BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25473_g7_i1 len=264 path=[12510:0-263]

Length=264
                                                                      Score     E

ref|XP_009799971.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  58.9    1e-07   
ref|XP_009614428.1|  PREDICTED: putative late blight resistance p...  58.2    2e-07   
gb|EYU29927.1|  hypothetical protein MIMGU_mgv1a021755mg              57.8    2e-07   
emb|CDP11163.1|  unnamed protein product                              56.6    5e-07   
ref|XP_009770146.1|  PREDICTED: putative late blight resistance p...  56.6    5e-07   
ref|XP_009599922.1|  PREDICTED: putative late blight resistance p...  56.2    7e-07   
ref|XP_009599921.1|  PREDICTED: putative late blight resistance p...  56.2    8e-07   
emb|CDP20176.1|  unnamed protein product                              55.8    9e-07   
ref|XP_009796760.1|  PREDICTED: putative late blight resistance p...  55.8    1e-06   
emb|CDP08038.1|  unnamed protein product                              55.1    2e-06   
ref|XP_010321401.1|  PREDICTED: putative late blight resistance p...  54.7    2e-06   
emb|CDP08024.1|  unnamed protein product                              54.3    3e-06   
ref|XP_004240205.1|  PREDICTED: putative late blight resistance p...  54.7    3e-06   
ref|XP_010321399.1|  PREDICTED: putative late blight resistance p...  54.7    3e-06   
ref|XP_010321400.1|  PREDICTED: putative late blight resistance p...  54.3    3e-06   
gb|EYU17661.1|  hypothetical protein MIMGU_mgv1a025742mg              53.9    4e-06   
ref|XP_009786145.1|  PREDICTED: putative late blight resistance p...  54.3    4e-06   
ref|XP_009786137.1|  PREDICTED: putative late blight resistance p...  53.9    4e-06   
ref|XP_009604596.1|  PREDICTED: putative late blight resistance p...  53.5    6e-06   
emb|CDP21300.1|  unnamed protein product                              53.5    6e-06   
ref|XP_009604598.1|  PREDICTED: putative late blight resistance p...  53.5    6e-06   
emb|CDP20153.1|  unnamed protein product                              53.1    7e-06   
ref|XP_004239804.1|  PREDICTED: putative late blight resistance p...  53.1    9e-06   
gb|EYU21105.1|  hypothetical protein MIMGU_mgv1a021133mg              52.8    9e-06   
ref|XP_009788847.1|  PREDICTED: putative late blight resistance p...  52.8    1e-05   
emb|CDP21728.1|  unnamed protein product                              52.8    1e-05   
gb|EYU33209.1|  hypothetical protein MIMGU_mgv1a025298mg              52.0    1e-05   
ref|XP_009786128.1|  PREDICTED: putative late blight resistance p...  52.4    1e-05   
ref|XP_004240523.1|  PREDICTED: putative late blight resistance p...  52.4    1e-05   
emb|CDP12547.1|  unnamed protein product                              52.4    1e-05   
ref|XP_009786116.1|  PREDICTED: putative late blight resistance p...  52.4    2e-05   
ref|XP_009610033.1|  PREDICTED: putative late blight resistance p...  52.0    2e-05   
ref|XP_004240304.1|  PREDICTED: putative late blight resistance p...  52.0    2e-05   
ref|XP_009610032.1|  PREDICTED: putative late blight resistance p...  52.0    2e-05   
ref|XP_009763119.1|  PREDICTED: putative late blight resistance p...  51.6    2e-05   
ref|XP_009763120.1|  PREDICTED: putative late blight resistance p...  51.6    2e-05   
emb|CDP19728.1|  unnamed protein product                              51.6    2e-05   
ref|XP_009592957.1|  PREDICTED: putative late blight resistance p...  51.6    2e-05   
gb|EYU24351.1|  hypothetical protein MIMGU_mgv1a025953mg              51.6    2e-05   
ref|XP_004240204.1|  PREDICTED: putative late blight resistance p...  51.6    2e-05   
ref|XP_009800886.1|  PREDICTED: putative late blight resistance p...  51.6    2e-05   
ref|XP_006365905.1|  PREDICTED: putative late blight resistance p...  51.6    3e-05   
ref|XP_009608041.1|  PREDICTED: putative late blight resistance p...  51.6    3e-05   
ref|XP_009608045.1|  PREDICTED: putative late blight resistance p...  51.6    3e-05   
ref|XP_009624532.1|  PREDICTED: putative late blight resistance p...  51.2    3e-05   
gb|EYU21170.1|  hypothetical protein MIMGU_mgv1a025737mg              51.2    3e-05   
emb|CDP08040.1|  unnamed protein product                              50.8    3e-05   
gb|EYU17666.1|  hypothetical protein MIMGU_mgv1a021453mg              50.8    4e-05   
ref|XP_009766122.1|  PREDICTED: putative late blight resistance p...  50.4    4e-05   
gb|EYU29922.1|  hypothetical protein MIMGU_mgv1a0259201mg             50.8    4e-05   
gb|AAZ95005.1|  late blight resistance protein Rpi-blb2               50.8    4e-05   Solanum bulbocastanum [ornamental nightshade]
ref|XP_009766276.1|  PREDICTED: putative late blight resistance p...  50.8    4e-05   
ref|XP_009766277.1|  PREDICTED: uncharacterized protein LOC104217...  50.8    4e-05   
emb|CDP11160.1|  unnamed protein product                              50.8    5e-05   
ref|XP_006365906.1|  PREDICTED: putative late blight resistance p...  50.4    6e-05   
ref|XP_009788554.1|  PREDICTED: putative late blight resistance p...  50.4    7e-05   
emb|CDP11649.1|  unnamed protein product                              50.4    7e-05   
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...  50.1    7e-05   
gb|EYU21848.1|  hypothetical protein MIMGU_mgv1a023991mg              50.1    8e-05   
emb|CDP05558.1|  unnamed protein product                              50.1    8e-05   
ref|XP_009613244.1|  PREDICTED: putative late blight resistance p...  50.1    8e-05   
ref|XP_009758239.1|  PREDICTED: putative late blight resistance p...  50.1    8e-05   
ref|XP_009758240.1|  PREDICTED: putative late blight resistance p...  50.1    9e-05   
gb|EYU31597.1|  hypothetical protein MIMGU_mgv1a001843mg              49.7    9e-05   
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...  49.7    1e-04   
emb|CDP08023.1|  unnamed protein product                              49.7    1e-04   
ref|XP_009768640.1|  PREDICTED: putative late blight resistance p...  49.7    1e-04   
ref|XP_009768636.1|  PREDICTED: putative late blight resistance p...  49.7    1e-04   
ref|XP_009800005.1|  PREDICTED: putative late blight resistance p...  49.7    1e-04   
ref|XP_009768641.1|  PREDICTED: putative late blight resistance p...  49.7    1e-04   
ref|XP_009608038.1|  PREDICTED: putative late blight resistance p...  49.7    1e-04   
ref|XP_009608035.1|  PREDICTED: putative late blight resistance p...  49.7    1e-04   
ref|XP_009608039.1|  PREDICTED: putative late blight resistance p...  49.7    1e-04   
ref|XP_009608040.1|  PREDICTED: putative late blight resistance p...  49.7    1e-04   
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...  49.3    1e-04   
gb|EYU23519.1|  hypothetical protein MIMGU_mgv1a022028mg              49.3    1e-04   
gb|EYU28481.1|  hypothetical protein MIMGU_mgv1a018543mg              49.3    1e-04   
ref|XP_009761395.1|  PREDICTED: putative late blight resistance p...  48.5    1e-04   
emb|CDP17920.1|  unnamed protein product                              49.3    1e-04   
emb|CDP16515.1|  unnamed protein product                              49.3    1e-04   
ref|XP_009618710.1|  PREDICTED: putative late blight resistance p...  49.3    1e-04   
ref|XP_009618708.1|  PREDICTED: putative late blight resistance p...  49.3    2e-04   
ref|XP_009618706.1|  PREDICTED: putative late blight resistance p...  49.3    2e-04   
gb|ABI96218.1|  truncated NBS-LRR resistance protein-like protein     48.9    2e-04   Solanum lycopersicum
ref|XP_010315011.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...  48.9    2e-04   
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...  48.9    2e-04   
gb|EYU21839.1|  hypothetical protein MIMGU_mgv1a022812mg              48.9    2e-04   
ref|XP_004242251.1|  PREDICTED: putative late blight resistance p...  48.9    2e-04   
gb|EYU21791.1|  hypothetical protein MIMGU_mgv1a001064mg              48.9    2e-04   
emb|CDP04879.1|  unnamed protein product                              47.8    2e-04   
gb|EYU19036.1|  hypothetical protein MIMGU_mgv1a021264mg              48.9    2e-04   
gb|EYU21830.1|  hypothetical protein MIMGU_mgv1a001060mg              48.9    2e-04   
ref|XP_009622003.1|  PREDICTED: putative late blight resistance p...  48.5    2e-04   
ref|XP_004242250.1|  PREDICTED: putative late blight resistance p...  48.5    2e-04   
emb|CDP11161.1|  unnamed protein product                              48.5    2e-04   
gb|EYU31598.1|  hypothetical protein MIMGU_mgv1a018432mg              48.5    3e-04   
ref|XP_010320896.1|  PREDICTED: late blight resistance protein R1...  48.5    3e-04   
ref|XP_010320895.1|  PREDICTED: putative late blight resistance p...  48.5    3e-04   
ref|XP_004239469.1|  PREDICTED: putative late blight resistance p...  48.5    3e-04   
emb|CDP01146.1|  unnamed protein product                              47.8    3e-04   
emb|CDP11157.1|  unnamed protein product                              48.1    3e-04   
ref|XP_006345448.1|  PREDICTED: putative late blight resistance p...  48.1    3e-04   
emb|CDP05439.1|  unnamed protein product                              47.8    3e-04   
ref|XP_009613225.1|  PREDICTED: late blight resistance protein R1...  47.8    4e-04   
gb|EYU29513.1|  hypothetical protein MIMGU_mgv1a025475mg              48.1    4e-04   
gb|EYU24354.1|  hypothetical protein MIMGU_mgv1a019328mg              48.1    4e-04   
emb|CDP10293.1|  unnamed protein product                              47.8    4e-04   
gb|EYU21828.1|  hypothetical protein MIMGU_mgv1a019841mg              47.8    4e-04   
gb|KHN13835.1|  Disease resistance protein RPP13                      47.8    4e-04   
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg              47.8    4e-04   
ref|XP_010320777.1|  PREDICTED: putative late blight resistance p...  47.8    4e-04   
gb|EYU21178.1|  hypothetical protein MIMGU_mgv1a019709mg              47.8    5e-04   
ref|XP_006603606.1|  PREDICTED: disease resistance protein RPP13-...  47.8    5e-04   
gb|EYU33970.1|  hypothetical protein MIMGU_mgv1a018989mg              47.8    5e-04   
emb|CDP15122.1|  unnamed protein product                              47.8    5e-04   
gb|EYU23534.1|  hypothetical protein MIMGU_mgv1a023257mg              47.4    6e-04   
emb|CDP11642.1|  unnamed protein product                              47.4    6e-04   
emb|CDP08020.1|  unnamed protein product                              47.4    6e-04   
emb|CDP18919.1|  unnamed protein product                              47.0    6e-04   
ref|XP_006366837.1|  PREDICTED: putative late blight resistance p...  47.4    6e-04   
ref|XP_004231117.1|  PREDICTED: putative late blight resistance p...  47.4    6e-04   
ref|NP_001234622.1|  plant resistance protein                         47.4    6e-04   
ref|XP_006362543.1|  PREDICTED: putative late blight resistance p...  47.0    7e-04   
gb|AAC32253.1|  disease resistance gene homolog Mi-copy1              47.4    7e-04   Solanum lycopersicum
gb|AAC32252.1|  disease resistance gene homolog Mi-copy2              47.4    7e-04   Solanum lycopersicum
gb|AAC97933.1|  disease resistance protein                            47.4    7e-04   Solanum lycopersicum
ref|NP_001234063.1|  root-knot nematode resistance protein            47.4    7e-04   
ref|XP_006356519.1|  PREDICTED: putative late blight resistance p...  47.0    7e-04   
gb|EYU24432.1|  hypothetical protein MIMGU_mgv1a023729mg              47.0    7e-04   
ref|XP_004243045.1|  PREDICTED: putative late blight resistance p...  47.0    7e-04   
gb|ABE68835.1|  root-knot nematode resistance protein                 47.4    7e-04   Capsicum annuum
ref|XP_009611209.1|  PREDICTED: putative late blight resistance p...  47.0    7e-04   
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...  47.0    8e-04   
gb|EYU23522.1|  hypothetical protein MIMGU_mgv1a018893mg              47.0    8e-04   
ref|XP_009768632.1|  PREDICTED: putative late blight resistance p...  47.0    8e-04   
ref|XP_009587569.1|  PREDICTED: putative late blight resistance p...  47.0    8e-04   
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...  47.0    8e-04   
ref|XP_009587570.1|  PREDICTED: putative late blight resistance p...  47.0    8e-04   
gb|EYU21847.1|  hypothetical protein MIMGU_mgv1a017843mg              47.0    8e-04   
ref|XP_006596445.1|  PREDICTED: disease resistance protein RPP13-...  47.0    9e-04   
emb|CDP21430.1|  unnamed protein product                              46.6    0.001   
ref|XP_006356561.1|  PREDICTED: putative late blight resistance p...  46.6    0.001   
ref|XP_006596446.1|  PREDICTED: disease resistance protein RPP13-...  46.6    0.001   
emb|CDP07957.1|  unnamed protein product                              47.0    0.001   
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg              46.6    0.001   
ref|XP_009600340.1|  PREDICTED: putative late blight resistance p...  46.2    0.001   



