W   E++R  D NKD K+   EF  G ++  +  +++    +    
Sbjct  251   FLHPDDSNNPRVRQWCRLEQIRTHDTNKDGKIGWEEFHHGLFDQLQDEQDYHHPKLAEQL  310

Query  788   ---DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDG  958
                 +   +  F  LD +KD +L  +E+ P+   L PGEL YA+  + YL+ EAD+N D 
Sbjct  311   EAEKLVQSKRKFAELDRNKDGYLTEDEIAPVMEKLRPGELYYAKQQSDYLLHEADENRDE  370

Query  959   KLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             +L+LDEM+NH  +FY T YD E + D   HDE 
Sbjct  371   RLSLDEMLNHPYIFYSTAYD-EDEFDPAIHDEF  402



>ref|XP_010915272.1| PREDICTED: calumenin-like isoform X1 [Elaeis guineensis]
Length=372

 Score =   182 bits (462),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 107/281 (38%), Positives = 155/281 (55%), Gaps = 12/281 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             A PE  D  D + Y ND+ R +   R++ LFP +D  P DGFV   EL  WN +QA   +
Sbjct  94    AQPEWEDFIDAEDYINDEDRFNVTHRIIDLFPKIDVGPADGFVSSDELTQWNLKQAEKEV  153

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNG  592
              +RT+R + L DK+ DG ISF EY P         + +     GWW    F  +DVD NG
Sbjct  154   MHRTERDMELHDKNRDGFISFDEYEPPSWAHRFYDSNSTDDKVGWWKEDHFNASDVDENG  213

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LNL EF DFLHP DSRN  +  WL  E++R+ D ++D KLS  E+  G +++ + Y E 
Sbjct  214   LLNLTEFNDFLHPADSRNPKLMHWLCKEEIRERDKDRDGKLSFQEYFNGLFDSLRNYDEV  273

Query  773   ------ETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
                     + ++ P+ ++ F+ LD D D  L  +EL P+   L P E  YA+    Y++ 
Sbjct  274   YNAIDQSDTSVEAPA-KKLFSQLDQDNDGLLSEDELLPVIGNLHPSEHYYAKQQADYVLT  332

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             +AD + DG+L+L EM+ +  +FY  I+  E +E   +HDE 
Sbjct  333   QADTDKDGRLSLREMIENPYVFYSAIFGEEDEEG--FHDEF  371



>ref|XP_003555827.1| PREDICTED: calumenin-B-like [Glycine max]
Length=371

 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 158/279 (57%), Gaps = 15/279 (5%)
 Frame = +2

Query  212   DPIVARRKGLANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEY  385
             DP  A     + PE  D  D + Y ND+ + +   RL++LFP +D DP D FV   EL  
Sbjct  84    DPAPAHE---SQPEWEDFMDAEDYLNDEDKFNVTNRLILLFPKIDVDPTDWFVTEHELIQ  140

Query  386   WNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQF  565
             WN QQA   + +RTQR + L DK+ DG +SFSEY P    ++ + NE+   D GWW  + 
Sbjct  141   WNLQQAQREVLHRTQREMELHDKNHDGFVSFSEYDPPSWVQNAD-NESFGYDMGWWKEEH  199

Query  566   KNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGA  742
              NA D D +G LNL EF DFLHP DS+N  + +WL  E++R+ D ++D K++  EF  G 
Sbjct  200   FNASDADGDGVLNLTEFNDFLHPADSKNPKLHQWLCKEEVRERDTDRDGKVNFKEFFHGL  259

Query  743   YETYKTYKEFET-------SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELS  901
             ++  + Y E          + +D P+    F  LD D D +L   EL+PI   L P E  
Sbjct  260   FDLVRNYDEESHNDTHNSDNSMDAPA-RVLFAQLDKDGDGYLSDVELQPIIGKLHPSEHY  318

Query  902   YARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYD  1018
             YA+    Y+I +AD++ DG+LTL EM+ +  +FY  I++
Sbjct  319   YAKQQADYIISQADEDKDGRLTLTEMIENPYVFYSAIFN  357



>emb|CDX78345.1| BnaA03g02570D [Brassica napus]
Length=383

 Score =   181 bits (460),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 112/283 (40%), Positives = 159/283 (56%), Gaps = 13/283 (5%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y ND+ + +   RL+ LFP LD  P DGFV   EL  WN Q +   +
Sbjct  102   SQPEWEDFMDAEDYLNDEEKFNVTDRLISLFPKLDVSPTDGFVTESELTEWNMQSSAKEV  161

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR + + D++ DG ISFSEY P     +   +  G+ + GWW  +  NA D + +G
Sbjct  162   MHRTQRDMDVHDRNKDGFISFSEYEPPSWVRNSGNDSFGY-NMGWWKEEHFNASDANGDG  220

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LNL EF DFLHP D++N  +  WL  E++R+ D +KD K+   EF  G ++T + Y+E 
Sbjct  221   LLNLTEFNDFLHPADTKNHKLLLWLCKEEVRERDSDKDGKIGFEEFYHGLFDTVRNYEED  280

Query  773   ETSGI----DVP--SVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               +      D+P    ++ F+ LD D D +L   EL PI   + P E  YA+    Y+I 
Sbjct  281   NHNATHPYHDLPEGPAKQLFSQLDKDGDGYLSDVELLPIISKIHPTEHYYAKQQADYIIS  340

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY--HDEL  1057
             +AD + DG+LTL EM+ H  +FY  I+ NE D DD Y  HDE 
Sbjct  341   QADSDKDGRLTLAEMIEHPYVFYSAIF-NEDDSDDDYGFHDEF  382



>ref|XP_010279470.1| PREDICTED: calumenin [Nelumbo nucifera]
 ref|XP_010279471.1| PREDICTED: calumenin [Nelumbo nucifera]
Length=390

 Score =   181 bits (460),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 124/379 (33%), Positives = 193/379 (51%), Gaps = 48/379 (13%)
 Frame = +2

Query  47    KAMAGKMTKVVAYTIAAAFVILLL-------SQDHNKLFRKDYSPRGLSRRLGTQGTAPP  205
             +++ GK + ++  T+A   + L+        S  H +L  K  S    S   G +   P 
Sbjct  17    RSVMGKTSVIIYITVALLLLFLISYSPKRSPSHHHGRL--KLRSTFTFSNSGGDRHHDPI  74

Query  206   IFDPIVA---RRKG----------------------LANPEKSD--DDDRYFNDKGRLDT  304
              FDP++A   RR+                        + PE  D  + + Y ND  R + 
Sbjct  75    AFDPLIAEMERRREDKEWERKYFEHAHKEFVEAPGEESQPEWEDFMNAEDYLNDDERFNI  134

Query  305   GLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
               RL++LFP +D DP DGFV   EL  WN +Q+   + +R++R + + DK+ DG +SF+E
Sbjct  135   TNRLVLLFPKIDIDPVDGFVTESELTEWNLRQSEKEVMHRSEREIEVHDKNHDGFVSFAE  194

Query  485   YFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRR  661
             Y P       + N  G+ D GWW  +  NA D D +G LN  EF DFLHP DS +  + +
Sbjct  195   YEPPTWVRKSDNNSFGY-DMGWWKEEHFNASDADGDGLLNRTEFNDFLHPADSNSPKLLK  253

Query  662   WLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETS-------GIDVPSVEETFTL  820
             WL  E++R+ D +KD K++  EF  G ++  + Y E + +        ++ P+ ++ F  
Sbjct  254   WLCQEEIRERDTDKDGKINFKEFFHGLFDLVRNYDEEDHNSSHHSDDSMEAPA-KQLFAQ  312

Query  821   LDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLF  1000
             LD + D  L  +EL PI   L P E  YA+    Y+I +AD N DG+L+L+EM+    +F
Sbjct  313   LDQNNDQHLSEDELLPIIGKLHPSERYYAKQQADYIISQADTNKDGRLSLEEMIESPYVF  372

Query  1001  YDTIYDNEKDEDDIYHDEL  1057
             Y  I+++E + D  YHDE 
Sbjct  373   YSAIFNDEDEYD--YHDEF  389



>emb|CDX81115.1| BnaC03g03690D [Brassica napus]
Length=384

 Score =   181 bits (459),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 113/283 (40%), Positives = 159/283 (56%), Gaps = 13/283 (5%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y ND+ + +   RL+ LFP LD  P DGFV   EL  WN Q +   +
Sbjct  103   SQPEWEDFMDAEDYLNDEEKFNVTDRLISLFPKLDVSPTDGFVTESELTEWNMQSSAKEV  162

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR + + D++ DG ISFSEY P     +   N+T   + GWW  +  NA D + +G
Sbjct  163   MHRTQRDMDVHDRNKDGFISFSEYEPPSWVRN-SGNDTFGYNMGWWKEEHFNASDANGDG  221

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LNL EF DFLHP D++N  +  WL  E++R+ D +KD K+   EF  G ++T + Y+E 
Sbjct  222   LLNLTEFNDFLHPADTKNHKLLLWLCKEEVRERDSDKDGKIGFEEFYHGLFDTVRNYEED  281

Query  773   ETSGI----DVPS--VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               +      D+P    ++ F+ LD D D +L   EL PI   + P E  YA+    Y+I 
Sbjct  282   NHNATHPYHDLPEGPAKQLFSQLDKDGDGYLSDVELLPIISKIHPTEHYYAKQQADYIIS  341

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY--HDEL  1057
             +AD + DG+LTL EM+ H  +FY  I+ NE D DD Y  HDE 
Sbjct  342   QADSDKDGRLTLAEMIEHPYVFYSAIF-NEDDSDDDYGFHDEF  383



>gb|EYU35555.1| hypothetical protein MIMGU_mgv1a008053mg [Erythranthe guttata]
 gb|EYU35556.1| hypothetical protein MIMGU_mgv1a008053mg [Erythranthe guttata]
Length=386

 Score =   181 bits (459),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 126/389 (32%), Positives = 199/389 (51%), Gaps = 61/389 (16%)
 Frame = +2

Query  59    GKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLG-----TQGTAPPI-----  208
             G+++ ++ Y   A  V+LL+S+  +K   +    R   RRL      T  T P +     
Sbjct  2     GRISLII-YVAVAVSVLLLISRSADK---RSAGNRNRHRRLKIRSNFTFSTTPLLSSDPH  57

Query  209   ---------FDPIVA----RR-------------KGLANPEKSD------------DDDR  274
                      FDP+VA    RR             +  + PE +             D + 
Sbjct  58    RPASAASFAFDPLVADIERRREDKQWEHHYFQNHRSESKPESTQSTQPEPEWEDFMDAED  117

Query  275   YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
             Y ND+ + +   RL+VLFP +D DP DG+V   EL  WN +Q+   + +RT+R + + DK
Sbjct  118   YLNDEEKFNVTNRLVVLFPKIDVDPVDGYVSETELIQWNLKQSQKEVLHRTEREIEVHDK  177

Query  455   DGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYEFRDFLHP  631
             + DG +SFSEY P    +D  ++  G+ + GWW  + F  +D D +G LN+ EF DFLHP
Sbjct  178   NNDGFVSFSEYDPPTWVKDSGKDSFGY-EMGWWKEEHFNASDADGDGRLNITEFNDFLHP  236

Query  632   EDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE--FETSGIDVPSVE  805
              D+ N  +  WL  E++R+ D +KD K++  EF  G ++  + Y E    +S  +  + E
Sbjct  237   ADTNNPKLLLWLCKEEIRERDSDKDGKVNFKEFFHGLFDLVRNYDEESHNSSTHEADNPE  296

Query  806   ET-----FTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTL  970
             E      F  LD D D +L   E+ PI   + P E  YA+  T Y++++AD + DG+L+L
Sbjct  297   EAPAKILFAQLDKDGDGYLSDVEILPIIGKVHPSERYYAKQQTDYIMQQADTDKDGRLSL  356

Query  971   DEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
              EM+++  +FY  ++D  +D+D  YHDE 
Sbjct  357   TEMVDNPYVFYSAVFDEGEDDDYGYHDEF  385



>ref|XP_006437651.1| hypothetical protein CICLE_v10031861mg [Citrus clementina]
 gb|ESR50891.1| hypothetical protein CICLE_v10031861mg [Citrus clementina]
Length=374

 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 162/282 (57%), Gaps = 12/282 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             A PE  D  + + Y ND+ + +   RL++LFP +D +P DG+++  EL  WN QQA   +
Sbjct  94    AQPEWEDFMNAEDYLNDEEKFNVTDRLVLLFPKIDVNPADGYINEDELTDWNMQQAERDV  153

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR +   DK+ DG +SF+EY P     + + N  G+ D GWW  +  NA D D +G
Sbjct  154   MHRTQREMETHDKNKDGFVSFAEYEPPTWVRNSDNNSFGY-DMGWWKEEHFNASDADGDG  212

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTY-KE  769
              LNL EF DFLHP D++N  +  WL  E++R+ D ++D K++  EF  G ++  + Y  E
Sbjct  213   LLNLTEFNDFLHPADTKNPKLILWLSKEEVRERDSDRDGKVNFKEFFHGLFDLVRNYDDE  272

Query  770   FETSG------IDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLI  931
                S       +D P+  + F  LD D D +L   EL PI   L P E  YA+    Y+I
Sbjct  273   GHNSSHPSDDTMDAPA-RQLFGQLDKDGDGYLSDVELLPIIGKLHPSERYYAKQQADYII  331

Query  932   READDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
              +AD + DG+LTL EM+ +  +FY  I+ +E D+D IYHDE 
Sbjct  332   SQADTDKDGRLTLLEMIENPYVFYSAIFTDEDDDDYIYHDEF  373



>ref|XP_006484483.1| PREDICTED: calumenin-like isoform X1 [Citrus sinensis]
 gb|KDO69929.1| hypothetical protein CISIN_1g017306mg [Citrus sinensis]
 gb|KDO69930.1| hypothetical protein CISIN_1g017306mg [Citrus sinensis]
 gb|KDO69931.1| hypothetical protein CISIN_1g017306mg [Citrus sinensis]
Length=374

 Score =   181 bits (458),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 162/282 (57%), Gaps = 12/282 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             A PE  D  + + Y ND+ + +   RL++LFP +D +P DG+++  EL  WN QQA   +
Sbjct  94    AQPEWEDFMNAEDYLNDEEKFNVTDRLVLLFPKIDVNPADGYINEDELTDWNMQQAERDV  153

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR +   DK+ DG +SF+EY P     + + N  G+ D GWW  +  NA D D +G
Sbjct  154   MHRTQREMETHDKNKDGFVSFAEYEPPTWVRNSDNNSFGY-DMGWWKEEHFNASDADGDG  212

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTY-KE  769
              LNL EF DFLHP D++N  +  WL  E++R+ D ++D K++  EF  G ++  + Y  E
Sbjct  213   LLNLTEFNDFLHPADTKNPKLILWLSKEEVRERDSDRDGKVNFKEFFHGLFDLVRNYDDE  272

Query  770   FETSG------IDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLI  931
                S       +D P+  + F  LD D D +L   EL PI   L P E  YA+    Y+I
Sbjct  273   GHNSSHPSDDTMDAPA-RQLFGQLDKDGDGYLSDVELLPIIGKLHPSERYYAKQQADYII  331

Query  932   READDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
              +AD + DG+LTL EM+ +  +FY  I+ +E D+D IYHDE 
Sbjct  332   SQADTDKDGRLTLLEMIENPYVFYSAIFTDEDDDDYIYHDEF  373



>ref|XP_009131091.1| PREDICTED: calumenin-A-like [Brassica rapa]
 ref|XP_009131092.1| PREDICTED: calumenin-A-like [Brassica rapa]
Length=383

 Score =   181 bits (459),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/283 (40%), Positives = 159/283 (56%), Gaps = 13/283 (5%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y ND+ + +   RL+ LFP LD  P DGFV   EL  WN Q +   +
Sbjct  102   SQPEWEDFMDAEDYLNDEEKFNVTDRLISLFPKLDVSPTDGFVTESELTEWNMQSSAKEV  161

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR + + D++ DG ISFSEY P     +   +  G+ + GWW  +  NA D + +G
Sbjct  162   MHRTQRDMDVHDRNKDGFISFSEYEPPSWVRNSGNDSFGY-NMGWWKEEHFNASDANGDG  220

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LNL EF DFLHP D++N  +  WL  E++R+ D +KD K+   EF  G ++T + Y+E 
Sbjct  221   LLNLTEFNDFLHPADTKNHELLLWLCKEEVRERDSDKDGKIGFEEFYHGLFDTVRNYEED  280

Query  773   ETSGI----DVPS--VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               +      D+P    ++ F+ LD D D +L   EL PI   + P E  YA+    Y+I 
Sbjct  281   NHNATHPYHDLPEDPAKQLFSQLDKDGDGYLSDVELLPIISKIHPTEHYYAKQQADYIIS  340

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY--HDEL  1057
             +AD + DG+LTL EM+ H  +FY  I+ NE D DD Y  HDE 
Sbjct  341   QADSDKDGRLTLAEMIEHPYVFYSAIF-NEDDSDDDYGFHDEF  382



>ref|XP_010547693.1| PREDICTED: reticulocalbin-2-like [Tarenaya hassleriana]
Length=387

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 106/282 (38%), Positives = 162/282 (57%), Gaps = 11/282 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y ND+ + +   RL++LFP +D  P DGFV   EL  WN Q +   +
Sbjct  106   SQPEWEDFMDAEDYLNDEDKFNVTDRLIMLFPKIDVAPTDGFVTESELTDWNMQSSEKEI  165

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR + + D++ DG +SFSEY P     + + +  G+ D GWW  +  NA D D +G
Sbjct  166   IHRTQREMDVHDRNKDGFVSFSEYEPPSWVRNADNDSFGY-DMGWWKEEHFNASDADGDG  224

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LN+ EF +++HP D++N  +  WL  E++R+ D +KD K+S  EF  G ++T + Y+E 
Sbjct  225   LLNITEFNEWVHPADTKNPKLLMWLCKEEVRERDSDKDGKISFKEFFHGLFDTVRNYEEE  284

Query  773   ETSGI----DVPS--VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               +      D+P    ++ F  LD D D +L   EL PI   + P E  YA+    Y+I 
Sbjct  285   SHNSSHPHHDLPEGPAKQLFGQLDKDGDGYLSDAELLPIITKIHPTERYYAKQQADYIIS  344

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDI-YHDEL  1057
             +AD + DG+LTL EM+ H  +FY  I+D ++ +D+  YHDE 
Sbjct  345   QADSDKDGRLTLAEMIEHPYVFYSAIFDEDETDDEYGYHDEF  386



>ref|XP_010452869.1| PREDICTED: calumenin-A-like [Camelina sativa]
Length=394

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/282 (40%), Positives = 162/282 (57%), Gaps = 11/282 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y N++ + +   RL++LFP +D  P DGFV   EL  W  Q A   +
Sbjct  113   SQPEWEDFMDAEDYLNNEDKFNVTDRLIMLFPKIDVSPADGFVTESELTEWTMQSAAKEV  172

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR + + DK+ DG ISFSEY P     + + N  G+ D GWW  +  NA D + +G
Sbjct  173   IHRTQRDMDVHDKNKDGFISFSEYEPPSWVRNSDNNSFGY-DMGWWKEEHFNASDANGDG  231

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LNL EF DFLHP D++N N+  WL  E++R+ D +KD K+S  EF  G ++T + Y+E 
Sbjct  232   LLNLTEFNDFLHPADTKNPNLLLWLCKEEVRERDSDKDGKISFEEFFHGLFDTVRNYEED  291

Query  773   ETSGI----DVPS--VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               +      D+P    ++ F+ LD + D +L   EL PI   + P E  YA+    Y+I 
Sbjct  292   NHNSTHPYHDLPEGPAKQLFSQLDKNDDGYLSDVELLPIISKIHPTERYYAKQQADYIIS  351

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDI-YHDEL  1057
             +AD + DG+LTL EM+ H  +FY  I+D +  +DD  YHDE 
Sbjct  352   QADSDKDGRLTLAEMIEHPYVFYSAIFDEDDTDDDYGYHDEF  393



>dbj|BAK00840.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   180 bits (457),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 121/328 (37%), Positives = 168/328 (51%), Gaps = 34/328 (10%)
 Frame = +2

Query  161   RGLSRRLGTQGTAPPIFDPIVA---RR-----------KGLANP---------EKSDDDD  271
             RG + R G        FDP++A   RR            GL  P         + +D +D
Sbjct  55    RGENLRHGGATRHQIPFDPVIADLERRVDDREWERLAAAGLHAPGMESAPVPEDLADYED  114

Query  272   RYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRD  451
              Y ND  R +  LR+  LFP +D DP D  V   EL  WN   A   + +RT R L L D
Sbjct  115   EYINDAARFNMTLRVAALFPKIDVDPADDAVTGAELAAWNLASARREVLHRTARELDLHD  174

Query  452   KDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWM-IQFKNADVDRNGTLNLYEFRDFLH  628
             +D DG ++FSEY         + N +     GWW    F  AD+D +G LNL EF DFLH
Sbjct  175   RDHDGRVAFSEYERPSWAWRFDDNNSSSDGMGWWKEGHFNAADMDGDGFLNLTEFNDFLH  234

Query  629   PEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETS-----GIDV  793
             P D+ N  +  WL  E++R+ D + D KL+  EF +G + + + Y + ETS     G D 
Sbjct  235   PADTTNPKLIHWLCKEEIRERDKDADGKLNFQEFYKGLFYSVRHYDD-ETSTDDSNGSDA  293

Query  794   PSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLD  973
             P+  ++F  LD D D FL  +ELKPI   L P E  YA+    Y+I +AD N DG+L+L+
Sbjct  294   PA-RKSFLQLDLDNDGFLSADELKPIIGKLHPAENFYAKQQADYVISQADTNKDGQLSLN  352

Query  974   EMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             EM+ +  +FY  ++    ++D   HDEL
Sbjct  353   EMIENPYVFYSALF---TEDDYGSHDEL  377



>ref|XP_010423050.1| PREDICTED: calumenin-A-like [Camelina sativa]
Length=395

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/282 (40%), Positives = 162/282 (57%), Gaps = 11/282 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y N++ + +   RL++LFP +D  P DGFV   EL  W  Q A   +
Sbjct  114   SQPEWEDFMDAEDYLNNEDKFNVTDRLIMLFPKIDVSPADGFVTESELTEWTMQSAAKEV  173

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR + + DK+ DG ISFSEY P     + + N  G+ D GWW  +  NA D + +G
Sbjct  174   VHRTQRDMDVHDKNKDGFISFSEYEPPSWVRNSDNNSFGY-DMGWWKEEHFNASDANGDG  232

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LNL EF DFLHP D++N N+  WL  E++R+ D +KD K+S  EF  G ++T + Y+E 
Sbjct  233   LLNLTEFNDFLHPADTKNPNLLLWLCKEEVRERDSDKDGKISFEEFFHGLFDTVRNYEED  292

Query  773   ETSGI----DVPS--VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               +      D+P    ++ F+ LD + D +L   EL PI   + P E  YA+    Y+I 
Sbjct  293   NHNSTHPYHDLPEGPAKQLFSQLDKNDDGYLSDVELLPIISKIHPTERYYAKQQADYIIS  352

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDI-YHDEL  1057
             +AD + DG+LTL EM+ H  +FY  I+D +  +DD  YHDE 
Sbjct  353   QADSDKDGRLTLAEMIEHPYVFYSAIFDEDDTDDDYGYHDEF  394



>ref|XP_010491505.1| PREDICTED: calumenin-A-like [Camelina sativa]
Length=395

 Score =   181 bits (458),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 112/282 (40%), Positives = 162/282 (57%), Gaps = 11/282 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y N++ + +   RL++LFP +D  P DGFV   EL  W  Q A   +
Sbjct  114   SQPEWEDFMDAEDYLNNEDKFNVTDRLIMLFPKIDVSPADGFVTESELTEWTMQSAAKEV  173

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR + + DK+ DG ISFSEY P     + + N  G+ D GWW  +  NA D + +G
Sbjct  174   VHRTQRDMDVHDKNKDGFISFSEYEPPSWVRNSDNNSFGY-DMGWWKEEHFNASDANGDG  232

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LNL EF DFLHP D++N N+  WL  E++R+ D +KD K+S  EF  G ++T + Y+E 
Sbjct  233   LLNLTEFNDFLHPADTKNPNLLLWLCKEEVRERDSDKDGKISFEEFFHGLFDTVRNYEED  292

Query  773   ETSGI----DVPS--VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               +      D+P    ++ F+ LD + D +L   EL PI   + P E  YA+    Y+I 
Sbjct  293   NHNSTHPYHDLPEGPAKQLFSQLDKNDDGYLSDVELLPIISKIHPTERYYAKQQADYIIS  352

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDI-YHDEL  1057
             +AD + DG+LTL EM+ H  +FY  I+D +  +DD  YHDE 
Sbjct  353   QADSDKDGRLTLAEMIEHPYVFYSAIFDEDDTDDDYGYHDEF  394



>ref|NP_001141343.1| uncharacterized protein LOC100273434 [Zea mays]
 gb|ACF86129.1| unknown [Zea mays]
Length=377

 Score =   179 bits (455),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 105/272 (39%), Positives = 155/272 (57%), Gaps = 11/272 (4%)
 Frame = +2

Query  260   DDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRAL  439
             D D+ Y ND  R +  LR+  LFP +D DP DG V   EL  WN   A   + +RT R L
Sbjct  110   DADEDYINDAARFNVTLRVEALFPKIDVDPADGAVTGAELAAWNLANARREVLHRTAREL  169

Query  440   SLRDKDGDGSISFSEY-FPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYEF  613
              L D+D DG +++ EY  P +     + N T  G  GWW  + F  AD+D +G LNL EF
Sbjct  170   ELHDRDHDGRVAYGEYERPSWAWRFDDHNSTDDG-VGWWKEEHFSAADMDGDGFLNLTEF  228

Query  614   RDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF----ETS  781
              DFLHP D+ N  +  WL  E++R+ D + D KL+  EF  G + + + Y +     +T 
Sbjct  229   NDFLHPADTTNPKLIHWLCKEEVRERDKDNDGKLNFQEFFNGLFYSIRHYDDEGLTDDTG  288

Query  782   GIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGK  961
             G D P+ +++F+ LD D D  L  +ELKP+   L P E  YA+    Y+I +AD N DG+
Sbjct  289   GSDAPA-KKSFSHLDLDNDGLLSADELKPVIGNLHPSEYFYAKQQADYVISQADTNKDGQ  347

Query  962   LTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             L+++EM+ +  +FY+ ++    ++D  +HDEL
Sbjct  348   LSMNEMIENPYVFYNALF---TEDDYGFHDEL  376



>ref|XP_008681444.1| PREDICTED: uncharacterized protein LOC100273434 isoform X1 [Zea 
mays]
 ref|XP_008681445.1| PREDICTED: uncharacterized protein LOC100273434 isoform X1 [Zea 
mays]
Length=403

 Score =   180 bits (457),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 106/273 (39%), Positives = 156/273 (57%), Gaps = 12/273 (4%)
 Frame = +2

Query  260   DDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRAL  439
             D D+ Y ND  R +  LR+  LFP +D DP DG V   EL  WN   A   + +RT R L
Sbjct  135   DADEDYINDAARFNVTLRVEALFPKIDVDPADGAVTGAELAAWNLANARREVLHRTAREL  194

Query  440   SLRDKDGDGSISFSEY-FPQFTDE-DIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYE  610
              L D+D DG +++ EY  P +    D + N T  G  GWW  + F  AD+D +G LNL E
Sbjct  195   ELHDRDHDGRVAYGEYERPSWAWRFDADHNSTDDG-VGWWKEEHFSAADMDGDGFLNLTE  253

Query  611   FRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF----ET  778
             F DFLHP D+ N  +  WL  E++R+ D + D KL+  EF  G + + + Y +     +T
Sbjct  254   FNDFLHPADTTNPKLIHWLCKEEVRERDKDNDGKLNFQEFFNGLFYSIRHYDDEGLTDDT  313

Query  779   SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDG  958
              G D P+ +++F+ LD D D  L  +ELKP+   L P E  YA+    Y+I +AD N DG
Sbjct  314   GGSDAPA-KKSFSHLDLDNDGLLSADELKPVIGNLHPSEYFYAKQQADYVISQADTNKDG  372

Query  959   KLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             +L+++EM+ +  +FY+ ++    ++D  +HDEL
Sbjct  373   QLSMNEMIENPYVFYNALF---TEDDYGFHDEL  402



>ref|XP_008681446.1| PREDICTED: uncharacterized protein LOC100273434 isoform X2 [Zea 
mays]
 gb|AFW71297.1| hypothetical protein ZEAMMB73_749984 [Zea mays]
 gb|AFW71298.1| hypothetical protein ZEAMMB73_749984 [Zea mays]
Length=402

 Score =   180 bits (456),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/272 (39%), Positives = 155/272 (57%), Gaps = 11/272 (4%)
 Frame = +2

Query  260   DDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRAL  439
             D D+ Y ND  R +  LR+  LFP +D DP DG V   EL  WN   A   + +RT R L
Sbjct  135   DADEDYINDAARFNVTLRVEALFPKIDVDPADGAVTGAELAAWNLANARREVLHRTAREL  194

Query  440   SLRDKDGDGSISFSEY-FPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYEF  613
              L D+D DG +++ EY  P +     + N T  G  GWW  + F  AD+D +G LNL EF
Sbjct  195   ELHDRDHDGRVAYGEYERPSWAWRFDDHNSTDDG-VGWWKEEHFSAADMDGDGFLNLTEF  253

Query  614   RDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF----ETS  781
              DFLHP D+ N  +  WL  E++R+ D + D KL+  EF  G + + + Y +     +T 
Sbjct  254   NDFLHPADTTNPKLIHWLCKEEVRERDKDNDGKLNFQEFFNGLFYSIRHYDDEGLTDDTG  313

Query  782   GIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGK  961
             G D P+ +++F+ LD D D  L  +ELKP+   L P E  YA+    Y+I +AD N DG+
Sbjct  314   GSDAPA-KKSFSHLDLDNDGLLSADELKPVIGNLHPSEYFYAKQQADYVISQADTNKDGQ  372

Query  962   LTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             L+++EM+ +  +FY+ ++    ++D  +HDEL
Sbjct  373   LSMNEMIENPYVFYNALF---TEDDYGFHDEL  401



>ref|XP_002451795.1| hypothetical protein SORBIDRAFT_04g007870 [Sorghum bicolor]
 gb|EES04771.1| hypothetical protein SORBIDRAFT_04g007870 [Sorghum bicolor]
Length=379

 Score =   179 bits (454),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 106/274 (39%), Positives = 155/274 (57%), Gaps = 11/274 (4%)
 Frame = +2

Query  254   KSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQR  433
             ++D D+ Y ND  R +   R+  LFP +D DP DG V   EL  WN   A   + +RT R
Sbjct  110   EADADEDYINDAARFNVTHRVEALFPKIDVDPADGAVTGAELAAWNLANARREVLHRTAR  169

Query  434   ALSLRDKDGDGSISFSEY-FPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLY  607
              L L D+D DG ++F EY  P +     + N T  G  GWW  + F  AD+D +G LNL 
Sbjct  170   ELELHDRDHDGRVAFGEYERPSWAWRFDDHNSTNDG-VGWWKEEHFNAADMDGDGFLNLT  228

Query  608   EFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF----E  775
             EF DFLHP D+ N  +  WL  E++R+ D + D KL+  EF  G + + + Y +     +
Sbjct  229   EFNDFLHPADTTNPKLINWLCKEEVRERDKDNDGKLNFQEFFSGLFYSIRHYDDEGITDD  288

Query  776   TSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNND  955
             T G D P+ +++F+ LD D D  L  +ELKPI   L P E  YA+    Y+I +AD N D
Sbjct  289   TGGSDAPA-KKSFSHLDLDNDGLLSADELKPIIDNLHPSEHFYAKQQADYVISQADTNKD  347

Query  956   GKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             G+L ++EM+ +  +FY+ ++    ++D  +HDEL
Sbjct  348   GQLNMNEMIENPYVFYNALF---TEDDYGFHDEL  378



>ref|XP_002310630.2| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEE91080.2| calcium-binding EF hand family protein [Populus trichocarpa]
Length=373

 Score =   179 bits (453),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 127/384 (33%), Positives = 196/384 (51%), Gaps = 64/384 (17%)
 Frame = +2

Query  59    GKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLS----RRLGTQG----------T  196
             GK + ++  TIA  F++L+            ++P+  S    RR+  +            
Sbjct  2     GKTSIIMYITIALLFLLLVT-----------HTPKKPSNLRNRRIKIRNDFAFDPRHHHH  50

Query  197   APPIFDPIVA-----------RRKGLAN-----------------PEKSD--DDDRYFND  286
              P  FDP+VA            R+ L N                 PE  D  D + Y ND
Sbjct  51    EPVPFDPLVADIERKREDKEWERQYLENSHPELVHHSAAPGHESQPEVDDFMDAEDYLND  110

Query  287   KGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDG  466
             + + +   RL+VLFP +D +P DG++   EL  W+ +Q+   + +RT+R + + DK+ DG
Sbjct  111   EEKFNVTNRLLVLFPKIDMEPVDGYLSEHELTEWSLKQSEKEVMHRTKREMDVHDKNHDG  170

Query  467   SISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSR  643
              ISF+EY P     + ++N  G+ D GWW  +  NA D D +G LN+ EF DF HP DS+
Sbjct  171   LISFAEYEPPSWVHNSDKNSFGY-DMGWWKEEHFNASDADGDGLLNITEFNDFQHPADSK  229

Query  644   NDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE--FETSGIDVPSVE----  805
             N  + +WL  E++R+ D +KD K++  EF  G +++ + Y E    +S +   SVE    
Sbjct  230   NPKLLQWLCKEEVRERDSDKDGKVNFQEFFHGLFDSVRNYDEEGHNSSHLSDDSVEAPAK  289

Query  806   ETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMN  985
             + F  LD D D FL   EL  I   L P E  YA+    Y++ ++D + DG+L+L EM+ 
Sbjct  290   KLFNELDKDADGFLSDVELLHIIGKLHPSERYYAKQQADYILSQSDTDKDGRLSLTEMIE  349