>ref|XP_009799971.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1A-3 [Nicotiana sylvestris]
Length=1241

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP EL+ +G+EI+ KC GLPL + L+ G++  +E  E +W E    LN+   F
Sbjct  685  KIFGEESCPNELKDVGEEIALKCEGLPLALDLIGGVIAKMERKEDLWLE---VLNNLKSF  741

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +      + IELSY +LSDHLKPCLL
Sbjct  742  KNEGEVMEVIELSYDHLSDHLKPCLL  767



>ref|XP_009614428.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009614429.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009614430.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=1164

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 61/87 (70%), Gaps = 2/87 (2%)
 Frame = +3

Query  3    VKLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
            +KLF    CP EL  +G+EI+++C GLPL+V LVAG++   E++++ W++   ++NS  +
Sbjct  641  IKLFNKPTCPSELCEVGEEIARECQGLPLLVILVAGVLTKKEKNKENWRKIAESINSDTD  700

Query  183  FREGIRSNDAIELSYKYLSDHLKPCLL  263
              E  +  D IELSY++L DHLKPCLL
Sbjct  701  ISE--KCLDIIELSYRHLPDHLKPCLL  725



>gb|EYU29927.1| hypothetical protein MIMGU_mgv1a021755mg, partial [Erythranthe 
guttata]
Length=842

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K F   ECP+ELE IGK+I+KKC GLPL++ +   L+     ++  W+     LNS    
Sbjct  320  KAFFDEECPRELEEIGKKIAKKCKGLPLLIAVFGALLRKSSRTQVYWENISKDLNSILNS  379

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            R   +S D + LSY++L  HLKPC L
Sbjct  380  RVDEQSLDILSLSYRHLPAHLKPCFL  405



>emb|CDP11163.1| unnamed protein product [Coffea canephora]
Length=2495

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+G +CP+EL  +GKEI+ KCGGLPL V  ++GL+  +E+S+++W++    L+S    
Sbjct  852  KVFQGEDCPEELLLVGKEIAHKCGGLPLAVVAISGLLQRMEKSKELWEKIAEGLSSEVMK  911

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                R  + IELSYK+L D+LK CLL
Sbjct  912  DPEARCVEIIELSYKHLPDYLKACLL  937


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +3

Query  6     KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
             K+F+G  CP+EL  IGK+I+++CGGLPL    ++GL+   E+S++ W+    +L+S    
Sbjct  1949  KVFQGEGCPQELLPIGKKIAQRCGGLPLATVTISGLLQRTEKSKEFWENILESLSSEIMS  2008

Query  186   REGIRSNDAIELSYKYLSDHLKPCLL  263
                 R N+  ELSYK+L  HL+ C L
Sbjct  2009  DPEARCNEIFELSYKHLPGHLRACFL  2034



>ref|XP_009770146.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=1174

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 60/87 (69%), Gaps = 2/87 (2%)
 Frame = +3

Query  3    VKLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
            +KLF    CP EL  +G+EI+++C GLPL+V LVAG++   E++++ W++   ++NS  +
Sbjct  641  IKLFNKPTCPSELCEVGEEIARECQGLPLLVILVAGVLTKKEKNKESWRKIAESINSDTD  700

Query  183  FREGIRSNDAIELSYKYLSDHLKPCLL  263
                 +  D IELSY++L DHLKPCLL
Sbjct  701  I--SAKCLDIIELSYRHLPDHLKPCLL  725



>ref|XP_009599922.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1193

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP EL+ +G+EI+ KC GLPL + L+ G++  +E+ E +W E    LN+   F
Sbjct  639  KVFGEESCPDELKDVGEEIALKCEGLPLALDLIGGVIAKMEKKEDLWLE---VLNNLKSF  695

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +      + IELSY +L DHLKPCLL
Sbjct  696  KNEGEVMEVIELSYDHLLDHLKPCLL  721



>ref|XP_009599921.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1251

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP EL+ +G+EI+ KC GLPL + L+ G++  +E+ E +W E    LN+   F
Sbjct  697  KVFGEESCPDELKDVGEEIALKCEGLPLALDLIGGVIAKMEKKEDLWLE---VLNNLKSF  753

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +      + IELSY +L DHLKPCLL
Sbjct  754  KNEGEVMEVIELSYDHLLDHLKPCLL  779



>emb|CDP20176.1| unnamed protein product [Coffea canephora]
Length=894

 Score = 55.8 bits (133),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K F  +ECP++L  +G EI++KC GLPL + LVAG++   + S   W++    L+S +  
Sbjct  360  KTFHKDECPQDLVEVGMEIARKCKGLPLSIVLVAGILSRSKNSLYWWKQIAFNLSS-SHP  418

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             EG  S D +ELSYK+L DHLKPC L
Sbjct  419  TEG--SMDILELSYKHLPDHLKPCFL  442



>ref|XP_009796760.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009796761.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009796762.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009796763.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009796764.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009796766.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009796767.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009796768.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=1257

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP EL  +G+EI+ KC GLPL + L+ G++  +E+ E +W E    LN+   F
Sbjct  706  KVFGEESCPDELRDVGEEIALKCDGLPLALDLIGGIIAKMEKKEDLWLE---VLNNLKSF  762

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +      + IELSY +L DHLKPCLL
Sbjct  763  KNEGEVMEVIELSYDHLLDHLKPCLL  788



>emb|CDP08038.1| unnamed protein product [Coffea canephora]
Length=1468

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    VKLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
            +K+F   +CPKEL ++GKEI+++C GLPL +  VAG++   E+S   W++   +L+S   
Sbjct  906  MKVFNEEDCPKELVAVGKEIARQCRGLPLAIVAVAGILKMTEKSRNSWKKIANSLSSQVL  965

Query  183  FREGIRSNDAIELSYKYLSDHLKPCLL  263
                 +    +ELSY+YL ++LKPC L
Sbjct  966  NDPEAQGQSVLELSYQYLPEYLKPCFL  992