Query  986   HDTLFYDTIYDNEKDEDDIYHDEL  1057
             +  +FY  I+ +E +EDDI HDE 
Sbjct  350   NPYVFYSAIFSDEDNEDDI-HDEF  372



>ref|XP_006286619.1| hypothetical protein CARUB_v10002410mg [Capsella rubella]
 gb|EOA19517.1| hypothetical protein CARUB_v10002410mg [Capsella rubella]
Length=392

 Score =   179 bits (454),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 162/282 (57%), Gaps = 11/282 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y N++ + +   RL++LFP +D  P DGFV   EL  W  Q A   +
Sbjct  111   SQPEWEDFMDAEDYLNNEEKFNVTDRLILLFPKIDVSPADGFVTESELTEWTMQSAAKEV  170

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR + + D++ DG ISFSEY P     + + N  G+ D GWW  +  NA D + +G
Sbjct  171   IHRTQRDMDVHDRNKDGFISFSEYEPPSWVRNSDNNSFGY-DMGWWKEEHFNASDANGDG  229

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LNL EF DFLHP D++N N+  WL  E++R+ D +KD K+S  EF  G ++T + Y+E 
Sbjct  230   LLNLTEFNDFLHPADTKNPNLLLWLCKEEVRERDSDKDGKISFEEFFHGLFDTVRNYEED  289

Query  773   ETSGI----DVPS--VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               +      D+P    ++ F+ LD + D +L   EL PI   + P E  YA+    Y+I 
Sbjct  290   NHNSTHPYHDLPEGPAKQLFSQLDKNDDGYLSDVELLPIISKIHPDERYYAKQQADYIIS  349

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDI-YHDEL  1057
             +AD + DG+LTL EM+ H  +FY  I+D +  +DD  YHDE 
Sbjct  350   QADSDKDGRLTLAEMIEHPYVFYSAIFDEDDTDDDYGYHDEF  391



>ref|XP_002447340.1| hypothetical protein SORBIDRAFT_06g033220 [Sorghum bicolor]
 gb|EES11668.1| hypothetical protein SORBIDRAFT_06g033220 [Sorghum bicolor]
Length=362

 Score =   178 bits (452),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 107/267 (40%), Positives = 152/267 (57%), Gaps = 28/267 (10%)
 Frame = +2

Query  272   RYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRD  451
             RYF   G LD   RL  LF ILDR P DG V V ELE W  +QA+ RL+  T+R ++  D
Sbjct  119   RYFGLDGPLDVRQRLAYLFVILDRSPRDGGVGVDELEAWLRRQAVARLDAVTRREMARHD  178

Query  452   KDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHP  631
             +D +G+++  E+F  +++        GHG    WM +F +AD + +G+LN  EF DFLHP
Sbjct  179   RDRNGAVTLREFFADWSN-------MGHGKMARWMDKFASADRNGDGSLNAVEFNDFLHP  231

Query  632   EDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEET  811
             ED+  +++  WLL +KL +MD + D +++L EF                S ++    EE 
Sbjct  232   EDTSQESVMLWLLKDKLSEMDHDGDGRINLEEF-------------VAQSDLERAEAEEK  278

Query  812   FTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHD  991
             F  LDAD D++L VEE + +   L  GE SYA  +  +L++ AD N DGKL+L+EM++  
Sbjct  279   FRELDADMDNYLTVEEARSVLQSLITGEFSYATSHAKFLMK-ADVNQDGKLSLEEMLDDY  337

Query  992   TLFYDTI-----YDNEKDEDDIYHDEL  1057
               FY T+     Y NE D D   HDEL
Sbjct  338   VSFYSTVYTDDHYSNEVDSDS--HDEL  362



>ref|XP_006399364.1| hypothetical protein EUTSA_v10013753mg [Eutrema salsugineum]
 gb|ESQ40817.1| hypothetical protein EUTSA_v10013753mg [Eutrema salsugineum]
Length=393

 Score =   177 bits (449),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 161/283 (57%), Gaps = 12/283 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y ND+ + +   RL+ LFP +D  P DGFV   EL  WN Q +   +
Sbjct  111   SQPEWEDFMDAEDYLNDEAKFNVTDRLISLFPKIDVSPEDGFVTESELTEWNMQSSAKEV  170

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR + + D++ DG ISF EY P     + + N  G+ D GWW  +  NA D + +G
Sbjct  171   MHRTQRDMDVHDRNKDGFISFPEYEPPSWVRNSDNNSFGY-DMGWWKEEHFNASDANGDG  229

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LNL EF DFLHP D++N  +  WL  E++R+ D +KD K+S  EF  G ++T ++Y+E 
Sbjct  230   LLNLTEFNDFLHPADTKNPKLLLWLCKEEVRERDSDKDGKISFEEFFHGLFDTVRSYEED  289

Query  773   ETSGI----DVP--SVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               +      D+P    ++ F  LD D D +L   EL P+ + + P E  YA+    Y+I 
Sbjct  290   NINSTHPYHDLPEGPAKQLFAQLDKDDDGYLSDVELLPVINKIHPTEHYYAKQQADYIIS  349

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDI--YHDEL  1057
             +AD + DG+L L EM+ H  +FY  I+D+E D DD   YHDE 
Sbjct  350   QADSDKDGRLALAEMIEHPYVFYSAIFDSEDDTDDDYGYHDEF  392



>ref|NP_001046324.2| Os02g0221800 [Oryza sativa Japonica Group]
 dbj|BAF08238.2| Os02g0221800 [Oryza sativa Japonica Group]
Length=383

 Score =   176 bits (447),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 106/273 (39%), Positives = 153/273 (56%), Gaps = 11/273 (4%)
 Frame = +2

Query  257   SDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRA  436
             +D D+ Y ND  R +   R+  LFP +D DP DG V   EL  WN   A   + +RT R 
Sbjct  115   ADPDEDYINDAARFNLTRRVEALFPKIDVDPADGAVTPAELTAWNLASARREVMHRTARE  174

Query  437   LSLRDKDGDGSISFSEY-FPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYE  610
             L L D+D DG I+FSEY  P +     + N +  G  GWW  + F  +D+D +G LNL E
Sbjct  175   LDLHDRDHDGRIAFSEYERPSWAWRFDDHNSSNDG-VGWWKEEHFNASDMDGDGFLNLIE  233

Query  611   FRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF----ET  778
             F DFLHP D+ N  +  WL  E++R+ D + D KL+  EF  G + + + + E     ++
Sbjct  234   FNDFLHPADTTNPKLINWLCKEEVRERDKDNDGKLNFQEFYNGLFYSIRHFDEEASTDDS  293

Query  779   SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDG  958
             +  D P+  ++FT LD D D  L  +ELKPI   L P E  YA+    Y+I +AD N DG
Sbjct  294   NASDAPA-RKSFTHLDLDNDGLLSADELKPIIGNLHPPEHFYAKQQADYVITQADTNKDG  352

Query  959   KLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             +L+L EM+ +  +FY  ++    ++D  +HDEL
Sbjct  353   QLSLQEMIENPYVFYSALF---TEDDYGFHDEL  382



>ref|XP_008782525.1| PREDICTED: calumenin [Phoenix dactylifera]
Length=371

 Score =   176 bits (446),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 99/265 (37%), Positives = 148/265 (56%), Gaps = 10/265 (4%)
 Frame = +2

Query  284   DKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGD  463
             D+ R +   R++ LFP +D  P DGFV   EL  WN +QA   + +RT+R + L DK+ D
Sbjct  109   DEDRFNITHRIIDLFPKIDVGPADGFVSSDELTQWNLKQAEREVMHRTERDMELHDKNRD  168

Query  464   GSISFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLHPEDS  640
             G ISF EY P         + +     GWW    F  +DVD NG LNL EF DFLHP DS
Sbjct  169   GFISFHEYEPPSWAHRFHDSNSTDDKVGWWKEDHFNASDVDENGLLNLTEFNDFLHPADS  228

Query  641   RNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF------ETSGIDVPSV  802
              N  +  WL TE++R+ D ++D KL+  E+ +G +++ + Y E         + ++ P+ 
Sbjct  229   SNPKLMHWLCTEEIRERDKDRDGKLNFQEYFKGLFDSLRNYDEVYIPTDQSDTSVEAPA-  287

Query  803   EETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMM  982
             ++ F+ LD D D  L  +EL P+   L P E  YA+    Y++ +AD + DG+L+L EM+
Sbjct  288   KKLFSKLDQDNDGLLSEDELLPVIGNLHPSEHYYAKQQADYVLMQADTDKDGRLSLREMI  347

Query  983   NHDTLFYDTIYDNEKDEDDIYHDEL  1057
              +  +FY  I+  E +E   +HDE 
Sbjct  348   ENPYVFYSAIFSEEDEEG--FHDEF  370



>ref|XP_004951461.1| PREDICTED: reticulocalbin-1-like isoform X1 [Setaria italica]
 ref|XP_004951462.1| PREDICTED: reticulocalbin-1-like isoform X2 [Setaria italica]
Length=380

 Score =   176 bits (446),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 111/300 (37%), Positives = 161/300 (54%), Gaps = 12/300 (4%)
 Frame = +2

Query  176   RLGTQGTAPPIFDPIVARRKGLANPEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCD  355
             RL   G   P  +        L++ E   D+D Y ND  R +   R+  LFP +D DP D
Sbjct  86    RLAAAGLHAPGMEAAPVPEDLLSDGEAGADED-YINDAARFNVTRRVEELFPRIDVDPAD  144

Query  356   GFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-FPQFTDEDIERNETG  532
             G V   EL  WN   A   + +RT R L L D+D DG ++F EY  P +     + N T 
Sbjct  145   GAVTGDELAAWNLANARREVLHRTARELELHDRDRDGRLAFGEYERPSWAWRFDDHNSTN  204

Query  533   HGDAGWWMIQ-FKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQ  709
              G  GWW  + F  AD+D +G LNL EF DFLHP D+ N  +  WL  E++R+ D + D 
Sbjct  205   DG-VGWWKEEHFSAADMDDDGFLNLTEFNDFLHPADTANPKLIHWLCKEEVRERDKDNDG  263

Query  710   KLSLLEFERGAYETYKTYKEF----ETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFH  877
             KL+  EF  G + + + Y +     +T G D P+ +++F+ LD D D  L  +ELKPI  
Sbjct  264   KLNFQEFFSGLFYSIRHYDDEGITDDTGGSDAPA-KKSFSHLDLDNDGLLSADELKPIID  322

Query  878   YLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
              L P E  YA+    Y+I +AD + DG+L++ EM+ +  +FY+ ++    + D  +HDEL
Sbjct  323   NLHPSEHFYAKQQADYVISQADTDKDGQLSMKEMIENPYVFYNALF---TENDYGFHDEL  379



>ref|XP_010031375.1| PREDICTED: reticulocalbin-2 [Eucalyptus grandis]
 ref|XP_010031376.1| PREDICTED: reticulocalbin-2 [Eucalyptus grandis]
 gb|KCW50654.1| hypothetical protein EUGRSUZ_J00344 [Eucalyptus grandis]
 gb|KCW50655.1| hypothetical protein EUGRSUZ_J00344 [Eucalyptus grandis]
Length=382

 Score =   175 bits (444),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 154/269 (57%), Gaps = 12/269 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             A PE  D  D + Y ND+ R +   RL+ LFP +D DP DGFV   EL  WN QQA++ +
Sbjct  103   AQPEWGDFVDAEDYLNDEERFNVTNRLVSLFPKIDVDPPDGFVTEHELTEWNLQQAVSEV  162

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR + L DK+ DG +SF+EY P       + N++   + GWW  +  NA D D +G
Sbjct  163   MHRTQREMELHDKNRDGYVSFAEYEPPSWVHSSD-NDSFAFNMGWWKEEHFNASDADGDG  221

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LN+ EF DFLHP DS+N  + +WL  E++R+ D +KD K++  EF  G ++  + Y E 
Sbjct  222   LLNITEFNDFLHPADSKNPKLLQWLSKEEVRERDSDKDGKVNFKEFFHGLFDLVRNYDEE  281

Query  773   ETS-------GIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLI  931
               +        ++ P+    F  LD D D +L   EL P+   L P E  YA+    Y++
Sbjct  282   SHNSSHNSDDSMEAPA-RVLFNQLDKDGDGYLSDVELLPVIGKLHPSERYYAKQQADYIL  340

Query  932   READDNNDGKLTLDEMMNHDTLFYDTIYD  1018
              +AD++ DG LTL EM+++  +FY  +++
Sbjct  341   SQADNDKDGHLTLTEMIDNPYVFYSAVFN  369



>ref|XP_011021981.1| PREDICTED: reticulocalbin-2-like [Populus euphratica]
 ref|XP_011021982.1| PREDICTED: reticulocalbin-2-like [Populus euphratica]
 ref|XP_011021983.1| PREDICTED: reticulocalbin-2-like [Populus euphratica]
Length=375

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 180/360 (50%), Gaps = 46/360 (13%)
 Frame = +2

Query  68    TKVVAYTIAAAFVILLLSQDHNKLFR------KDYSPRGLSRRLGTQGTAPPIFDPIVA-  226
             T ++ Y   A   +LL++Q  NK         K  S      R       P  FDP+VA 
Sbjct  4     TSIIIYITIALLFLLLVTQTPNKPSNHRNRRIKIRSKFDFDPRHHNHHHEPVPFDPVVAD  63

Query  227   -RRK--------------------------GLANPEKSD--DDDRYFNDKGRLDTGLRLM  319
               RK                            + PE  D  D + Y ND+ + +   RL+
Sbjct  64    IERKREDKEWEKQYFEHSHPEFVHDSAAAGHESQPEWEDFIDAEDYVNDEEKFNVTNRLL  123

Query  320   VLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQF  499
             VLFP +D +P DG+V V EL  WN +Q+   + +RT+R + + DK+ DG +SF+EY P  
Sbjct  124   VLFPKIDVEPDDGYVSVHELTEWNLKQSEKEVMHRTKREMDVHDKNHDGLVSFAEYDPPS  183

Query  500   TDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTE  676
                + ++N  G+ D GWW  +  NA D D +G LN+ EF DF HP DS+N  + +WL  E
Sbjct  184   WVRNSDKNSFGY-DMGWWKEEHFNASDADGDGFLNITEFNDFQHPADSKNPKLLQWLCKE  242

Query  677   KLRQMDVNKDQKLSLLEFERGAYETYKTYKE-------FETSGIDVPSVEETFTLLDADK  835
             ++R+ D +KD K++  EF  G ++  + Y E          + ++ P+ ++ F  LD D 
Sbjct  243   EVRERDSDKDGKVNFQEFFHGLFDLVRNYDEEGHNSSHLSDNLMEAPA-KKLFNELDKDG  301

Query  836   DSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             D FL   EL PI   L P E  YA+    Y++ +AD + DG+L+L EM+ +  +FY  I+
Sbjct  302   DGFLSDIELLPIIGKLHPSERYYAKQQADYILSQADSDKDGRLSLTEMIENPYVFYSAIF  361



>ref|XP_011013553.1| PREDICTED: reticulocalbin-2-like [Populus euphratica]
 ref|XP_011013554.1| PREDICTED: reticulocalbin-2-like [Populus euphratica]
 ref|XP_011013555.1| PREDICTED: reticulocalbin-2-like [Populus euphratica]
Length=375

 Score =   174 bits (442),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 119/360 (33%), Positives = 180/360 (50%), Gaps = 46/360 (13%)
 Frame = +2

Query  68    TKVVAYTIAAAFVILLLSQDHNKLFR------KDYSPRGLSRRLGTQGTAPPIFDPIVA-  226
             T ++ Y   A   +LL++Q  NK         K  S      R       P  FDP+VA 
Sbjct  4     TSIIIYVTIALLFLLLVTQTPNKPSNHRNRRIKIRSKFDFDPRHHNHHHEPVPFDPLVAD  63

Query  227   -RRK--------------------------GLANPEKSD--DDDRYFNDKGRLDTGLRLM  319
               RK                            + PE  D  D + Y ND+ + +   RL+
Sbjct  64    IERKREDKEWEKQYFEHSHPEFVHDSAAAGHESQPEWEDFIDAEDYVNDEEKFNVTNRLL  123

Query  320   VLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQF  499
             VLFP +D +P DG+V V EL  WN +Q+   + +RT+R + + DK+ DG +SF+EY P  
Sbjct  124   VLFPKIDVEPDDGYVSVHELTEWNLKQSEKEVMHRTKREMDVHDKNHDGLVSFAEYDPPS  183

Query  500   TDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTE  676
                + ++N  G+ D GWW  +  NA D D +G LN+ EF DF HP DS+N  + +WL  E
Sbjct  184   WVRNSDKNSFGY-DMGWWKEEHFNASDADGDGFLNITEFNDFQHPADSKNPKLLQWLCKE  242

Query  677   KLRQMDVNKDQKLSLLEFERGAYETYKTYKE-------FETSGIDVPSVEETFTLLDADK  835
             ++R+ D +KD K++  EF  G ++  + Y E          + ++ P+ ++ F  LD D 
Sbjct  243   EVRERDSDKDGKVNFQEFFHGLFDLVRNYDEEGHNSSHLSDNLMEAPA-KKLFNELDKDG  301

Query  836   DSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             D FL   EL PI   L P E  YA+    Y++ +AD + DG+L+L EM+ +  +FY  I+
Sbjct  302   DGFLSDIELLPIIGKLHPSERYYAKQQADYILSQADSDKDGRLSLTEMIENPYVFYSAIF  361



>ref|XP_011070474.1| PREDICTED: calumenin [Sesamum indicum]
 ref|XP_011070475.1| PREDICTED: calumenin [Sesamum indicum]
Length=384

 Score =   175 bits (443),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 103/288 (36%), Positives = 160/288 (56%), Gaps = 10/288 (3%)
 Frame = +2

Query  221   VARRKGLANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNT  394
              A+    + PE  D  D + Y N++ + +   RL++LFP +D DP D FV   EL  WN 
Sbjct  97    TAQGHDASEPEWEDFMDAEDYLNNEEKFNVTYRLILLFPKIDVDPVDDFVSEGELTEWNL  156

Query  395   QQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQ-FKN  571
             QQ    + +RT+R + + DK+ DG +SF+EY      +  +    G+ D GWW  + F  
Sbjct  157   QQGQREVLHRTEREMEVHDKNKDGFVSFAEYEAPSWVKSSDNTSFGY-DMGWWKEEHFNA  215

Query  572   ADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYET  751
             AD D +G LN+ EF DFLHP D+ N  + RWL  E++R+ D ++D K++  EF  G ++ 
Sbjct  216   ADADGDGLLNITEFNDFLHPADTNNPKLLRWLCQEEIREGDSDRDSKINFKEFFHGIFDM  275

Query  752   YKTYKE------FETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARY  913
              + Y E       E+  +     ++ F  LD D D +L   EL PI   + P E  YA+ 
Sbjct  276   VRNYDEEGNHSSHESDDLVEAPAKKLFAQLDKDGDGYLSDVELLPIIGKIHPSERYYAKQ  335

Query  914   YTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
              + Y++++AD N DG+LTL EM+ +  +FY  +++ + D+D  YHDE 
Sbjct  336   QSEYIMQQADTNKDGRLTLMEMIENPYVFYSAVFNEDDDDDYGYHDEF  383



>ref|XP_011009182.1| PREDICTED: reticulocalbin-2-like [Populus euphratica]
Length=371

 Score =   174 bits (441),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 127/379 (34%), Positives = 191/379 (50%), Gaps = 59/379 (16%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGL-SRRLGTQG----------TAPPIF  211
             MT ++ Y   A   +LL++    K       P  L +RR+  +             P  F
Sbjct  3     MTSIIMYITIALLFLLLVTHTPKK-------PSNLRNRRIKIRNDFAFDPRHHHHEPVPF  55

Query  212   DPIVA-----------RRKGLAN-----------------PEKSD--DDDRYFNDKGRLD  301
             DP+VA            R+ L N                 PE  D  D + Y ND+ + +
Sbjct  56    DPLVADIERKREDKEWERRYLENSHSELVHHSAAPGHESQPEGDDFMDAEDYLNDEEKFN  115

Query  302   TGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFS  481
                RL+VLFP +D +P DG+V   EL  W+ +Q+   + +RT+R + + DK+ DG ISF+
Sbjct  116   VTNRLLVLFPKIDVEPVDGYVSEHELTEWSLKQSEKEVMHRTKREMDVHDKNHDGLISFA  175

Query  482   EYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIR  658
             EY P     + ++N  G+ D GWW  +  NA D D +G LN+ EF DF HP DS+N  + 
Sbjct  176   EYEPPSWVHNSDKNSFGY-DMGWWKEEHFNASDADGDGLLNITEFNDFQHPADSKNPKLL  234

Query  659   RWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE--FETSGIDVPSVE----ETFTL  820
             +WL  E++R  D +KD K++  EF  G +++ + Y E    +S +   SVE    + F  
Sbjct  235   QWLCKEEVR--DSDKDGKVNFQEFFHGLFDSVRNYDEEGHNSSHLSDDSVEAPAKKLFNE  292

Query  821   LDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLF  1000
             LD D D FL   EL  I   L P E  YA+    Y++ ++D + DG+L+L EM+ +  +F
Sbjct  293   LDKDADGFLSDVELLHIIGKLHPSERYYAKQQADYILSQSDTDKDGRLSLTEMIENPYVF  352

Query  1001  YDTIYDNEKDEDDIYHDEL  1057
             Y  I+ +E +E DI HDE 
Sbjct  353   YSAIFSDEDNEYDI-HDEF  370



>gb|EEC72762.1| hypothetical protein OsI_06410 [Oryza sativa Indica Group]
Length=383

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 104/272 (38%), Positives = 149/272 (55%), Gaps = 9/272 (3%)
 Frame = +2

Query  257   SDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRA  436
             +D D+ Y ND  R +   R+  LFP +D DP DG V   EL  WN   A   + +RT R 
Sbjct  115   ADPDEDYINDAARFNLTRRVEALFPKIDVDPADGAVTPAELTAWNLASARREVMHRTARE  174

Query  437   LSLRDKDGDGSISFSEY-FPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYE  610
             L L D+D DG I+FSEY  P +     + N +  G  GWW  + F  +D+D +G LNL E
Sbjct  175   LDLHDRDHDGRIAFSEYERPSWAWRFDDHNSSNDG-VGWWKEEHFNASDMDGDGFLNLTE  233

Query  611   FRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFET---S  781
             F DFLHP D+ N  +  WL  E++R+ D + D KL+  EF  G + + + + E  +   S
Sbjct  234   FNDFLHPADTTNPKLINWLCKEEVRERDKDNDGKLNFQEFYNGLFYSIRHFDEEASTDDS  293

Query  782   GIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGK  961
              +      ++FT LD D D  L  +ELKP    L P E  YA+    Y+I +AD N DG+
Sbjct  294   NVSDAPARKSFTHLDLDNDGLLSADELKPTIGNLHPPEHFYAKQQADYVITQADTNKDGQ  353

Query  962   LTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             L+L EM+ +  +FY  ++    ++D  +HDEL
Sbjct  354   LSLQEMIENPYVFYSALF---TEDDYGFHDEL  382



>ref|XP_002873373.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49632.1| calcium-binding EF hand family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   174 bits (442),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 111/282 (39%), Positives = 158/282 (56%), Gaps = 11/282 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y ND+ + +   RLM+LFP +D  P DGFV   EL  W  Q +   +
Sbjct  110   SQPEWEDFMDAEDYLNDEEKFNVTDRLMLLFPKIDVSPTDGFVTESELTEWTMQSSAKEV  169

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
              +RTQR L + D++ DG ISFSEY P       + N  G+ D GWW  +  NA D + +G
Sbjct  170   VHRTQRDLDVHDRNKDGFISFSEYEPPSWVRKSDNNSFGY-DMGWWKEEHFNASDANGDG  228

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
              LNL EF DFLHP D++N  +  WL  E++R+ D +KD K+S  EF  G ++T + Y+E 
Sbjct  229   LLNLTEFNDFLHPADTKNPKLLLWLCKEEVRERDSDKDGKISFEEFFHGLFDTVRNYEED  288

Query  773   ETSGI----DVP--SVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               +      D+P    ++ F  LD + D +L   EL PI   + P E  YA+    Y+I 
Sbjct  289   NHNSTHPYHDLPEGPAKQLFAQLDKNDDGYLSDVELLPIISKIHPTEHYYAKQQADYIIS  348

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDI-YHDEL  1057
             +AD + D +LTL EM+ H  +FY  I+D +  +DD  YHDE 
Sbjct  349   QADSDKDRRLTLAEMIEHPYVFYSAIFDEDDTDDDYGYHDEF  390



>gb|KHG01010.1| Calumenin-A [Gossypium arboreum]
Length=359

 Score =   172 bits (437),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 120/363 (33%), Positives = 183/363 (50%), Gaps = 36/363 (10%)
 Frame = +2

Query  59    GKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRR-----LGTQGTAPPIFDPIV  223
             G+++ +V  T+A   +IL +     K    D   R +  R     +      P  FDP+V
Sbjct  2     GELSAIVYMTLA--LLILFIISYSPKKHPADNRRRLVKLRSSFSFINPARHEPVAFDPLV  59

Query  224   A-------------------RRKGLANPEKSDDD----DRYFNDKGRLDTGLRLMVLFPI  334
             A                   R   L  PE +++     + Y ND+ + +   RL++LFP 
Sbjct  60    AKIERLREDKQWEKQYVEHFRPDYLQYPEPAEESQPETEDYLNDEDKFNVTNRLVLLFPK  119

Query  335   LDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-FPQFTDED  511
             +D DP DGFV   EL  WN QQA+    +R+ R + + D + DG +S++EY  P +   D
Sbjct  120   IDVDPADGFVTENELIEWNLQQAMKEEWFRSLREMEIHDINNDGLVSYAEYEAPSWVKND  179

Query  512   IERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQ  688
                   GH D GWW  + F  +D D +  LNL EF DF+HP DS+N  + +WL  +++R+
Sbjct  180   YAS--FGH-DMGWWTEEHFYASDADGDHVLNLTEFNDFMHPADSKNPKLLQWLCKKEVRE  236

Query  689   MDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKP  868
              D +KD K++  EF  G ++    +   + S       +  F+ LD D D  L  EEL P
Sbjct  237   RDADKDGKVNFDEFFHGVFDLVINHDPSDYSMDAETPAKRMFSQLDKDGDRLLSDEELVP  296

Query  869   IFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYH  1048
             I   L P E  YA+    Y+I +AD N DG+L+L EM+++  +FY  I+ N+ ++D  YH
Sbjct  297   IIGKLHPSEWYYAKQQADYIISQADLNKDGRLSLVEMIDNPYVFYTAIF-NDSEDDYEYH  355

Query  1049  DEL  1057
             DE 
Sbjct  356   DEF  358



>emb|CDX69937.1| BnaA10g22860D [Brassica napus]
Length=379

 Score =   173 bits (439),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 121/364 (33%), Positives = 178/364 (49%), Gaps = 47/364 (13%)
 Frame = +2

Query  59    GKMTKVVAYTIAAAFVILLLS--------QDHNKLFRKDYSPRGLSRRLGTQGTA--PPI  208
             GK + V+ Y      V+ L+S         DHN      +    L      + T   P  
Sbjct  2     GKAS-VILYITVGILVLFLVSYSPKKKSHHDHNGGHNSQHHRLKLRSSFNFKPTRHDPIP  60

Query  209   FDPIVA---RRKG---------------LANP----------EKSDDDDRYFNDKGRLDT  304
             FDP+VA   RR+                LA+P          E+  D + Y ND+ + + 
Sbjct  61    FDPLVADMERRREDKEWERQYIEHSHPELASPAPGQESQPEWEEFMDAEDYLNDEEKFNV  120

Query  305   GLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
               RL+ LFP +D  P DG+V   EL  WN Q +   + +R+QR + + D++ DG ISFSE
Sbjct  121   TDRLISLFPKIDVSPLDGYVTESELTEWNVQSSAKEVMHRSQRDMDVHDRNKDGFISFSE  180

Query  485   YFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRR  661
             Y P     D      G+ D GWW  +  NA D + +G LNL EF DFLHP D++N  +  
Sbjct  181   YEPPSWARDSGNYSFGY-DIGWWKEEHFNASDANGDGLLNLTEFNDFLHPADTKNPKLLL  239

Query  662   WLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI----DVP--SVEETFTLL  823
             WL  E++R+ D +KD K+   EF  G ++  ++Y+E   +      D+P    ++ F  L
Sbjct  240   WLCKEEVRERDSDKDGKIGFDEFFHGLFDAVRSYEEDNLNATHPYHDLPEGPAKQLFAQL  299

Query  824   DADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFY  1003
             D D D +L   EL P+   + P E  YA+    Y+I +AD + DG+LTL EM+ H  +FY
Sbjct  300   DKDGDGYLSDVELLPVISKIHPTEHYYAKEQADYIISKADSDKDGRLTLAEMIEHPYVFY  359

Query  1004  DTIY  1015
               I+
Sbjct  360   SAIF  363



>ref|XP_004963374.1| PREDICTED: calumenin-A-like [Setaria italica]
Length=357

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 105/268 (39%), Positives = 147/268 (55%), Gaps = 18/268 (7%)
 Frame = +2

Query  272   RYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRD  451
             RYF     L    RL+ LF ILDR P DG V + ELE W  + A  RL   T+R ++  D
Sbjct  102   RYFGPAAPLGVRERLVYLFAILDRSPRDGGVSLAELEAWLRRHAAARLEAATRREMAKHD  161

Query  452   KDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHP  631
             ++GDG+++ SEY                G    W+ +F  AD D +G+LN  E  DFLHP
Sbjct  162   RNGDGAVALSEY-----------RGMKPGKPWGWLHKFATADGDGDGSLNAAELNDFLHP  210

Query  632   EDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFER--GAYETYKTYKEFETSGIDVPSVE  805
             EDS ++ ++ WLL +KL +MD + D++LSL EF     A +           G+     E
Sbjct  211   EDSSHETMQLWLLKDKLSEMDHDGDRRLSLEEFVHLSHALDHISIAHHLGDHGLARAQAE  270

Query  806   ETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMN  985
             + F  LDAD D++L VEE +P+   L  GE SYA      L++ AD + DGKL+LDEM+N
Sbjct  271   KKFQDLDADMDNYLTVEEARPVIQSLLTGEFSYATSQAKLLMK-ADSDGDGKLSLDEMLN  329

Query  986   HDTLFYDTIY-DNEKDEDDI---YHDEL  1057
               T FY+ +Y D+  D +++   Y DEL
Sbjct  330   DYTSFYNIVYMDDHYDSEEVDGDYRDEL  357



>ref|XP_010249102.1| PREDICTED: reticulocalbin-2-like isoform X3 [Nelumbo nucifera]
Length=379

 Score =   172 bits (436),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/268 (37%), Positives = 154/268 (57%), Gaps = 10/268 (4%)
 Frame = +2

Query  275   YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
             Y ND  + +   RL++LFP +D DP DGFV   EL  WN +Q    + +R++R + + DK
Sbjct  114   YLNDDEKFNVTNRLVLLFPDIDIDPVDGFVTESELMEWNLRQTEKEVTHRSEREMEVYDK  173

Query  455   DGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYEFRDFLHP  631
             + DG +SF+EY P    ++   N + + D GWW  + F  +D D +G LN  EF+DF+HP
Sbjct  174   NHDGFVSFAEYDPPGWVKN-SANNSFYYDMGWWKEEHFNASDADEDGLLNQTEFKDFMHP  232

Query  632   EDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE------FETSGIDV  793
              DS N  + +WL  E++ + D +KD K++  +F  G ++  + Y E      F +  ++ 
Sbjct  233   ADSNNPKLLQWLCKEEIWERDSDKDGKINFKDFFHGLFDMIRNYDEESQNSSFHSDSMES  292

Query  794   PSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLD  973
             P+ +  F  +D D D ++   EL PI   L P E  YA+    Y++ +AD + DG+L+L 
Sbjct  293   PA-KMLFAQIDQDGDGYISESELLPIIGKLHPSERYYAKQQANYILSQADMDKDGRLSLT  351

Query  974   EMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             EM+ +  +FY TI+D+E D D  YHDE 
Sbjct  352   EMIENPYVFYSTIFDDE-DGDFYYHDEF  378



>ref|XP_002307146.1| hypothetical protein POPTR_0005s08980g [Populus trichocarpa]
 ref|XP_006382937.1| calcium-binding EF hand family protein [Populus trichocarpa]
 gb|EEE94142.1| hypothetical protein POPTR_0005s08980g [Populus trichocarpa]
 gb|ERP60734.1| calcium-binding EF hand family protein [Populus trichocarpa]
Length=375

 Score =   171 bits (433),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 118/360 (33%), Positives = 179/360 (50%), Gaps = 46/360 (13%)
 Frame = +2

Query  68    TKVVAYTIAAAFVILLLSQDHNKLFR------KDYSPRGLSRRLGTQGTAPPIFDPIVA-  226
             T ++ Y   A   +LL++Q  NK         K  S      R       P  FDP+VA 
Sbjct  4     TSIIIYITIALLFLLLVTQTPNKPSNHRNRRIKIRSKFDFEPRQHNHHHEPVPFDPLVAD  63

Query  227   -RRK--------------------------GLANPEKSD--DDDRYFNDKGRLDTGLRLM  319
               RK                            + PE  D  D + Y ND+ + +   RL+
Sbjct  64    IERKREDKEWEKQYFEHSHPEFVHDSAAAGHESQPEWEDFIDAEDYVNDEEKFNVTNRLL  123

Query  320   VLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQF  499
             VLFP +D +P DG+V   EL  WN +Q+   + +RT+R + + DK+ DG +SF+EY P  
Sbjct  124   VLFPKIDVEPDDGYVSEHELTEWNLKQSEKEVMHRTKREMDVHDKNHDGFVSFAEYEPPS  183