>ref|XP_010321401.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Solanum lycopersicum]
Length=1176

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP ELE + K I++KC GLPLVV L+ G++   E+ E +W E    L+S   F
Sbjct  683  KVFGEGRCPDELEDVEKRIARKCDGLPLVVDLIGGVISRKEKKEALWAEVLNDLSSSI-F  741

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++  +    I+LSY +LSDH+KPCL+
Sbjct  742  KDEEKVLKVIQLSYDHLSDHVKPCLV  767



>emb|CDP08024.1| unnamed protein product [Coffea canephora]
Length=703

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 56/87 (64%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    VKLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
            +K+F   +CPKEL ++GKEI+++C GLPL + +VAG++   E S   W++   +L+S   
Sbjct  141  MKVFNEEDCPKELVAVGKEIARQCRGLPLAIVVVAGILAMTEMSRNEWKKIANSLSSQVL  200

Query  183  FREGIRSNDAIELSYKYLSDHLKPCLL  263
                 +    +ELSY+YL ++LKPC L
Sbjct  201  NDPEAQGQSVLELSYQYLPEYLKPCFL  227



>ref|XP_004240205.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Solanum lycopersicum]
Length=1243

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP ELE + K I++KC GLPLVV L+ G++   E+ E +W E    L+S   F
Sbjct  682  KVFGEGRCPDELEDVEKRIARKCDGLPLVVDLIGGVISRKEKKEALWAEVLNDLSSSI-F  740

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++  +    I+LSY +LSDH+KPCL+
Sbjct  741  KDEEKVLKVIQLSYDHLSDHVKPCLV  766



>ref|XP_010321399.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Solanum lycopersicum]
Length=1244

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP ELE + K I++KC GLPLVV L+ G++   E+ E +W E    L+S   F
Sbjct  683  KVFGEGRCPDELEDVEKRIARKCDGLPLVVDLIGGVISRKEKKEALWAEVLNDLSSSI-F  741

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++  +    I+LSY +LSDH+KPCL+
Sbjct  742  KDEEKVLKVIQLSYDHLSDHVKPCLV  767



>ref|XP_010321400.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Solanum lycopersicum]
Length=1197

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP ELE + K I++KC GLPLVV L+ G++   E+ E +W E    L+S   F
Sbjct  636  KVFGEGRCPDELEDVEKRIARKCDGLPLVVDLIGGVISRKEKKEALWAEVLNDLSSSI-F  694

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++  +    I+LSY +LSDH+KPCL+
Sbjct  695  KDEEKVLKVIQLSYDHLSDHVKPCLV  720



>gb|EYU17661.1| hypothetical protein MIMGU_mgv1a025742mg, partial [Erythranthe 
guttata]
Length=726

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 1/80 (1%)
 Frame = +3

Query  27   CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTL-NSCAEFREGIRS  203
            CP+ELE IGK+I +KC GLPL + ++ GL+G   ++++ W+ F + + NS     +  RS
Sbjct  167  CPRELERIGKKIVEKCKGLPLSIVVIGGLLGKSHKTQEYWEYFAIIIRNSILNLEDDPRS  226

Query  204  NDAIELSYKYLSDHLKPCLL  263
             D + LSY +L  HLKPC L
Sbjct  227  LDILSLSYSHLPAHLKPCFL  246



>ref|XP_009786145.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1242

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CPKEL  +G+EI++KC GLPLV+ L+AG++   E  +  W E    LN+    
Sbjct  691  KVFGEKSCPKELLDVGEEIAQKCEGLPLVLDLIAGVIAKNETKKAFWLE---VLNNLKSI  747

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  ++    I+LSY +LSDHLKPCLL
Sbjct  748  KNEVKK--VIQLSYDHLSDHLKPCLL  771



>ref|XP_009786137.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1253

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CPKEL  +G+EI++KC GLPLV+ L+AG++   E  +  W E    LN+    
Sbjct  702  KVFGEKSCPKELLDVGEEIAQKCEGLPLVLDLIAGVIAKNETKKAFWLE---VLNNLKSI  758

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  ++    I+LSY +LSDHLKPCLL
Sbjct  759  KNEVKK--VIQLSYDHLSDHLKPCLL  782



>ref|XP_009604596.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009604597.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1258

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CPKEL  +G+EI++KC GLPLV+ L+ G++   E+ +  W E    LN+    
Sbjct  708  KVFGEKSCPKELLGVGEEIAQKCEGLPLVLDLIGGVIARKEKIKAFWLE---VLNNLKSI  764

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  ++    I+LSY +LSDHLKPCLL
Sbjct  765  KNEVKK--VIQLSYDHLSDHLKPCLL  788



>emb|CDP21300.1| unnamed protein product [Coffea canephora]
Length=1433

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F G  CP+EL  +GKEI+KKC GLPL V  ++GL+  +EES + W +   +L +    
Sbjct  874  KVFHGEGCPEELLLVGKEIAKKCKGLPLAVVAISGLLQRIEESSESWGKIAKSLIAEVME  933

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                R  + +ELSYK+L  +LKPC L
Sbjct  934  DPNARCMEILELSYKHLPGYLKPCFL  959



>ref|XP_009604598.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1252

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CPKEL  +G+EI++KC GLPLV+ L+ G++   E+ +  W E    LN+    
Sbjct  702  KVFGEKSCPKELLGVGEEIAQKCEGLPLVLDLIGGVIARKEKIKAFWLE---VLNNLKSI  758

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  ++    I+LSY +LSDHLKPCLL
Sbjct  759  KNEVKK--VIQLSYDHLSDHLKPCLL  782



>emb|CDP20153.1| unnamed protein product [Coffea canephora]
Length=1449

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            KLF   +CP EL ++GK+I++ C GLPL V  ++GL+    + +  W+    TL+SC   
Sbjct  889  KLFNRKDCPDELVNLGKKIARGCKGLPLAVVAISGLLQRTGKKQDWWETVARTLSSCIAD  948

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                R  D +ELSY +L  +LKPC L
Sbjct  949  DPETRCMDILELSYSHLPTYLKPCFL  974



>ref|XP_004239804.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=1228

 Score = 53.1 bits (126),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F    CP EL+ +GK+I++KC GLPLVV L++G++   E+ E  W +    L+S   F
Sbjct  691  RVFGEEGCPDELKDVGKKIARKCDGLPLVVDLISGVISRNEKKEAFWLDILNNLSSFI-F  749

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++       I+LSY +LSDH+KPCL+
Sbjct  750  KDEKEVEKVIQLSYDHLSDHVKPCLI  775



>gb|EYU21105.1| hypothetical protein MIMGU_mgv1a021133mg [Erythranthe guttata]
Length=913

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F G +CP ELE IGKEI++ C GLPL + ++ G++  +  +   W E    ++S    
Sbjct  368  KVFAGQDCPHELERIGKEIARNCRGLPLAIVVIGGILSTISRTRASWSEIMRNVSSAFAT  427

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                +    + LSY +L  HL+PC L
Sbjct  428  NNNGQFEKILSLSYTHLPHHLRPCFL  453



>ref|XP_009788847.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=900

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 55/86 (64%), Gaps = 2/86 (2%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            KLF+G +CP EL  +GK I++KC GLPL V LVAGL+G +E  E  W +   +L++    
Sbjct  353  KLFQGQQCPPELVDVGKRIAEKCQGLPLSVVLVAGLLGKMETKEDGWLQVAESLSTTTVG  412

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                R    IELSYK+L ++LKPC L
Sbjct  413  DSSSRG--IIELSYKHLPEYLKPCFL  436



>emb|CDP21728.1| unnamed protein product [Coffea canephora]
Length=705

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F G  CPKEL  +GKEI+KKC GLPL V  ++GL+   E+S   W E    L   AE 
Sbjct  142  KVFHGEGCPKELLLVGKEIAKKCKGLPLTVVAMSGLLQKTEKSRASWGEIAKGL--VAEV  199

Query  186  REGIRSN--DAIELSYKYLSDHLKPCLL  263
             E  ++   + +ELSYK+L  +LKPC L
Sbjct  200  MEEPKAQCMEILELSYKHLPGYLKPCFL  227



>gb|EYU33209.1| hypothetical protein MIMGU_mgv1a025298mg, partial [Erythranthe 
guttata]
Length=461

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F   +CP ELE IGK+I+K CGGLPL + ++ GL+  + +++  W++    +NS    
Sbjct  126  KVFGNQDCPSELEDIGKKIAKGCGGLPLAIVVIGGLLRTLSKTQASWRQIAENVNSIVAT  185

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++G    + + LSY +L  HL+PC L
Sbjct  186  QDG-EFEEVLSLSYTHLPHHLRPCFL  210



>ref|XP_009786128.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana sylvestris]
Length=1185

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP EL  +G EI+KKC GLPLV+ L+ G++   E+S+  W E   +LNS    
Sbjct  634  KVFGKESCPDELLHVGYEITKKCKGLPLVLHLIGGVIATKEKSKAFWCEVLNSLNSF--L  691

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             +       ++ SY +LSDHLKPCLL
Sbjct  692  LDDFEFMKILQFSYDHLSDHLKPCLL  717



>ref|XP_004240523.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 gb|ABI96217.1| NBS-LRR resistance protein-like protein [Solanum lycopersicum]
Length=1249

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 54/85 (64%), Gaps = 6/85 (7%)
 Frame = +3

Query  18   GNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF--R  188
            GNE CP EL  +GKEI++ C GLPLV  L+AG++ G E+   +W E    LN+   F  +
Sbjct  688  GNESCPNELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLE---VLNNSHSFILK  744

Query  189  EGIRSNDAIELSYKYLSDHLKPCLL  263
              +     IE+SY +LSDHLKPCLL
Sbjct  745  NEVEVMKVIEISYDHLSDHLKPCLL  769