Query  500   TDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTE  676
                + ++N  G+ D GWW  +  NA D D +G LN+ EF DF HP DS+N  + +WL  E
Sbjct  184   WVRNSDKNSFGY-DMGWWKEEHFNASDADGDGFLNITEFNDFQHPADSKNPKLLQWLCKE  242

Query  677   KLRQMDVNKDQKLSLLEFERGAYETYKTYKE-------FETSGIDVPSVEETFTLLDADK  835
             ++R+ D +KD K++  EF  G ++  + Y E          + ++ P+ ++ F  LD D 
Sbjct  243   EVRERDSDKDGKVNFQEFFHGLFDLVRNYDEEGHNSSHLSDNLMEAPA-KKLFDELDKDG  301

Query  836   DSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             D FL   EL PI   L P E  YA+    Y++ +AD + DG+L+L EM+ +  +FY  I+
Sbjct  302   DGFLSDIELLPIIGKLHPSERYYAKQQADYILSQADTDKDGRLSLTEMIENPYVFYSAIF  361



>ref|NP_568202.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
 dbj|BAB10007.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL24286.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN15353.1| Unknown protein [Arabidopsis thaliana]
 gb|AED91325.1| EF-hand, calcium binding motif-containing protein [Arabidopsis 
thaliana]
Length=391

 Score =   171 bits (434),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 99/258 (38%), Positives = 146/258 (57%), Gaps = 8/258 (3%)
 Frame = +2

Query  263   DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALS  442
             D + Y ND+ + +   RL++LFP +D  P DGF+   EL  W  Q +   + +RTQR L 
Sbjct  119   DAEDYLNDEEKFNVTDRLILLFPKIDVSPADGFMTESELTEWTMQSSAKEVVHRTQRDLD  178

Query  443   LRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRD  619
             + D++ DG ISFSEY P       + N  G+ D GWW  +  NA D + +G LNL EF D
Sbjct  179   VHDRNKDGFISFSEYEPPSWVRKSDNNSFGY-DMGWWKEEHFNASDANGDGLLNLTEFND  237

Query  620   FLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI----  787
             FLHP D++N  +  WL  E++R+ D +KD K+S  EF  G ++T + Y+E   +      
Sbjct  238   FLHPADTKNPKLLLWLCKEEVRERDSDKDGKISFEEFFHGLFDTVRNYEEDNHNSTHPYH  297

Query  788   DVPS--VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGK  961
             D+P    ++ F+ LD + D +L   EL PI   + P E  YA+    Y+I +AD + D +
Sbjct  298   DLPEGPAKQLFSQLDKNDDGYLSDVELLPIISKIHPTEHYYAKQQADYIISQADSDKDRR  357

Query  962   LTLDEMMNHDTLFYDTIY  1015
             LTL EM+ H  +FY  I+
Sbjct  358   LTLAEMIEHPYVFYSAIF  375



>ref|XP_004253257.1| PREDICTED: calumenin-B [Solanum lycopersicum]
Length=373

 Score =   171 bits (432),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 102/268 (38%), Positives = 151/268 (56%), Gaps = 10/268 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y ND+ + +   RL+ LFP +D +P DGFV   EL +WN +Q    +
Sbjct  94    SQPEWEDFMDAEDYLNDEHKFNVTDRLVSLFPKIDVNPSDGFVTDHELTHWNLEQTRKEV  153

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNG  592
              +RTQR + + DK+ DG +SF EY P     + + +  G+ D GWW    F  +D+D +G
Sbjct  154   LHRTQRDMEVHDKNHDGFVSFHEYEPPSWVRNSDNSSFGY-DMGWWKEDHFNASDIDGDG  212

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE-  769
              LN+ EF DFLHP D+ N  +  WL  E++R+ D +KD K++  EF  G ++  + Y E 
Sbjct  213   LLNITEFNDFLHPADTTNPKLLHWLCKEEIRERDSDKDGKVNFNEFFHGLFDLVRNYDEE  272

Query  770   -FETSGIDVPSVE----ETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               +TS     S E    + F  LD D D +L   EL PI   L P E  YA+    Y+I+
Sbjct  273   SHDTSHHSEDSQESPARKLFAELDKDGDGYLSEAELLPIIGKLHPSERYYAKQQADYIIQ  332

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYD  1018
             +AD + DG+LTL EM++   +FY  I++
Sbjct  333   QADADKDGRLTLKEMIDSPYVFYSAIFN  360



>gb|EEE56578.1| hypothetical protein OsJ_05929 [Oryza sativa Japonica Group]
Length=545

 Score =   174 bits (440),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 106/273 (39%), Positives = 152/273 (56%), Gaps = 11/273 (4%)
 Frame = +2

Query  257   SDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRA  436
             +D D+ Y ND  R +   R+  LFP +D DP DG V   EL  WN   A   + +RT R 
Sbjct  277   ADPDEDYINDAARFNLTRRVEALFPKIDVDPADGAVTPAELTAWNLASARREVMHRTARE  336

Query  437   LSLRDKDGDGSISFSEY-FPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYE  610
             L L D+D DG I+FSEY  P +     + N +  G  GWW  + F  +D+D +G LNL E
Sbjct  337   LDLHDRDHDGRIAFSEYERPSWAWRFDDHNSSNDG-VGWWKEEHFNASDMDGDGFLNLIE  395

Query  611   FRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETS---  781
             F DFLHP D+ N  +  WL  E++R+ D + D KL+  EF  G + + + + E  ++   
Sbjct  396   FNDFLHPADTTNPKLINWLCKEEVRERDKDNDGKLNFQEFYNGLFYSIRHFDEEASTDDS  455

Query  782   -GIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDG  958
                D P+  ++FT LD D D  L  +ELKPI   L P E  YA+    Y+I +AD N DG
Sbjct  456   NASDAPA-RKSFTHLDLDNDGLLSADELKPIIGNLHPPEHFYAKQQADYVITQADTNKDG  514

Query  959   KLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             +L+L EM+ +  +FY  ++    ++D  +HDEL
Sbjct  515   QLSLQEMIENPYVFYSALF---TEDDYGFHDEL  544



>gb|KHG18826.1| Calumenin-A [Gossypium arboreum]
 gb|KHG30698.1| Calumenin-A [Gossypium arboreum]
Length=373

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 120/360 (33%), Positives = 182/360 (51%), Gaps = 45/360 (13%)
 Frame = +2

Query  59    GKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAP----PI-FDPIV  223
             GK++ ++   IA A +IL L     K        R L  R     + P    P+ FDP+V
Sbjct  2     GKVSAII--YIAVALLILFLISHSPKKHPNHSRHRRLKLRSSFSFSNPTHHEPVAFDPLV  59

Query  224   A---RRK------------------------GLANPEKSD--DDDRYFNDKGRLDTGLRL  316
             A   RR+                          + PE  D  + + Y ND+ + +   RL
Sbjct  60    ADIERRREDRQWEKQYLEHTHPEFVNDHAPGHESQPEWEDFMNAEDYLNDEDKFNVTNRL  119

Query  317   MVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQ  496
             ++LFP +D DP DGFV   EL  W+ QQ    + +R+ R + + DK  DG +SF+EY P 
Sbjct  120   VMLFPKIDADPADGFVTENELTEWHLQQTAKEVLHRSMREMEVHDKSHDGFVSFAEYEPP  179

Query  497   FTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLT  673
                ++ + N  G+ D GWW  +  NA DV+ +G LN+ EF DFLHP DS++  +  WL  
Sbjct  180   SWVKN-DNNSFGY-DMGWWKEEHFNASDVNGDGLLNITEFNDFLHPSDSKSPKLLHWLCK  237

Query  674   EKLRQMDVNKDQKLSLLEFERGAYETYKTYKE--FETSGIDVPSVEET----FTLLDADK  835
             E++R+ D ++D K++  EF  G ++  + Y E    +S +   S+E      F+ LD D 
Sbjct  238   EEVRERDTDRDGKVNFDEFFHGLFDLVRNYDEEDHNSSHLSHDSLESPARRLFSQLDKDG  297

Query  836   DSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             D  L  EEL PI   + P E  YA+    Y+I +AD + DG+L+L EM+ +  +FY  I+
Sbjct  298   DRLLSEEELLPIIGKIHPSERYYAKQQADYIISQADSDKDGRLSLLEMIENPYVFYSAIF  357



>ref|XP_009385791.1| PREDICTED: reticulocalbin-2-like [Musa acuminata subsp. malaccensis]
Length=364

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/298 (37%), Positives = 154/298 (52%), Gaps = 21/298 (7%)
 Frame = +2

Query  188   QGTAPPIFDPIVARRKGLANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGF  361
             QG AP +           A PE  D  D + Y ND+ R +   R++ LFP +D  P DGF
Sbjct  79    QGHAPAM----------EAQPEWEDFMDAEDYINDEERFNVSDRIVQLFPKIDVAPADGF  128

Query  362   VDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGD  541
             V   EL  WN +Q    + +RTQR + L DK+ DG ISF EY P         +      
Sbjct  129   VSSDELAEWNLRQVEKEVIHRTQRDMELHDKNHDGFISFEEYEPPSWARRYHDDNATDDK  188

Query  542   AGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLS  718
              GWW  +  NA D+D +G LNL EF DFLHP D+ N  +  WL  E++R+ D +KD KL+
Sbjct  189   VGWWKEEHFNASDMDGDGLLNLTEFNDFLHPADTNNPKLIHWLSKEEIRERDKDKDGKLN  248

Query  719   LLEFERGAYETYK-----TYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYL  883
               E+  G ++  +      +     S  D P+ +  F+ LD + D +L  +EL P+   L
Sbjct  249   FQEYFNGLFDLIRKDDVYNFTHESDSSTDAPA-KRLFSQLDHNNDGYLSEDELIPVIGDL  307

Query  884   DPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
              P E  YA+    Y+I EAD + D +LTL EM+ +  +FY  I+  E D +  YHDE 
Sbjct  308   HPSERYYAKQQADYVISEADADKDRRLTLKEMIENPYVFYSAIFAEEDDYN--YHDEF  363



>ref|XP_009122475.1| PREDICTED: calumenin-A [Brassica rapa]
Length=379

 Score =   169 bits (427),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 95/258 (37%), Positives = 143/258 (55%), Gaps = 8/258 (3%)
 Frame = +2

Query  263   DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALS  442
             D + Y ND+ + +   RL+ LFP +D  P DG+V   EL  WN Q +   + +R+QR + 
Sbjct  107   DAEDYLNDEEKFNVTDRLISLFPKIDVSPLDGYVTESELTEWNVQSSAKEVMHRSQRDMD  166

Query  443   LRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYEFRD  619
             + D++ DG ISFSEY P     D      G+ D GWW  + F  +D + +G LNL EF D
Sbjct  167   VHDRNKDGFISFSEYEPPSWARDSGNYSFGY-DIGWWKEEHFNASDANGDGLLNLTEFND  225

Query  620   FLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI----  787
             FLHP D++N  +  WL  E++R+ D +KD K+   EF    ++  ++Y+E   +      
Sbjct  226   FLHPADTKNPKLLLWLCKEEVRERDSDKDGKIGFDEFFHSLFDAVRSYEEDNLNATHPYH  285

Query  788   DVP--SVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGK  961
             D+P    ++ F  LD D D +L   EL P+   + P E  YA+    Y+I +AD + DG+
Sbjct  286   DLPEGPAKQLFAQLDKDGDGYLSDVELLPVISKIHPTEHCYAKEQADYIISKADSDKDGR  345

Query  962   LTLDEMMNHDTLFYDTIY  1015
             LTL EM+ H  +FY  I+
Sbjct  346   LTLAEMIKHPYVFYSAIF  363



>ref|XP_008661643.1| PREDICTED: uncharacterized protein LOC100274210 isoform X1 [Zea 
mays]
 gb|ACL54431.1| unknown [Zea mays]
 gb|AFW59926.1| hypothetical protein ZEAMMB73_452013 [Zea mays]
Length=381

 Score =   168 bits (426),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 100/254 (39%), Positives = 143/254 (56%), Gaps = 14/254 (6%)
 Frame = +2

Query  272   RYFNDKGRLDTGLRLMVLFPILDRDP--CDGFVDVKELEYWNTQQAINRLNYRTQRALSL  445
             RYF     LD   R+  LF ILDR P      V V ELE W   QA  RL+  T+R ++ 
Sbjct  117   RYFGPDAPLDVRQRIAYLFAILDRSPRGVGVGVGVGELEAWLRWQAAARLDAVTRREMAP  176

Query  446   RDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFL  625
              D D DG+++  E+F  + +        GH   GWWM +F +AD D +G+LN  EF DFL
Sbjct  177   HDTDRDGAVTLREFFADWIN-------MGHDKMGWWMHKFASADRDGDGSLNAVEFNDFL  229

Query  626   HPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSG----IDV  793
             HPEDS  +++  WLL +KL +MD + D +LS  EF   ++      +  +  G    ++ 
Sbjct  230   HPEDSSQESVMLWLLKDKLSEMDHDGDGRLSQEEFVAQSHIIISGARHADDGGHAHDLER  289

Query  794   PSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLD  973
                 + FT LDADKD++L VEE + +   L  GE SYA  +  +L++ AD N+DGKL+L+
Sbjct  290   AEAAKKFTELDADKDNYLTVEEARCVLQSLVTGEFSYATSHAKFLMK-ADVNHDGKLSLE  348

Query  974   EMMNHDTLFYDTIY  1015
             EM++    FY T+Y
Sbjct  349   EMLDDYISFYSTVY  362



>ref|XP_009415362.1| PREDICTED: calumenin-like [Musa acuminata subsp. malaccensis]
Length=359

 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 121/363 (33%), Positives = 178/363 (49%), Gaps = 41/363 (11%)
 Frame = +2

Query  68    TKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQG----TAPPIFDPIVA---  226
             + V+ Y     F++LLL+   N   R ++  R L  R    G    + P  FDPI+A   
Sbjct  4     SSVLLYLGVVLFIVLLLTFAPN---RPNHPHRRLRLRSAMSGHDRRSIP--FDPIIADIE  58

Query  227   ------------------RRKGLANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRD  346
                                    A PE  D  D + + ND+ R +   R++ LFP +D  
Sbjct  59    RRREDREWERANFFPQGHAPAMEAQPEWEDFMDAEDFINDEERFNVTDRIVKLFPKIDVG  118

Query  347   PCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-FPQFTDEDIERN  523
             P DGFV   EL  WN +Q    + +RTQR + L D++ DG ISF EY  P +     + N
Sbjct  119   PADGFVSSDELTEWNLRQVEKEVMHRTQRDMELHDRNHDGFISFEEYEPPSWVHRYHDDN  178

Query  524   ETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVN  700
              TG    GWW    F  +D+D +G LNL EF DFLHP ++ +  + +WL  E++R+ D +
Sbjct  179   STG-DQVGWWKEDHFNASDMDGDGLLNLTEFNDFLHPANTNSPKLIQWLSKEEIRERDKD  237

Query  701   KDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVE----ETFTLLDADKDSFLRVEELKP  868
             KD KL+  EF  G ++  +    +  + +   S E    + F+ LD + D +L  +EL P
Sbjct  238   KDGKLNFQEFFNGLFDLIRRDDIYNLTHVSDASTEAPAKKLFSQLDHNNDGYLSEDELIP  297

Query  869   IFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYH  1048
             +   L P E  YA+    Y+  EAD + DG+L L EM+ +  +FY  I   E D +  YH
Sbjct  298   VIGDLHPSEHYYAKQQADYVTSEADTDKDGRLNLKEMIENPYVFYSAIIPEEDDYN--YH  355

Query  1049  DEL  1057
             DE 
Sbjct  356   DEF  358



>ref|XP_006345305.1| PREDICTED: calumenin-B-like isoform X1 [Solanum tuberosum]
 ref|XP_006345306.1| PREDICTED: calumenin-B-like isoform X2 [Solanum tuberosum]
Length=373

 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/268 (38%), Positives = 148/268 (55%), Gaps = 10/268 (4%)
 Frame = +2

Query  242   ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
             + PE  D  D + Y ND+ + +   RL++LFP +D  P DGFV   EL  WN +Q    +
Sbjct  94    SQPEWEDFMDAEDYLNDEHKFNVTDRLVLLFPKIDVHPSDGFVTDHELTDWNLEQTRKEV  153

Query  416   NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNG  592
              +RTQR + + DK+ DG +SF EY P     + +    G+ D GWW    F  +D+D +G
Sbjct  154   LHRTQRDMEVHDKNHDGFVSFHEYEPPSWVRNSDNTSFGY-DMGWWKEDHFNASDIDGDG  212

Query  593   TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE-  769
              LN+ EF DFLHP D+ N  +  WL  E++R+ D + D K++  EF  G ++  + Y E 
Sbjct  213   LLNITEFNDFLHPADTSNPKLLHWLCKEEIRERDSDTDGKVNFNEFFHGLFDLVRNYDEE  272

Query  770   -FETSGIDVPSVE----ETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
               +TS     S E    + F  LD D D +L   EL PI   L P E  YA+    Y+I+
Sbjct  273   SHDTSHHSEDSEESPARKLFAELDKDGDGYLSEAELLPIIGKLHPSERYYAKQQADYIIQ  332

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYD  1018
             +AD + DG+LTL EM++   +FY  I++
Sbjct  333   QADADKDGRLTLKEMIDSPYVFYSAIFN  360



>emb|CDY21552.1| BnaC09g47400D [Brassica napus]
Length=379

 Score =   166 bits (421),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/258 (37%), Positives = 143/258 (55%), Gaps = 8/258 (3%)
 Frame = +2

Query  263   DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALS  442
             D + Y ND+ + +   RL+ LFP +D  P DG+V   EL  WN Q +   + +R+QR + 
Sbjct  107   DAEDYLNDEEKFNVTDRLISLFPKIDVSPLDGYVSESELIEWNVQSSAKEVMHRSQRDMD  166

Query  443   LRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRD  619
             + D++ DG +SFSEY P     D      G+ D GWW  +  NA D + +G LNL EF D
Sbjct  167   VHDRNKDGFVSFSEYEPPSWGRDSGNYSFGY-DIGWWKEEHFNASDANGDGLLNLTEFND  225

Query  620   FLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI----  787
             FLHP D++N  +  WL  E++R+ D +KD K+   EF  G ++  ++Y+E   +      
Sbjct  226   FLHPADTKNPKLLLWLCKEEVRERDSDKDGKIGFDEFFHGLFDAVRSYEEDNHNATHSYH  285

Query  788   DVP--SVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGK  961
             D+P    ++ F  LD D   +L   EL P+   + P E  YA+    Y+I +AD + DG+
Sbjct  286   DLPEGPAKQLFAQLDKDGVGYLSDVELLPVISKIHPTERYYAKEQADYIISKADSDKDGR  345

Query  962   LTLDEMMNHDTLFYDTIY  1015
             LTL EM+ H  +FY  I+
Sbjct  346   LTLAEMIEHPYVFYSAIF  363



>ref|XP_010103594.1| hypothetical protein L484_023091 [Morus notabilis]
 gb|EXB96371.1| hypothetical protein L484_023091 [Morus notabilis]
Length=416

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 130/418 (31%), Positives = 188/418 (45%), Gaps = 89/418 (21%)
 Frame = +2

Query  59    GKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLG-------TQGTAPPIFDP  217
             GK + ++  TIA   V+LLL     +     +  R L  R          +  AP  FDP
Sbjct  2     GKGSLIIYITIA--LVVLLLVSRSPRKSATQHRHRRLKLRSNFIISDHHNRNHAPVAFDP  59

Query  218   IVA---RRK-------------------------GLANPEKSDDDDRYFNDKGRLDTGLR  313
             +VA   RR+                         G    E+  D + Y ND+ R +   R
Sbjct  60    LVADIERRREDRQWEKEYIEHVHPELSTAAPGDEGQPEWEEYMDAEDYLNDEERFNVTGR  119

Query  314   LMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFP  493
             L+ LFP +D  P DGFV  +EL  WN +QA   + +RT+R +   DK+ DG +SF+EY P
Sbjct  120   LVELFPKVDVGPADGFVSEEELTEWNLRQAHTEVLHRTKRDMETHDKNRDGLVSFAEYDP  179

Query  494   --------------------------QFTD----------------EDIERNETGHGDAG  547
                                        F                  E  E N +   D G
Sbjct  180   PSWARNADLNDEFLYWRQANQNRESTSFCAKSALFGVMFYLLDCLVEMCEDNGSVGYDMG  239

Query  548   WWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLL  724
             WW  +  NA D D +G LN+ EF DFLHP DS++  +  WL  E++R+ D +KD K++  
Sbjct  240   WWKEEHFNASDADEDGFLNITEFNDFLHPADSKSPKLLHWLCKEEVRERDTDKDGKVNFK  299

Query  725   EFERGAYETYKTY-------KEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYL  883
             EF  G ++  + Y              ++ P+ +  F  LD D D +L  EEL P+   L
Sbjct  300   EFFHGLFDLVRNYDDESHNFSHHSDDSMEAPA-KVLFAQLDKDGDGYLSDEELLPVIDKL  358

Query  884   DPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
              P E  YA+    Y+I +AD + DG+LTL EM+++  +FY  I+ N+ +ED  YHDE 
Sbjct  359   HPSERYYAKQQADYIISQADTDKDGRLTLTEMIDNPYVFYSAIF-NDDEEDYEYHDEF  415



>gb|KEH44431.1| calcium-binding EF hand-like protein [Medicago truncatula]
Length=346

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 111/328 (34%), Positives = 163/328 (50%), Gaps = 39/328 (12%)
 Frame = +2

Query  65   MTKVVAYTIAAAFVILLLSQ-----DHNKLFR----KDYSPRGLSRRLGTQGTAPPIFDP  217
            +  V+ YTI A  V+  LS      +H+   R    K  S   LS         P  FDP
Sbjct  3    LGSVLIYTILALIVLFFLSSHSPFNNHHSSHRHRRLKLRSNFTLSPSRSHSSHQPVPFDP  62

Query  218  IVA-------------RRKGLANPEKSDDD-------DRYFNDKGRLDTGLRLMVLFPIL  337
            +VA             +    A P +S  +       + + ND+ + +   RL++LFP +
Sbjct  63   LVAELERHREDKQWEQQHIQHAPPHESQPEWEDFMNAEDFINDEDKFNVTSRLLLLFPKI  122

Query  338  DRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIE  517
            D DP D FVD+ EL  WN QQA   + +R+QR + L DK+ DG +SFSEY P    +  +
Sbjct  123  DVDPADQFVDLHELTMWNLQQAHREVLHRSQREMELHDKNHDGFVSFSEYDPPSWVKSAD  182

Query  518  RNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMD  694
            +   G+ D GWW  +  NA D D +G LNL EF DFLHP DS +  +++WL  E++R+ D
Sbjct  183  KESFGY-DMGWWKEEHFNASDADGDGVLNLTEFNDFLHPADSNSTKLQQWLCKEEIRERD  241

Query  695  VNKDQKLSLLEFERGAYETYKTYKE-------FETSGIDVPSVEETFTLLDADKDSFLRV  853
             ++D K++  EF  G ++  + Y E          + +D P+  + F  LD D D  L  
Sbjct  242  SDRDGKVNFKEFFHGLFDLVRNYDEESHNDSHHSDNSLDAPA-RKLFAQLDQDGDGLLSD  300

Query  854  EELKPIFHYLDPGELSYARYYTTYLIRE  937
             EL PI   L P E  YA+  + Y+I +
Sbjct  301  IELLPIIGKLHPSEHYYAKQQSEYIISQ  328



>ref|XP_004147104.1| PREDICTED: calumenin-B-like [Cucumis sativus]
 ref|XP_004166358.1| PREDICTED: calumenin-B-like [Cucumis sativus]
 gb|KGN51567.1| hypothetical protein Csa_5G579050 [Cucumis sativus]
Length=358

 Score =   163 bits (412),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 160/303 (53%), Gaps = 21/303 (7%)
 Frame = +2

Query  209   FDPIVA----RR----------KGLANPEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRD  346
             FDP+++    RR          K LA  +   + + + ND+ R +   RL  +FP +D D
Sbjct  56    FDPLISDIELRREDDEWHKQSLKNLAAHDSHPEWEEFINDEDRFNVTERLFWIFPKIDVD  115

Query  347   PCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNE  526
             P DGFV  +EL  WN QQA+N   YRT+R     D + DG +SF+EY P           
Sbjct  116   PSDGFVSAEELTRWNLQQAMNEALYRTEREFQSHDDNRDGFVSFAEYEPPSWVLSAGNGS  175

Query  527   TGHGDAGWWMIQ-FKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNK  703
              G+ D GWW  + F  +D D +G L+L EF DFLHP DS++  +  WL  + +R+ D +K
Sbjct  176   FGY-DIGWWNEEHFNASDADGDGVLDLNEFNDFLHPADSKSTKLLLWLCADVVRERDNDK  234

Query  704   DQKLSLLEFERGAYETYKTYKE-FETSGIDVPSVE----ETFTLLDADKDSFLRVEELKP  868
             D KL+  EF     +  +   E + +S  +    E    + F  LD D D +L   E+ P
Sbjct  235   DGKLNFSEFFPKVLDLVRRVDEDYNSSNWEDEEPEALAKKMFLELDKDSDGYLSTTEMLP  294

Query  869   IFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYH  1048
             I   + P E  YA+    Y+I +AD ++DG LTL++M+ + ++FY +++  ++ +   YH
Sbjct  295   IIGKIHPSEAYYAKQQAEYIISQADSDDDGLLTLNDMIENPSVFYSSVFTEDEMDYYPYH  354

Query  1049  DEL  1057
             DE 
Sbjct  355   DEF  357



>ref|XP_008445899.1| PREDICTED: calumenin-B [Cucumis melo]
Length=358

 Score =   162 bits (410),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 110/331 (33%), Positives = 169/331 (51%), Gaps = 32/331 (10%)
 Frame = +2

Query  158   PRGLSRRLGTQGT-APPI----------FDPIVA-----------RRKGLANPEKSDDD-  268
             PR    RL +  T  PP+          FDP+++           +++ L N    D   
Sbjct  28    PRHRRLRLRSNFTFNPPLHRQQHDHYISFDPLISDIELRREDDEWQKQSLENLAAHDSHP  87

Query  269   --DRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALS  442
               + + ND+ R +   RL  +FP +D DP DGFV  +EL  WN QQA+N   +RT+R   
Sbjct  88    EWEEFINDEDRFNVTERLFFIFPKIDVDPSDGFVSAEELTRWNLQQAMNEALHRTEREFQ  147

Query  443   LRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYEFRD  619
               D++ DG +SF+EY P         +  G+ D GWW  + F  +D D +G L+L EF D
Sbjct  148   SHDENRDGFVSFAEYEPPSWVLAAGNSSFGY-DIGWWNEEHFNASDADGDGVLDLNEFND  206

Query  620   FLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE-FETSGIDVP  796
             FLHP DS++  +  WL  + +R+ D +KD KL+  EF     +  +   E + +S  +  
Sbjct  207   FLHPADSKSPKLLLWLCADVVRERDNDKDGKLNFSEFFPKILDLIRRVDEDYNSSNWEDE  266

Query  797   SVE----ETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKL  964
               E    + F  LD D D FL   EL PI   + P E  YA+    Y+I +AD ++DG L
Sbjct  267   EPEALARKMFLELDKDSDGFLSTSELLPIIGKIHPSEAYYAKQQAEYIISQADSDDDGLL  326

Query  965   TLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             TL++M+ +  +FY +++  ++ +   YHDE 
Sbjct  327   TLNDMIENPFVFYSSVFSEDEMDYYPYHDEF  357



>gb|EPS67553.1| hypothetical protein M569_07223 [Genlisea aurea]
Length=386

 Score =   162 bits (411),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 114/377 (30%), Positives = 173/377 (46%), Gaps = 68/377 (18%)
 Frame = +2

Query  59    GKMTKVVAYTIAAAFVILLLSQD-----------------HNKLFRKDYSPRGLSRRLGT  187
             GK + ++ Y + A F++L++ +                   N  F     PR        
Sbjct  2     GKFSVLLIYVVIAVFLLLVIIRSPENPRGLRRRHRRLTIRSNFTFTPPADPR--------  53

Query  188   QGTAPPIFDPIVAR----------------------RKGLANPEKSD--DDDRYFNDKGR  295
                A   FDP+VA                       R     PE  D  + + Y N++ R
Sbjct  54    HRAAAAAFDPLVADIELKREDKEWEHQYFQTHHPEFRSESPEPEWEDYMNAEDYLNNEER  113

Query  296   LDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSIS  475
              +   RL++LFP +D DP DG+V  KEL  W  QQ+   + +RT+R + + DKD DG +S
Sbjct  114   FNVTNRLVLLFPKIDVDPPDGYVSHKELTEWYLQQSQKEVFHRTEREMEIHDKDKDGFVS  173

Query  476   FSEY-FPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLHPEDSRND  649
             F EY  P +     E    G+ D GWW    F  +D D +G LN+ EF DFLHP DS N 
Sbjct  174   FQEYDPPSWVKNSGESAALGY-DMGWWKHDHFNASDADGDGLLNITEFNDFLHPADSANP  232

Query  650   NIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI--------------  787
              +R WL  E++R+ D +KD K+S  EF  G + +     + E                  
Sbjct  233   ALRLWLCQEEIRERDSDKDGKMSFHEFFHGLFHSLSGRSDEENHNSSSSSSSSHLVSDDE  292

Query  788   -DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKL  964
              + P+ ++ F  LD D D +L   EL  +   + PGE  YA   T Y++++AD + DG+L
Sbjct  293   ENAPA-QKLFNQLDKDGDGYLSDVELLAVIGQIHPGERYYAEQQTEYIMQQADSDGDGRL  351

Query  965   TLDEMMNHDTLFYDTIY  1015
             +  EM+ +  +FY  ++
Sbjct  352   SPTEMIENPYVFYSAVF  368



>ref|NP_001142054.1| uncharacterized protein LOC100274210 precursor [Zea mays]
 gb|ACF87552.1| unknown [Zea mays]
 gb|AFW59928.1| hypothetical protein ZEAMMB73_452013 [Zea mays]
Length=374

 Score =   161 bits (407),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 98/254 (39%), Positives = 139/254 (55%), Gaps = 21/254 (8%)
 Frame = +2

Query  272   RYFNDKGRLDTGLRLMVLFPILDRDP--CDGFVDVKELEYWNTQQAINRLNYRTQRALSL  445
             RYF     LD   R+  LF ILDR P      V V ELE W   QA  RL+  T+R ++ 
Sbjct  117   RYFGPDAPLDVRQRIAYLFAILDRSPRGVGVGVGVGELEAWLRWQAAARLDAVTRREMAP  176

Query  446   RDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFL  625
              D D DG+++  E+F                  GWWM +F +AD D +G+LN  EF DFL
Sbjct  177   HDTDRDGAVTLREFFAD--------------KMGWWMHKFASADRDGDGSLNAVEFNDFL  222

Query  626   HPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSG----IDV  793
             HPEDS  +++  WLL +KL +MD + D +LS  EF   ++      +  +  G    ++ 
Sbjct  223   HPEDSSQESVMLWLLKDKLSEMDHDGDGRLSQEEFVAQSHIIISGARHADDGGHAHDLER  282

Query  794   PSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLD  973
                 + FT LDADKD++L VEE + +   L  GE SYA  +  +L++ AD N+DGKL+L+
Sbjct  283   AEAAKKFTELDADKDNYLTVEEARCVLQSLVTGEFSYATSHAKFLMK-ADVNHDGKLSLE  341

Query  974   EMMNHDTLFYDTIY  1015
             EM++    FY T+Y
Sbjct  342   EMLDDYISFYSTVY  355



>ref|XP_006589743.1| PREDICTED: calumenin-B-like isoform X2 [Glycine max]
Length=338

 Score =   158 bits (399),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 98/250 (39%), Positives = 138/250 (55%), Gaps = 12/250 (5%)
 Frame = +2

Query  212  DPIVARRKGLANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEY  385
            DP  A     + PE  D  D + Y ND+ + +   RL++LFP +D DP D FV   EL  
Sbjct  84   DPAPAHE---SQPEWEDFMDAEDYLNDEDKFNVTNRLILLFPKIDVDPTDWFVTEHELTQ  140

Query  386  WNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQF  565
            WN QQA   + +RTQR + L DK+ DG +SFSEY P    ++ + NE+   D GWW  + 
Sbjct  141  WNLQQAQREVLHRTQREMELHDKNHDGFVSFSEYDPPSWVQNAD-NESFGYDMGWWKEEH  199

Query  566  KNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGA  742
             NA D D +G LNL EF DFLHP DS+N  + +WL  E++R+ D ++D+K++  EF  G 
Sbjct  200  FNASDADGDGVLNLTEFNDFLHPADSKNPKLLQWLCKEEVRERDTDRDEKVNFKEFFHGL  259

Query  743  YETYKTYKEFET----SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYAR  910
            ++  + Y E       + +D P+    F  LD D D +L   EL PI   L P E  YA+
Sbjct  260  FDLVRNYDEESHNDTDNSMDAPA-RGLFAQLDKDGDGYLSDVELLPIIGKLHPSEHYYAK  318

Query  911  YYTTYLIREA  940
                Y+I + 
Sbjct  319  QQADYIISQV  328



>ref|XP_006589744.1| PREDICTED: calumenin-B-like isoform X3 [Glycine max]
Length=336

 Score =   157 bits (398),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 98/249 (39%), Positives = 138/249 (55%), Gaps = 12/249 (5%)
 Frame = +2

Query  212  DPIVARRKGLANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEY  385
            DP  A     + PE  D  D + Y ND+ + +   RL++LFP +D DP D FV   EL  
Sbjct  84   DPAPAHE---SQPEWEDFMDAEDYLNDEDKFNVTNRLILLFPKIDVDPTDWFVTEHELTQ  140

Query  386  WNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQF  565
            WN QQA   + +RTQR + L DK+ DG +SFSEY P    ++ + NE+   D GWW  + 
Sbjct  141  WNLQQAQREVLHRTQREMELHDKNHDGFVSFSEYDPPSWVQNAD-NESFGYDMGWWKEEH  199

Query  566  KNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGA  742
             NA D D +G LNL EF DFLHP DS+N  + +WL  E++R+ D ++D+K++  EF  G 
Sbjct  200  FNASDADGDGVLNLTEFNDFLHPADSKNPKLLQWLCKEEVRERDTDRDEKVNFKEFFHGL  259

Query  743  YETYKTYKEFET----SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYAR  910
            ++  + Y E       + +D P+    F  LD D D +L   EL PI   L P E  YA+
Sbjct  260  FDLVRNYDEESHNDTDNSMDAPA-RGLFAQLDKDGDGYLSDVELLPIIGKLHPSEHYYAK  318

Query  911  YYTTYLIRE  937
                Y+I +
Sbjct  319  QQADYIISQ  327



>ref|XP_010915273.1| PREDICTED: calumenin-like isoform X2 [Elaeis guineensis]
Length=355

 Score =   157 bits (398),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 133/251 (53%), Gaps = 10/251 (4%)
 Frame = +2

Query  242  ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
            A PE  D  D + Y ND+ R +   R++ LFP +D  P DGFV   EL  WN +QA   +
Sbjct  94   AQPEWEDFIDAEDYINDEDRFNVTHRIIDLFPKIDVGPADGFVSSDELTQWNLKQAEKEV  153

Query  416  NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNG  592
             +RT+R + L DK+ DG ISF EY P         + +     GWW    F  +DVD NG
Sbjct  154  MHRTERDMELHDKNRDGFISFDEYEPPSWAHRFYDSNSTDDKVGWWKEDHFNASDVDENG  213

Query  593  TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
             LNL EF DFLHP DSRN  +  WL  E++R+ D ++D KLS  E+  G +++ + Y E 
Sbjct  214  LLNLTEFNDFLHPADSRNPKLMHWLCKEEIRERDKDRDGKLSFQEYFNGLFDSLRNYDEV  273

Query  773  ------ETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
                    + ++ P+ ++ F+ LD D D  L  +EL P+   L P E  YA+    Y++ 
Sbjct  274  YNAIDQSDTSVEAPA-KKLFSQLDQDNDGLLSEDELLPVIGNLHPSEHYYAKQQADYVLT  332

Query  935  EADDNNDGKLT  967
            +   N   K T
Sbjct  333  QVMSNYKIKST  343



>ref|XP_010915275.1| PREDICTED: calumenin-like isoform X4 [Elaeis guineensis]
Length=336

 Score =   156 bits (395),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/241 (38%), Positives = 130/241 (54%), Gaps = 10/241 (4%)
 Frame = +2

Query  242  ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
            A PE  D  D + Y ND+ R +   R++ LFP +D  P DGFV   EL  WN +QA   +
Sbjct  94   AQPEWEDFIDAEDYINDEDRFNVTHRIIDLFPKIDVGPADGFVSSDELTQWNLKQAEKEV  153

Query  416  NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNG  592
             +RT+R + L DK+ DG ISF EY P         + +     GWW    F  +DVD NG
Sbjct  154  MHRTERDMELHDKNRDGFISFDEYEPPSWAHRFYDSNSTDDKVGWWKEDHFNASDVDENG  213

Query  593  TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
             LNL EF DFLHP DSRN  +  WL  E++R+ D ++D KLS  E+  G +++ + Y E 
Sbjct  214  LLNLTEFNDFLHPADSRNPKLMHWLCKEEIRERDKDRDGKLSFQEYFNGLFDSLRNYDEV  273

Query  773  ------ETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
                    + ++ P+ ++ F+ LD D D  L  +EL P+   L P E  YA+    Y++ 
Sbjct  274  YNAIDQSDTSVEAPA-KKLFSQLDQDNDGLLSEDELLPVIGNLHPSEHYYAKQQADYVLT  332

Query  935  E  937
            +
Sbjct  333  Q  333



>ref|XP_010915274.1| PREDICTED: calumenin-like isoform X3 [Elaeis guineensis]
Length=339

 Score =   156 bits (394),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 91/241 (38%), Positives = 130/241 (54%), Gaps = 10/241 (4%)
 Frame = +2

Query  242  ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
            A PE  D  D + Y ND+ R +   R++ LFP +D  P DGFV   EL  WN +QA   +
Sbjct  94   AQPEWEDFIDAEDYINDEDRFNVTHRIIDLFPKIDVGPADGFVSSDELTQWNLKQAEKEV  153

Query  416  NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNG  592
             +RT+R + L DK+ DG ISF EY P         + +     GWW    F  +DVD NG
Sbjct  154  MHRTERDMELHDKNRDGFISFDEYEPPSWAHRFYDSNSTDDKVGWWKEDHFNASDVDENG  213

Query  593  TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
             LNL EF DFLHP DSRN  +  WL  E++R+ D ++D KLS  E+  G +++ + Y E 
Sbjct  214  LLNLTEFNDFLHPADSRNPKLMHWLCKEEIRERDKDRDGKLSFQEYFNGLFDSLRNYDEV  273

Query  773  ------ETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIR  934
                    + ++ P+ ++ F+ LD D D  L  +EL P+   L P E  YA+    Y++ 
Sbjct  274  YNAIDQSDTSVEAPA-KKLFSQLDQDNDGLLSEDELLPVIGNLHPSEHYYAKQQADYVLT  332

Query  935  E  937
            +
Sbjct  333  Q  333



>ref|XP_009407305.1| PREDICTED: reticulocalbin-2-like [Musa acuminata subsp. malaccensis]
Length=359

 Score =   155 bits (393),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 102/294 (35%), Positives = 149/294 (51%), Gaps = 36/294 (12%)
 Frame = +2

Query  209   FDPIVA----RRKGL--------------ANPEKSD--DDDRYFNDKGRLDTGLRLMVLF  328
             FDPI+A    RR+                + PE  D  D   Y + + R +   R++VLF
Sbjct  59    FDPIIADIERRREARQWEGDHFRLPHHEESQPEWDDFFDPKDYVDGEDRFNITHRIVVLF  118

Query  329   PILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDE  508
             P +D  P DGFV   EL  WN QQA ++  +R+ R L L D +GDG +SF EY       
Sbjct  119   PRIDVGPADGFVSSTELAEWNFQQAAHQAIHRSGRELELCDSNGDGFVSFEEYRQSVKAS  178

Query  509   DIERNETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLR  685
              ++       + GWW    F  +D D NG LNL EF DFLHP DS N  + +WL  E++R
Sbjct  179   PVD-------ETGWWKEDHFNASDTDGNGLLNLTEFNDFLHPADSGNPKLIQWLCKEEIR  231

Query  686   QMDVNKDQKLSLLEFERGAYETYK----TYKEFETSGIDVPSVEETFTLLDADKDSFLRV  853
             Q D ++D KL+  E+  G +++ +     Y    T G +    +  F+ LD D D FL  
Sbjct  232   QKDGDEDGKLNFKEYFVGLFDSIRDDDGPYNHSATLGQE----KMLFSRLDQDNDGFLSG  287

Query  854   EELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             ++L  +   +   E  YA+    Y + EAD + D +L+L EM+ H  +FY +I+
Sbjct  288   DDLVGVIGKIHHSERYYAKQQADYALSEADSDRDSQLSLKEMIEHPYVFYSSIF  341



>gb|EAZ12410.1| hypothetical protein OsJ_02298 [Oryza sativa Japonica Group]
Length=396

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 97/270 (36%), Positives = 147/270 (54%), Gaps = 11/270 (4%)
 Frame = +2

Query  263   DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALS  442
             +D+ + ND  R + G R+  LFP +D  P DGF  + EL  WN +Q+     +R+ R + 
Sbjct  132   EDEDFINDDERFNLGDRIRALFPKIDLAPRDGFASLDELTRWNLEQSRADQLHRSAREME  191

Query  443   LRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRD  619
             L DK+GDG +S+ ++  Q  +   E N  G     WW  +  NA D D +G LN  EF D
Sbjct  192   LYDKNGDGVVSYGDFRAQHNESSGEVNSLG---FPWWKEEHFNASDADGHGFLNKTEFND  248

Query  620   FLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI----  787
             FL+P DS N  I   L  +++RQ D + D KL+  E+  G ++    Y ++E + I    
Sbjct  249   FLNPSDSENPQIINLLCKQEIRQRDKDGDGKLNFEEYFHGLHDHIHGY-DYENADISHIG  307

Query  788   DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLT  967
             +    +E F+ LD D D F+   EL+P+   L   E  YAR    + I EAD ++DG+LT
Sbjct  308   NNTVAKERFSKLDKDSDGFISEHELEPVLDKLHLSERYYARQQAAHAISEADKDHDGRLT  367

Query  968   LDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             LDEM+ +   FY +++    D++D +HDE 
Sbjct  368   LDEMIENPYAFYGSVF--LSDDEDYFHDEF  395



>ref|XP_006648466.1| PREDICTED: calumenin-like, partial [Oryza brachyantha]
Length=235

 Score =   150 bits (378),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 95/239 (40%), Positives = 134/239 (56%), Gaps = 10/239 (4%)
 Frame = +2

Query  356   GFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-FPQFTDEDIERNETG  532
             G V   EL  WN   A   + +RT R L L D+D DG I+FSEY  P +     + N + 
Sbjct  1     GAVTAAELTAWNLASARREVLHRTARELDLHDRDHDGRIAFSEYERPSWAWRFDDHNSSN  60

Query  533   HGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQ  709
              G  GWW  +  NA D+D +G LNL EF DFLHP D+ N  +  WL  E++R+ D + D 
Sbjct  61    DG-VGWWKEEHFNASDMDGDGFLNLTEFNDFLHPADTMNPKLIDWLCKEEVRERDKDNDG  119

Query  710   KLSLLEFERGAYETYKTYKEFET---SGIDVPSVEETFTLLDADKDSFLRVEELKPIFHY  880
             KL+  EF  G + + + + E  +   SG D P+  ++FT LD D D  L  +ELKPI   
Sbjct  120   KLNFQEFYSGLFYSIRHFDEEASTDDSGSDAPA-RKSFTQLDLDNDGLLSADELKPIIGN  178

Query  881   LDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             L P E  YA+    Y+I +AD N DG+L+L EM+ +  +FY  ++    ++D  +HDEL
Sbjct  179   LHPPEHFYAKQQADYVITQADTNKDGQLSLQEMIENPYVFYSALF---TEDDYGFHDEL  234



>gb|EAY74626.1| hypothetical protein OsI_02514 [Oryza sativa Indica Group]
Length=396

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 146/269 (54%), Gaps = 9/269 (3%)
 Frame = +2

Query  263   DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALS  442
             +D+ + ND  R + G R+  LFP  D  P DGF  + EL  WN +Q+     +R+ R + 
Sbjct  132   EDEDFINDDERFNLGDRIRALFPKFDLAPRDGFASLDELTRWNLEQSGADQLHRSAREME  191

Query  443   LRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRD  619
             L DK+G+G +S+ ++  Q  +   E N  G     WW  +  NA D D +G LN  EF D
Sbjct  192   LYDKNGNGVVSYGDFRAQHNESSGEVNSLG---FPWWKEEHFNASDADGDGFLNKTEFND  248

Query  620   FLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTY--KEFETSGIDV  793
             FL+P DS N  I   L  +++RQ D + D KL+  E+  G ++    Y  +  + S I  
Sbjct  249   FLNPSDSENPQIINLLCKQEIRQRDKDGDGKLNFEEYFHGLHDHIHGYDDENADISHIGN  308

Query  794   PSV-EETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTL  970
              +V +E F+ LD D D F+   EL+P+   L   E  YAR    + I EAD ++DG+LTL
Sbjct  309   NTVAKERFSKLDKDSDGFISEHELEPVLDKLHLSERYYARQQAAHAISEADKDHDGRLTL  368

Query  971   DEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             DEM+ +   FY +++    D++D +HDE 
Sbjct  369   DEMIENPYAFYGSVF--LSDDEDYFHDEF  395



>emb|CBI23033.3| unnamed protein product [Vitis vinifera]
Length=195

 Score =   145 bits (365),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 118/206 (57%), Gaps = 32/206 (16%)
 Frame = +2

Query  65   MTKVVA---YTIAAAFVI---LLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVA  226
            M+K V     TIA  F +   L   + HN  +        L+RRLG    A   F+P+V 
Sbjct  1    MSKAVVSGLLTIAFVFFVVFTLATQKGHNNFY--------LARRLGHNRVA---FNPLVE  49

Query  227  RRK-------------GLANPEKSDDDDRY--FNDKGRLDTGLRLMVLFPILDRDPCDGF  361
            + +              L+N   +D +D+Y   +    L+  +RLMVLFP+LD +P DGF
Sbjct  50   KIEEMARETSDHHFLFNLSNIFLNDVEDKYEFVSQVKNLNITMRLMVLFPLLDVEPRDGF  109

Query  362  VDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGD  541
            + +KELE+WN QQAI+RL+YRT + L L D++ DG+I+F EY P+ + + IE N   HG+
Sbjct  110  ISLKELEHWNMQQAIHRLSYRTHKELVLFDQNEDGAITFREYLPKISYQSIENNGMTHGE  169

Query  542  AGWWMIQFKNADVDRNGTLNLYEFRD  619
            AGWW  QFKNAD D NG L   EF++
Sbjct  170  AGWWEDQFKNADFDNNGALGFEEFKE  195



>ref|XP_008661644.1| PREDICTED: uncharacterized protein LOC100274210 isoform X2 [Zea 
mays]
Length=347

 Score =   148 bits (374),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/237 (38%), Positives = 127/237 (54%), Gaps = 13/237 (5%)
 Frame = +2

Query  272  RYFNDKGRLDTGLRLMVLFPILDRDP--CDGFVDVKELEYWNTQQAINRLNYRTQRALSL  445
            RYF     LD   R+  LF ILDR P      V V ELE W   QA  RL+  T+R ++ 
Sbjct  117  RYFGPDAPLDVRQRIAYLFAILDRSPRGVGVGVGVGELEAWLRWQAAARLDAVTRREMAP  176

Query  446  RDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFL  625
             D D DG+++  E+F  + +        GH   GWWM +F +AD D +G+LN  EF DFL
Sbjct  177  HDTDRDGAVTLREFFADWIN-------MGHDKMGWWMHKFASADRDGDGSLNAVEFNDFL  229

Query  626  HPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSG----IDV  793
            HPEDS  +++  WLL +KL +MD + D +LS  EF   ++      +  +  G    ++ 
Sbjct  230  HPEDSSQESVMLWLLKDKLSEMDHDGDGRLSQEEFVAQSHIIISGARHADDGGHAHDLER  289

Query  794  PSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKL  964
                + FT LDADKD++L VEE + +   L  GE SYA  +  +L++    +N  KL
Sbjct  290  AEAAKKFTELDADKDNYLTVEEARCVLQSLVTGEFSYATSHAKFLMKVVASSNRTKL  346



>dbj|BAK03620.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=389

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 151/273 (55%), Gaps = 17/273 (6%)
 Frame = +2

Query  263   DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALS  442
             +++ + ND  R +   R+  LFP +D  P DGFV + EL  WN  QA     +R+ R + 
Sbjct  125   EEEDFINDDDRFNISDRIRALFPKIDLSPEDGFVSLDELIRWNLDQARADQLHRSAREME  184

Query  443   LRDKDGDGSISFSEYFPQFTDEDIERNETGHGDA---GWWMIQFKNA-DVDRNGTLNLYE  610
             L DK+G+G +SF+ +      + + +   G G++    WW  +  NA DV+ +G LN  E
Sbjct  185   LYDKNGNGIVSFTAF------QTLRQQSHGDGNSLGFPWWKEEHFNASDVNGDGFLNKTE  238

Query  611   FRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI-  787
             F DFL+P DS N  I   L  ++LRQ D + D KL+  E+  G ++    Y + E + I 
Sbjct  239   FHDFLNPSDSENPKIINLLCRQELRQRDKDGDGKLNFEEYFHGLHDHIHGYDD-ENAAIS  297

Query  788   ---DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDG  958
                ++   +E F+ LD D D F+   EL+P+   L   E  YAR   T+ I EAD ++DG
Sbjct  298   HIGNMTIAKERFSKLDKDNDGFISGHELEPVLDKLHLSERYYARQQATHAISEADKDHDG  357

Query  959   KLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             +LTL+EM+ +   FY ++Y +  D++D +H+E 
Sbjct  358   RLTLEEMIENPYAFYGSVYFS--DDEDYFHEEF  388



>emb|CDM83219.1| unnamed protein product [Triticum aestivum]
Length=389

 Score =   149 bits (375),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 97/271 (36%), Positives = 145/271 (54%), Gaps = 21/271 (8%)
 Frame = +2

Query  275   YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
             + ND  R +   R+  LFP +D  P DGFV + EL  WN  QA     +R+ R + L DK
Sbjct  129   FINDDDRFNVSDRIRALFPKIDLTPKDGFVSLDELIRWNLDQARADQLHRSAREMELYDK  188

Query  455   DGDGSISFSEYFPQFTDEDIERNETGHGDAG-----WWMIQFKNA-DVDRNGTLNLYEFR  616
             +G+G +SF+ +            +  HGD       WW  +  NA DV+ +G LN  EF 
Sbjct  189   NGNGIVSFTTFRAL--------RQQSHGDGNSLGFPWWKEEHFNASDVNGDGFLNKTEFH  240

Query  617   DFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI---  787
             DFL+P DS N  I   L  ++LRQ D + D KL+  E+  G ++    Y + E + I   
Sbjct  241   DFLNPSDSENPKIVNLLCRQELRQRDKDGDGKLNFEEYFHGLHDHIHGYDD-ENAAISHI  299

Query  788   -DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKL  964
              ++   +E F+ LD D D F+   EL+P+   L   E  YAR   T+ I EAD ++DG+L
Sbjct  300   GNMTIAKERFSKLDKDNDGFISEHELEPVLDKLHLSERYYARQQATHAISEADKDHDGRL  359

Query  965   TLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             TL+EM+ +   FY ++Y +  D++D +H+E 
Sbjct  360   TLEEMIENPYAFYGSVYFS--DDEDYFHEEF  388



>ref|XP_003569237.2| PREDICTED: developmentally-regulated G-protein 2 [Brachypodium 
distachyon]
Length=689

 Score =   150 bits (380),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 93/265 (35%), Positives = 146/265 (55%), Gaps = 9/265 (3%)
 Frame = +2

Query  275   YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
             + ND  R +   R+  LFP +D  P DGF+ + EL  WN +QA     +R+ R + L DK
Sbjct  429   FINDDDRFNVSDRIRALFPKIDLAPQDGFISLDELIRWNLEQARTDQLHRSAREMELYDK  488

Query  455   DGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYEFRDFLHP  631
             +GDG +SF  + P +     ERN  G     WW  + F  +D + +G LN  EF DFL+P
Sbjct  489   NGDGIVSFEAFQPVYQASHGERNSLGF---PWWKEEHFNASDANGDGFLNKDEFHDFLNP  545

Query  632   EDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTY--KEFETSGI-DVPSV  802
              DS N  I   L  +++RQ D + D KL+  E+  G ++    Y  +  + S I ++   
Sbjct  546   SDSENPKIINLLCRQEIRQRDKDGDGKLNFQEYFHGLHDHIHGYDDENADISHIGNMTIA  605

Query  803   EETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMM  982
             ++ F+ LD D D F+   E++P+   L   E  YAR   T+ + EAD ++DG+LTL+EM+
Sbjct  606   KQRFSKLDKDNDGFISEHEIEPVLDKLHLSERYYARQQATHAMSEADKDHDGRLTLEEMI  665

Query  983   NHDTLFYDTIYDNEKDEDDIYHDEL  1057
              +   FY ++Y +  D++D +H+E 
Sbjct  666   ENPYSFYGSVYFS--DDEDYFHEEF  688



>ref|XP_004510451.1| PREDICTED: calumenin-B-like isoform X1 [Cicer arietinum]
Length=316

 Score =   145 bits (365),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 110/331 (33%), Positives = 160/331 (48%), Gaps = 33/331 (10%)
 Frame = +2

Query  71    KVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARRKGL-AN  247
              +V YTI A  V+ LL+          YSP            + P     + R +   +N
Sbjct  5     SMVVYTIGAIVVLFLLT----------YSP-------NNNNHSTPHHRLFLHRDENQESN  47

Query  248   PEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRT  427
                S   + +  +    DT +R+   FP +D DP D FVD+ EL  WN +Q    + +R+
Sbjct  48    TNHSHTSEEWDENLNVTDTIVRI---FPEIDADPTDQFVDLHELTEWNFEQVQREVLHRS  104

Query  428   QRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLY  607
             QR +++ DK+ DG +SFSEY P   D        G+         F  +D D +G LNL 
Sbjct  105   QREMNIHDKNHDGYLSFSEYGPPTPDGSF-----GYDSRLSEEEHFNASDADGDGFLNLA  159

Query  608   EFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYK-----TYKEF  772
             EF DFLHP DS +  I+ WL    +R+ D ++D K+S  EF  G +++ +     +Y + 
Sbjct  160   EFNDFLHPADSNSAKIKEWLSKMDVRESDTDRDGKVSFKEFFYGLFDSVRYYDAESYNDL  219

Query  773   ETSGIDV-PSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDN  949
               S      S    F+ LD D+D  L   EL PI   L P    YA+    YLI  A+ +
Sbjct  220   HQSDDSTDASARALFSQLDKDRDGSLSDIELLPIIGKLHPSGHYYAKKQAEYLISLAEVD  279

Query  950   NDGKLTLDEMMNHDTLFYDTI-YDNEKDEDD  1039
              DG+L L EM+ +  +FYD I YD+E + DD
Sbjct  280   KDGRLNLTEMIENAYIFYDVIFYDDEVEYDD  310



>gb|KDO69932.1| hypothetical protein CISIN_1g017306mg [Citrus sinensis]
 gb|KDO69933.1| hypothetical protein CISIN_1g017306mg [Citrus sinensis]
Length=339

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/243 (37%), Positives = 134/243 (55%), Gaps = 12/243 (5%)
 Frame = +2

Query  242  ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
            A PE  D  + + Y ND+ + +   RL++LFP +D +P DG+++  EL  WN QQA   +
Sbjct  94   AQPEWEDFMNAEDYLNDEEKFNVTDRLVLLFPKIDVNPADGYINEDELTDWNMQQAERDV  153

Query  416  NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
             +RTQR +   DK+ DG +SF+EY P     + + N  G+ D GWW  +  NA D D +G
Sbjct  154  MHRTQREMETHDKNKDGFVSFAEYEPPTWVRNSDNNSFGY-DMGWWKEEHFNASDADGDG  212

Query  593  TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTY-KE  769
             LNL EF DFLHP D++N  +  WL  E++R+ D ++D K++  EF  G ++  + Y  E
Sbjct  213  LLNLTEFNDFLHPADTKNPKLILWLSKEEVRERDSDRDGKVNFKEFFHGLFDLVRNYDDE  272

Query  770  FETSG------IDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLI  931
               S       +D P+  + F  LD D D +L   EL PI   L P E  YA+    Y+I
Sbjct  273  GHNSSHPSDDTMDAPA-RQLFGQLDKDGDGYLSDVELLPIIGKLHPSERYYAKQQADYII  331

Query  932  REA  940
             + 
Sbjct  332  SQV  334



>ref|XP_004969021.1| PREDICTED: calumenin-like isoform X1 [Setaria italica]
 ref|XP_004969022.1| PREDICTED: calumenin-like isoform X2 [Setaria italica]
Length=397

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 147/271 (54%), Gaps = 21/271 (8%)
 Frame = +2

Query  275   YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
             + ND  R +   R+  LFP +D  P DGFV + EL  WN +QA    ++R+ R + L DK
Sbjct  137   FINDDDRFNLADRIHALFPKIDVSPTDGFVSLDELTRWNLEQARADQHHRSAREMELYDK  196

Query  455   DGDGSISFSEYFPQFTDEDIERNETGHGDAG-----WWMIQFKNA-DVDRNGTLNLYEFR  616
              G+G +SF+ +       +  R E+ HGD       WW  +  NA D + +G L+  EF 
Sbjct  197   KGNGIVSFATF-------NTLRQES-HGDGNMLGFPWWKEEHFNASDANGDGFLDKSEFN  248

Query  617   DFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI---  787
             DFL+P DS N  I   L  +++RQ D + D KL+  E+  G ++    Y + E + I   
Sbjct  249   DFLNPSDSDNPKIINLLSKQEIRQRDKDGDGKLNFDEYFNGLHDHIHGYDD-ENADISHI  307

Query  788   -DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKL  964
              ++   ++ F+ LD D D F+  +EL+P+   L   E  YAR    + I EAD ++DG+L
Sbjct  308   GNITVAKDRFSKLDKDNDGFISEQELEPVLDKLYLSERYYARQQAIHAISEADKDHDGRL  367

Query  965   TLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
              LDEM+ +  +FY ++Y    D+DD +HDE 
Sbjct  368   ALDEMIENPYVFYGSVY--LSDDDDYFHDEF  396



>ref|XP_004173689.1| PREDICTED: uncharacterized protein LOC101225663 [Cucumis sativus]
Length=171

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 92/125 (74%), Gaps = 1/125 (1%)
 Frame = +2

Query  686   QMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELK  865
             +MD +KD KL+  EF    Y+ YK Y EFET G DVPS EE F  LD D+D  L  EEL+
Sbjct  47    RMDHDKDGKLNFDEFLHHTYDIYKNYIEFETQGEDVPSAEEKFDELDLDEDEVLSTEELR  106

Query  866   PIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEK-DEDDI  1042
             P+F YL PGE+SYA++YT++LI EADDN DG LT+DEM+NH+ +FY T+Y+N+  D +D 
Sbjct  107   PLFQYLHPGEVSYAQHYTSHLINEADDNKDGYLTIDEMLNHEYVFYSTVYENQNGDYEDD  166

Query  1043  YHDEL  1057
             YHDEL
Sbjct  167   YHDEL  171



>ref|XP_004150198.1| PREDICTED: calumenin-like, partial [Cucumis sativus]
Length=302

 Score =   144 bits (362),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 117/208 (56%), Gaps = 11/208 (5%)
 Frame = +2

Query  242  ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
            + PE  D  D + Y ND  R +   RLM+LFP +D DP DGFV V+EL  WN  QA    
Sbjct  96   SQPEWEDFADAEDYINDDNRFNVTDRLMLLFPKIDVDPVDGFVTVEELTEWNLHQAQRET  155

Query  416  NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
             +RTQR L   DK+ DG +SFSEY P     + + +  G+ D GWW ++  NA DVD +G
Sbjct  156  LHRTQRELETHDKNHDGFVSFSEYEPPSWVRNSDNSSFGY-DMGWWKLEHFNASDVDGDG  214

Query  593  TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEF  772
             LNL EF DFLHP DS+N  +  WL  E++R+ D +KD K++  EF  G ++  + Y E 
Sbjct  215  LLNLTEFNDFLHPADSKNPKLIHWLCEEEIRERDSDKDGKINFNEFFHGLFDMVRNYDEN  274

Query  773  ETSGI------DVPSVEETFTLLDADKD  838
              S        D P+    F +LD D D
Sbjct  275  HNSSHHSEDSRDGPA-RNLFAVLDKDND  301



>gb|EMT28085.1| Developmentally-regulated GTP-binding protein 2 [Aegilops tauschii]
Length=686

 Score =   147 bits (372),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 144/271 (53%), Gaps = 21/271 (8%)
 Frame = +2

Query  275   YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
             + ND  R +   R+  LFP +D  P DGFV + EL  WN  QA     +R+ R + L DK
Sbjct  426   FINDDDRFNVSDRIRALFPKIDLSPKDGFVSLDELIRWNLDQARADQLHRSAREMELYDK  485

Query  455   DGDGSISFSEYFPQFTDEDIERNETGHGDAG-----WWMIQ-FKNADVDRNGTLNLYEFR  616
             +G+G +SF+ +            +  HGD       WW  + F  +DV+ +G LN  EF 
Sbjct  486   NGNGIVSFTTFRAL--------RQQSHGDGNSLGFPWWKEEHFNASDVNGDGFLNKTEFH  537

Query  617   DFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI---  787
             DFL+P DS N  I   L  ++LRQ D + D KL+  E+  G ++    Y + E + I   
Sbjct  538   DFLNPSDSENPKIINLLCRQELRQRDKDGDGKLNFEEYFHGLHDHIHGYDD-ENAAISHI  596

Query  788   -DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKL  964
              ++   +E F  LD D D F+   EL+P+   L   E  YAR   T+ I EAD ++DG+L
Sbjct  597   GNMTIAKERFAKLDKDNDGFISEHELEPVLDKLHLSERYYARQQATHAISEADKDHDGRL  656

Query  965   TLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             TL+EM+ +   FY ++Y +  D++D +H+E 
Sbjct  657   TLEEMIENPYAFYGSVYFS--DDEDYFHEEF  685



>gb|EMS62241.1| Developmentally-regulated GTP-binding protein 2 [Triticum urartu]
Length=756

 Score =   147 bits (372),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 97/271 (36%), Positives = 144/271 (53%), Gaps = 21/271 (8%)
 Frame = +2

Query  275   YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
             + ND  R +   R+  LFP +D  P DGFV + EL  WN  QA     +R+ R + L DK
Sbjct  496   FINDDDRFNVSDRIRALFPKIDLSPKDGFVSLDELIRWNLDQARADQLHRSAREMELYDK  555

Query  455   DGDGSISFSEYFPQFTDEDIERNETGHGDAG-----WWMIQFKNA-DVDRNGTLNLYEFR  616
             +G+G +SF+ +            +  HGD       WW  +  NA DV+ +G LN  EF 
Sbjct  556   NGNGIVSFTTFRAL--------RQQSHGDGNSLGFPWWKEEHFNASDVNGDGFLNKTEFH  607

Query  617   DFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI---  787
             DFL+P DS N  I   L  ++LRQ D + D KL+  E+  G ++    Y + E + I   
Sbjct  608   DFLNPSDSENPKIINLLCRQELRQRDKDGDGKLNFEEYFHGLHDHIHGYDD-ENAAISHI  666

Query  788   -DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKL  964
              ++    E F+ LD D D F+   EL+P+   L   E  YAR   T+ I EAD ++DG+L
Sbjct  667   GNMTIANERFSKLDKDNDGFISEHELEPVLDKLHLSERYYARQQATHAISEADKDHDGRL  726

Query  965   TLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             TL+EM+ +   FY ++Y +  D++D +H+E 
Sbjct  727   TLEEMIENPYAFYGSVYFS--DDEDYFHEEF  755



>ref|XP_002458033.1| hypothetical protein SORBIDRAFT_03g025800 [Sorghum bicolor]
 gb|EES03153.1| hypothetical protein SORBIDRAFT_03g025800 [Sorghum bicolor]
Length=392

 Score =   141 bits (355),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 117/378 (31%), Positives = 179/378 (47%), Gaps = 54/378 (14%)
 Frame = +2

Query  74    VVAYTIAAAFVILLLSQDHNKLFRKDYSP-RGLSRRLGTQGTAPPI--------------  208
             V+   +A AF++LLL   ++   +  ++  R L RRL     + P               
Sbjct  18    VLLLYVACAFILLLLLASYSPGLQPHHAHGRSLHRRLKLHPKSYPSSGAASGGNGGQQET  77

Query  209   ------FDPIVA---RR-----------KGLANPEKSD----------DDDRYFNDKGRL  298
                   FDP +A   RR             L   E  D          D++ + ND  R 
Sbjct  78    HHHAASFDPTIAELERRLDDKEWEREHYSLLHGAEPDDHMKEWEEFLKDEEDFINDDERF  137

Query  299   DTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISF  478
             +   R+  LFP +D  P DGFV + EL  WN QQA    ++R+ R + L +KDGDG +SF
Sbjct  138   NVADRIRELFPKIDVAPQDGFVSLDELTTWNLQQARADQHHRSAREMELYNKDGDGIVSF  197

Query  479   SEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNI  655
               +     +   E N  G     WW  +  NA D + +G L+  EF DFL+P DS N  I
Sbjct  198   EAFNALRQESHGEGNMLG---FQWWKEEHFNASDANADGFLDKDEFNDFLNPSDSDNPKI  254

Query  656   RRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI----DVPSVEETFTLL  823
                L  +++RQ D + D KL+  E+     +    Y + E + I    +V   ++ F+ L
Sbjct  255   INLLCRQEIRQRDKDGDGKLNFEEYFSALNDHIHGYDD-ENADISHIGNVTVAKDRFSKL  313

Query  824   DADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFY  1003
             D D D F+   EL+P+   L   E  Y+R    + I EAD ++DG+LTL+EM+ +   FY
Sbjct  314   DKDNDGFISEHELEPVLDKLYLSERYYSRQQAIHAISEADKDHDGRLTLEEMIENPYAFY  373

Query  1004  DTIYDNEKDEDDIYHDEL  1057
              ++Y ++ D++D +HDE 
Sbjct  374   GSVYLSDDDDEDYFHDEF  391



>gb|KDO59624.1| hypothetical protein CISIN_1g0485992mg, partial [Citrus sinensis]
Length=126

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = +2

Query  686   QMDVNKDQKLSLLEFERGAYETYKTYKEFE--TSGIDVPSVEETFTLLDADKDSFLRVEE  859
             +MD + D KL+L EF    Y TYK+Y EFE    G D PS EETF  LD +KD  L VEE
Sbjct  1     RMDDDNDGKLNLDEFLENTYRTYKSYAEFEDDGDGTDFPSAEETFVELDTNKDKLLEVEE  60

Query  860   LKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYD  1018
             LKPIF YL PGE+SYA+YY+ +LI EADDN DG LTLDEM+NH+ +FY+T+Y+
Sbjct  61    LKPIFSYLHPGEISYAKYYSRHLIHEADDNRDGNLTLDEMLNHEYIFYNTVYN  113



>ref|XP_004510449.1| PREDICTED: calumenin-B-like isoform X1 [Cicer arietinum]
Length=315

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/253 (36%), Positives = 133/253 (53%), Gaps = 20/253 (8%)
 Frame = +2

Query  314   LMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFP  493
             ++ +FP +D DP D FVD+ EL  WN +     +  R+QR +++ DK+ DG +SFSEY P
Sbjct  66    IVRIFPEIDADPTDQFVDLHELTEWNFEHVQREVLNRSQREMNIHDKNHDGYLSFSEYGP  125