>emb|CDP12547.1| unnamed protein product [Coffea canephora]
Length=1233

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 55/86 (64%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K F  +ECP++L  +G EI++KC GLPL + LVAG++   + S   W+    +L+S    
Sbjct  693  KTFHKDECPQDLVEVGMEIARKCKGLPLSIVLVAGILAKSKNSLYWWKRIARSLSSSHPI  752

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             +G  S D +ELSY+++ DHLKPC L
Sbjct  753  -DG--SMDILELSYRHIPDHLKPCFL  775



>ref|XP_009786116.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1235

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 2/86 (2%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP EL  +G EI+KKC GLPLV+ L+ G++   E+S+  W E   +LNS    
Sbjct  684  KVFGKESCPDELLHVGYEITKKCKGLPLVLHLIGGVIATKEKSKAFWCEVLNSLNSF--L  741

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             +       ++ SY +LSDHLKPCLL
Sbjct  742  LDDFEFMKILQFSYDHLSDHLKPCLL  767



>ref|XP_009610033.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=731

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +3

Query  9    LFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFR  188
            +F+   CP ELE IG EI+  C GLPL + L AGL+   E+    W+E  L L+S   F 
Sbjct  180  VFEEESCPDELEEIGNEIASSCLGLPLAIVLTAGLLARGEKEVGYWKEVTLNLSSNL-FH  238

Query  189  EGIRSNDAIELSYKYLSDHLKPCLL  263
            +     + IELSYKYL  HL+PC L
Sbjct  239  DAKWLMEVIELSYKYLLHHLRPCFL  263



>ref|XP_004240304.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=1320

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F    CP EL+ +G++I++KC GLPLV+ L+ G++   E+ E +W E    L+S   F
Sbjct  743  RVFGEEGCPDELKDVGEKIARKCDGLPLVLDLIGGVISRKEKKEALWLEVLNNLSSFI-F  801

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++       I+LSY +LSDH+KPCL+
Sbjct  802  KDEEEVAKVIQLSYDHLSDHVKPCLV  827



>ref|XP_009610032.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=734

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +3

Query  9    LFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFR  188
            +F+   CP ELE IG EI+  C GLPL + L AGL+   E+    W+E  L L+S   F 
Sbjct  180  VFEEESCPDELEEIGNEIASSCLGLPLAIVLTAGLLARGEKEVGYWKEVTLNLSSNL-FH  238

Query  189  EGIRSNDAIELSYKYLSDHLKPCLL  263
            +     + IELSYKYL  HL+PC L
Sbjct  239  DAKWLMEVIELSYKYLLHHLRPCFL  263



>ref|XP_009763119.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
isoform X1 [Nicotiana sylvestris]
Length=735

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +3

Query  9    LFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFR  188
            +F+   CP ELE IG EI+  C GLPL + L AGL+   E+    W+E  L L+S   F 
Sbjct  180  VFEEESCPDELEEIGNEIASSCLGLPLAIVLTAGLLARGEKEVGYWKEVTLNLSSNL-FH  238

Query  189  EGIRSNDAIELSYKYLSDHLKPCLL  263
            +     + IELSYKYL  HL+PC L
Sbjct  239  DAKWLMEVIELSYKYLLHHLRPCFL  263



>ref|XP_009763120.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
isoform X2 [Nicotiana sylvestris]
Length=732

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 50/85 (59%), Gaps = 1/85 (1%)
 Frame = +3

Query  9    LFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFR  188
            +F+   CP ELE IG EI+  C GLPL + L AGL+   E+    W+E  L L+S   F 
Sbjct  180  VFEEESCPDELEEIGNEIASSCLGLPLAIVLTAGLLARGEKEVGYWKEVTLNLSSNL-FH  238

Query  189  EGIRSNDAIELSYKYLSDHLKPCLL  263
            +     + IELSYKYL  HL+PC L
Sbjct  239  DAKWLMEVIELSYKYLLHHLRPCFL  263



>emb|CDP19728.1| unnamed protein product [Coffea canephora]
Length=1099

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            KLF   +CP EL   GK+I++ C GLPL V  +AGL+   +++  +W++   ++ S    
Sbjct  559  KLFDTKDCPNELMEAGKQIAESCKGLPLAVVAIAGLLERTDKTPDIWKQVSESICSRIAD  618

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
               +R  D +ELSY+YL  HLKPC L
Sbjct  619  DPEMRCMDILELSYRYLPTHLKPCFL  644



>ref|XP_009592957.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009592958.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009592959.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009592960.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009592961.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009592962.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009592963.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=1191

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+   CP EL   GKEI + C GLPLVV L+AG++   E+ + +W E    L+S   F
Sbjct  626  KVFENGSCPDELVDAGKEIVQNCKGLPLVVNLIAGVIAEKEKKKTVWLEVLNNLHSFI-F  684

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  +     I LSY +L DHLKPCL+
Sbjct  685  QNEVDVMKVIALSYDHLPDHLKPCLI  710



>gb|EYU24351.1| hypothetical protein MIMGU_mgv1a025953mg [Erythranthe guttata]
Length=567

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K F    CP ELE IGKEI KKC GLPL + ++ GL+G    S++ W+     LNS    
Sbjct  340  KAFGEAGCPLELEDIGKEIVKKCKGLPLSITVIGGLLGRSHMSQKYWKNIAKDLNSFLNS  399

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             E    +  + LSY YL  HLKPC L
Sbjct  400  GEDENCSSILSLSYTYLPAHLKPCFL  425



>ref|XP_004240204.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=1247

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F    CP EL  +GK I+KKCGGLPLV+ L+ G++   E+ E +W E   +L+S   F
Sbjct  692  RVFGEEGCPDELMDVGKRIAKKCGGLPLVLDLIGGVLSRKEKKETLWLEVLHSLSSSI-F  750

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++      AI+LSY +LSD +KPCL+
Sbjct  751  KDEEEVVKAIQLSYYHLSDDVKPCLV  776



>ref|XP_009800886.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1433

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP EL  +G+EI + C GLPLVV L+AG++ G E+ + +W E    L S   F
Sbjct  871  KVFGKERCPDELVDVGEEIVRNCKGLPLVVDLIAGVIAGKEKKKSVWLEVQNNLKSFI-F  929

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             + +     IELSY +L DHLKPCLL
Sbjct  930  NKKVEVRRIIELSYDHLPDHLKPCLL  955



>ref|XP_006365905.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=1266

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 52/83 (63%), Gaps = 2/83 (2%)
 Frame = +3

Query  18   GNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            GNE CP EL  +GKEI++ C GLPLV  L+AG++ G E+   +W E    L+S    +  
Sbjct  704  GNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEILNNLHSFI-LKNE  762

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
            +     IE+SY +L DHLKPCLL
Sbjct  763  VEVMKVIEISYDHLPDHLKPCLL  785



>ref|XP_009608041.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608042.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608043.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608044.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1582

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  6     KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
             K+F    CP EL  +G+EI + C GLPLVV L+AG++ G E+ + +W E    L S   F
Sbjct  1018  KVFGKESCPDELVDVGEEIVQNCKGLPLVVDLIAGVIAGKEKKKSVWHEVQNNLKSFI-F  1076

Query  186   REGIRSNDAIELSYKYLSDHLKPCLL  263
              + +     IELSY YL D+LKPCLL
Sbjct  1077  NKKVEVMRVIELSYDYLPDYLKPCLL  1102



>ref|XP_009608045.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1547

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  6     KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
             K+F    CP EL  +G+EI + C GLPLVV L+AG++ G E+ + +W E    L S   F
Sbjct  983   KVFGKESCPDELVDVGEEIVQNCKGLPLVVDLIAGVIAGKEKKKSVWHEVQNNLKSFI-F  1041

Query  186   REGIRSNDAIELSYKYLSDHLKPCLL  263
              + +     IELSY YL D+LKPCLL
Sbjct  1042  NKKVEVMRVIELSYDYLPDYLKPCLL  1067



>ref|XP_009624532.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
 ref|XP_009624533.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=1253

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F    CP EL  +GK I++KC GLPLV  L+A ++   E+ + +W E    LNS    
Sbjct  685  RIFGEESCPDELLGVGKGIARKCQGLPLVADLIARVIATKEKKKTLWLEVLNNLNSFI-L  743

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
               +     I+LSY +L DH+KPCLL
Sbjct  744  ENELEVMKIIQLSYDHLPDHVKPCLL  769



>gb|EYU21170.1| hypothetical protein MIMGU_mgv1a025737mg [Erythranthe guttata]
Length=817

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K F   +CP ELE IGKEI KKC GLPL + ++ GL+G    +++ W+     ++S    
Sbjct  328  KTFGEADCPLELEDIGKEIVKKCKGLPLSITVIGGLLGRSHMTQKYWKNIARDIHSILNS  387

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             E    +  + LSY YL  HLKPC L
Sbjct  388  GEDKNCSSILSLSYTYLPPHLKPCFL  413



>emb|CDP08040.1| unnamed protein product [Coffea canephora]
Length=576

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    VKLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
            +K+F   +CPKEL + GKEI+ +C GLPL +  VAGL+   E S   W++   +L+S   
Sbjct  62   MKVFNEEDCPKELAAAGKEIAWQCRGLPLAIVAVAGLLKMTEMSRNSWKKIANSLSSQVL  121

Query  183  FREGIRSNDAIELSYKYLSDHLKPCLL  263
                 +    +ELSY+YL ++LKPC L
Sbjct  122  NGPEAQCRSVVELSYQYLPEYLKPCFL  148



>gb|EYU17666.1| hypothetical protein MIMGU_mgv1a021453mg, partial [Erythranthe 
guttata]
Length=690

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   KGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            K   CP ELE IGKEI K+C GLPL + ++ GL+G    + + W++F     S    R G
Sbjct  344  KEGNCPLELEGIGKEIVKECKGLPLSIVVIGGLLGKSINTREYWEKFAKEKKSILNTRGG  403