Query  494   QFTDE----DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRR  661
                D     D+  +E  H         F  +D D +G LNL EF DFLHP D+ +  I+ 
Sbjct  126   PTPDGSFGYDLRLSEEEH---------FNASDADGDGFLNLAEFNDFLHPADNNSSKIKE  176

Query  662   WLLTEKLRQMDVNKDQKLSLLEFERGAYETYK-----TYKEFETSGIDV-PSVEETFTLL  823
             WL    +R+ D ++D K+S  EF  G +++ +     +Y +   S      S    F+ L
Sbjct  177   WLSKVDVRESDTDRDGKVSFKEFFYGLFDSVRYYDAESYNDLHQSDDSTDASARALFSQL  236

Query  824   DADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFY  1003
             D D D  L   EL PI   L P    YA+    YLI  A+ + DG+L L EM+ +  +FY
Sbjct  237   DKDHDGSLSDNELLPIIGKLHPSGHYYAKKQAEYLISLAEVDKDGRLNLTEMIENAYIFY  296

Query  1004  DTI-YDNEKDEDD  1039
             D I YD+E + DD
Sbjct  297   DVIFYDDEVEYDD  309



>ref|XP_008654569.1| PREDICTED: uncharacterized protein LOC100273329 isoform X1 [Zea 
mays]
 gb|AFW83087.1| hypothetical protein ZEAMMB73_495027 [Zea mays]
Length=396

 Score =   140 bits (352),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 91/268 (34%), Positives = 142/268 (53%), Gaps = 11/268 (4%)
 Frame = +2

Query  275   YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
             + ND  R +   R+  LFP +D  P DGFV + EL  WN QQA    ++R+ R + L +K
Sbjct  132   FINDDDRFNIADRIRALFPKIDVAPQDGFVSLDELTAWNLQQARADQHHRSAREMELYNK  191

Query  455   DGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLHP  631
             +GD  +SF  +     +   E N  G     WW    F  +D + +G L+  EF DFL+P
Sbjct  192   NGDEIVSFEAFNALRQESHGEGNMLG---FEWWKEDHFNASDANADGFLDKTEFNDFLNP  248

Query  632   EDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI----DVPS  799
              DS N  I   L  +++RQ D + D KL+  E+  G ++    Y + E + I    ++  
Sbjct  249   SDSDNPKIINLLCKQEIRQRDKDGDGKLNFEEYFTGLHDHIHGYDD-ENADISQIGNITV  307

Query  800   VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEM  979
              ++ F  LD D D F+   EL+P+   L   E  Y+R    + I EAD ++DG+LTL+EM
Sbjct  308   AKDRFFKLDKDNDGFISEHELEPVLDKLYLSERYYSRQQAIHAISEADKDHDGRLTLEEM  367

Query  980   MNHDTLFYDTIY--DNEKDEDDIYHDEL  1057
             + +   FY ++Y   ++ D++D +HDE 
Sbjct  368   VENPYAFYGSVYLSSSDNDDEDYFHDEF  395



>gb|ACR34935.1| unknown [Zea mays]
Length=396

 Score =   140 bits (352),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 91/268 (34%), Positives = 142/268 (53%), Gaps = 11/268 (4%)
 Frame = +2

Query  275   YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
             + ND  R +   R+  LFP +D  P DGFV + EL  WN QQA    ++R+ R + L +K
Sbjct  132   FINDDDRFNIADRIRALFPKIDVAPQDGFVSLDELTAWNLQQARADQHHRSAREMELYNK  191

Query  455   DGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLHP  631
             +GD  +SF  +     +   E N  G     WW    F  +D + +G L+  EF DFL+P
Sbjct  192   NGDEIVSFEAFNALRQESHGEGNMLG---FEWWEEDHFNASDANADGFLDKTEFNDFLNP  248

Query  632   EDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI----DVPS  799
              DS N  I   L  +++RQ D + D KL+  E+  G ++    Y + E + I    ++  
Sbjct  249   SDSDNPKIINLLCKQEIRQRDKDGDGKLNFEEYFTGLHDHIHGYDD-ENADISQIGNITV  307

Query  800   VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEM  979
              ++ F  LD D D F+   EL+P+   L   E  Y+R    + I EAD ++DG+LTL+EM
Sbjct  308   AKDRFFKLDKDNDGFISEHELEPVLDKLYLSERYYSRQQAIHAISEADKDHDGRLTLEEM  367

Query  980   MNHDTLFYDTIY--DNEKDEDDIYHDEL  1057
             + +   FY ++Y   ++ D++D +HDE 
Sbjct  368   VENPYAFYGSVYLSSSDNDDEDYFHDEF  395



>ref|XP_006646020.1| PREDICTED: calumenin-like [Oryza brachyantha]
Length=394

 Score =   139 bits (350),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 87/246 (35%), Positives = 131/246 (53%), Gaps = 9/246 (4%)
 Frame = +2

Query  293   RLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSI  472
             R +   R+  LFP +D  P DGFV + EL  WN +Q+     +R+ R + L +K+GDG +
Sbjct  140   RFNLADRIRALFPKIDLAPQDGFVSLDELARWNLEQSRADQLHRSAREMELYNKNGDGMV  199

Query  473   SFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRND  649
             S+ ++  Q  +   E N  G     WW  +  NA D D +G LN  EF DFL+P DS N 
Sbjct  200   SYGDFRAQHDESHGEVNSLG---FPWWKEEHFNASDADGDGLLNKAEFNDFLNPSDSENP  256

Query  650   NIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPS----VEETFT  817
              I   L  +++RQ D + D KL+  E+  G ++    Y + E + I +       +E F 
Sbjct  257   KIISLLCKQEIRQRDKDGDGKLNFEEYFHGLHDHIHGYDD-ENAYISLIGNTTVAKERFA  315

Query  818   LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTL  997
              LD D D F+   EL+P+   L   E  YAR    + I EAD ++DG+LTL+EM+ +   
Sbjct  316   KLDKDNDGFVSDHELEPVLDKLHLSERYYARQQAIHAISEADKDHDGRLTLEEMIENPYA  375

Query  998   FYDTIY  1015
             FY +++
Sbjct  376   FYGSVF  381



>ref|XP_003627249.1| Calumenin [Medicago truncatula]
 gb|AET01725.1| calcium-binding EF hand-like protein [Medicago truncatula]
Length=287

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 102/334 (31%), Positives = 155/334 (46%), Gaps = 64/334 (19%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARRKGLA  244
             +  ++ YTI    V+ LLS+ HNK                                +   
Sbjct  2     IKSILVYTIIIISVLFLLSRTHNK--------------------------------QQQI  29

Query  245   NPEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYR  424
             +P    D+D +       +   R+  LFP +D DP D FV V+EL  WN      ++ + 
Sbjct  30    HPSAEWDEDEF-------NVTNRIARLFPEIDVDPTDQFVSVQELTQWNVHHVQRQILHH  82

Query  425   TQRALSLRDKDGDGSISFSEYFPQFTDE-------DIERNETGHGDAGWWMIQFKNADVD  583
             +Q+ + + DK+ DG +SFSE F  FT         D+   E  H         F  +DVD
Sbjct  83    SQKEMVVYDKNRDGFVSFSE-FGLFTPTTGDPFGYDLRLLEEEH---------FNASDVD  132

Query  584   RNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTY  763
              +G LNL EF DFLHP DS N  +++WL  E++R+ D+++D K+S  EF  G Y+    Y
Sbjct  133   GDGLLNLAEFNDFLHPADSNNPRLQQWLCKEEVRERDMDRDGKVSFREFFYGLYDLVSNY  192

Query  764   KE-------FETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTT  922
              E            +D  S +  F+ LD D D +L   EL PI   + P    YA     
Sbjct  193   DEKSHNDSHHSDHSMDA-SAKVLFSQLDKDFDGYLSDIELLPIIGKVHPSGHYYATKQAE  251

Query  923   YLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNE  1024
             YL+ +A+ +NDG+L L EM+++    + +I+ +E
Sbjct  252   YLMSQAEVDNDGRLNLTEMIDNAYTLFVSIFPDE  285



>gb|EEC78266.1| hypothetical protein OsI_17954 [Oryza sativa Indica Group]
Length=320

 Score =   136 bits (342),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 90/251 (36%), Positives = 123/251 (49%), Gaps = 43/251 (17%)
 Frame = +2

Query  269   DRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLR  448
             +RYF   G L+   RL+ LFP+L R P DG V   ELE W  +QA +RL+   +R L   
Sbjct  90    ERYFGSDGELNVKERLLYLFPMLHRAPKDGGVSCGELEAWLRRQAADRLDAVARRELKRH  149

Query  449   DKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLH  628
             DKDGDGS +  +            N +  G                           FLH
Sbjct  150   DKDGDGSAAAPD------------NTSSQGS--------------------------FLH  171

Query  629   PEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGID---VPS  799
             PEDS  + ++ WLL +KL  MD ++D KLSL EF    +         E S  D      
Sbjct  172   PEDSSQEKVKLWLLKDKLSGMDHDRDGKLSLDEF-ISQFHMIDHNSIVEHSADDDTSCAE  230

Query  800   VEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEM  979
              E+ F  LD++ D +L VEE +P+   L  GE SYA+ +   L++ ADDN D KL+L+EM
Sbjct  231   AEKKFRELDSNNDGYLTVEEARPVIQSLISGEFSYAKSHAKLLMK-ADDNKDNKLSLEEM  289

Query  980   MNHDTLFYDTI  1012
             +NH   FY+ +
Sbjct  290   LNHYLSFYNIV  300



>emb|CAJ86276.1| H0901F07.13 [Oryza sativa Indica Group]
 emb|CAJ86284.1| H0124B04.1 [Oryza sativa Indica Group]
Length=376

 Score =   130 bits (328),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 92/291 (32%), Positives = 130/291 (45%), Gaps = 67/291 (23%)
 Frame = +2

Query  269   DRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLR  448
             +RYF   G L+   RL+ LFP+L R P DG V   ELE W  +QA +RL+   +R L   
Sbjct  90    ERYFGSDGELNVKERLLYLFPMLHRAPKDGGVSCGELEAWLRRQAADRLDAVARRELKRH  149

Query  449   DKDGDGSISFSEYFPQFTDEDI--------------------------------------  514
             DKDGDG ++  EY     D+ I                                      
Sbjct  150   DKDGDGVVTLREYLAVDHDQHIGTDNCNFSVSVCTVFVDASPRFKHVICSPQRHPTTRRR  209

Query  515   --ERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQ  688
               +  +T HG+ GWW+ +F +AD D +G ++  E  D                       
Sbjct  210   KGDWTDTEHGEPGWWLHKFISADRDHSGAMDFIELND----------------------G  247

Query  689   MDVNKDQKLSLLEFERGAYETYKTYKEFETSGID---VPSVEETFTLLDADKDSFLRVEE  859
             MD ++D KLSL EF    +         E S  D       E+ F  LD++ D +L VEE
Sbjct  248   MDHDRDGKLSLDEF-ISQFHMIDHNSIVEHSADDDTSCAEAEKKFRELDSNNDGYLTVEE  306

Query  860   LKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTI  1012
              +P+   L  GE SYA+ +   L++ ADDN D KL+L+EM+NH   FY+ +
Sbjct  307   ARPVIQSLISGEFSYAKSHAKLLMK-ADDNKDNKLSLEEMLNHYLSFYNIV  356



>ref|NP_001043383.1| Os01g0572700 [Oryza sativa Japonica Group]
 dbj|BAF05297.1| Os01g0572700 [Oryza sativa Japonica Group]
Length=244

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 82/234 (35%), Positives = 126/234 (54%), Gaps = 11/234 (5%)
 Frame = +2

Query  371   KELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGW  550
             + L  WN +Q+     +R+ R + L DK+GDG +S+ ++  Q  +   E N  G     W
Sbjct  16    RALTRWNLEQSRADQLHRSAREMELYDKNGDGVVSYGDFRAQHNESSGEVNSLG---FPW  72

Query  551   WMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLE  727
             W  +  NA D D +G LN  EF DFL+P DS N  I   L  +++RQ D + D KL+  E
Sbjct  73    WKEEHFNASDADGHGFLNKTEFNDFLNPSDSENPQIINLLCKQEIRQRDKDGDGKLNFEE  132

Query  728   FERGAYETYKTYKEFETSGI----DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGE  895
             +  G ++    Y ++E + I    +    +E F+ LD D D F+   EL+P+   L   E
Sbjct  133   YFHGLHDHIHGY-DYENADISHIGNNTVAKERFSKLDKDSDGFISEHELEPVLDKLHLSE  191

Query  896   LSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
               YAR    + I EAD ++DG+LTLDEM+ +   FY +++    D++D +HDE 
Sbjct  192   RYYARQQAAHAISEADKDHDGRLTLDEMIENPYAFYGSVF--LSDDEDYFHDEF  243



>dbj|BAD17628.1| calcium-binding EF hand family protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD17636.1| calcium-binding EF hand family protein-like [Oryza sativa Japonica 
Group]
Length=392

 Score =   130 bits (327),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 96/285 (34%), Positives = 144/285 (51%), Gaps = 26/285 (9%)
 Frame = +2

Query  257   SDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRA  436
             +D D+ Y ND  R +   R+  LFP +D DP DG V   EL  WN   A   + +RT R 
Sbjct  115   ADPDEDYINDAARFNLTRRVEALFPKIDVDPADGAVTPAELTAWNLASARREVMHRTARE  174

Query  437   LSLRDKDGDGSISFSEY-FPQFTDEDIERNETGHGDAGWWMIQ-FKNADVDRNGTLNLYE  610
             L L D+D DG I+FSEY  P +     + N +  G  GWW  + F  +D+D     +L  
Sbjct  175   LDLHDRDHDGRIAFSEYERPSWAWRFDDHNSSNDG-VGWWKEEHFNASDMD---VFSLVY  230

Query  611   FRDFL------HPEDSRNDNIRRWLLTEKL------RQMDVNKDQKLSLLEFERGAYETY  754
             F   L       P+ ++    RR  + +        R+ D + D KL+  EF  G + + 
Sbjct  231   FVQLLTSSRYYEPKANKLVVQRRSQVGDSTGYSLESRERDKDNDGKLNFQEFYNGLFYSI  290

Query  755   KTYKEF----ETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTT  922
             + + E     +++  D P+  ++FT LD D D  L  +ELKPI   L P E  YA+    
Sbjct  291   RHFDEEASTDDSNASDAPA-RKSFTHLDLDNDGLLSADELKPIIGNLHPPEHFYAKQQAD  349

Query  923   YLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             Y+I +AD N DG+L+L EM+ +  +FY  ++    ++D  +HDEL
Sbjct  350   YVITQADTNKDGQLSLQEMIENPYVFYSALF---TEDDYGFHDEL  391



>ref|XP_007043215.1| Calcium-binding EF hand family protein isoform 2, partial [Theobroma 
cacao]
 gb|EOX99046.1| Calcium-binding EF hand family protein isoform 2, partial [Theobroma 
cacao]
Length=250

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 88/252 (35%), Positives = 125/252 (50%), Gaps = 49/252 (19%)
 Frame = +2

Query  59   GKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGT---------APPIF  211
            GK++ VV Y   A  ++ L+S   NK     +S     RRL  + +          P  F
Sbjct  2    GKVSAVV-YITVALLILFLISYSPNK-----HSSHNRHRRLKLRTSYNFGKPTRHEPVAF  55

Query  212  DPIVA---RRKG----------LANPEKSDDD----------------DRYFNDKGRLDT  304
            DP+VA   RR+            ++PE + D                 + Y ND+ + + 
Sbjct  56   DPLVADIERRREDRQWEKQHFEYSHPEFTHDPAPAEESQPEWEDFMNAEDYLNDEEKFNV  115

Query  305  GLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
              RL++LFP +D DP DGFV   EL  WN QQA   + +RTQR + + DK+ DG IS+ E
Sbjct  116  TDRLVMLFPKIDVDPADGFVTENELTEWNLQQAAREVLHRTQREMEIHDKNHDGLISYKE  175

Query  485  YFPQFTDEDIERNETGHG-DAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIR  658
            Y P      ++ + T  G D GWW  +  NA D D +G LN+ EF DFLHP DS+N  + 
Sbjct  176  YEPPSW---VKNDNTSFGYDMGWWKEEHFNASDADGDGLLNITEFNDFLHPADSKNSKLL  232

Query  659  RWLLTEKLRQMD  694
            +WL  E++R  D
Sbjct  233  KWLCKEEVRNYD  244



>ref|XP_010249086.1| PREDICTED: reticulocalbin-2-like isoform X1 [Nelumbo nucifera]
Length=315

 Score =   122 bits (307),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 113/201 (56%), Gaps = 9/201 (4%)
 Frame = +2

Query  275  YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
            Y ND  + +   RL++LFP +D DP DGFV   EL  WN +Q    + +R++R + + DK
Sbjct  114  YLNDDEKFNVTNRLVLLFPDIDIDPVDGFVTESELMEWNLRQTEKEVTHRSEREMEVYDK  173

Query  455  DGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHP  631
            + DG +SF+EY P    ++   N + + D GWW  +  NA D D +G LN  EF+DF+HP
Sbjct  174  NHDGFVSFAEYDPPGWVKN-SANNSFYYDMGWWKEEHFNASDADEDGLLNQTEFKDFMHP  232

Query  632  EDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE------FETSGIDV  793
             DS N  + +WL  E++ + D +KD K++  +F  G ++  + Y E      F +  ++ 
Sbjct  233  ADSNNPKLLQWLCKEEIWERDSDKDGKINFKDFFHGLFDMIRNYDEESQNSSFHSDSMES  292

Query  794  PSVEETFTLLDADKDSFLRVE  856
            P+ +  F  +D D D  + ++
Sbjct  293  PA-KMLFAQIDQDGDGLIWIK  312



>emb|CAN69014.1| hypothetical protein VITISV_032830 [Vitis vinifera]
Length=179

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/165 (38%), Positives = 96/165 (58%), Gaps = 7/165 (4%)
 Frame = +2

Query  545   GWWMIQ-FKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSL  721
             GWW  + F  +D D +G LN+ EF DFLHP DS+N  + +WL  E++R+ D +KD K++ 
Sbjct  2     GWWKEEHFNASDADGDGLLNITEFNDFLHPADSKNPKLVQWLCKEEIRERDTDKDGKVNF  61

Query  722   LEFERGAYETYKTYKE------FETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYL  883
              EF  G ++  + Y E       E+S +     ++ F+ LD D D  L  +EL PI   L
Sbjct  62    NEFFHGLFDLVRNYNEEGHNSSHESSDLMEAPAKKLFSQLDKDGDGLLSEDELLPIIGKL  121

Query  884   DPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYD  1018
              P E  YA+    Y+I +AD + DG+LTL EM+++  +FY  I++
Sbjct  122   HPSEHYYAKQQADYIISQADADKDGRLTLTEMIDNPYVFYSAIFN  166



>dbj|BAD45102.1| calcium binding protein-like [Oryza sativa Japonica Group]
 dbj|BAD45181.1| calcium binding protein-like [Oryza sativa Japonica Group]
Length=207

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 115/212 (54%), Gaps = 11/212 (5%)
 Frame = +2

Query  437   LSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEF  613
             + L DK+GDG +S+ ++  Q  +   E N  G     WW  +  NA D D +G LN  EF
Sbjct  1     MELYDKNGDGVVSYGDFRAQHNESSGEVNSLG---FPWWKEEHFNASDADGHGFLNKTEF  57

Query  614   RDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI--  787
              DFL+P DS N  I   L  +++RQ D + D KL+  E+  G ++    Y ++E + I  
Sbjct  58    NDFLNPSDSENPQIINLLCKQEIRQRDKDGDGKLNFEEYFHGLHDHIHGY-DYENADISH  116

Query  788   --DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGK  961
               +    +E F+ LD D D F+   EL+P+   L   E  YAR    + I EAD ++DG+
Sbjct  117   IGNNTVAKERFSKLDKDSDGFISEHELEPVLDKLHLSERYYARQQAAHAISEADKDHDGR  176

Query  962   LTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             LTLDEM+ +   FY +++    D++D +HDE 
Sbjct  177   LTLDEMIENPYAFYGSVF--LSDDEDYFHDEF  206



>ref|XP_009613610.1| PREDICTED: calumenin-like [Nicotiana tomentosiformis]
Length=272

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 121/244 (50%), Gaps = 38/244 (16%)
 Frame = +2

Query  59   GKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRR--------LGTQGTAPPIFD  214
            GK + V+ Y   A  ++LL+SQ  +    K +  R L  R        +  +    P FD
Sbjct  2    GKAS-VIIYITIAVLLLLLISQSPSNKAGKRHGHRRLKVRSNFTFDQHIHHEHERIP-FD  59

Query  215  PIVARRKGL------------------------ANPEKSD--DDDRYFNDKGRLDTGLRL  316
            P+VA+ +                          + PE  D  D + Y ND+ + +   RL
Sbjct  60   PLVAKIERQREDKEWEKRYIDTHHPELHAPGEESQPEWEDFMDAEDYLNDEDKFNVTDRL  119

Query  317  MVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQ  496
            ++LFP +D DP DGFV   EL  WN +Q+   + +RT+R + + DK+ D  +SFSEY P 
Sbjct  120  VLLFPKIDVDPSDGFVSEHELTEWNLEQSRKEVLHRTEREMEVHDKNHDAFVSFSEYEPP  179

Query  497  FTDEDIERNETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLT  673
                + + +  G+ D GWW    F  +DVD +G LN+ EF DFLHP D+RN  +  WL  
Sbjct  180  SWVRNSDNSSFGY-DMGWWKEDHFNASDVDGDGLLNITEFNDFLHPADTRNPKLLNWLCK  238

Query  674  EKLR  685
            E++R
Sbjct  239  EEIR  242



>ref|XP_008661645.1| PREDICTED: uncharacterized protein LOC100274210 isoform X3 [Zea 
mays]
 gb|ACF80042.1| unknown [Zea mays]
 gb|AFW59931.1| hypothetical protein ZEAMMB73_452013 [Zea mays]
Length=320

 Score =   117 bits (292),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 102/175 (58%), Gaps = 10/175 (6%)
 Frame = +2

Query  560   QFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERG  739
             QF +AD D +G+LN  EF DFLHPEDS  +++  WLL +KL +MD + D +LS  EF   
Sbjct  147   QFASADRDGDGSLNAVEFNDFLHPEDSSQESVMLWLLKDKLSEMDHDGDGRLSQEEFVAQ  206

Query  740   AYETYKTYKEFETSG----IDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYA  907
             ++      +  +  G    ++     + FT LDADKD++L VEE + +   L  GE SYA
Sbjct  207   SHIIISGARHADDGGHAHDLERAEAAKKFTELDADKDNYLTVEEARCVLQSLVTGEFSYA  266

Query  908   RYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTI-----YDNEKDEDDIYHDEL  1057
               +  +L++ AD N+DGKL+L+EM++    FY T+     Y +E + D    DEL
Sbjct  267   TSHAKFLMK-ADVNHDGKLSLEEMLDDYISFYSTVYMDDHYASEGEVDSDSRDEL  320



>ref|XP_008809951.1| PREDICTED: calumenin-B-like [Phoenix dactylifera]
Length=247

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 96/187 (51%), Gaps = 25/187 (13%)
 Frame = +2

Query  200  PPI-FDPIVA----RR-----------------KGLANPEKSD--DDDRYFNDKGRLDTG  307
            PPI FDPI++    RR                 +G A PE  D  + + Y ND  R +  
Sbjct  56   PPIPFDPIISDIEIRREDKQWEREHFSIPHRDGQGEAAPEWEDFMNAEDYINDDKRFNVT  115

Query  308  LRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY  487
             R+++LFP +D  P DGFV   EL  WN +Q      +RTQR + L DK+ DG ISF EY
Sbjct  116  HRIVLLFPKIDLSPSDGFVSSDELTEWNLRQGTRETMHRTQRDMELHDKNHDGFISFHEY  175

Query  488  FPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRW  664
                 +   +   +   D GWW    F  +DVD NG LNL EF DFLHP DS N  + +W
Sbjct  176  EGPTWNRHSDDKSSSDNDMGWWKEDHFNASDVDGNGLLNLTEFNDFLHPVDSNNPKLIQW  235

Query  665  LLTEKLR  685
            L  E++R
Sbjct  236  LCKEEIR  242



>gb|KDO69934.1| hypothetical protein CISIN_1g017306mg [Citrus sinensis]
Length=243

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 91/151 (60%), Gaps = 4/151 (3%)
 Frame = +2

Query  242  ANPEKSD--DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRL  415
            A PE  D  + + Y ND+ + +   RL++LFP +D +P DG+++  EL  WN QQA   +
Sbjct  94   AQPEWEDFMNAEDYLNDEEKFNVTDRLVLLFPKIDVNPADGYINEDELTDWNMQQAERDV  153

Query  416  NYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNG  592
             +RTQR +   DK+ DG +SF+EY P     + + N  G+ D GWW  +  NA D D +G
Sbjct  154  MHRTQREMETHDKNKDGFVSFAEYEPPTWVRNSDNNSFGY-DMGWWKEEHFNASDADGDG  212

Query  593  TLNLYEFRDFLHPEDSRNDNIRRWLLTEKLR  685
             LNL EF DFLHP D++N  +  WL  E++R
Sbjct  213  LLNLTEFNDFLHPADTKNPKLILWLSKEEVR  243



>ref|XP_006827761.1| hypothetical protein AMTR_s00009p00264050 [Amborella trichopoda]
 gb|ERM95177.1| hypothetical protein AMTR_s00009p00264050 [Amborella trichopoda]
Length=230

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 0/108 (0%)
 Frame = +2

Query  299  DTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISF  478
            D   RL+ LFP++D  P DGFV  +ELE WN +QAI +L   T+R +  RDKDGDG+++ 
Sbjct  97   DVTRRLVFLFPLIDVKPKDGFVSYEELEGWNVRQAIEKLQRETEREMRDRDKDGDGTVTL  156

Query  479  SEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDF  622
             E+    +D ++E N   +G  GWW  QF+NAD D NG+LNL EF  +
Sbjct  157  REFLSHVSDAELEINNMANGHPGWWREQFRNADEDGNGSLNLTEFNKY  204



>gb|AFW59927.1| hypothetical protein ZEAMMB73_452013 [Zea mays]
Length=263

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 86/151 (57%), Gaps = 9/151 (6%)
 Frame = +2

Query  272  RYFNDKGRLDTGLRLMVLFPILDRDP--CDGFVDVKELEYWNTQQAINRLNYRTQRALSL  445
            RYF     LD   R+  LF ILDR P      V V ELE W   QA  RL+  T+R ++ 
Sbjct  117  RYFGPDAPLDVRQRIAYLFAILDRSPRGVGVGVGVGELEAWLRWQAAARLDAVTRREMAP  176

Query  446  RDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFL  625
             D D DG+++  E+F  + +        GH   GWWM +F +AD D +G+LN  EF DFL
Sbjct  177  HDTDRDGAVTLREFFADWIN-------MGHDKMGWWMHKFASADRDGDGSLNAVEFNDFL  229

Query  626  HPEDSRNDNIRRWLLTEKLRQMDVNKDQKLS  718
            HPEDS  +++  WLL +KLR + +++ Q L+
Sbjct  230  HPEDSSQESVMLWLLKDKLRHVRIDRSQLLA  260



>gb|AFW59933.1| hypothetical protein ZEAMMB73_452013 [Zea mays]
Length=303

 Score =   110 bits (274),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 85/149 (57%), Gaps = 4/149 (3%)
 Frame = +2

Query  530  GHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQ  709
            GH   GWWM +F +AD D +G+LN  EF DFLHPEDS  +++  WLL +KL +MD + D 
Sbjct  154  GHDKMGWWMHKFASADRDGDGSLNAVEFNDFLHPEDSSQESVMLWLLKDKLSEMDHDGDG  213

Query  710  KLSLLEFERGAYETYKTYKEFETSG----IDVPSVEETFTLLDADKDSFLRVEELKPIFH  877
            +LS  EF   ++      +  +  G    ++     + FT LDADKD++L VEE + +  
Sbjct  214  RLSQEEFVAQSHIIISGARHADDGGHAHDLERAEAAKKFTELDADKDNYLTVEEARCVLQ  273

Query  878  YLDPGELSYARYYTTYLIREADDNNDGKL  964
             L  GE SYA  +  +L++    +N  KL
Sbjct  274  SLVTGEFSYATSHAKFLMKVVASSNRTKL  302



>ref|NP_001141242.1| uncharacterized protein LOC100273329 [Zea mays]
 gb|ACF85825.1| unknown [Zea mays]
Length=223

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/264 (29%), Positives = 116/264 (44%), Gaps = 58/264 (22%)
 Frame = +2

Query  275   YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
             + ND  R +   R+  LFP +D  P DGFV + EL  WN QQA    ++R+ R + L +K
Sbjct  14    FINDDDRFNIADRIRALFPKIDVAPQDGFVSLDELTAWNLQQARADQHHRSAREMELYNK  73

Query  455   DGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLHP  631
             +GD  +SF  +     +   E N  G     WW    F  +D + +G L+  EF DFL+P
Sbjct  74    NGDEIVSFEAFNALRQESHGEGNMLGF---EWWKEDHFNASDANADGFLDKTEFNDFLNP  130

Query  632   EDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEET  811
              DS N  I   L  +++R                                          
Sbjct  131   SDSDNPKIINLLCKQEIR------------------------------------------  148

Query  812   FTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHD  991
                       F+   EL+P+   L   E  Y+R    + I EAD ++DG+LTL+EM+ + 
Sbjct  149   ----------FISEHELEPVLDKLYLSERYYSRQQAIHAISEADKDHDGRLTLEEMVENP  198

Query  992   TLFYDTIY--DNEKDEDDIYHDEL  1057
               FY ++Y   ++ D++D +HDE 
Sbjct  199   YAFYGSVYLSSSDNDDEDYFHDEF  222



>gb|AFW83088.1| hypothetical protein ZEAMMB73_495027 [Zea mays]
Length=341

 Score =   104 bits (260),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 76/264 (29%), Positives = 116/264 (44%), Gaps = 58/264 (22%)
 Frame = +2

Query  275   YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
             + ND  R +   R+  LFP +D  P DGFV + EL  WN QQA    ++R+ R + L +K
Sbjct  132   FINDDDRFNIADRIRALFPKIDVAPQDGFVSLDELTAWNLQQARADQHHRSAREMELYNK  191

Query  455   DGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMI-QFKNADVDRNGTLNLYEFRDFLHP  631
             +GD  +SF  +     +   E N  G     WW    F  +D + +G L+  EF DFL+P
Sbjct  192   NGDEIVSFEAFNALRQESHGEGNMLG---FEWWKEDHFNASDANADGFLDKTEFNDFLNP  248

Query  632   EDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEET  811
              DS N  I   L  +++R                                          
Sbjct  249   SDSDNPKIINLLCKQEIR------------------------------------------  266

Query  812   FTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHD  991
                       F+   EL+P+   L   E  Y+R    + I EAD ++DG+LTL+EM+ + 
Sbjct  267   ----------FISEHELEPVLDKLYLSERYYSRQQAIHAISEADKDHDGRLTLEEMVENP  316

Query  992   TLFYDTIY--DNEKDEDDIYHDEL  1057
               FY ++Y   ++ D++D +HDE 
Sbjct  317   YAFYGSVYLSSSDNDDEDYFHDEF  340



>ref|XP_004510452.1| PREDICTED: calumenin-B-like isoform X2 [Cicer arietinum]
Length=235

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 110/237 (46%), Gaps = 34/237 (14%)
 Frame = +2

Query  71   KVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARRKGL-AN  247
             +V YTI A  V+ LL+          YSP            + P     + R +   +N
Sbjct  5    SMVVYTIGAIVVLFLLT----------YSP-------NNNNHSTPHHRLFLHRDENQESN  47

Query  248  PEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRT  427
               S   + +  +    DT +R+   FP +D DP D FVD+ EL  WN +Q    + +R+
Sbjct  48   TNHSHTSEEWDENLNVTDTIVRI---FPEIDADPTDQFVDLHELTEWNFEQVQREVLHRS  104

Query  428  QRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLY  607
            QR +++ DK+ DG +SFSEY P   D        G+         F  +D D +G LNL 
Sbjct  105  QREMNIHDKNHDGYLSFSEYGPPTPDGSF-----GYDSRLSEEEHFNASDADGDGFLNLA  159

Query  608  EFRDFLHPEDSRNDNIRRWLLTEKLRQMD--------VNKDQKLSLLEFERGAYETY  754
            EF DFLHP DS +  I+ WL    +R+ D        V+KD +L+L E    AY  Y
Sbjct  160  EFNDFLHPADSNSAKIKEWLSKMDVRESDTDRDGKAEVDKDGRLNLTEMIENAYIFY  216



>gb|ACU23329.1| unknown [Glycine max]
Length=173

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 89/171 (52%), Gaps = 24/171 (14%)
 Frame = +2

Query  65   MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTA-PPIFDPIVAR----  229
            M+K V Y + A  V+  +      L +    P   +RR G +     P  DP+V      
Sbjct  1    MSKAVVYILIATAVLFFIFMSPLNLQKPKGRP---NRRFGYKLLERAPNLDPLVTNIEKE  57

Query  230  ----------RKGLANPEKSDDDD------RYFNDKGRLDTGLRLMVLFPILDRDPCDGF  361
                       + L+N + +          +Y    G+L+T LRL++LFP+LDR+P DG 
Sbjct  58   IEKKMYHEPAPRMLSNLDSTTSVSDVIETYQYLTSGGKLNTTLRLIILFPLLDREPKDGV  117

Query  362  VDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDI  514
            +   ELE W TQ+AI RL+Y TQ  L  +DK+GD +ISF EY PQF+++D+
Sbjct  118  IGFNELEAWITQRAIERLDYLTQVELDSKDKNGDLAISFKEYLPQFSEKDM  168



>ref|XP_007508412.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20516.1| predicted protein [Bathycoccus prasinos]
Length=364

 Score = 98.6 bits (244),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 84/281 (30%), Positives = 128/281 (46%), Gaps = 35/281 (12%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYF  490
             RL  +FP++D D  +G V  +EL  W+  QA N    R +    + D D DG ++  EY 
Sbjct  87    RLEEIFPVIDLDQ-NGIVSREELRIWHYAQARNHSENRAEHEFDVTDNDHDGFVTLKEYL  145

Query  491   PQFTDEDIERNETGHGDAGWWMIQFKNA-------DVDRNGTLNLYEFRDFLHPEDS-RN  646
                 D D+  N T      + +   +NA       D D++G LN  EF  F+HPE+  R 
Sbjct  146   EDDFDVDVTGNGTEKEMEEYNVRWIRNARKVFELTDTDKDGKLNRTEFFYFIHPEEGKRG  205

Query  647   DNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE-------------------  769
               I + L+ E +R  D N D+KL+  EF    +      +E                   
Sbjct  206   SEIGKHLVAETIRDHDTNMDEKLNFTEFYESLFHQVDEVEEEPVGSDDKTNSNEEGSNNN  265

Query  770   --FETSGIDVPSVEETFTLLDADKDSFLRVEEL---KPIFHYLDPGELSYARYYTTYLIR  934
               ++ S + V ++   F  LD DKD  +   EL   +  +  L P    +AR  +  L+ 
Sbjct  266   DAYDESVMRVRAL-ALFARLDKDKDGLVTSHELHADEASYKKLHPTNDDHARDQSGSLVD  324

Query  935   EADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             +AD+N DG L+L E++ +  +FY T   +E D  D YHDE 
Sbjct  325   DADENKDGGLSLVEILKNKMMFYSTAMTSEDDYHD-YHDEF  364



>ref|XP_004510503.1| PREDICTED: uncharacterized protein LOC101494856 [Cicer arietinum]
Length=319

 Score = 97.8 bits (242),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 121/265 (46%), Gaps = 33/265 (12%)
 Frame = +2

Query  314   LMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFP  493
             ++ +FP +D DP D +VD+ EL  WN +Q    + +R+QR +++ DK+ DG +SFSEY P
Sbjct  59    IVRIFPDIDVDPTDQYVDLHELTEWNFEQVQREVLHRSQREMNIHDKNHDGYLSFSEYGP  118

Query  494   QFTDEDIERNETGHGDAGWWMIQF----------------KNADVDRNGTLNLYEFRDFL  625
                D  +  +   H         F                     DR  +L++     ++
Sbjct  119   PAPDP-VSTHRKRHKPPRRSFTSFISRRREKTFLPPANLPPQVQQDRKSSLHMQLAYLYI  177

Query  626   HPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE------FETSGI  787
              P           +L    R+ D ++D K+S  EF  G +++ + Y E       ++   
Sbjct  178   LP---------YCILLFPYRESDTDRDGKVSFKEFFYGLFDSVRYYDEESYNDLHQSDDS  228

Query  788   DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLT  967
                S    F+ LD D D  L   EL PI   L P    YA+    YLI  A+ + DG+L 
Sbjct  229   TDASARALFSQLDKDHDGSLSDIELLPIIGKLHPSGHYYAKKQAEYLISLAEVDKDGRLN  288

Query  968   LDEMMNHDTLFYDTI-YDNEKDEDD  1039
             L EM+ +  +FYD I YD+E + DD
Sbjct  289   LTEMIENAYIFYDAIFYDDEVEYDD  313



>gb|AFW59932.1| hypothetical protein ZEAMMB73_452013 [Zea mays]
Length=286

 Score = 97.1 bits (240),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 79/139 (57%), Gaps = 4/139 (3%)
 Frame = +2

Query  560  QFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERG  739
            QF +AD D +G+LN  EF DFLHPEDS  +++  WLL +KL +MD + D +LS  EF   
Sbjct  147  QFASADRDGDGSLNAVEFNDFLHPEDSSQESVMLWLLKDKLSEMDHDGDGRLSQEEFVAQ  206

Query  740  AYETYKTYKEFETSG----IDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYA  907
            ++      +  +  G    ++     + FT LDADKD++L VEE + +   L  GE SYA
Sbjct  207  SHIIISGARHADDGGHAHDLERAEAAKKFTELDADKDNYLTVEEARCVLQSLVTGEFSYA  266

Query  908  RYYTTYLIREADDNNDGKL  964
              +  +L++    +N  KL
Sbjct  267  TSHAKFLMKVVASSNRTKL  285



>ref|XP_004510450.1| PREDICTED: calumenin-B-like isoform X2 [Cicer arietinum]
Length=234

 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/159 (37%), Positives = 84/159 (53%), Gaps = 21/159 (13%)
 Frame = +2

Query  314  LMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFP  493
            ++ +FP +D DP D FVD+ EL  WN +     +  R+QR +++ DK+ DG +SFSEY P
Sbjct  66   IVRIFPEIDADPTDQFVDLHELTEWNFEHVQREVLNRSQREMNIHDKNHDGYLSFSEYGP  125

Query  494  QFTDE----DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRR  661
               D     D+  +E  H         F  +D D +G LNL EF DFLHP D+ +  I+ 
Sbjct  126  PTPDGSFGYDLRLSEEEH---------FNASDADGDGFLNLAEFNDFLHPADNNSSKIKE  176

Query  662  WLLTEKLRQMD--------VNKDQKLSLLEFERGAYETY  754
            WL    +R+ D        V+KD +L+L E    AY  Y
Sbjct  177  WLSKVDVRESDTDRDGKAEVDKDGRLNLTEMIENAYIFY  215



>ref|XP_004168209.1| PREDICTED: uncharacterized LOC101225663, partial [Cucumis sativus]
Length=160

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 92/167 (55%), Gaps = 20/167 (12%)
 Frame = +2

Query  53   MAGKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARR  232
            M   +  V+  T+ A F ++  S  HN+      S +  +RRLG +    P FDP+V   
Sbjct  1    MGKAVVYVLTATVFALFFLISPSNFHNR------SHQQATRRLGFK-FPNPTFDPLVTEM  53

Query  233  KGLANPEKSD-------------DDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVK  373
            + LA  E+ +             D  R + D+GRL+  LRL+VLFP+LD  P DG +  +
Sbjct  54   ERLAAEERGENAIGVDNQNHKIIDSYRNYYDEGRLNISLRLLVLFPLLDNSPKDGVISYE  113

Query  374  ELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDI  514
            EL  W   QAI RLNYRT + L   DK+GD +ISF EY PQFT+EDI
Sbjct  114  ELSDWINGQAIERLNYRTTKQLEFYDKNGDDAISFHEYLPQFTEEDI  160



>ref|XP_010249093.1| PREDICTED: reticulocalbin-2-like isoform X2 [Nelumbo nucifera]
Length=307

 Score = 88.2 bits (217),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 106/226 (47%), Gaps = 40/226 (18%)
 Frame = +2

Query  275  YFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDK  454
            Y ND  + +   RL++LFP +D DP DGFV   EL  WN +Q    + +R++R + + DK
Sbjct  114  YLNDDEKFNVTNRLVLLFPDIDIDPVDGFVTESELMEWNLRQTEKEVTHRSEREMEVYDK  173

Query  455  DGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNA-DVDRNGTLNLYEFRDFLHP  631
            + DG +SF+EY P    ++   N + + D GWW  +  NA D D +G LN  EF++    
Sbjct  174  NHDGFVSFAEYDPPGWVKN-SANNSFYYDMGWWKEEHFNASDADEDGLLNQTEFKE----  228

Query  632  EDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKE------FETSGIDV  793
                              + D +KD K++  +F  G ++  + Y E      F +  ++ 
Sbjct  229  ------------------ERDSDKDGKINFKDFFHGLFDMIRNYDEESQNSSFHSDSMES  270

Query  794  PSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLI  931
            P+ +  F  +D D D +  ++               Y +Y  T+LI
Sbjct  271  PA-KMLFAQIDQDGDGYSSMQL---------SSSTDYGKYQVTFLI  306



>ref|XP_002129310.1| PREDICTED: reticulocalbin-2-like [Ciona intestinalis]
Length=312

 Score = 82.4 bits (202),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 72/235 (31%), Positives = 108/235 (46%), Gaps = 32/235 (14%)
 Frame = +2

Query  353   DGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY------------FPQ  496
             DGF+D KEL  W  +   +  N   +   S+ D D DG++S+ E+             P+
Sbjct  78    DGFIDAKELHSWTLKAFDSFENDDAKEEFSMVDVDKDGAVSWREHSDDAHGKGYGEESPE  137

Query  497   F----TDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRW  664
             F     +E IE+ ET   D       F  AD D N  L+L E+ +F HP   RN    + 
Sbjct  138   FANPEAEEGIEKKETYLKDKKI----FAAADRDGNEILDLMEYFNFKHP--RRNPETSQV  191

Query  665   LLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSF  844
             L+ +KL  +D NK+  + L E+        K  K  +       S  E F  LD D D  
Sbjct  192   LIEDKLESLDANKNGGIDLEEY-------LKDTKNADEDEALAESETERFGELDGDGDGV  244

Query  845   LRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDT  1009
             LR  EL     ++DP     A     +L+ E+D + DGKL+ DE++N+  L+ ++
Sbjct  245   LRGSEL---LQWIDPDNSEEADDEADHLMTESDKDEDGKLSPDEIVNNHELWVES  296



>ref|XP_002157829.2| PREDICTED: 45 kDa calcium-binding protein-like [Hydra vulgaris]
Length=296

 Score = 78.2 bits (191),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 76/233 (33%), Positives = 104/233 (45%), Gaps = 34/233 (15%)
 Frame = +2

Query  407   NRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDI-----------ERNETGHGDAGWW  553
             N     +++     D + D  +S++EY  Q  D D+           E+NE       W 
Sbjct  82    NEAKSNSEKIFERVDLNKDKFVSWTEYKSQLMDLDLNSLNNSDQAIDEKNEFLREAKNW-  140

Query  554   MIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFE  733
                 KNAD D N  LN+ EF  FLHPE   N  +   +  E +  MDVN D K+S+ EF 
Sbjct  141   ----KNADYDGNNILNMSEFVVFLHPE--HNKRVIEIMADELITPMDVNADGKISVEEFT  194

Query  734   R--GAY---ETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGEL  898
             R  G     E  +  K+++         EE    +DAD D F+  EE      YLDP   
Sbjct  195   RLPGGIVDPEEAELDKQYQKE-----RKEEFERDMDADGDGFVTKEEFCI---YLDPRHF  246

Query  899   SYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
              +A     YLI  AD + DGKL+ DEM+    LF  + ++   D   I HDE 
Sbjct  247   QHASKEAKYLINIADQDKDGKLSEDEMLLKYQLFTGSSFN---DYVKILHDEF  296



>ref|NP_001187699.1| calumenin precursor [Ictalurus punctatus]
 gb|ADO29004.1| calumenin [Ictalurus punctatus]
Length=313

 Score = 77.4 bits (189),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 74/249 (30%), Positives = 120/249 (48%), Gaps = 19/249 (8%)
 Frame = +2

Query  299   DTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISF  478
             ++  RL  +   +D D  DGFV   EL YW   +    +     +     D++ DG IS+
Sbjct  63    ESKARLGKIVERIDTDK-DGFVSHAELHYWIKHRQRRYIEENVDKNWKEYDQNKDGKISW  121

Query  479   SEY----FPQFTD---EDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPED  637
              EY    +  + D   ED+E  E+          +FK AD D +G     EF  FLHPE+
Sbjct  122   IEYKNTTYGTYLDDESEDLEDRESYKAMHARDQRRFKMADKDGDGIATREEFTAFLHPEE  181

Query  638   SRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT  817
                D ++  ++ E +  +D N D K++L E+    +    T +E E+    V +  + F+
Sbjct  182   F--DYMKGLVVQETMEDIDKNGDGKINLEEYIGDMF----TPEEGESEPEWVATERKHFS  235

Query  818   -LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNH-D  991
                DA+KD FL  +E   + H++ P ++ +      +LI E D NNDG L++ E+M+  D
Sbjct  236   EYRDANKDGFLDADE---VAHWILPNDVDHTDNEAKHLIHETDKNNDGLLSVSEIMDELD  292

Query  992   TLFYDTIYD  1018
              +   TI D
Sbjct  293   VIKISTITD  301



>ref|XP_003385607.1| PREDICTED: calumenin-B-like [Amphimedon queenslandica]
Length=323

 Score = 76.3 bits (186),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 74/241 (31%), Positives = 117/241 (49%), Gaps = 20/241 (8%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-  487
            RL V+F  +D +  D  ++  EL+ W    A   +   T   +   DK+ DG ++  EY 
Sbjct  74   RLQVIFGKIDTN-NDKHIEHNELKKWVESVAHRHVIDSTAEQMPEFDKNKDGKVTLEEYH  132

Query  488  ---FPQFTDEDIERNETGHGDAGWWMIQ------FKNADVDRNGTLNLYEFRDFLHPEDS  640
               + +  DED E +   H    +  ++      F +AD D +G+LN  EF  FLHPED 
Sbjct  133  STAYGEVEDEDAEYD--PHRKLSFKEMKARDKRRFDSADKDNDGSLNKEEFGTFLHPED-  189

Query  641  RNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTL  820
             ND++R  ++ E +  MD +KD  ++L E+    +      +E E+    V S  E F+ 
Sbjct  190  -NDHMRDIVIDEAMEDMDKDKDGFIALQEYVDDIW-PKNDRQEDESEPDWVKSEREQFSQ  247

Query  821  L-DADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTL  997
              D++KD  L   EL     ++ P     A     +LI  AD + DGKLT+ EM+ ++ L
Sbjct  248  HRDSNKDGKLDKRELGS---WIAPDGHDNAEAEARHLIFNADKDKDGKLTMAEMLENEEL  304

Query  998  F  1000
            F
Sbjct  305  F  305



>ref|XP_009602532.1| PREDICTED: calumenin-B-like [Nicotiana tomentosiformis]
Length=187

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 67/130 (52%), Gaps = 7/130 (5%)
 Frame = +2

Query  686   QMDVNKDQKLSLLEFERGAYETYKTYKE------FETSGIDVPSVEETFTLLDADKDSFL  847
             + D +KD K++  EF  G ++  + Y E        +         + F  LD D D +L
Sbjct  58    ERDSDKDGKVNFKEFFHGLFDLVRNYDEESHDSSHHSEDSQESPARKLFAELDKDGDGYL  117

Query  848   RVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEK  1027
                EL PI   L P E  YA+    Y+I++AD + DG+LTL EM++   +FY  I+ NE 
Sbjct  118   SDAELLPIIGKLHPSERYYAKQQADYIIQQADADKDGRLTLKEMIDSPYVFYSAIF-NED  176

Query  1028  DEDDIYHDEL  1057
             DED  YHDE 
Sbjct  177   DEDYEYHDEF  186



>gb|KHJ96096.1| EF hand [Oesophagostomum dentatum]
Length=288

 Score = 74.3 bits (181),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 113/250 (45%), Gaps = 37/250 (15%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALS--LRDKDGDGSISFSE  484
             RL  L P +D D  DGFVD KEL+   T      +N   +R       DK  DG I + +
Sbjct  38    RLAKLVPKMDSD-GDGFVDEKELKEHITFMQKRYVNNDVERTWKNYKDDKIVDGKIKWED  96

Query  485   YFPQFTDEDIERNETGHG-------------DAGWWMIQFKNADVDRNGTLNLYEFRDFL  625
             Y      E +  + TG G             D   W +    AD D NG L+  E+  F+
Sbjct  97    YR-----EMVYGSPTGEGQELSPEYAKMIARDEKRWAV----ADYDSNGALDRTEYGCFM  147

Query  626   HPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGID-VPSV  802
             HPED   D++R  ++ E +  +D NKD  + L E+    Y   + Y E      D V S 
Sbjct  148   HPEDC--DHMRDVVVAETIEDIDKNKDGYVDLEEYIGDMYRP-EDYPELNGKEPDWVQSE  204

Query  803   EETFT-LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEM  979
              E F    D D D  L  EE++    ++ P    +A     +L+  ADDN DGKL++DE+
Sbjct  205   REMFKEHRDKDGDGKLNQEEMRD---WIMPVGFDHAEAEARHLVGIADDNKDGKLSMDEI  261

Query  980   MNHDTLFYDT  1009
             + H    YDT
Sbjct  262   LAH----YDT  267



>ref|XP_010754283.1| PREDICTED: reticulocalbin-3 isoform X2 [Larimichthys crocea]
Length=323

 Score = 74.3 bits (181),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 70/231 (30%), Positives = 112/231 (48%), Gaps = 19/231 (8%)
 Frame = +2

Query  323  LFPILDRDPCD--GFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY---  487
            L  I+DR   D  G+V   EL +W   +    +     +  +  DK+ DG I++ EY   
Sbjct  78   LAKIVDRIDTDKDGYVTHTELHHWIKHRQRRYIEENVNKHWNDYDKNQDGKIAWEEYKNT  137

Query  488  -FPQFTDE---DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNI  655
             +  + DE   D+E   T          +FK AD D +G     EF  FLHPE+   D +
Sbjct  138  TYGYYLDEEFDDVEDKATYKSMLTRDERRFKTADRDGDGIATREEFTAFLHPEEF--DYM  195

Query  656  RRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT-LLDAD  832
            R  ++ E L  +D N+D K+ + E+    Y    T +  E+    V +  + F+   DA+
Sbjct  196  RDLVVQETLEDIDKNRDGKIDIDEYIGDMY----TPENGESEPDWVKTERKHFSEFRDAN  251

Query  833  KDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMN  985
            KD +L   E   + H++ PGE+ +A     +LI E D + DG+LTL E+++
Sbjct  252  KDGYLDTGE---VSHWILPGEVDHADNEAKHLIHETDTDKDGRLTLSELLD  299



>gb|AFW59934.1| hypothetical protein ZEAMMB73_452013 [Zea mays]
Length=219

 Score = 73.2 bits (178),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  530  GHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQ  709
            GH   GWWM +F +AD D +G+LN  EF DFLHPEDS  +++  WLL +KLR + +++ Q
Sbjct  154  GHDKMGWWMHKFASADRDGDGSLNAVEFNDFLHPEDSSQESVMLWLLKDKLRHVRIDRSQ  213

Query  710  KLS  718
             L+
Sbjct  214  LLA  216



>gb|ACO12502.1| Calumenin precursor [Lepeophtheirus salmonis]
Length=325

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 71/241 (29%), Positives = 119/241 (49%), Gaps = 25/241 (10%)
 Frame = +2

Query  323  LFPILDRDPCD--GFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY---  487
            L  I+DR   D  G+V   EL+ W        +N    +     + DG  S+ + +Y   
Sbjct  77   LAAIVDRIDTDKNGYVSQDELQGWIQFTQQRYINEDVDKQWEQHNPDGKSSLKWEDYRKI  136

Query  488  FPQFTDEDIE--RNETGHGDAGWWMIQ------FKNADVDRNGTLNLYEFRDFLHPEDSR  643
               F D+D E   NE    +  +  +Q      ++ AD + +G L   EF+ FLHPEDS 
Sbjct  137  VYGFLDDDQENPENEEETSNVSYEQMQSRDERRWRTADQNEDGALESAEFKFFLHPEDS-  195

Query  644  NDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAY--ETYKTYKEFETSGIDVPSVEETFT  817
             D++R  ++TE L  +D +KD K+SL E+    Y  E+ +T  ++  SG      E+   
Sbjct  196  -DHMRDIVVTETLEDIDKDKDGKISLEEYISDMYKGESDETEPDWVKSG-----REQFKE  249

Query  818  LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTL  997
              D +KD F+  +E+K   +++ P +  ++     +LI E+D +ND +LT  E+++   L
Sbjct  250  FRDVNKDGFMDHDEVK---NWIVPADFDHSEAEAKHLIFESDSDNDRQLTKIEILDKYDL  306

Query  998  F  1000
            F
Sbjct  307  F  307



>gb|EHJ77301.1| hypothetical protein KGM_10065 [Danaus plexippus]
Length=321

 Score = 73.9 bits (180),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 79/260 (30%), Positives = 127/260 (49%), Gaps = 33/260 (13%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-  487
             RL  L P +D D  D F+D  EL+ W     IN      +  +S  D + DG I++SEY 
Sbjct  84    RLEQLLPKMDLDR-DKFIDRDELKKWILNSFINLSQEEAEERMSEADDNNDGVITWSEYL  142

Query  488   ---FPQFTDEDIERNETGHGDAGWWMIQ----FKNADVDRNGTLNLYEFRDFLHPEDSRN  646
                F    +++I  ++T  G+ G  + +    +K AD + +GTL+  EF  F +PE+  +
Sbjct  143   RDAFGAENEDEISIDDT--GETGMLLPEEKAMWKAADKNGDGTLDFEEFAVFTNPEE--H  198

Query  647   DNIRRWLLTEKLRQMDVNKDQKLSLLEF--ERGAYETYKTYKEFETSGIDVPSVEETFTL  820
               +  +LL + LR+ D + D ++   E+  +RG  +     KE+      + S  + FT 
Sbjct  199   PEMHEYLLQQTLREKDRDGDGRIDFQEYVGDRGVQQD----KEW------LLSERDKFTH  248

Query  821   -LDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTL  997
              LD DKD  L   EL     +L P     A     +L   ADD++DG+L+ +E++ H  +
Sbjct  249   DLDRDKDGSLDAHELT---RWLIPDNNEIAEEEVDHLFASADDDHDGRLSYEEVVGHHHV  305

Query  998   FYDTIYDNEKDEDDIYHDEL  1057
             F  +    E   D  Y+DEL
Sbjct  306   FVGS----EAAPDHRYYDEL  321



>ref|XP_008288435.1| PREDICTED: reticulocalbin-3 isoform X3 [Stegastes partitus]
Length=352

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 68/236 (29%), Positives = 111/236 (47%), Gaps = 15/236 (6%)
 Frame = +2

Query  299  DTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISF  478
            ++  RL  +   +D D  DG++   EL YW   +    +     +     DK+ DG I +
Sbjct  101  ESKARLAKIVDRIDTDK-DGYISHAELHYWIKHRQRRYIEENVNKHWHDYDKNQDGKIGW  159

Query  479  SEY----FPQFTDE---DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPED  637
             EY    +  +  E   DIE   T          +FK AD D +G     EF  FLHPE+
Sbjct  160  EEYKNTTYGYYLGEEFDDIEDKATYKAMLTRDERRFKGADRDADGIATREEFTAFLHPEE  219

Query  638  SRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT  817
               D++R  ++ E +  +D N+D K+ L E+    Y T +   E E   + V   +  + 
Sbjct  220  Y--DHMRDVIVQETMEDIDKNRDGKVDLSEYIGDMY-TPEGDGEPEPDWV-VTERKHFYE  275

Query  818  LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMN  985
              D +KD ++   E   + +++ PGE+ +A     +LI E D N DG+LTL E+++
Sbjct  276  FRDTNKDGYMDAAE---VANWILPGEVDHADNEAKHLIHETDTNKDGRLTLSELLD  328



>ref|XP_010754282.1| PREDICTED: reticulocalbin-3 isoform X1 [Larimichthys crocea]
 ref|XP_010754284.1| PREDICTED: reticulocalbin-3 isoform X1 [Larimichthys crocea]
Length=323

 Score = 73.6 bits (179),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 121/255 (47%), Gaps = 19/255 (7%)
 Frame = +2

Query  323   LFPILDRDPCD--GFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY---  487
             L  I+DR   D  G+V   EL +W   +    +     +  +  DK+ DG I++ EY   
Sbjct  78    LAKIVDRIDTDKDGYVTHTELHHWIKHRQRRYIEENVNKHWNDYDKNQDGKIAWEEYKNT  137

Query  488   -FPQFTDE---DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNI  655
              +  + DE   D+E   T          +FK AD D +G     EF  FLHPE+   D +
Sbjct  138   TYGYYLDEEFDDVEDKATYKSMLTRDERRFKTADRDGDGIATREEFTAFLHPEEF--DYM  195

Query  656   RRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT-LLDAD  832
             R  ++ E L  +D N+D K+ + E+    Y    T +  E+    V +  + F+   DA+
Sbjct  196   RDLVVQETLEDIDKNRDGKIDIDEYIGDMY----TPENGESEPDWVKTERKHFSEFRDAN  251

Query  833   KDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTI  1012
             KD +L   E   + H++ PGE+ +A     +LI E D + DGK+T  E++ +  +F  + 
Sbjct  252   KDGYLDTGE---VSHWILPGEVDHADNEAKHLIHETDTDKDGKITKKEILANWNMFVGSQ  308

Query  1013  YDNEKDEDDIYHDEL  1057
               N  ++    HDEL
Sbjct  309   ATNYGEDLTKRHDEL  323



>ref|XP_001641982.1| predicted protein [Nematostella vectensis]
 gb|EDO49919.1| predicted protein [Nematostella vectensis]
Length=250

 Score = 72.4 bits (176),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 66/236 (28%), Positives = 113/236 (48%), Gaps = 30/236 (13%)
 Frame = +2

Query  353   DGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYF-PQFT------DED  511
             DGFV   EL       +           ++  D + DG +S+ E+    FT      D+ 
Sbjct  35    DGFVTEDELRLRLLNTSRKHRKTEVNSTVTFHDDNKDGKVSWEEFKKAHFTHTEGKEDDK  94

Query  512   IERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQM  691
               + +    +A     +FK ADV+ +G L+L+E+  F HP D  ++ +  W++ + L++ 
Sbjct  95    ATKEQMAEDEA-----KFKYADVNGDGMLDLHEYVTFYHPGD--DERMSAWVIQDTLKKH  147

Query  692   DVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVP-SVEETF-TLLDADKDSFLRVEELK  865
             D +KD  +S  E+             F  +  D    +E+ F T  D +KD  L   E++
Sbjct  148   DTDKDGMISKSEY----------MATFSDANNDAKIELEKDFDTSFDKNKDGKLDQTEIR  197

Query  866   PIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDE  1033
                H+L P +   A+    ++I+EADDN DGKL+++E++ H ++F D     E DE
Sbjct  198   ---HWLFPDD-DMAKEEPAHMIKEADDNKDGKLSMEEILKHSSVFVDNGETPEHDE  249



>emb|CAP24846.2| Protein CBG04054 [Caenorhabditis briggsae]
Length=264

 Score = 72.4 bits (176),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 109/246 (44%), Gaps = 33/246 (13%)
 Frame = +2

Query  353   DGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY----FPQFTDEDIER  520
             DGFVD  EL  W ++     ++      +S  D++ DG +S+ EY    FP+    + E 
Sbjct  41    DGFVDKNELLAWVSESYQKTVDREAVERMSELDENADGFVSWEEYLLDSFPEEELHNKEE  100

Query  521   NETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVN  700
                   D     + FK AD D +G LNL E   FL+PE   + ++   L+   L + D N
Sbjct  101   ETLIAQD----RMYFKQADQDDDGKLNLEELASFLNPE--HHPHMHSVLIAVTLLEKDQN  154

Query  701   KDQKLSLLEF------ERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEEL  862
              D  +   EF      +RG+ E YK              VE   T+ D +KD  L  +EL
Sbjct  155   GDGAIDEKEFLGELDDQRGS-EWYKV------------EVERFHTVYDHNKDGKLSGDEL  201

Query  863   KPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDI  1042
                  +L     +   Y    L+  ADD+ DGKL+ DE++ H  LF  T    E D    
Sbjct  202   ---VAWLLVDGTTAGSYEAQSLLNNADDDKDGKLSYDEIVKHHALFAKTEAAQEADHLHP  258

Query  1043  Y-HDEL  1057
             Y HDEL
Sbjct  259   YSHDEL  264



>emb|CCD81718.1| putative ef hand containing protein [Schistosoma mansoni]
Length=281

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 116/236 (49%), Gaps = 31/236 (13%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYW--NTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
            RL V F  +D +  +GF++  EL  W   T ++++R     ++ L+  D + DG +SF E
Sbjct  43   RLHVYFKKIDTNN-NGFIEDDELASWILKTYESLDR--EHAEKQLTRFDVNKDGKVSFEE  99

Query  485  YFPQF--TDEDIERNETGHGDAGWWM-------IQFKNADVDRNGTLNLYEFRDFLHPED  637
            Y  Q   T E+  R+      + + +       ++F  AD D +G L+L EF  FL PE+
Sbjct  100  YISQTYETSEEELRHSKDDKSSKFILELLKDERLRFSFADKDNDGLLSLEEFTLFLRPEN  159

Query  638  SRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPS-VEETF  814
               +++  + + +     D N D  ++  EF   +Y            G+   + + E F
Sbjct  160  Y--EDMANYEMQKSFSSFDQNGDGMITKDEFTNFSYR-----------GVSQENYLHEQF  206

Query  815  TLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMM  982
            T LD DK+  L ++EL+P   +L P   + A+   T L+   D N DGKLTL+E++
Sbjct  207  TSLDVDKNGILTLDELRP---WLLPSLKAAAKSEATRLMNLTDSNRDGKLTLEEIL  259



>ref|NP_491936.3| Protein CALU-2 [Caenorhabditis elegans]
 emb|CCD66935.2| Protein CALU-2 [Caenorhabditis elegans]
Length=286

 Score = 71.6 bits (174),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 74/243 (30%), Positives = 108/243 (44%), Gaps = 26/243 (11%)
 Frame = +2

Query  353   DGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFP-QFTDEDIERNET  529
             DGFVD  E+  W ++     ++      +S  D++ DG +S+ EY    F DE++   E 
Sbjct  62    DGFVDKSEILAWVSESYQKTVDREAVERISELDENADGFVSWEEYLADSFPDEELHNKEE  121

Query  530   GHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQ  709
                 A   M  FK AD D +G LNL E   FL+PE   + ++   L+   L + D N D 
Sbjct  122   ESLIAQDKMY-FKQADEDNDGKLNLEELASFLNPE--HHPHMHPVLIAVTLLEKDQNGDG  178

Query  710   KLSLLEF-----ERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIF  874
              +   EF     E+   E YK              VE   T+ D +KD  L  +EL    
Sbjct  179   AIEEKEFLGELDEQRGSEWYKV------------EVERFRTVYDKNKDGKLAGDELTD--  224

Query  875   HYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIY--H  1048
              +L     +   Y    L+  +DD+ DG+L+ +E++ H  LF  T    E D    Y  H
Sbjct  225   -WLLVDGTTAGSYEAESLLTNSDDDKDGQLSYEEIVKHHALFAKTEAAQEADHLHPYYSH  283

Query  1049  DEL  1057
             DEL
Sbjct  284   DEL  286



>gb|AAW27305.1| SJCHGC06047 protein [Schistosoma japonicum]
 emb|CAX73591.1| Reticulocalbin-1 precursor [Schistosoma japonicum]
Length=281

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/236 (28%), Positives = 114/236 (48%), Gaps = 31/236 (13%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYW--NTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
            RL + F  +D +  +GF++  EL  W   T ++++R     ++ L   D + D  +S  E
Sbjct  43   RLHIYFKKIDTNN-NGFIEYDELTSWIFKTYESLDR--EHAEKQLVKYDTNKDAKVSLDE  99

Query  485  YFPQ-FTDEDIERNETGHGDAGWWMIQ--------FKNADVDRNGTLNLYEFRDFLHPED  637
            Y  Q +   + E N +    +  ++++        F  AD D +G L+L EF  FL PE+
Sbjct  100  YISQTYETSEEELNHSKDDQSSNFILESLKNERSRFNFADKDCDGLLSLEEFTLFLRPEN  159

Query  638  SRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPS-VEETF  814
               +++  + L +     D N D  +           TY  +  F   G+   + + E F
Sbjct  160  Y--EDMANYELQKSFSSFDQNGDGVV-----------TYDEFTNFSYRGVSQQNYLHEQF  206

Query  815  TLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMM  982
              LD DK++ L ++EL+P   +L P   + A+   T+L+   D N+DG+LTLDE++
Sbjct  207  KSLDVDKNNLLTLDELRP---WLLPSLKAAAKSEATWLMNLTDSNHDGQLTLDEIL  259



>ref|XP_005164069.1| PREDICTED: reticulocalbin-3 isoform X1 [Danio rerio]
Length=315

 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 67/233 (29%), Positives = 113/233 (48%), Gaps = 18/233 (8%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-  487
            RL  +   +D D  DGFV   EL +W   +    +     +  +  D++ DG I + EY 
Sbjct  70   RLGKIVDKIDTDK-DGFVSHAELHHWIKHRQRRYIEENVDKHWNEYDQNKDGKIGWIEYK  128

Query  488  ---FPQFTD---EDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRND  649
               +  + D   +D++   T          +FK+AD D +G     EF  FLHPE+   D
Sbjct  129  NTTYGYYIDTEFDDVDDKATYKSMLNRDERRFKSADRDGDGVATREEFTAFLHPEEF--D  186

Query  650  NIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT-LLD  826
             +R  ++ E +  +D N D K+ L E+    Y      ++ ET    V + ++ F+   D
Sbjct  187  FMRDIVIQETIEDIDKNGDGKIDLQEYIGDMYNP----EDGETEPDWVTTEKKQFSEFRD  242

Query  827  ADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMN  985
             +KD FL   E+    H++ P E+ +A     +LI E D +NDG+L+++E+M+
Sbjct  243  MNKDGFLDATEVS---HWILPTEVDHADNEARHLIHETDKDNDGRLSINEIMD  292



>emb|CDJ97399.1| reticulocalbin [Haemonchus contortus]
Length=303

 Score = 70.9 bits (172),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 117/246 (48%), Gaps = 21/246 (9%)
 Frame = +2

Query  278  FNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKD  457
            F++  + ++  RL VL   +D +  DGFVD  EL  W  +  +   N      +   D +
Sbjct  54   FDEIPKEESKRRLEVLAKGMDVNE-DGFVDETELTNWVERSMVALDNEEVIDRMGEMDMN  112

Query  458  GDGSISFSEYFP-QFTDEDIERNETGHGDAGWWM----IQFKNADVDRNGTLNLYEFRDF  622
            GD  +S+ EY    F D+D++  +    D    M    + FK AD+D +G LN  E   F
Sbjct  113  GDKLVSWDEYMADSFPDQDVKNLDA---DDRKLMEEDKLYFKAADLDGDGKLNQDELSAF  169