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
              S D + LSY +L  HLKPC L
Sbjct  404  EESLDILSLSYNHLPAHLKPCFL  426



>ref|XP_009766122.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=469

 Score = 50.4 bits (119),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+G  CP  L+  G ++++ C GLPLV+ L+AG++G +E  E +W E    L+S A  
Sbjct  198  KVFQGESCPPNLQGPGLKVAQHCKGLPLVIVLIAGIIGKMERQESLWLEVANDLSSHAL-  256

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
              G +S + I+ SY +L DHLKPCLL
Sbjct  257  --GEQSMNVIQSSYDHLEDHLKPCLL  280



>gb|EYU29922.1| hypothetical protein MIMGU_mgv1a0259201mg, partial [Erythranthe 
guttata]
Length=778

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +3

Query  27   CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIRSN  206
            CP ELE IGK+I+ KC GLPL++ ++ G +     ++++W++    ++     RE  ++ 
Sbjct  220  CPLELEKIGKKIATKCKGLPLLIVVIGGFLRKSSRTQELWEDISNDISLIPNIREEEQNL  279

Query  207  DAIELSYKYLSDHLKPCLL  263
            D + LSYK+L  HLKPC L
Sbjct  280  DILSLSYKHLPVHLKPCFL  298



>gb|AAZ95005.1| late blight resistance protein Rpi-blb2 [Solanum bulbocastanum]
Length=1267

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 54/83 (65%), Gaps = 2/83 (2%)
 Frame = +3

Query  18   GNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            GNE CP EL  +GKEI++ C GLPLVV L+AG++ G E+ + +W E    L+S    +  
Sbjct  703  GNESCPDELLDVGKEIAENCKGLPLVVDLIAGIIAGREKKKSVWLEVVNNLHSFI-LKNE  761

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
            +     IE+SY +L DHLKPCLL
Sbjct  762  VEVMKVIEISYDHLPDHLKPCLL  784



>ref|XP_009766276.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +3

Query  6     KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
             KLF+  +CP EL  +GK I++KC GLPL V LVAGL+G +E  E  W +   +L+S    
Sbjct  1263  KLFQDQQCPPELVDVGKRIAEKCQGLPLSVVLVAGLLGKMETKEDGWLKVAASLSSTTVG  1322

Query  186   REGIRSNDAIELSYKYLSDHLKPCLL  263
                 R    IELSYK+L ++LKPC L
Sbjct  1323  DSSSRG--IIELSYKHLPEYLKPCFL  1346



>ref|XP_009766277.1| PREDICTED: uncharacterized protein LOC104217671 isoform X2 [Nicotiana 
sylvestris]
Length=1468

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +3

Query  6     KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
             KLF+  +CP EL  +GK I++KC GLPL V LVAGL+G +E  E  W +   +L+S    
Sbjct  1263  KLFQDQQCPPELVDVGKRIAEKCQGLPLSVVLVAGLLGKMETKEDGWLKVAASLSSTTVG  1322

Query  186   REGIRSNDAIELSYKYLSDHLKPCLL  263
                 R    IELSYK+L ++LKPC L
Sbjct  1323  DSSSRG--IIELSYKHLPEYLKPCFL  1346



>emb|CDP11160.1| unnamed protein product [Coffea canephora]
Length=1430

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 55/88 (63%), Gaps = 4/88 (5%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F G  CP+EL  +GKEI+KKC GLPL V  ++GL+  +E+S + W +   +L   AE 
Sbjct  870  KVFHGKGCPEELLLVGKEIAKKCKGLPLAVVAISGLLQRIEKSTESWGKIAKSL--IAEV  927

Query  186  REG--IRSNDAIELSYKYLSDHLKPCLL  263
             E    R  +  ELSYK+L  +LKPC L
Sbjct  928  MEDPKARCMEIFELSYKHLPGYLKPCFL  955



>ref|XP_006365906.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
[Solanum tuberosum]
Length=1007

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 53/83 (64%), Gaps = 2/83 (2%)
 Frame = +3

Query  18   GNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            GNE CP EL  +GKEI++ C GLPLVV L+AG++ G E  + +W E    L+S    +  
Sbjct  443  GNESCPDELLDVGKEIAENCKGLPLVVDLIAGVIAGRENKKSVWLEVVNNLHSFI-LKNE  501

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
            +     IE+SY +L DHLKPCLL
Sbjct  502  VEVMKVIEISYDHLPDHLKPCLL  524



>ref|XP_009788554.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009788555.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=1311

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F+   CP EL   GKEI + C GLPLVV L+AG++   E+ + +W E    L+S   F
Sbjct  748  RVFENGSCPDELLDAGKEIIQNCKGLPLVVNLIAGVIAEKEKKKTVWLEILNNLHSFI-F  806

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  +     I LSY +L DHLKPCL+
Sbjct  807  QNEVDVMKVIALSYDHLPDHLKPCLI  832



>emb|CDP11649.1| unnamed protein product [Coffea canephora]
Length=1527

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 0/87 (0%)
 Frame = +3

Query  3     VKLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
             +K+F    CP+EL  +GKEI++ C GLPL +  +AGL+ G       W++   +LNS   
Sbjct  935   MKVFSKVGCPEELLEVGKEIARNCKGLPLSIVAIAGLLQGEHMKPDSWKQIAESLNSIIV  994

Query  183   FREGIRSNDAIELSYKYLSDHLKPCLL  263
                  R  D +ELSYK+L D+LK C L
Sbjct  995   IDPQTRCMDILELSYKHLPDYLKACFL  1021



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+   CP ELE IG +I+KKC GLPL + +V+GL+   E++   W++    ++S    
Sbjct  326  KVFRKGSCPLELEDIGLQIAKKCYGLPLAIVVVSGLLLKKEKTRDWWKKVANDVSSYVA-  384

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            R+  +  D + LSYK+L DHLK C +
Sbjct  385  RDPKQCMDVLALSYKHLPDHLKVCFI  410



>gb|EYU21848.1| hypothetical protein MIMGU_mgv1a023991mg [Erythranthe guttata]
Length=905

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   KGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            K  +CP ELE IGK+I+K C GLPL + ++ GL+   + + + W+     LNS     E 
Sbjct  344  KKEDCPFELEEIGKKIAKNCKGLPLSIVVIGGLLAKSKPTREYWEYISENLNSIVHLEEN  403

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
             R    + LSY +L  HLKPC L
Sbjct  404  ERCLKVLHLSYNHLPVHLKPCFL  426



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+   CP EL+ +G+ ISK+C GLPL + +V+GL+   E++   W +   ++++    
Sbjct  326  KVFREGSCPPELQELGQRISKRCDGLPLAIVVVSGLLSKREKTRTWWNKVAESVSTYVA-  384

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            R+  +  D + LSYK+L DHLK C +
Sbjct  385  RDPTQCMDVLALSYKHLPDHLKVCFI  410



>ref|XP_009613244.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
Length=694

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+G  CP EL ++G  ++KKC G P+++ ++AG++   +E    W E    ++S A  
Sbjct  175  KVFQGESCPLELLNVGPLVAKKCNGFPILIIMIAGILSRKKEDPSFWLEVAYDISSHASV  234

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             + ++    I+ SY  L DHLKPCLL
Sbjct  235  EDSMK---MIQSSYDQLEDHLKPCLL  257



>ref|XP_009758239.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1255

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F    CP EL  +GKEI++KC GLPLV  L+A ++   E+ + +W E    LNS    
Sbjct  696  RIFGEESCPDELLRVGKEIARKCQGLPLVADLIARVIAAKEKKKTLWLEVLNNLNSFI-L  754

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
               +     I+LSY +L DH+K CLL
Sbjct  755  ENELEVMKIIQLSYDHLPDHVKSCLL  780



>ref|XP_009758240.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009758241.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1244

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F    CP EL  +GKEI++KC GLPLV  L+A ++   E+ + +W E    LNS    
Sbjct  685  RIFGEESCPDELLRVGKEIARKCQGLPLVADLIARVIAAKEKKKTLWLEVLNNLNSFI-L  743

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
               +     I+LSY +L DH+K CLL
Sbjct  744  ENELEVMKIIQLSYDHLPDHVKSCLL  769



>gb|EYU31597.1| hypothetical protein MIMGU_mgv1a001843mg [Erythranthe guttata]
Length=751

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +3

Query  15   KGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            K  +CP ELE IGK+I+K C GLPL + ++ GL+   + + + W+     LNS     E 
Sbjct  313  KQEDCPLELEEIGKKIAKNCKGLPLSIVVIGGLLAKSKPTREYWEYISENLNSILHLEEN  372

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
             R    + LSY +L  HLKPC L
Sbjct  373  ERCLKVLHLSYNHLPVHLKPCFL  395



>ref|XP_011088087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=853

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 53/87 (61%), Gaps = 2/87 (2%)
 Frame = +3

Query  6    KLFKGNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
            K+F   E CP ELE +GK+I+K C GLPL + ++ G++   + S+  W +    ++S   
Sbjct  321  KVFASEETCPPELEKVGKKIAKDCRGLPLAIHVIGGILSQAKTSQDFWDQVSDNVSSTVA  380

Query  183  FREGIRSNDAIELSYKYLSDHLKPCLL  263
              +G + ++ + LSY YL DHL+PC L
Sbjct  381  -DKGEQFSNILSLSYNYLPDHLRPCFL  406



>emb|CDP08023.1| unnamed protein product [Coffea canephora]
Length=1489

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 56/89 (63%), Gaps = 5/89 (6%)
 Frame = +3

Query  6     KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNS----  173
             K+FKG  CPKEL  +GKEI+++C GLPL +  VAG++    ++ + W++   TL+S    
Sbjct  923   KVFKGESCPKELLEVGKEIARRCQGLPLALVAVAGILKAPVKNPKSWKKLADTLSSEVID  982