Query  623  LHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSV  802
            L+PE+ +  ++ + L+   +++ D NKD  + L EF            + E S       
Sbjct  170  LNPENYK--HMHKVLVEVTMKEKDANKDGAIDLKEF-------LGEMADNEHSDWHTVEK  220

Query  803  EETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMM  982
            +      D+D D  LR +E++    +L P   + A+   T+LI  AD + DGKL++ E++
Sbjct  221  DRFLAEYDSDGDGVLRGDEVR---RWLIPDVKAVAKQEATHLINGADKDKDGKLSIAEIV  277

Query  983  NHDTLF  1000
            +   LF
Sbjct  278  DAYELF  283



>ref|XP_001753027.1| predicted protein [Physcomitrella patens]
 gb|EDQ82068.1| predicted protein [Physcomitrella patens]
Length=550

 Score = 72.4 bits (176),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 116/289 (40%), Gaps = 48/289 (17%)
 Frame = +2

Query  44   HKAMAGKMTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIV  223
            H  +  KM+  V+          +L   H  ++        ++RR   +G    I   + 
Sbjct  288  HTGIPCKMSSAVSVLGPPGLFFYILGSVHVMVYF-------VTRRF--EGVRSSIICCLF  338

Query  224  ARRKGLANPEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQA  403
            +R   ++N   S +      D+   +   RL VLF +LD +P D FV + EL+ W+  + 
Sbjct  339  SRVDLVSNATLSHELFALGLDQ--FNITHRLAVLFSLLDVNPRDDFVSLIELQEWHLVEG  396

Query  404  INRLNYRTQRALSLRDKDGDGSISFSEYFPQFTDEDIERNETG-----HGDAGWWMIQFK  568
               +  R+ R +   DK+ DG ISF E     T+E+     +G     HG    WM+   
Sbjct  397  RKAMQRRSDREMEANDKNHDGLISFEECLLHLTEEERATKTSGCRTKQHGVRRIWML---  453

Query  569  NADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYE  748
                                 EDS N  + +W   E++R  D NKD K++  EF  G ++
Sbjct  454  ------------------FTSEDSNNPRVLQWCRMEQIRTHDTNKDGKINWEEFHLGMFD  495

Query  749  TYKTYKEFETSGIDVP---------SVEETFTLLDADKDSFLRVEELKP  868
              +   E +T  +              E  F+ +D +KD  L  +E+ P
Sbjct  496  HLR--DEHDTEHLHPAEQLEEKKQVQSEHLFSEIDRNKDGCLIEDEIAP  542



>ref|XP_008288434.1| PREDICTED: reticulocalbin-3 isoform X2 [Stegastes partitus]
Length=318

 Score = 70.9 bits (172),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 72/260 (28%), Positives = 119/260 (46%), Gaps = 15/260 (6%)
 Frame = +2

Query  299   DTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISF  478
             ++  RL  +   +D D  DG++   EL YW   +    +     +     DK+ DG I +
Sbjct  67    ESKARLAKIVDRIDTDK-DGYISHAELHYWIKHRQRRYIEENVNKHWHDYDKNQDGKIGW  125

Query  479   SEY----FPQFTDE---DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPED  637
              EY    +  +  E   DIE   T          +FK AD D +G     EF  FLHPE+
Sbjct  126   EEYKNTTYGYYLGEEFDDIEDKATYKAMLTRDERRFKGADRDADGIATREEFTAFLHPEE  185

Query  638   SRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT  817
                D++R  ++ E +  +D N+D K+ L E+    Y T +   E E   + V   +  + 
Sbjct  186   Y--DHMRDVIVQETMEDIDKNRDGKVDLSEYIGDMY-TPEGDGEPEPDWV-VTERKHFYE  241

Query  818   LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTL  997
               D +KD ++   E   + +++ PGE+ +A     +LI E D N D K+T  E++ +  +
Sbjct  242   FRDTNKDGYMDAAE---VANWILPGEVDHADNEAKHLIHETDTNKDEKITKKEILANWNM  298

Query  998   FYDTIYDNEKDEDDIYHDEL  1057
             F  +   N  ++    HDEL
Sbjct  299   FVGSQATNYGEDLTKRHDEL  318



>ref|XP_007251119.1| PREDICTED: calumenin-like isoform X2 [Astyanax mexicanus]
Length=313

 Score = 70.5 bits (171),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 69/242 (29%), Positives = 113/242 (47%), Gaps = 18/242 (7%)
 Frame = +2

Query  323   LFPILDRDPCD--GFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY---  487
             L  I+DR   D  GFV   EL +W   +    +     +     D+D DG I+++EY   
Sbjct  68    LGKIVDRIDTDKDGFVSHAELHHWIKHRQRRYIEENVDKHWKEYDQDKDGKIAWTEYKNT  127

Query  488   -FPQFTDE---DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNI  655
              +  + D+   D+E  E+          +FK AD D +G  +  EF  FLHPE+     +
Sbjct  128   TYGFYLDDEFSDVENRESYKAMLMRDERRFKVADKDGDGIASREEFTAFLHPEEFSY--M  185

Query  656   RRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADK  835
             +  ++ E +  +D N D K++L E+    Y +     E E    +     E     D +K
Sbjct  186   KDLVVQETVEDIDKNGDGKINLEEYIGDMYTSEDGENEPEWVNTEKKQFSE---FRDVNK  242

Query  836   DSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNH-DTLFYDTI  1012
             D FL   E   +  ++ PG++ +A     +LI E D +NDG+L++ E+M+  D +   TI
Sbjct  243   DGFLDASE---VAQWILPGDVDHADIEAKHLIHETDRDNDGRLSVSEIMDKLDKIKISTI  299

Query  1013  YD  1018
              D
Sbjct  300   TD  301



>ref|XP_008288433.1| PREDICTED: reticulocalbin-3 isoform X1 [Stegastes partitus]
Length=352

 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 72/260 (28%), Positives = 119/260 (46%), Gaps = 15/260 (6%)
 Frame = +2

Query  299   DTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISF  478
             ++  RL  +   +D D  DG++   EL YW   +    +     +     DK+ DG I +
Sbjct  101   ESKARLAKIVDRIDTDK-DGYISHAELHYWIKHRQRRYIEENVNKHWHDYDKNQDGKIGW  159

Query  479   SEY----FPQFTDE---DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPED  637
              EY    +  +  E   DIE   T          +FK AD D +G     EF  FLHPE+
Sbjct  160   EEYKNTTYGYYLGEEFDDIEDKATYKAMLTRDERRFKGADRDADGIATREEFTAFLHPEE  219

Query  638   SRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT  817
                D++R  ++ E +  +D N+D K+ L E+    Y T +   E E   + V   +  + 
Sbjct  220   Y--DHMRDVIVQETMEDIDKNRDGKVDLSEYIGDMY-TPEGDGEPEPDWV-VTERKHFYE  275

Query  818   LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTL  997
               D +KD ++   E   + +++ PGE+ +A     +LI E D N D K+T  E++ +  +
Sbjct  276   FRDTNKDGYMDAAE---VANWILPGEVDHADNEAKHLIHETDTNKDEKITKKEILANWNM  332

Query  998   FYDTIYDNEKDEDDIYHDEL  1057
             F  +   N  ++    HDEL
Sbjct  333   FVGSQATNYGEDLTKRHDEL  352



>ref|XP_005230921.1| PREDICTED: reticulocalbin-3-like [Falco peregrinus]
Length=471

 Score = 71.2 bits (173),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 84/310 (27%), Positives = 136/310 (44%), Gaps = 27/310 (9%)
 Frame = +2

Query  155   SPRGLSRRLGTQGTAPPIFDPIVARRKGLANPEKSDDDDRYFNDKGRLDTGLRLMVLFPI  334
             +PRGL R LG  G      D      +    PE++    R F+     ++  RL +L  +
Sbjct  180   APRGLPRDLG--GAHHDHADGFAYDHEAFLGPEEA----RTFDQLSPSESQRRLGLLVGL  233

Query  335   LDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY------FPQ  496
             +D D  DG V  +EL  W  +          +R     D+D DG +++ EY       P+
Sbjct  234   IDGD-GDGAVTTEELRGWIERTQRRAREESLRRGWQRYDRDSDGIVTWDEYRREAYGHPE  292

Query  497   FTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTE  676
                E  +  ET          +F+ AD D +G  N  EF  FLHPED   +++R  ++TE
Sbjct  293   DDFEGTQHPETYRQLLARDERRFRAADKDGDGGANRTEFAAFLHPEDF--EHMRPLVVTE  350

Query  677   KLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPS--VEETFTLLDA-DKDSFL  847
              +  MD + D  + + E+     E Y       T G   P    EE    + A D+D   
Sbjct  351   TMEDMDKDGDGFVHVDEY---IAELYTG-----TPGTPEPQWVQEERVQFVQARDRDGDG  402

Query  848   RVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEK  1027
             R++  + + H+L P    +A     +L+  +D + DG+LT  E++ +  +F  +   N  
Sbjct  403   RLDPSE-VGHWLRPPSPDWAGVEAAHLLHHSDVDKDGQLTKAEILGNWQMFVGSQATNYG  461

Query  1028  DEDDIYHDEL  1057
              + +  HDEL
Sbjct  462   QDLERPHDEL  471



>gb|KIH67675.1| EF hand [Ancylostoma duodenale]
Length=292

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 116/251 (46%), Gaps = 39/251 (16%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKEL-EYWNTQQA--INRLNYRTQRALSLRDKDGDGSISFS  481
             RL  L P +D D  DGFV+ KEL E+ N  Q   +N    RT +     +K  DG I + 
Sbjct  42    RLAKLVPKMDSD-GDGFVEEKELREHINFMQKRYVNNDVERTWKNYK-DEKIVDGKIKWE  99

Query  482   EYFPQFTDEDIERNETGHG-------------DAGWWMIQFKNADVDRNGTLNLYEFRDF  622
             +Y      E +  + TG G             D   W +    AD D NG L+  E+  F
Sbjct  100   DYR-----EMVYGSPTGEGQELSPEYAKMIARDEKRWAV----ADYDSNGALDRTEYGCF  150

Query  623   LHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGID-VPS  799
             +HPED   +++R  ++ E +  +D NKD  + L E+    Y   + Y E      D V S
Sbjct  151   MHPEDC--EHMRDIVVAETVEDIDKNKDGYVDLEEYIGDMYRP-EDYPELNGKEPDWVQS  207

Query  800   VEETFT-LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDE  976
               E F    D D D  L  +E++    ++ P    +A     +L+  ADDN DGKL+LDE
Sbjct  208   EREMFKEHRDKDGDGKLNQDEMR---DWIMPVGFDHAEAEARHLVGIADDNKDGKLSLDE  264

Query  977   MMNHDTLFYDT  1009
             ++ H    YDT
Sbjct  265   ILAH----YDT  271



>gb|EYB90169.1| hypothetical protein Y032_0223g2687 [Ancylostoma ceylanicum]
Length=354

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 116/251 (46%), Gaps = 39/251 (16%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKEL-EYWNTQQA--INRLNYRTQRALSLRDKDGDGSISFS  481
             RL  L P +D D  DGFV+ KEL E+ N  Q   +N    RT +     +K  DG I + 
Sbjct  104   RLAKLVPKMDSD-GDGFVEEKELREHINFMQKRYVNNDVERTWKNYK-DEKIVDGKIKWE  161

Query  482   EYFPQFTDEDIERNETGHG-------------DAGWWMIQFKNADVDRNGTLNLYEFRDF  622
             +Y      E +  + TG G             D   W +    AD D NG L+  E+  F
Sbjct  162   DYR-----EMVYGSPTGEGQELSPEYAKMIARDEKRWAV----ADYDSNGALDRTEYGCF  212

Query  623   LHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGID-VPS  799
             +HPED   +++R  ++ E +  +D NKD  + L E+    Y   + Y E      D V S
Sbjct  213   MHPEDC--EHMRDIVVAETVEDIDKNKDGYVDLEEYIGDMYRP-EDYPELNGKEPDWVQS  269

Query  800   VEETFT-LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDE  976
               E F    D D D  L  +E++    ++ P    +A     +L+  ADDN DGKL+LDE
Sbjct  270   EREMFKEHRDKDGDGKLNQDEMR---DWIMPVGFDHAEAEARHLVGIADDNKDGKLSLDE  326

Query  977   MMNHDTLFYDT  1009
             ++ H    YDT
Sbjct  327   ILAH----YDT  333



>gb|EYB90170.1| hypothetical protein Y032_0223g2687 [Ancylostoma ceylanicum]
Length=288

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 116/251 (46%), Gaps = 39/251 (16%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKEL-EYWNTQQA--INRLNYRTQRALSLRDKDGDGSISFS  481
             RL  L P +D D  DGFV+ KEL E+ N  Q   +N    RT +     +K  DG I + 
Sbjct  38    RLAKLVPKMDSD-GDGFVEEKELREHINFMQKRYVNNDVERTWKNYK-DEKIVDGKIKWE  95

Query  482   EYFPQFTDEDIERNETGHG-------------DAGWWMIQFKNADVDRNGTLNLYEFRDF  622
             +Y      E +  + TG G             D   W +    AD D NG L+  E+  F
Sbjct  96    DYR-----EMVYGSPTGEGQELSPEYAKMIARDEKRWAV----ADYDSNGALDRTEYGCF  146

Query  623   LHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGID-VPS  799
             +HPED   +++R  ++ E +  +D NKD  + L E+    Y   + Y E      D V S
Sbjct  147   MHPEDC--EHMRDIVVAETVEDIDKNKDGYVDLEEYIGDMYRP-EDYPELNGKEPDWVQS  203

Query  800   VEETFT-LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDE  976
               E F    D D D  L  +E++    ++ P    +A     +L+  ADDN DGKL+LDE
Sbjct  204   EREMFKEHRDKDGDGKLNQDEMRD---WIMPVGFDHAEAEARHLVGIADDNKDGKLSLDE  260

Query  977   MMNHDTLFYDT  1009
             ++ H    YDT
Sbjct  261   ILAH----YDT  267



>ref|XP_004562935.1| PREDICTED: reticulocalbin-1-like isoform X1 [Maylandia zebra]
Length=317

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/233 (29%), Positives = 113/233 (48%), Gaps = 18/233 (8%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-  487
            RL  +   +D D  DG+V   EL YW   +    +     +     DK+ D  IS+ EY 
Sbjct  71   RLAKIVDRIDTDK-DGYVSHGELHYWIKHRQRRYIEENVNKHWKDYDKNQDDKISWEEYK  129

Query  488  ---FPQFTDE---DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRND  649
               +  +  E   DI+  ET          +FK AD D +G     EF  FLHPE+   D
Sbjct  130  NTTYGYYLGEEFDDIDDKETYKSMLKRDERRFKTADRDSDGIATHEEFTAFLHPEEF--D  187

Query  650  NIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT-LLD  826
             ++  ++ E +  +D N D K++L E+    Y    T ++ E+    V + ++ F+ + D
Sbjct  188  YMKDLVIQETVEDIDKNGDGKINLEEYIGDMY----TAEDGESEPDWVQTEKKHFSEIRD  243

Query  827  ADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMN  985
             +KD +L  +E   +  ++ PGE+ +A     +LI E D + DG+L+L E+++
Sbjct  244  TNKDGYLDADE---VGQWVLPGEVDHADNEAKHLIHETDTDKDGRLSLPEILD  293



>gb|ELT88564.1| hypothetical protein CAPTEDRAFT_89350 [Capitella teleta]
Length=321

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 72/260 (28%), Positives = 127/260 (49%), Gaps = 53/260 (20%)
 Frame = +2

Query  323  LFPILDRDPCDGFVDVKELEYW---NTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFP  493
            +F  +D D  D ++  +ELE W     Q+  +     T+R     D D DG++++ E+  
Sbjct  65   IFFKVDTD-LDTYISQEELEEWIQVKVQEHFDESTDETERIFKHLDSDKDGTVAWEEFHV  123

Query  494  QF------TDEDIERNETGH-------GDAGWWMIQFK----NADVD-RNGTLNLYEFRD  619
             F      + E+ E+  + +        DA   +I++K     AD+D ++  L + EF  
Sbjct  124  HFLLAKGVSAEEAEKQVSDYYAVGSLDPDAKENLIRYKFRWAEADLDPQDNKLTMEEFAS  183

Query  620  FLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEF--------ERGAYETYKTY----  763
            F HPE S+ D + R L+ E +  +D + + ++SL EF        E  A ++ K +    
Sbjct  184  FRHPEQSK-DMLER-LVKEIMDNLDQDSNDEISLKEFVALPPGEIEYAAQDSDKMWQNER  241

Query  764  -KEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREA  940
             KEF+              ++D + D  +  +ELK    Y+DP   +++R     LI+ A
Sbjct  242  EKEFKE-------------VVDLNSDGKITKDELKV---YMDPKNPTHSRSEAASLIQMA  285

Query  941  DDNNDGKLTLDEMMNHDTLF  1000
            D+NNDGKL+L E+++++ LF
Sbjct  286  DENNDGKLSLTEVLDNEDLF  305



>emb|CDJ86334.1| calumenin [Haemonchus contortus]
Length=313

 Score = 68.9 bits (167),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 113/245 (46%), Gaps = 27/245 (11%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSL--RDKDGDGSISFSE  484
             RL  L P +D D  DGFV+ KEL    T      +N   +R       +K  DG+I + +
Sbjct  63    RLAKLVPKMDSD-GDGFVEEKELREHITFMQKRYVNNDVERTWKSYREEKVKDGTIKWED  121

Query  485   Y----FPQFTDEDIERN----ETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDS  640
             Y    +   TDE  E +    +    D   W +    AD D NG L+  E+  F+HPED 
Sbjct  122   YREMVYGSPTDEGQELSPEYAKMIARDKKRWAV----ADYDSNGVLDRTEYGCFMHPEDC  177

Query  641   RNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGID-VPSVEETFT  817
               D++R  ++ E +  +D NKD  + + E+    Y     Y E      D V S  E F 
Sbjct  178   --DHMRDVVVAETVDDIDKNKDGYVDMEEYIGDMYRP-DDYPELSGKEPDWVQSEREMFK  234

Query  818   -LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDT  994
                D D D  L  EE++    ++ P    +A     +L+  ADDN DGKL+++E++ H  
Sbjct  235   EHRDKDGDGKLNQEEMRD---WIMPVGFDHAEAEARHLVGIADDNKDGKLSMEEIIAH--  289

Query  995   LFYDT  1009
               YDT
Sbjct  290   --YDT  292



>gb|EYB90171.1| hypothetical protein Y032_0223g2687 [Ancylostoma ceylanicum]
Length=306

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 116/251 (46%), Gaps = 39/251 (16%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKEL-EYWNTQQA--INRLNYRTQRALSLRDKDGDGSISFS  481
             RL  L P +D D  DGFV+ KEL E+ N  Q   +N    RT +     +K  DG I + 
Sbjct  56    RLAKLVPKMDSD-GDGFVEEKELREHINFMQKRYVNNDVERTWKNYK-DEKIVDGKIKWE  113

Query  482   EYFPQFTDEDIERNETGHG-------------DAGWWMIQFKNADVDRNGTLNLYEFRDF  622
             +Y      E +  + TG G             D   W +    AD D NG L+  E+  F
Sbjct  114   DYR-----EMVYGSPTGEGQELSPEYAKMIARDEKRWAV----ADYDSNGALDRTEYGCF  164

Query  623   LHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGID-VPS  799
             +HPED   +++R  ++ E +  +D NKD  + L E+    Y   + Y E      D V S
Sbjct  165   MHPEDC--EHMRDIVVAETVEDIDKNKDGYVDLEEYIGDMYRP-EDYPELNGKEPDWVQS  221

Query  800   VEETFT-LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDE  976
               E F    D D D  L  +E++    ++ P    +A     +L+  ADDN DGKL+LDE
Sbjct  222   EREMFKEHRDKDGDGKLNQDEMRD---WIMPVGFDHAEAEARHLVGIADDNKDGKLSLDE  278

Query  977   MMNHDTLFYDT  1009
             ++ H    YDT
Sbjct  279   ILAH----YDT  285



>gb|EYU26422.1| hypothetical protein MIMGU_mgv1a016838mg [Erythranthe guttata]
Length=105

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +2

Query  545  GWWMIQFKNA-DVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSL  721
            GWW  +  NA D D +G LN+ EF DFLHP D+ N  +  WL  E++R+ D +KD K++ 
Sbjct  2    GWWKEEHFNASDADGDGRLNITEFNDFLHPADTNNPKLLLWLCKEEIRERDSDKDGKINF  61

Query  722  LEFERGAYETYKTYKE  769
             EF  G ++  + Y E
Sbjct  62   KEFFHGLFDLVRNYDE  77



>ref|XP_010765101.1| PREDICTED: reticulocalbin-3 isoform X2 [Notothenia coriiceps]
Length=317

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 81/331 (24%), Positives = 138/331 (42%), Gaps = 42/331 (13%)
 Frame = +2

Query  65    MTKVVAYTIAAAFVILLLSQDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARRKGLA  244
             +  + +  + A   + + +Q+     + D S R      G Q           A+     
Sbjct  4     LRSLASICLLAVAALSVPTQEKRVHHQSDLSDRAHDDSHGFQYDHEAFLGKEEAKTFDQL  63

Query  245   NPEKSDDDDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYR  424
              PE+S D               +L ++   +D D  DG++   EL +W   +    +   
Sbjct  64    TPEESKD---------------KLAMIVVRIDTDK-DGYISHAELHHWIKHRQRRYIEEN  107

Query  425   TQRALSLRDKDGDGSISFSEY----FPQFTDE---DIERNETGHGDAGWWMI-----QFK  568
               +     DK+ DG I + EY    +  + DE   D+E   T       +M+     +FK
Sbjct  108   VNKHWKDYDKNQDGKIGWEEYKNTTYGFYLDEEFDDVEDKATYR-----FMLTRDERRFK  162

Query  569   NADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYE  748
              AD D +G     EF  FLHPE+   D+++  ++ E +  +D N D K+ + E+    + 
Sbjct  163   TADRDGDGIATREEFTAFLHPEEF--DHMKDLVVQETVEDIDKNGDGKIDINEYIGDMFS  220

Query  749   TYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYL  928
                  +E +    +     E     DA+KD +L   E   + H++ PGE+ +A     +L
Sbjct  221   PESGEREPDWVQTERKHFHE---FRDANKDGYLDNAE---VAHWVLPGEVDHADNEAKHL  274

Query  929   IREADDNNDGKLTLDEMM-NHDTLFYDTIYD  1018
             I E D + DG LTL E++ N D +   TI D
Sbjct  275   IHETDTDKDGLLTLSEVLDNSDYIITSTITD  305



>ref|XP_001623269.1| predicted protein [Nematostella vectensis]
 gb|EDO31169.1| predicted protein [Nematostella vectensis]
Length=269

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 113/244 (46%), Gaps = 25/244 (10%)
 Frame = +2

Query  302  TGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFS  481
            T  RL  LFP +D D  D  + +KEL  W            ++  +   DK+ DG +S+ 
Sbjct  24   TKQRLRELFPKIDVDQ-DQKISLKELVEWIDVNMKKHTRKSSESRMEQMDKNKDGKVSWE  82

Query  482  EYFPQFTDEDIERNETGHGDAGWWMIQ---------FKNADVDRNGTLNLYEFRDFLHPE  634
            EY     D    +NE G  +     ++         +K+AD+D +  L + E + F+HPE
Sbjct  83   EYVNVEYDP---KNEKGMSNENKDHLKEMKKRDEKRWKHADMDNDNLLTIDELQMFIHPE  139

Query  635  DSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETF  814
            ++    +   L+ E +  +D +KD K+S  E+   A +    ++  E +   + S+++ F
Sbjct  140  ETP--RMTSVLVQENMEMLDSDKDGKISFAEY---AGKLSVMWRMREDNQDSLKSLKDDF  194

Query  815  TL-LDADKDSFLRVEELKP-IFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNH  988
               LD DKD  L  EELK  IF    P     +     +L+ E D N D  LT+DE+M  
Sbjct  195  NNDLDKDKDGSLNKEELKSWIFPSGSP-----SSGEAEHLMTEVDKNKDNFLTVDEIMER  249

Query  989  DTLF  1000
              LF
Sbjct  250  YELF  253



>ref|XP_006805088.1| PREDICTED: reticulocalbin-1-like isoform X2 [Neolamprologus brichardi]
Length=317

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 113/233 (48%), Gaps = 18/233 (8%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-  487
            RL  +   +D D  DG++   EL YW   +    +     +     DK+ D  IS+ EY 
Sbjct  71   RLAKIVDRIDTDK-DGYISHGELHYWIKHRQRRYIEENVNKHWKDYDKNQDDKISWEEYK  129

Query  488  ---FPQFTDED---IERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRND  649
               +  +  ED   I+  ET          +FK AD D +G     EF  FLHPE+   D
Sbjct  130  NTTYGYYLGEDFDDIDDKETYKSMLKRDERRFKTADRDSDGIATREEFTAFLHPEEF--D  187

Query  650  NIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT-LLD  826
             ++  ++ E +  +D N D K++L E+    Y    T ++ E+    V + ++ F+ + D
Sbjct  188  YMKDLVIQETVEDIDKNGDGKINLEEYIGDMY----TAEDGESEPDWVQTEKKHFSEIRD  243

Query  827  ADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMN  985
             +KD +L  +E   +  ++ PGE+ +A     +LI E D + DG+L+L E+++
Sbjct  244  TNKDGYLDADE---VGQWVLPGEVDHADNEAKHLIHETDTDKDGRLSLPEILD  293



>gb|KFM74065.1| Calumenin-A, partial [Stegodyphus mimosarum]
Length=315

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 123/252 (49%), Gaps = 21/252 (8%)
 Frame = +2

Query  272  RYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRD  451
            + F+D    ++  RL  +   +D D  DGFV ++EL+ W        +   ++R     +
Sbjct  62   KKFDDLSPEESKHRLGKIVDKIDADK-DGFVSMQELKDWIQHTQRRYIIDDSERQWKNLN  120

Query  452  KDGDGSISFSEYFP---QFTDEDIERNETGHGDAGWWMIQ-----FKNADVDRNGTLNLY  607
             + +  +++  Y      +T++ I+ NE  H      M++     +K AD D N +LN  
Sbjct  121  PNDEPEVTWKTYRKVTYGYTEDTIDDNEKVHYKE---MMERDLRRWKKADQDGNDSLNKK  177

Query  608  EFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI  787
            EF DF+HPEDS  ++++  ++ E +  +D N D K+SL E+     + Y    + E    
Sbjct  178  EFIDFVHPEDS--NHMKDIVVIETMEDIDKNNDGKISLEEY---IGDMYNDDDDLEDEPS  232

Query  788  DVPSVEETFTLL-DADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKL  964
             V S  + F L  D DK  F+  EE+K    ++ P +   +     +L+ E+D N D +L
Sbjct  233  WVQSERDQFKLFRDKDKSGFMEYEEVK---QWILPDDYDNSDAEAKHLVYESDVNRDNQL  289

Query  965  TLDEMMNHDTLF  1000
            + +E++N   LF
Sbjct  290  SKEEILNKFDLF  301



>ref|XP_005926821.1| PREDICTED: reticulocalbin-1-like isoform X2 [Haplochromis burtoni]
Length=317

 Score = 68.2 bits (165),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 113/233 (48%), Gaps = 18/233 (8%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-  487
            RL  +   +D D  DG++   EL YW   +    +     +     DK+ D  IS+ EY 
Sbjct  71   RLAKIVDRIDTDK-DGYISHGELHYWIKHRQRRYIEENVNKHWKDYDKNQDNKISWEEYK  129

Query  488  ---FPQFTDE---DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRND  649
               +  +  E   DI+  ET          +FK AD D +G     EF  FLHPE+   D
Sbjct  130  NTTYGYYLGEEFDDIDDKETYKSMLKRDERRFKMADRDSDGIATREEFTAFLHPEEF--D  187

Query  650  NIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT-LLD  826
             ++  ++ E +  +D N D K++L E+    Y    T ++ E+    V + ++ F+ + D
Sbjct  188  YMKDLVIQETVEDIDKNGDGKINLEEYIGDMY----TAEDGESEPDWVQTEKKHFSEIRD  243

Query  827  ADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMN  985
             +KD +L  +E   +  ++ PGE+ +A     +LI E D + DG+L+L E+++
Sbjct  244  TNKDGYLDADE---VGQWVLPGEVDHADNEAKHLIHETDTDKDGRLSLPEILD  293



>ref|XP_008413286.1| PREDICTED: calumenin-like isoform X2 [Poecilia reticulata]
Length=317

 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 73/245 (30%), Positives = 116/245 (47%), Gaps = 19/245 (8%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-  487
             RL  +   +D D  DG+V   EL  W   +    +     +     D++ D  I++ EY 
Sbjct  71    RLAKIVDRIDTDK-DGYVTNSELHQWIKHRQRRYIEENVNKHWKDYDQNRDDKIAWEEYK  129

Query  488   ---FPQFTDE---DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRND  649
                +  +  E   DIE  +T          +FK+AD DR+G     EF  FLHPE+   D
Sbjct  130   NATYGYYLGEEFSDIEDKDTYKSMLARDERRFKSADKDRDGIATREEFTAFLHPEEF--D  187

Query  650   NIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT-LLD  826
              ++  ++ E +  +D + D K++L E+    Y    T ++ E+    V +  + FT   D
Sbjct  188   YMKDVVVQETMEDIDKDGDGKINLHEYIGDMY----TPEDSESEPDWVQTERKHFTEFRD  243

Query  827   ADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNH-DTLFY  1003
              +KD +L   E   +  ++ PGE+ +A     +LI E D N DG+LTL EM++  D L  
Sbjct  244   VNKDGYLDANE---VAEWVLPGEVDHADNEAKHLIYETDTNKDGRLTLSEMLDKTDYLRM  300

Query  1004  DTIYD  1018
              TI D
Sbjct  301   STITD  305



>ref|XP_002644617.1| C. briggsae CBR-CALU-1 protein [Caenorhabditis briggsae]
 emb|CAP33056.1| Protein CBR-CALU-1 [Caenorhabditis briggsae]
Length=314

 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 77/259 (30%), Positives = 114/259 (44%), Gaps = 55/259 (21%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKELE---------YWNTQQAINRLNYRTQRALSLRDKDGD  463
             +L  L P +D D  DGF++  EL+         Y N        NY+ ++ +       D
Sbjct  64    KLAKLVPKMDAD-SDGFIEENELKDHINFMQKRYVNNDVDRTWKNYKAEKIV-------D  115

Query  464   GSISFSEY---------------FPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTL  598
             G I + +Y                P++  + I R+E        W +    AD D NG L
Sbjct  116   GKIKWEDYREMVYGSADGAGQELSPEYA-KMIARDEKR------WAV----ADYDSNGAL  164

Query  599   NLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFET  778
             +  E+  F+HPED   D++R  ++ E +  +D NKD  + L E+    Y   + Y E   
Sbjct  165   DRTEYGCFMHPEDC--DHMRDIVVAETVDDIDKNKDGSVDLEEYIGDMYRP-EDYPELAG  221

Query  779   SGID-VPSVEETFT-LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNN  952
                D V S  E F    D D D  L  EE++    ++ P    +A     +L+  ADDN 
Sbjct  222   KEPDWVQSEREMFKEHRDKDGDGKLNQEEMRD---WIMPVGFDHAEAEARHLVGIADDNK  278

Query  953   DGKLTLDEMMNHDTLFYDT  1009
             DGKLTLDE++ H    YDT
Sbjct  279   DGKLTLDEIVAH----YDT  293



>ref|XP_007251118.1| PREDICTED: calumenin-like isoform X1 [Astyanax mexicanus]
Length=313

 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 70/254 (28%), Positives = 116/254 (46%), Gaps = 17/254 (7%)
 Frame = +2

Query  323   LFPILDRDPCD--GFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY---  487
             L  I+DR   D  GFV   EL +W   +    +     +     D+D DG I+++EY   
Sbjct  68    LGKIVDRIDTDKDGFVSHAELHHWIKHRQRRYIEENVDKHWKEYDQDKDGKIAWTEYKNT  127

Query  488   -FPQFTDE---DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNI  655
              +  + D+   D+E  E+          +FK AD D +G  +  EF  FLHPE+     +
Sbjct  128   TYGFYLDDEFSDVENRESYKAMLMRDERRFKVADKDGDGIASREEFTAFLHPEEFSY--M  185

Query  656   RRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTLLDADK  835
             +  ++ E +  +D N D K++L E+    Y +     E E    +     E     D +K
Sbjct  186   KDLVVQETVEDIDKNGDGKINLEEYIGDMYTSEDGENEPEWVNTEKKQFSE---FRDVNK  242

Query  836   DSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIY  1015
             D FL   E   +  ++ PG++ +A     +LI E D +ND K+T  E++ +  +F  +  
Sbjct  243   DGFLDASE---VAQWILPGDVDHADIEAKHLIHETDRDNDDKMTKKEILENWNMFVGSQA  299

Query  1016  DNEKDEDDIYHDEL  1057
              N  ++    HDEL
Sbjct  300   TNYGEDLTRKHDEL  313



>gb|EMS64995.1| hypothetical protein TRIUR3_25358 [Triticum urartu]
Length=367

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 60/132 (45%), Gaps = 23/132 (17%)
 Frame = +2

Query  161  RGLSRRLGTQGTAPPIFDPIVA---RR-----------KGLANP---------EKSDDDD  271
            RG   R G        FDP++A   RR            GL  P         + +D +D
Sbjct  55   RGAHLRHGGATPHQIPFDPVIADLERRLDDREWERLAAAGLHAPGMESAPVPEDLADYED  114

Query  272  RYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRD  451
             Y ND  R +  LR+  LFP +D DP D  V   EL  WN   A   + +RT R L L D
Sbjct  115  EYINDAVRFNMTLRVAALFPKIDVDPADDAVTGAELAAWNLASARREVLHRTARELDLHD  174