Query  174   CAEFREGIRSNDAIELSYKYLSDHLKPCL  260
               E RE  R  + + +SY +L +HLK CL
Sbjct  983   NPEAREA-RCKEVLGVSYNHLPEHLKSCL  1010



>ref|XP_009768640.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1339

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F     P EL  +GK+I + C GLPLVV L+AG++ G E+ + +W E   +LNS   F
Sbjct  770  RVFGKESFPDELLDVGKKIVQNCKGLPLVVDLIAGVIAGKEKKKPVWLEVLNSLNSFI-F  828

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  +     IELSY +L DHLKPCL+
Sbjct  829  QNEVEVMKVIELSYDHLPDHLKPCLI  854



>ref|XP_009768636.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768638.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768639.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1355

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F     P EL  +GK+I + C GLPLVV L+AG++ G E+ + +W E   +LNS   F
Sbjct  786  RVFGKESFPDELLDVGKKIVQNCKGLPLVVDLIAGVIAGKEKKKPVWLEVLNSLNSFI-F  844

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  +     IELSY +L DHLKPCL+
Sbjct  845  QNEVEVMKVIELSYDHLPDHLKPCLI  870



>ref|XP_009800005.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
Length=731

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 54/86 (63%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+FKG  CP +L   G ++++ C GLPLV+ L+AG++  +E    +W +     N  + +
Sbjct  158  KVFKGESCPPDLREAGLQVAEHCKGLPLVIVLIAGIIAKMEREASLWLKL---ANDLSSY  214

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
              G +S  AI+ SY++L DHL+PCLL
Sbjct  215  VLGEQSMKAIQSSYEHLEDHLRPCLL  240



>ref|XP_009768641.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana sylvestris]
Length=1282

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F     P EL  +GK+I + C GLPLVV L+AG++ G E+ + +W E   +LNS   F
Sbjct  713  RVFGKESFPDELLDVGKKIVQNCKGLPLVVDLIAGVIAGKEKKKPVWLEVLNSLNSFI-F  771

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  +     IELSY +L DHLKPCL+
Sbjct  772  QNEVEVMKVIELSYDHLPDHLKPCLI  797



>ref|XP_009608038.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1338

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F     P EL  +GK I + C GLPLVV L+AG++ G E+ + +W E   +LNS   F
Sbjct  769  RVFGKESFPDELLDVGKRIVQNCKGLPLVVDLIAGVIAGKEKKKPVWLEVLNSLNSFI-F  827

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  +     IELSY +L DHLKPCL+
Sbjct  828  QNEVEVMKVIELSYDHLPDHLKPCLI  853



>ref|XP_009608035.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608036.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608037.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=1354

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F     P EL  +GK I + C GLPLVV L+AG++ G E+ + +W E   +LNS   F
Sbjct  785  RVFGKESFPDELLDVGKRIVQNCKGLPLVVDLIAGVIAGKEKKKPVWLEVLNSLNSFI-F  843

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  +     IELSY +L DHLKPCL+
Sbjct  844  QNEVEVMKVIELSYDHLPDHLKPCLI  869



>ref|XP_009608039.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=1307

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F     P EL  +GK I + C GLPLVV L+AG++ G E+ + +W E   +LNS   F
Sbjct  738  RVFGKESFPDELLDVGKRIVQNCKGLPLVVDLIAGVIAGKEKKKPVWLEVLNSLNSFI-F  796

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  +     IELSY +L DHLKPCL+
Sbjct  797  QNEVEVMKVIELSYDHLPDHLKPCLI  822



>ref|XP_009608040.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1208

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F     P EL  +GK I + C GLPLVV L+AG++ G E+ + +W E   +LNS   F
Sbjct  639  RVFGKESFPDELLDVGKRIVQNCKGLPLVVDLIAGVIAGKEKKKPVWLEVLNSLNSFI-F  697

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            +  +     IELSY +L DHLKPCL+
Sbjct  698  QNEVEVMKVIELSYDHLPDHLKPCLI  723



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 54/86 (63%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+   CP ELE IG +I+KKC GLPL + +V+GL+   E++   W++    ++S    
Sbjct  326  KVFRKGICPLELEDIGLQIAKKCYGLPLAIVVVSGLLLKKEKTRDWWKKIANDVSSYVA-  384

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            R+  +  D + LSYK+L DHLK C +
Sbjct  385  RDPKQCMDVLALSYKHLPDHLKVCFI  410



>gb|EYU23519.1| hypothetical protein MIMGU_mgv1a022028mg [Erythranthe guttata]
Length=872

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+   CP +LE IGKEI KKC GLPL + ++ GL+     +++ W+     L S   F
Sbjct  316  KVFRHALCPSKLEDIGKEIVKKCKGLPLSISVIGGLLRRSHMTQEYWKYIAKDLISILNF  375

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                     + LSY YL  HLKPC L
Sbjct  376  GNDENCLSILSLSYNYLPAHLKPCFL  401



>gb|EYU28481.1| hypothetical protein MIMGU_mgv1a018543mg [Erythranthe guttata]
Length=940

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K F    CP ELE IGKEI KKC GLPL + ++ GL+G    +++ W+     L S    
Sbjct  352  KTFGEAGCPLELEDIGKEIVKKCKGLPLSITVIGGLLGRSHMTQKYWKNIAKDLTSFLNS  411

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             E    ++ + LSY YL  HLKPC L
Sbjct  412  GEDENCSNILSLSYTYLPAHLKPCFL  437



>ref|XP_009761395.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=350

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F+G  CP +L   G +I++ C GLPLV+ L+AG++   E    +W EF    N  +  
Sbjct  192  RVFQGESCPLDLREAGLKIAEHCKGLPLVIVLIAGIIVKTEREASLWLEF---ANDLSSH  248

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
              G +S   I+ SY++L DHLKPCLL
Sbjct  249  VLGEQSMKVIQSSYEHLEDHLKPCLL  274



>emb|CDP17920.1| unnamed protein product [Coffea canephora]
Length=1489

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +3

Query  6     KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
             K+FK   CP EL  +G +I+ +C GLPL V  VAG++   E+S+  W+    TL+S    
Sbjct  929   KVFKEEGCPDELLGVGNDIAYRCQGLPLAVVAVAGILKMTEKSQNSWKRIADTLSSQIID  988

Query  186   REGIRSNDAIELSYKYLSDHLKPCLL  263
              EG    + I+LSYK+L ++LK C L
Sbjct  989   NEGAWCKEVIDLSYKHLPEYLKLCFL  1014



>emb|CDP16515.1| unnamed protein product [Coffea canephora]
Length=815

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            KLF   ECP EL  +GK+I++ C GLPL V  +AGL+   +     W++   ++ S    
Sbjct  313  KLFDTKECPSELMVVGKQIAESCKGLPLAVVAIAGLLEKTDMIADRWKQVSESICSQIAD  372

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                R  D +ELSY+YL ++LKPC L
Sbjct  373  DPETRCMDILELSYRYLPNYLKPCFL  398



>ref|XP_009618710.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X3 [Nicotiana tomentosiformis]
Length=1431

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F    CP EL+ +G++I++ C GLPLV+ L+ G++   E+ E  W E    LNS   F
Sbjct  851  RVFGEEHCPDELKEVGEKIARTCDGLPLVLDLICGVLARKEKKEASWLEVLNNLNSFI-F  909

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++       ++LSY +L DHLKPCL+
Sbjct  910  KDEEEVMKVVQLSYDHLPDHLKPCLI  935



>ref|XP_009618708.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009618709.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
Length=1444

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F    CP EL+ +G++I++ C GLPLV+ L+ G++   E+ E  W E    LNS   F
Sbjct  864  RVFGEEHCPDELKEVGEKIARTCDGLPLVLDLICGVLARKEKKEASWLEVLNNLNSFI-F  922

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++       ++LSY +L DHLKPCL+
Sbjct  923  KDEEEVMKVVQLSYDHLPDHLKPCLI  948



>ref|XP_009618706.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009618707.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=1464

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F    CP EL+ +G++I++ C GLPLV+ L+ G++   E+ E  W E    LNS   F
Sbjct  884  RVFGEEHCPDELKEVGEKIARTCDGLPLVLDLICGVLARKEKKEASWLEVLNNLNSFI-F  942

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++       ++LSY +L DHLKPCL+
Sbjct  943  KDEEEVMKVVQLSYDHLPDHLKPCLI  968



>gb|ABI96218.1| truncated NBS-LRR resistance protein-like protein [Solanum lycopersicum]
Length=996

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  18   GNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            GNE CP EL  +GKEI+K C GLPLV  L+AG++ G E+   +W E   +L+S       
Sbjct  688  GNESCPDELLDVGKEIAKNCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFI-LNSE  746

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
            +     IELSY +L  HLKPCLL
Sbjct  747  VEVMKVIELSYDHLPHHLKPCLL  769



>ref|XP_010315011.1| PREDICTED: LOW QUALITY PROTEIN: putative late blight resistance 
protein homolog R1B-14, partial [Solanum lycopersicum]
Length=1078

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  18   GNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            GNE CP EL  +GKEI+K C GLPLV  L+AG++ G E+   +W E   +L+S       
Sbjct  688  GNESCPDELLDVGKEIAKNCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFI-LNSE  746

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
            +     IELSY +L  HLKPCLL
Sbjct  747  VEVMKVIELSYDHLPHHLKPCLL  769



>ref|XP_011077106.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
 ref|XP_011077107.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=897

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            KLFK   CP ELE+IGK I++ C GLPL + ++AGL+  V +++  W++    +NS    
Sbjct  348  KLFKEEPCPSELENIGKMIARSCKGLPLAIIVIAGLLSTVSQTQTSWEDIAEKVNSAVT-  406

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
              G      + LSY +L  HL+PC L
Sbjct  407  ANGEEFAKILSLSYSHLPHHLRPCFL  432



>gb|EYU21839.1| hypothetical protein MIMGU_mgv1a022812mg [Erythranthe guttata]
Length=872