Query  452  KDGDGSISFSEY  487
            +D DG ++FSEY
Sbjct  175  RDHDGRVAFSEY  186


 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 58/95 (61%), Gaps = 4/95 (4%)
 Frame = +2

Query  773   ETSGIDVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNN  952
             +++G D P+  ++F+ LD D D  L  +ELKPI   L P E  YA+    Y+I +AD N 
Sbjct  276   DSNGSDAPA-RKSFSQLDLDNDGLLSADELKPIIGKLHPAENFYAKQQADYVISQADTNK  334

Query  953   DGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             DG+L+L+EM+ +  +FY  ++    ++D   HDEL
Sbjct  335   DGQLSLNEMIENPYVFYSALF---TEDDYGSHDEL  366



>ref|XP_002610904.1| hypothetical protein BRAFLDRAFT_126288 [Branchiostoma floridae]
 gb|EEN66914.1| hypothetical protein BRAFLDRAFT_126288 [Branchiostoma floridae]
Length=319

 Score = 67.8 bits (164),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 73/250 (29%), Positives = 109/250 (44%), Gaps = 26/250 (10%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYW---NTQQAINRLNYRTQRALSLRDKDGDGSISFS  481
            RL  +F  +D D  DG +  +EL+ W    TQ+          +     D++ DG++ + 
Sbjct  60   RLKEIFKRIDVD-TDGLLTQQELQDWILRKTQEHFQEAEQENSKHFQEVDQNKDGNLHWD  118

Query  482  EYFPQF----------------TDEDIERNETGHGDAGWWMIQFKNADVD-RNGTLNLYE  610
            EY  QF                 D +IE +     D      +F  AD D R+  LN  E
Sbjct  119  EYRLQFLESRGYDRDKIMEVIQQDTEIEMDVDDEEDLERDHDRFLQADEDPRDELLNEKE  178

Query  611  FRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGID  790
            F  F HPE S +  +   ++ E L  +D N DQ L+LLEF    Y       E       
Sbjct  179  FLAFRHPEHSSS--MLSLMVQEILHDLDQNGDQILTLLEFVSMPYGAKVEEVEDSKDTWV  236

Query  791  VPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTL  970
            V   +E   ++D D D  + + EL+    Y+DP     A      +IR AD N+DGKL+L
Sbjct  237  VERRQEFKEVMDTDGDGKVTLTELEA---YMDPRSDQQALNEARQMIRVADANSDGKLSL  293

Query  971  DEMMNHDTLF  1000
             E++++   F
Sbjct  294  AEILDNCQFF  303



>ref|NP_001002158.1| reticulocalbin-3 precursor [Danio rerio]
 gb|AAH71338.1| Reticulocalbin 3, EF-hand calcium binding domain [Danio rerio]
Length=316

 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 72/257 (28%), Positives = 120/257 (47%), Gaps = 18/257 (7%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-  487
             RL  +   +D D  DGFV   EL +W   +    +     +  +  D++ DG I + EY 
Sbjct  70    RLGKIVDKIDTDK-DGFVSHAELHHWIKHRQRRYIEENVDKHWNEYDQNKDGKIGWIEYK  128

Query  488   ---FPQFTD---EDIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRND  649
                +  + D   +D++   T          +FK+AD D +G     EF  FLHPE+   D
Sbjct  129   NTTYGYYIDTEFDDVDDKATYKSMLNRDERRFKSADRDGDGVATREEFTAFLHPEEF--D  186

Query  650   NIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT-LLD  826
              +R  ++ E +  +D N D K+ L E+    Y      ++ ET    V + ++ F+   D
Sbjct  187   FMRDIVIQETIEDIDKNGDGKIDLQEYIGDMYNP----EDGETEPDWVTTEKKQFSEFRD  242

Query  827   ADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYD  1006
              +KD FL   E   + H++ P E+ +A     +LI E D +ND K+T  E++ +  +F  
Sbjct  243   MNKDGFLDATE---VSHWILPTEVDHADNEARHLIHETDKDNDDKITKKEILENWNMFVG  299

Query  1007  TIYDNEKDEDDIYHDEL  1057
             +   N  ++    HDEL
Sbjct  300   SQATNYGEDLTKRHDEL  316



>ref|XP_009022215.1| hypothetical protein HELRODRAFT_185810 [Helobdella robusta]
 gb|ESN99878.1| hypothetical protein HELRODRAFT_185810 [Helobdella robusta]
Length=332

 Score = 67.4 bits (163),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 65/240 (27%), Positives = 120/240 (50%), Gaps = 16/240 (7%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYW--NTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
            +L ++   +D D  DG+VD  EL  W  + +Q   ++N   Q     R  D +  +S+ +
Sbjct  81   KLKLIVEKIDTDK-DGYVDKAELTTWIEHAEQVYIKMNINKQWKDYQRTDDSNIKLSWKQ  139

Query  485  YFPQ-FTDEDIERNETGHGDAGWWMIQ-----FKNADVDRNGTLNLYEFRDFLHPEDSRN  646
            Y  + +  ED   +  G  +    M++     +K ADVD +G L+  EF+ F+HPE+ ++
Sbjct  140  YKERMYGSEDAVPDVMGLPNDYREMLRKDERRWKRADVDGDGELSKDEFKAFIHPEEFQH  199

Query  647  DNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETF--TL  820
                     E +  +D NKD K+++ E+    +       E +    D    E T+    
Sbjct  200  --TADLAGIETMEDVDKNKDGKVTIEEYIGDLWPRSTEEDEDDEEEPDWVRKERTYFAEH  257

Query  821  LDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLF  1000
             D +KD F+ +EE++    ++ P + + A   + +LI EAD + DGKLT+ E++++ ++F
Sbjct  258  RDQNKDGFMDLEEVQ---EWISPKDFNNAAVESEHLINEADQDQDGKLTMSEILDNYSIF  314



>gb|KGB36528.1| Ubiquinone biosynthesis protein COQ7-like protein [Schistosoma 
haematobium]
Length=421

 Score = 68.2 bits (165),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 68/236 (29%), Positives = 116/236 (49%), Gaps = 31/236 (13%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYW--NTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
            RL + F  +D +  +GF++  EL  W   T ++++R     ++ L+  D + DG +SF E
Sbjct  183  RLHMYFKKIDTNS-NGFIEDDELASWIYKTYESLDR--EHAEKQLTRFDVNEDGKVSFEE  239

Query  485  YFPQF--TDEDIERNETGHGDAGWWM-------IQFKNADVDRNGTLNLYEFRDFLHPED  637
            Y  Q   T E+  R+      + + +       ++F  AD D +G L+L EF  FL PE+
Sbjct  240  YINQTYETSEEELRHSKDDKSSKFILELLKDERLRFNFADKDNDGLLSLEEFTLFLRPEN  299

Query  638  SRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPS-VEETF  814
               +++  + L +     D N D  ++  EF   +Y            G+   + + E F
Sbjct  300  Y--EDMENYELQKSFSSFDQNGDGIITKDEFTNFSYR-----------GVSQENYLHEQF  346

Query  815  TLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMM  982
            + LD DK+  L ++EL+P   +L P     A+   T L+   D N+DGKLTL+E++
Sbjct  347  SNLDVDKNDILILDELRP---WLLPSLKVAAKSEATRLMNLTDSNHDGKLTLEEIL  399



>ref|XP_003704568.1| PREDICTED: calumenin-B-like [Megachile rotundata]
Length=324

 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 68/244 (28%), Positives = 122/244 (50%), Gaps = 26/244 (11%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYW--NTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
            RL ++   +D+D  DG+V  +EL+ W   TQ+   R N   +R     + +G   + +SE
Sbjct  75   RLGIIVDKIDKDK-DGYVTGEELKDWILYTQRRYIRDN--VERQWKSHNPEGKEKLPWSE  131

Query  485  Y----FPQFTDEDIERNETGHGDAGWWMIQFK-------NADVDRNGTLNLYEFRDFLHP  631
            Y    +    +++ E +E    ++  ++   K        AD+D +  L   EF  FLH 
Sbjct  132  YLAMVYGDMDEQEAENHEKSKDNSFSYVAMLKKDRRRWSTADLDGDDALTKEEFAAFLHA  191

Query  632  EDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEET  811
            E++  D+++  ++ E +  +D + D K+SL E+    Y+  +  +E E     V + +E 
Sbjct  192  EEA--DHMKDVVVLETMEDIDKDGDGKISLSEYIGDMYDGAEGEEEPEW----VKNEKEQ  245

Query  812  FTLL-DADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNH  988
            F++  D D D FL  EE+K    ++ P +  +A   + +LI EAD + D KLT DE++  
Sbjct  246  FSMYRDKDGDGFLDFEEVKT---WITPADFDHAEAESRHLIFEADTDADQKLTKDEILEK  302

Query  989  DTLF  1000
              +F
Sbjct  303  YDIF  306



>emb|CDJ90877.1| 45 kDa calcium-binding protein [Haemonchus contortus]
Length=328

 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 64/228 (28%), Positives = 104/228 (46%), Gaps = 21/228 (9%)
 Frame = +2

Query  353  DGFVDVKELE---YWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYFPQF----TDED  511
            DG + ++ELE     NT+  +       Q   ++ D + DG IS+ EY P +    + +D
Sbjct  94   DGALSLEELEERIINNTRAHLEEAVMEAQSHFNIVDTNKDGQISWQEYEPHYLVNESPKD  153

Query  512  IERNETGHG--DAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLR  685
               +ET          +  F++AD+D++G L+  E+  F HPE   N +  + +  + L+
Sbjct  154  GHEHETVDNIDSVADAVRAFESADLDKDGVLDSKEWLRFFHPE--HNGDSLKEMAGDILK  211

Query  686  QMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFTL---LDADKDSFLRVE  856
              DVN D K++  EF  G     K+ KE +         +  F     +D + D    +E
Sbjct  212  LHDVNGDGKMTREEFSAGP----KSEKEDDEEPDSKRKAKREFEFDKQIDVNGDGVATIE  267

Query  857  ELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLF  1000
            E   IF Y++P          + LI   D + D KLTLDE++  D L 
Sbjct  268  E---IFEYINPRNARSLAAEASELIDSIDSDGDRKLTLDELLKQDRLV  312



>ref|XP_003111447.1| hypothetical protein CRE_03758 [Caenorhabditis remanei]
 gb|EFO84947.1| hypothetical protein CRE_03758 [Caenorhabditis remanei]
Length=289

 Score = 66.6 bits (161),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 72/246 (29%), Positives = 109/246 (44%), Gaps = 33/246 (13%)
 Frame = +2

Query  353   DGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY----FPQFTDEDIER  520
             DGFVD  EL  W ++     ++      +S  D++ DG +S+ EY    FP+    + E 
Sbjct  66    DGFVDKNELLAWVSESYQKTVDREAVERMSELDENADGFVSWEEYLRDSFPEEELHNKEE  125

Query  521   NETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVN  700
                   D     + FK AD + +G L++ E   FL+PE   + ++   L+   L + D N
Sbjct  126   ETLIAQDK----LYFKQADQNEDGKLDMQELASFLNPE--HHPHMHPVLIAVTLLEKDQN  179

Query  701   KDQKLSLLEF------ERGAYETYKTYKEFETSGIDVPSVEETFTLLDADKDSFLRVEEL  862
              D  +   EF      +RG+ E Y               VE   T+ D +KD  L  +EL
Sbjct  180   GDGAIDEKEFLGELDDQRGS-EWYNV------------EVERFHTVYDKNKDGKLSGDEL  226

Query  863   KPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDI  1042
                  +L     +   Y    L++ +DD+ DGKL+ DE++ H  LF  T    E D    
Sbjct  227   TA---WLLVDGTTAGSYEAESLLQNSDDDKDGKLSYDEIVKHHALFAKTEAAQEADHLHP  283

Query  1043  Y-HDEL  1057
             Y HDEL
Sbjct  284   YSHDEL  289



>ref|XP_007575667.1| PREDICTED: reticulocalbin-3 isoform X1 [Poecilia formosa]
Length=317

 Score = 67.0 bits (162),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 115/245 (47%), Gaps = 19/245 (8%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-  487
             RL  +   +D D  DG+V   EL  W   +    +     +     D++ D  I++ EY 
Sbjct  71    RLAKIVDRIDTDK-DGYVTHSELHQWIKHRQRRYIEENVNKHWKDYDQNRDDKIAWEEYK  129

Query  488   ---FPQFTDE---DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRND  649
                +  +  E   DIE  +T          +FK+AD DR+G     EF  FLHPE+   D
Sbjct  130   NTTYGYYLGEEFSDIEDKDTYKSMLARDERRFKSADKDRDGIATREEFTAFLHPEEF--D  187

Query  650   NIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETF-TLLD  826
              ++  ++ E +  +D + D K++L E+    Y    T ++ E+    V +  + F    D
Sbjct  188   YMKDVVVQETMEDIDKDGDGKINLHEYIGDMY----TSEDSESEPDWVQTERKHFGEFRD  243

Query  827   ADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNH-DTLFY  1003
              +KD +L   E   +  ++ PGE+ +A     +LI E D N DG+LTL EM++  D L  
Sbjct  244   VNKDGYLDANE---VAQWVLPGEVDHADNEAKHLIYETDTNKDGRLTLSEMLDKTDYLRM  300

Query  1004  DTIYD  1018
              TI D
Sbjct  301   STITD  305



>gb|KFB38128.1| AGAP010392-PA-like protein [Anopheles sinensis]
Length=323

 Score = 67.0 bits (162),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 68/242 (28%), Positives = 116/242 (48%), Gaps = 21/242 (9%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYF  490
            RL ++   +D D  DGFV++ EL+ W        ++    R     + +    I +  Y 
Sbjct  73   RLGLIVDKIDGDK-DGFVNLSELKSWIQYTQRRYIDDDVNRQWKTHNPNSTDKIHWDTYR  131

Query  491  PQ---FTDEDIERNETGHGDAGW---WMIQ-----FKNADVDRNGTLNLYEFRDFLHPED  637
                 F D+   +     G+  +    M++     + NAD D +  L+  EF DFLHPE+
Sbjct  132  KNVYGFLDDFASQESENMGEEHFSYRAMLKRDRRRWSNADRDGDDQLSREEFTDFLHPEE  191

Query  638  SRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT  817
            S   ++R  ++TE +  +D +KD K+S+ E+     + Y+  ++ E     V    ETF+
Sbjct  192  SS--HMRDVVVTETIEDIDKDKDGKVSVEEY---IGDMYRQAEDNEEEPDWVKHERETFS  246

Query  818  -LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDT  994
               D DK+ F+  +E+K    ++ P +  +A     +LI EAD + D KLT DE++    
Sbjct  247  NFRDKDKNGFMDEQEVKD---WITPADFDHAEAEARHLIYEADSDADEKLTKDEIIEKYD  303

Query  995  LF  1000
            LF
Sbjct  304  LF  305



>ref|XP_001607801.2| PREDICTED: calumenin [Nasonia vitripennis]
Length=363

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 123/243 (51%), Gaps = 25/243 (10%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYW--NTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
            RL ++   +D+D  DG+V  +EL+ W   TQQ  +R +  T+R     + DG   +S+ E
Sbjct  115  RLGLIVDKIDKDK-DGYVTQEELKDWIRYTQQRYSRDD--TERQWQSHNPDGKDKVSWQE  171

Query  485  YFPQ---FTDE-DIERNETGHGDAGWWMIQFKN------ADVDRNGTLNLYEFRDFLHPE  634
            Y  +   F DE D E+ +    +  +  +Q +       AD D +  L   EF  FLHPE
Sbjct  172  YRGRIYGFLDETDPEKIDKQDENYSYATMQKRERRRWSIADKDGDDALTKEEFAAFLHPE  231

Query  635  DSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETF  814
            ++  D ++  ++ E +  +D +KD K+SL E+    Y+     +E E     V + +E F
Sbjct  232  ET--DYMKDIVVIETIEDIDTDKDGKISLAEYIGDMYKG----EEGEEVPEWVKNEQEQF  285

Query  815  -TLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHD  991
             T  D D D F+  +E+K   +++ P +  +A     +LI EAD + D KLT +E++   
Sbjct  286  STHRDKDGDGFMDNDEVK---NWILPDDFDHAEAEARHLIYEADSDADHKLTKEEILEKY  342

Query  992  TLF  1000
             +F
Sbjct  343  DIF  345



>gb|ETN61842.1| reticulocalbin [Anopheles darlingi]
Length=324

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 72/247 (29%), Positives = 111/247 (45%), Gaps = 30/247 (12%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYF  490
            RL ++   +D D  DGFV++ EL+ W        ++    R     + +    + +  Y 
Sbjct  73   RLGLIVDKIDGDK-DGFVNLSELKAWIQYTQRRYIDDDVNRQWKTHNTNNTEKLHWDTYR  131

Query  491  PQ---FTDEDIERNETGHG-------------DAGWWMIQFKNADVDRNGTLNLYEFRDF  622
                 F DE   R  + H              D   W I    AD D +  L   EF DF
Sbjct  132  QNVYGFLDELASREGSDHPADEHFSYRAMMKRDRRRWGI----ADRDGDDELTKEEFTDF  187

Query  623  LHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSV  802
            LHPE+S  D++R  ++TE +  +D + D K+S+ E+     + Y+  +E E     V   
Sbjct  188  LHPEES--DHMRDVVVTETIEDIDKDNDGKVSVEEY---IGDMYRVGEENEEEPDWVKHE  242

Query  803  EETFT-LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEM  979
             ETF+   D +KD F+  EE+K    ++ P    +A     +LI EAD + D KLT DE+
Sbjct  243  RETFSNFRDKNKDGFMDNEEVKD---WITPAHFDHAEAEARHLIYEADSDADEKLTKDEI  299

Query  980  MNHDTLF  1000
            +    LF
Sbjct  300  IEKYDLF  306



>ref|XP_005464990.1| PREDICTED: reticulocalbin-1-like isoform X2 [Oreochromis niloticus]
Length=317

 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 65/233 (28%), Positives = 111/233 (48%), Gaps = 18/233 (8%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-  487
            RL  +   +D D  DG++   EL YW   +    +     +     DK+ D  IS+ EY 
Sbjct  71   RLAKIVDRIDTDK-DGYISHGELHYWIKHRQRRYIEENVNKHWKDYDKNQDDKISWEEYK  129

Query  488  ---FPQFTDED---IERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRND  649
               +  +  ED   ++  ET          +FK AD D +G     EF  FLHPE+   D
Sbjct  130  NTTYGYYLGEDFDDVDDKETYKSMLKRDERRFKTADRDSDGIATREEFTAFLHPEEF--D  187

Query  650  NIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT-LLD  826
             ++  ++ E +  +D N D K++L E+    Y    T ++ E+    V +  + F+ + D
Sbjct  188  YMKDVVIQETVEDIDKNGDGKINLEEYIGDMY----TAEDGESEPDWVQTERKHFSEIRD  243

Query  827  ADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMN  985
             +KD +L   E   +  ++ PGE+ +A     +LI E D + DG+L+L E+++
Sbjct  244  TNKDGYLDANE---VGQWVLPGEVDHADNEAKHLIHETDTDKDGRLSLPEVLD  293



>ref|XP_003118182.1| CRE-CALU-1 protein [Caenorhabditis remanei]
 gb|EFO82780.1| CRE-CALU-1 protein [Caenorhabditis remanei]
Length=314

 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 77/259 (30%), Positives = 113/259 (44%), Gaps = 55/259 (21%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKELE---------YWNTQQAINRLNYRTQRALSLRDKDGD  463
             +L  L P +D D  DGF++  EL+         Y N        NY+ ++ +       D
Sbjct  64    KLAKLVPKMDAD-SDGFIEENELKDHINFMQKRYVNNDVDRTWKNYKAEKIV-------D  115

Query  464   GSISFSEY---------------FPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTL  598
             G I + +Y                P++  + I R+E        W +    AD D NG L
Sbjct  116   GKIKWEDYREMVYGSADGAGQELSPEYA-KMIARDEKR------WAV----ADYDSNGAL  164

Query  599   NLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFET  778
             +  E+  F+HPED   D++R  ++ E +  +D NKD  + L E+    Y     Y E   
Sbjct  165   DRTEYGCFMHPEDC--DHMRDIVVAETVDDIDKNKDGTVDLDEYIGDMYRP-DDYPELNG  221

Query  779   SGID-VPSVEETFT-LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNN  952
                D V S  E F    D D D  L  EE++    ++ P    +A     +L+  ADDN 
Sbjct  222   KEPDWVQSEREMFKEHRDKDGDGKLNQEEMRD---WIMPVGFDHAEAEARHLVGIADDNK  278

Query  953   DGKLTLDEMMNHDTLFYDT  1009
             DGKLTLDE++ H    YDT
Sbjct  279   DGKLTLDEIVAH----YDT  293



>ref|XP_002109885.1| hypothetical protein TRIADDRAFT_20674 [Trichoplax adhaerens]
 gb|EDV28051.1| hypothetical protein TRIADDRAFT_20674 [Trichoplax adhaerens]
Length=301

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 119/253 (47%), Gaps = 37/253 (15%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEYF  490
             RL VL P +D +  D  +D+ EL  W   +    +    + +  L DK+ D  +S+ E  
Sbjct  57    RLKVLIPEIDSNN-DNLIDILELTNWIRTRQDKVIARGAEASFQLYDKNKDNKVSWDE--  113

Query  491   PQFTDEDIERNETGHGD----AGWWMI--------------QFKNADVDRNGTLNLYEFR  616
                    I   + G  D    AG  ++              ++ +AD D +  L+L+EF+
Sbjct  114   -------IRSAKYGISDNSETAGILVVSQNVDLKEMKYDKEKYNHADTDGDLKLSLHEFK  166

Query  617   DFLHPE-DSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDV  793
              +LHPE D R   +  +L  E L + D NKD   +LLEF+      +   +E E +   +
Sbjct  167   IWLHPESDPR---MAEFLHQEALHKSDRNKD---NLLEFKEYLGSNHDNIQEIEHTHDWL  220

Query  794   PSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLD  973
                ++ F   D + D  L +EE++   +Y+    L+  R    +LI +AD N D KL+++
Sbjct  221   KEEKQKFDSYDKNNDGMLDLEEVR--LYYVPVQFLNQLRNEARHLINKADKNQDQKLSVE  278

Query  974   EMMNHDTLFYDTI  1012
             E++++  +F  ++
Sbjct  279   EILDNSDIFVGSL  291



>ref|XP_002407941.1| calumenin, putative [Ixodes scapularis]
 gb|EEC03896.1| calumenin, putative [Ixodes scapularis]
Length=342

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 155/337 (46%), Gaps = 41/337 (12%)
 Frame = +2

Query  68   TKVVAYTIAAAFVILLLS-----QDHNKLFRKDYSPRGLSRRLGTQGTAPPIFDPIVARR  232
            ++V+ Y++   F+ L L+     ++H ++ ++      LS     +  + P+ D    R 
Sbjct  3    SRVMQYSLVLYFLHLSLTLAIPKEEHKRVHQQKLG--ALSGVAEREPRSQPLSDEQHYRE  60

Query  233  KGLANPEKSDD------DDRYFNDKGRLDTGLRLMVLFPILDRDPCDGFVDVKELEYWNT  394
                NP+   D      D + F      ++  RL  +   +D+D  DG+V  +ELE W  
Sbjct  61   GAEHNPDYDHDAFLGEEDAKTFEHLTPAESKDRLGKIVDKIDKD-SDGYVTQEELENWIR  119

Query  395  QQAINRLNYRTQRALSLRDKDGDGSISFSEY------FPQFTD-EDIERNETG-------  532
                  +     +   + +      IS++EY      F + +D ED +++E G       
Sbjct  120  FTQKRYIRDDVDKQWKVYNPQESNRISWAEYRNSTYGFEEGSDGEDSDKDEDGATFRDMA  179

Query  533  HGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQK  712
              D   W      AD D +G L+  EF +FLHPE+S  ++++  ++ E +  +D ++D K
Sbjct  180  RRDKRRW----DRADKDGDGHLDKEEFGNFLHPEES--EDMKSVVVEETMEDIDKDRDGK  233

Query  713  LSLLEFERGAYETYKTYKEFETSGIDVPSVEETF-TLLDADKDSFLRVEELKPIFHYLDP  889
            +SL E+     + Y    + E     V + +E F    D DKD F+  +E++    ++ P
Sbjct  234  ISLDEY---IGDMYGGAGDEEVVPEWVQNEKEQFQNFRDKDKDGFMSADEVRD---WIMP  287

Query  890  GELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLF  1000
             +  +++    +L+ EAD N D KL+ +E+++   LF
Sbjct  288  VDYDHSKSEARHLVYEADKNKDKKLSREEILDKYDLF  324



>ref|XP_011058992.1| PREDICTED: calumenin-B [Acromyrmex echinatior]
 gb|EGI62733.1| Calumenin-B [Acromyrmex echinatior]
Length=326

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 68/245 (28%), Positives = 122/245 (50%), Gaps = 27/245 (11%)
 Frame = +2

Query  311  RLMVLFPILDRDPCDGFVDVKELEYW--NTQQAINRLNYRTQRALSLRDKDGDGSISFSE  484
            RL ++   +D+D  DG+V  +EL+ W   TQQ   R +   +R     +  G   +S++E
Sbjct  76   RLGIIVDKIDKD-SDGYVTQEELKDWIMYTQQRYIRDD--VERQWVSHNPMGKEKLSWTE  132

Query  485  Y----FPQFTDEDIERNETGHGDAGWWMIQ--------FKNADVDRNGTLNLYEFRDFLH  628
            Y    +    +++ E+ E+   D  +  +Q        +  AD+D +  L   EF  FLH
Sbjct  133  YKDMVYGDMEEQEAEKRESDKTDESFSYVQMYKRDRRRWTTADLDGDDALTKEEFTAFLH  192

Query  629  PEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEE  808
             ED+  ++++  ++ E +  +D ++D K+SL E+    Y   +  +E E     V + +E
Sbjct  193  AEDA--EHMKDVIVLETMEDIDKDQDGKISLAEYIGDMYRGEEGEEEPEW----VKNEKE  246

Query  809  TFTLL-DADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMN  985
             F+L  D + D FL  +E+K    ++ P E  +A   + +LI EAD + D KLT  E++ 
Sbjct  247  QFSLYRDKNGDGFLNADEVKT---WIIPAEFDHAEAESRHLIYEADTDADHKLTKSEILE  303

Query  986  HDTLF  1000
               +F
Sbjct  304  KYDIF  308



>gb|EKC18995.1| 45 kDa calcium-binding protein [Crassostrea gigas]
Length=345

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 119/270 (44%), Gaps = 31/270 (11%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSL---RDKDGDGSISFS  481
             +L+ +F  +D+D  DG+++  EL+ W   +    +N   +   ++    D DGDG + + 
Sbjct  86    KLVDIFHKIDKD-TDGYLNEGELDSWILDKINEHMNEAMEENAAIFKHLDPDGDGYVEWK  144

Query  482   EYFPQFT-----------------DEDIERNETGHGDAGWWMIQFKNADVDR-NGTLNLY  607
             EY+  F                  D DI +++       W+  ++ +AD+   +  L++ 
Sbjct  145   EYYKHFLLAKGHGLNETEKYLEDYDTDILQDDE-RDKLVWYKFKWTDADIKPIDNRLDVE  203

Query  608   EFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI  787
             EF  F HPE S    +   ++   +  +DV+KD KL+L EF +          E E    
Sbjct  204   EFFSFRHPEHSVQ--LIENMVLSIINSLDVDKDGKLTLKEFSKPDIMEEDPTTEKEREEE  261

Query  788   DVPSVEETFTLLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLT  967
                  +E  + +D +KD     EE+     Y++P     +      L+   DDN DGKL+
Sbjct  262   YKVREKEFVSAIDKNKDGVATKEEM---MEYMNPRNPQQSLQEAKNLMSLMDDNKDGKLS  318

Query  968   LDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
             +DE+  H  +F  +   N K    + HDE 
Sbjct  319   VDEIKKHKDIFISSKIVNVK---KVLHDEF  345



>ref|XP_004072082.1| PREDICTED: reticulocalbin-3-like [Oryzias latipes]
Length=186

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 51/167 (31%), Positives = 89/167 (53%), Gaps = 10/167 (6%)
 Frame = +2

Query  560   QFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERG  739
             +F+ AD D +G     EF  FLHPE+   D+++  ++ E L  +D NKD K+ + E+   
Sbjct  29    RFRAADRDADGIATRSEFTAFLHPEEF--DHMKDVVVQETLEDIDKNKDGKIDINEYIGD  86

Query  740   AYETYKTYKEFETSGIDVPSVEETFT-LLDADKDSFLRVEELKPIFHYLDPGELSYARYY  916
              +    T ++ ET    V + ++ F+   D++KD +L   E   + H++ PGE+ +A   
Sbjct  87    MF----TPEDGETEPDWVHTEKKHFSEFRDSNKDGYLDAGE---VAHWILPGEVDHADNE  139

Query  917   TTYLIREADDNNDGKLTLDEMMNHDTLFYDTIYDNEKDEDDIYHDEL  1057
               +LI E D + DGK+T  E++ +  +F  +   N  ++    HDEL
Sbjct  140   AKHLIHETDTDKDGKVTKKEILANWNMFVGSQATNYGEDLTKKHDEL  186



>gb|ABN14961.1| calumenin [Taenia asiatica]
Length=199

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/149 (32%), Positives = 83/149 (56%), Gaps = 13/149 (9%)
 Frame = +2

Query  560  QFKNADVDRNGTLNLYEFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERG  739
            +F+ AD + +G L   EF  FLHPE+   D++R  +++E L  +D NKD ++ L E+ R 
Sbjct  44   RFEKADANGDGKLTKEEFAAFLHPEEF--DHMRDIVISETLEDLDSNKDGRIDLEEYTRD  101

Query  740  AY-ETYKTYKEFETSGIDVPSVEETFT-LLDADKDSFLRVEELKPIFHYLDPGELSYARY  913
             + +  ++  E+      V + ++ F    D +KD +L  EE   I+ +L P +  +   
Sbjct  102  MWVDDSQSPPEW------VKTEQQQFKEARDKNKDGYLDREE---IYAWLFPSDYDHIES  152

Query  914  YTTYLIREADDNNDGKLTLDEMMNHDTLF  1000
               +L+ E DD+ DGKL+ DE+++H  +F
Sbjct  153  ELKHLMSETDDDQDGKLSKDEILSHYHVF  181



>gb|KHN83833.1| Calumenin-A [Toxocara canis]
Length=312

 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 74/256 (29%), Positives = 110/256 (43%), Gaps = 49/256 (19%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKEL---------------------EYWNTQQAINRLNYRT  427
             RL +L P +D D  DGFV   EL                      Y   +    +L ++ 
Sbjct  62    RLSMLVPKMDSD-GDGFVGEGELREHIKFMQKRYVNNDVDRTWKNYNEDKIKDGKLEWKD  120

Query  428   QRALSLRDKDGDGSISFSEYFPQFTDEDIERNETGHGDAGWWMIQFKNADVDRNGTLNLY  607
              R +     DG+G     EY    T     R+E           ++K AD D NG L+  
Sbjct  121   YRTMVYGSPDGEGQELSPEYAKMIT-----RDER----------RWKVADYDSNGVLDRT  165

Query  608   EFRDFLHPEDSRNDNIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGI  787
             E+  F+HPED   D++R  ++ E +  +D NKD  + L E+    Y   + Y E      
Sbjct  166   EYGCFMHPEDC--DHMRDIVVAETVEDIDKNKDGFVDLEEYIGDMYRP-EDYPELNGKEP  222

Query  788   D-VPSVEETFT-LLDADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGK  961
             D V S  E F    D D D  L  +E++    ++ P    +A     +L+  ADDN DGK
Sbjct  223   DWVASEREMFKEHRDKDGDGKLNQDEMRD---WIMPIGFDHADAEAKHLVGIADDNKDGK  279

Query  962   LTLDEMMNHDTLFYDT  1009
             L+++E++ H    YDT
Sbjct  280   LSMEEILAH----YDT  291



>ref|XP_004562936.1| PREDICTED: reticulocalbin-1-like isoform X2 [Maylandia zebra]
Length=317

 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 71/257 (28%), Positives = 121/257 (47%), Gaps = 18/257 (7%)
 Frame = +2

Query  311   RLMVLFPILDRDPCDGFVDVKELEYWNTQQAINRLNYRTQRALSLRDKDGDGSISFSEY-  487
             RL  +   +D D  DG+V   EL YW   +    +     +     DK+ D  IS+ EY 
Sbjct  71    RLAKIVDRIDTDK-DGYVSHGELHYWIKHRQRRYIEENVNKHWKDYDKNQDDKISWEEYK  129

Query  488   ---FPQFTDE---DIERNETGHGDAGWWMIQFKNADVDRNGTLNLYEFRDFLHPEDSRND  649
                +  +  E   DI+  ET          +FK AD D +G     EF  FLHPE+   D
Sbjct  130   NTTYGYYLGEEFDDIDDKETYKSMLKRDERRFKTADRDSDGIATHEEFTAFLHPEEF--D  187

Query  650   NIRRWLLTEKLRQMDVNKDQKLSLLEFERGAYETYKTYKEFETSGIDVPSVEETFT-LLD  826
              ++  ++ E +  +D N D K++L E+    Y    T ++ E+    V + ++ F+ + D
Sbjct  188   YMKDLVIQETVEDIDKNGDGKINLEEYIGDMY----TAEDGESEPDWVQTEKKHFSEIRD  243

Query  827   ADKDSFLRVEELKPIFHYLDPGELSYARYYTTYLIREADDNNDGKLTLDEMMNHDTLFYD  1006
              +KD +L  +E   +  ++ PGE+ +A     +LI E D + D ++T  E++ +  +F  
Sbjct  244   TNKDGYLDADE---VGQWVLPGEVDHADNEAKHLIHETDTDKDERITKKEILANWNMFVG  300

Query  1007  TIYDNEKDEDDIYHDEL  1057
             +   N  ++    HDEL
Sbjct  301   SQATNYGEDLTKKHDEL  317



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4495759397920