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +3

Query  24   ECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIRS  203
            +CP ELE IGK+I+K C GLPL + ++ GL+   + + + W+     LNS     +  R 
Sbjct  329  DCPHELEEIGKKIAKNCKGLPLSIVVIGGLLANSKHTTEHWEYISENLNSIVHLEDNERC  388

Query  204  NDAIELSYKYLSDHLKPCLL  263
               + LSY +L  HLKPC L
Sbjct  389  LKVLLLSYNHLPVHLKPCFL  408



>ref|XP_004242251.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Solanum lycopersicum]
Length=763

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+G  CP +L   G +++  C GLPL V L+AG++G  E    +W E    L+S A  
Sbjct  203  KIFRGESCPPDLVEAGLQVALHCKGLPLTVVLIAGILGKTEREASLWLEVAADLSSLAL-  261

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
              G +S   I+ SY +L DHLKPCLL
Sbjct  262  --GQQSMKVIQSSYDHLEDHLKPCLL  285



>gb|EYU21791.1| hypothetical protein MIMGU_mgv1a001064mg [Erythranthe guttata]
Length=898

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +3

Query  24   ECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIRS  203
            +CP ELE IGK+I+K C GLPL + ++ GL+  +  + + W+     LNS     +  R 
Sbjct  336  DCPVELEEIGKKIAKNCKGLPLSIVVIGGLLAKLNPTRENWEYISENLNSIVNVEDNERC  395

Query  204  NDAIELSYKYLSDHLKPCLL  263
               + LSY YL  HLKPC L
Sbjct  396  LKVLLLSYHYLPVHLKPCFL  415



>emb|CDP04879.1| unnamed protein product [Coffea canephora]
Length=252

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 46/86 (53%), Gaps = 2/86 (2%)
 Frame = +3

Query  3    VKLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
            +KLF G  CP+EL SI K I+  C  L L + L+AG +   ++ +  W++   T      
Sbjct  136  LKLFNGETCPRELSSISKRIACSCKRLRLAMVLIAGALNRTKKEKDSWEKVARTFIRSQS  195

Query  183  FREGIRSNDAIELSYKYLSDHLKPCL  260
             +E I   D +E SYK L DHL PC 
Sbjct  196  IQEQIW--DILEGSYKLLPDHLNPCF  219



>gb|EYU19036.1| hypothetical protein MIMGU_mgv1a021264mg, partial [Erythranthe 
guttata]
Length=768

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +3

Query  24   ECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIRS  203
            +CP ELE IG +I+KKC GLPL + ++ GL+     + Q W+     LNS     +  R 
Sbjct  258  DCPVELEEIGNKIAKKCKGLPLSIVVIGGLLAKSNPTRQNWEYISENLNSIVNMEDNERC  317

Query  204  NDAIELSYKYLSDHLKPCLL  263
               + LSY +L  HLKPC L
Sbjct  318  LKVLLLSYHHLPVHLKPCFL  337



>gb|EYU21830.1| hypothetical protein MIMGU_mgv1a001060mg [Erythranthe guttata]
Length=899

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +3

Query  24   ECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIRS  203
            +CP ELE IGK+I+K C GLPL + ++ GL+   + + + W+     LNS     +  R 
Sbjct  330  DCPHELEEIGKKIAKNCKGLPLSIVVIGGLLANSKHTTEHWKYISENLNSIVHLEDNERC  389

Query  204  NDAIELSYKYLSDHLKPCLL  263
               + LSY +L  HLKPC L
Sbjct  390  LKVLLLSYNHLPVHLKPCFL  409



>ref|XP_009622003.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
 ref|XP_009622004.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
 ref|XP_009622005.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=771

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F+G  CP +L   G +++K C GLPLV+ L+AG++   E    +W EF    N     
Sbjct  198  RVFQGESCPLDLREAGLKVAKHCKGLPLVIVLIAGIIVKTEREASLWLEF---ANDLRSH  254

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
              G +S   I+ SY++L DHLKPCLL
Sbjct  255  VLGEQSMKVIQSSYEHLEDHLKPCLL  280



>ref|XP_004242250.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=762

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+G  CP +L   G +++  C GLPL V L+AG++  ++    +W E     N  + F
Sbjct  200  KVFRGESCPPDLVEAGLQVALHCKGLPLAVVLIAGIIAKMKREASLWVE---VANDLSSF  256

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
              G +S   I+ SY +L DHLKPCLL
Sbjct  257  ALGEQSMKVIQSSYHHLDDHLKPCLL  282



>emb|CDP11161.1| unnamed protein product [Coffea canephora]
Length=871

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F+G  CP+EL   GKEI++KC GLPL V  ++GL+  +E++ + W++   +L +    
Sbjct  332  RVFQGEGCPEELLLAGKEIAQKCKGLPLAVVAISGLLRRIEKNRESWEKIAKSLIAKVME  391

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                R  + +ELSYK+L  +LKPC L
Sbjct  392  DPKARCMEILELSYKHLPGYLKPCFL  417



>gb|EYU31598.1| hypothetical protein MIMGU_mgv1a018432mg [Erythranthe guttata]
Length=852

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +3

Query  21   NECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIR  200
            ++CP ELE IGK+I+K C GLPL + ++ G +   E + + W+      N+     +  R
Sbjct  316  DDCPPELEEIGKKIAKNCEGLPLSIVVIGGHLAKSERTREHWEYISENTNTIVNSEDNER  375

Query  201  SNDAIELSYKYLSDHLKPCLL  263
               A++LSY  L  HLKPC L
Sbjct  376  CLKALQLSYNLLPVHLKPCFL  396



>ref|XP_010320896.1| PREDICTED: late blight resistance protein R1-A-like isoform X3 
[Solanum lycopersicum]
Length=945

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP  LE +G+ I+K+CGGLPL V LVAG++   E+    W++  + L S  + 
Sbjct  671  KVFNTKSCPLVLEDVGQRIAKRCGGLPLSVVLVAGILETTEKETNCWEQVAINLGSHIQ-  729

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                +S D I LSY+ L  HLKPC L
Sbjct  730  ---AKSEDIINLSYQALPFHLKPCFL  752



>ref|XP_010320895.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Solanum lycopersicum]
Length=1037

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP  LE +G+ I+K+CGGLPL V LVAG++   E+    W++  + L S  + 
Sbjct  671  KVFNTKSCPLVLEDVGQRIAKRCGGLPLSVVLVAGILETTEKETNCWEQVAINLGSHIQ-  729

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                +S D I LSY+ L  HLKPC L
Sbjct  730  ---AKSEDIINLSYQALPFHLKPCFL  752



>ref|XP_004239469.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Solanum lycopersicum]
Length=1200

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 4/86 (5%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F    CP  LE +G+ I+K+CGGLPL V LVAG++   E+    W++  + L S  + 
Sbjct  671  KVFNTKSCPLVLEDVGQRIAKRCGGLPLSVVLVAGILETTEKETNCWEQVAINLGSHIQ-  729

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                +S D I LSY+ L  HLKPC L
Sbjct  730  ---AKSEDIINLSYQALPFHLKPCFL  752



>emb|CDP01146.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = +3

Query  3    VKLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
            +KLF G+ CPKEL SI   I+  C GLPL + L+AG +   +  +  W+    TL     
Sbjct  79   MKLFNGDPCPKELSSISCRIASCCKGLPLALVLIAGTLKSTKRKKDSWKHVAKTLFRSLS  138

Query  183  FREGIRSNDAIELSYKYLSDHLKPCL  260
             +E I   + +E+SYK L DHLKPC 
Sbjct  139  IQEQIL--EILEVSYKRLPDHLKPCF  162



>emb|CDP11157.1| unnamed protein product [Coffea canephora]
Length=886

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 4/88 (5%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F G  CP+EL  +G+EI+KKC GLPL V  ++GL+  +E+S   W +    L   AE 
Sbjct  315  KVFHGEGCPEELLLVGREIAKKCEGLPLAVVAISGLLQKIEKSRASWGKIAKGL--IAEV  372

Query  186  REGIRSN--DAIELSYKYLSDHLKPCLL  263
             E  ++   +  ELSYK+L  +LKPC L
Sbjct  373  MEDPKAQCMEIFELSYKHLPGYLKPCFL  400



>ref|XP_006345448.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=888

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 14/94 (15%)
 Frame = +3

Query  3    VKLFKGNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCA  179
            +K+F  N+ CP ELE IGK+I+++CGGLPL + +VAG +  +    + W     T+NS  
Sbjct  319  IKVFGVNDLCPSELEDIGKQIAERCGGLPLAILVVAGHLSKISRRRESWIIVAKTVNS--  376

Query  180  EFREGIRSND------AIELSYKYLSDHLKPCLL  263
                 + +ND       + +SY YLS+HLKPC L
Sbjct  377  -----VVANDPDKCLGVLGMSYNYLSNHLKPCFL  405



>emb|CDP05439.1| unnamed protein product [Coffea canephora]
Length=514

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +3

Query  27   CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIRSN  206
            CP+ L  IGKEI++KC GLPL V + AG +     + + W+E   ++NS  +     R  
Sbjct  149  CPEALLEIGKEIARKCKGLPLSVVVAAGFLKAKNMTPKFWKEISDSINSLKDNDPQKRCM  208

Query  207  DAIELSYKYLSDHLKPCLL  263
            D +ELSY +L D+LK C L
Sbjct  209  DILELSYNHLPDYLKSCFL  227



>ref|XP_009613225.1| PREDICTED: late blight resistance protein R1-A-like [Nicotiana 
tomentosiformis]
Length=579

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 53/88 (60%), Gaps = 7/88 (8%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTL--NSCA  179
            K+F+G  CP EL+S+G EI+    GLPL V ++AG++  +E    +W E    L  +S  
Sbjct  197  KVFQGESCPPELQSVGAEIATLTKGLPLAVTVIAGILSQMERQASLWLEVAHKLCPSSLE  256

Query  180  EFREGIRSNDAIELSYKYLSDHLKPCLL  263
            +   G+     ++LSY +L DHLKPCLL
Sbjct  257  QQLMGV-----MQLSYDHLEDHLKPCLL  279



>gb|EYU29513.1| hypothetical protein MIMGU_mgv1a025475mg [Erythranthe guttata]
Length=873

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 50/79 (63%), Gaps = 2/79 (3%)
 Frame = +3

Query  27   CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIRSN  206
            CP+ELE IG +I+KKC GLPL++ ++ GL+     +++ W+     +NS  +  E  ++ 
Sbjct  297  CPRELEKIGMKIAKKCKGLPLLIVVIGGLLRKSSRTQEYWENISENMNSILDSEE--QNL  354

Query  207  DAIELSYKYLSDHLKPCLL  263
            D + LSY +L  HLKPC L
Sbjct  355  DILSLSYSHLPAHLKPCFL  373



>gb|EYU24354.1| hypothetical protein MIMGU_mgv1a019328mg [Erythranthe guttata]
Length=815

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K F    CP ELE +GKEI +KC GLPL + ++ GL+G    +++ W+     L S    
Sbjct  275  KTFGEAGCPLELEDVGKEIVQKCKGLPLSISVIGGLLGTSHMTQKYWKTISKDLTSFLNS  334

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            RE       + LSY YL  HLKPC L
Sbjct  335  REDENCLSILSLSYTYLPAHLKPCFL  360



>emb|CDP10293.1| unnamed protein product [Coffea canephora]
Length=669

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 53/90 (59%), Gaps = 9/90 (10%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F   +CP+ L  IG EI+KKC GLP  V +VAG++  +E    +W+EF  +L S    
Sbjct  154  KVFGKEDCPQGLRGIGMEIAKKCRGLPFAVVVVAGILATIEHDILVWEEFAESLTSTT--  211

Query  186  REGIRSND----AIELSYKYLSDHLKPCLL  263
               +   D    ++ELSY++L  HLK CLL
Sbjct  212  ---VSGTDQWKKSLELSYEHLPYHLKACLL  238



>gb|EYU21828.1| hypothetical protein MIMGU_mgv1a019841mg [Erythranthe guttata]
Length=784

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +3

Query  21   NECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIR  200
            ++CP ELE IGK+I+K C GLPL + ++ G +   + + + W+      N+     +  R
Sbjct  358  DDCPPELEEIGKKIAKNCEGLPLSIVVIGGHLAKSKRTREHWEYISENTNTIVNLEDNER  417

Query  201  SNDAIELSYKYLSDHLKPCLL  263
                ++LSY +L  HLKPC L
Sbjct  418  CLKVLQLSYNHLPVHLKPCFL  438



>gb|KHN13835.1| Disease resistance protein RPP13 [Glycine soja]
Length=874

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+G ECP +LE +G+ I K CGGLPL + ++AGLV   E+S++ W           E 
Sbjct  328  KIFRGEECPSDLEPLGRSIVKTCGGLPLAIVVLAGLVAKKEKSQREWSRIKDVSWHLTED  387

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            + G+   D ++LSY  L   LKPC L
Sbjct  388  KTGVM--DILKLSYNNLPGRLKPCFL  411



>gb|EYU19026.1| hypothetical protein MIMGU_mgv1a020094mg [Erythranthe guttata]
Length=770

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +3

Query  21   NECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIR  200
            ++CP ELE IGK+I+K C GLPL + ++ G +   + + + W+      N+     +  R
Sbjct  327  DDCPPELEEIGKKIAKNCEGLPLSIVVIGGHLAKSKRTREHWEYISENTNTIVNLEDNER  386

Query  201  SNDAIELSYKYLSDHLKPCLL  263
                ++LSY +L  HLKPC L
Sbjct  387  CLKVLQLSYNHLPVHLKPCFL  407



>ref|XP_010320777.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
 ref|XP_010320778.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
 ref|XP_010320779.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
 ref|XP_004238958.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=591

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+G  CP EL ++G  ++KKC GLP ++ ++AG++   ++   +W +  +  + C+  
Sbjct  78   KVFQGENCPLELSNVGPLVAKKCRGLPSLIIMIAGILSSKKKEADLWLK--VAYDICSHA  135

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             E   S   I+ SY +L++HLKPCL+
Sbjct  136  FETKMSLKTIQSSYDHLANHLKPCLI  161



>gb|EYU21178.1| hypothetical protein MIMGU_mgv1a019709mg [Erythranthe guttata]
Length=889

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K F    CP ELE IGKEI KKC GLPL + ++ GL+G    +++ W+     L S    
Sbjct  345  KAFDQVGCPSELEDIGKEIIKKCKGLPLSICVIGGLLGRSNRTQKYWKNIAKDLTSILNS  404

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             E       + LSY YL  HLKPC L
Sbjct  405  GEDENCLSILSLSYTYLPAHLKPCFL  430



>ref|XP_006603606.1| PREDICTED: disease resistance protein RPP13-like [Glycine max]
Length=858

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+G ECP +LE +G+ I K CGGLPL + ++AGLV   E+S++ W           E 
Sbjct  328  KIFRGEECPSDLEPLGRSIVKTCGGLPLAIVVLAGLVAKKEKSQREWSRIKEVSWHLTED  387

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            + G+   D ++LSY  L   LKPC L
Sbjct  388  KTGVM--DILKLSYNNLPGRLKPCFL  411



>gb|EYU33970.1| hypothetical protein MIMGU_mgv1a018989mg [Erythranthe guttata]
Length=895

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +3

Query  9    LFKGNECPK-ELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            +F   +CP  ELE IGKEI+K C GLPL + ++ GL+   E + + W+     ++S    
Sbjct  320  VFGEQDCPNLELEEIGKEIAKSCKGLPLSIVVIGGLLAKSERTREYWEYVLENISSIVNL  379

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             +  R    + +SY +LS HLKPC L
Sbjct  380  EDNERCLRILNMSYDHLSVHLKPCFL  405



>emb|CDP15122.1| unnamed protein product [Coffea canephora]
Length=1299

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    VKLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
            VKLFK   CP+EL  IG++I+  C GLP+ V L+AGL+G  +  ++ W++    LN+   
Sbjct  721  VKLFKQESCPQELFGIGQQIAANCKGLPIAVDLIAGLLGTKDRKKESWKQIANGLNAHLL  780

Query  183  FREGIRSNDAIELSYKYLSDHLKPCLL  263
              +  +    +ELSY  L +HLKPC L
Sbjct  781  EDQNGQCMGMLELSYDNLPNHLKPCFL  807



>gb|EYU23534.1| hypothetical protein MIMGU_mgv1a023257mg, partial [Erythranthe 
guttata]
Length=913

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K F   +CP +L  IGKEI +KC GLPL + ++ GL+G    +++ W+     L S    
Sbjct  343  KAFGHADCPSKLVDIGKEIVQKCKGLPLAICVIGGLLGRSHMTQKYWKNISKDLISILNS  402

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            RE    +  + LSY YL  HLKPC L
Sbjct  403  REDGNCSSILSLSYTYLPAHLKPCFL  428



>emb|CDP11642.1| unnamed protein product [Coffea canephora]
Length=1450

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    VKLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
            +K+F    CP+EL  +GKEI++ C GLPL +  +AGL+   +     W++     N+   
Sbjct  890  MKIFPKEICPEELLQVGKEIARSCKGLPLSLVAIAGLLQKTDMKSDSWKKIAERSNAIIV  949

Query  183  FREGIRSNDAIELSYKYLSDHLKPCLL  263
                 R  D +ELSY++L D+LKPC L
Sbjct  950  NDPQTRCMDILELSYEHLPDYLKPCFL  976



>emb|CDP08020.1| unnamed protein product [Coffea canephora]
Length=1459

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+FK   CP EL+ +GKEI+  C GLPL V  VAG++    +S+  W+    TL+S    
Sbjct  898  KVFKEECCPSELQGVGKEIAYHCQGLPLAVVAVAGILKTTGKSQSSWKRITDTLSSHIID  957

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                R  + I+LSYK+L ++LK C L
Sbjct  958  NPEARCKEVIDLSYKHLPEYLKSCFL  983



>emb|CDP18919.1| unnamed protein product [Coffea canephora]
Length=494

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = +3

Query  3    VKLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
            +KLF G  CP EL SI K I+  C GLPL V L+AG +   ++ +  W++   T      
Sbjct  137  LKLFNGETCPGELSSISKRIACSCKGLPLAVVLIAGALNRTKKEKDSWEKVAKTFIRSQS  196

Query  183  FREGIRSNDAIELSYKYLSDHLKPCL  260
             +E  R  D +E SYK L DHLKPC 
Sbjct  197  IQE--RIWDILEESYKLLPDHLKPCF  220



>ref|XP_006366837.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=618

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +3

Query  27   CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIRSN  206
            CP ELE IGK++++KC GLPL + +VAG +  +E +++ W++   +++      E  +  
Sbjct  324  CPPELEDIGKQVAQKCQGLPLALLVVAGHLSKIERTQESWKDVAKSVSKVVA-NESDKCL  382

Query  207  DAIELSYKYLSDHLKPCLL  263
              + +SY YL +HLKPC L
Sbjct  383  GVLAMSYHYLPNHLKPCFL  401



>ref|XP_004231117.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=880

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 56/94 (60%), Gaps = 14/94 (15%)
 Frame = +3

Query  3    VKLFKGNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCA  179
            +K+F  N+ CP ELE IGK+I+++CGGLPL + +VAG +  +    + W     T+NS  
Sbjct  315  IKVFGVNDLCPFELEDIGKQIAERCGGLPLAILVVAGHLSKISMRRESWITVAKTVNS--  372

Query  180  EFREGIRSND------AIELSYKYLSDHLKPCLL  263
                 + +ND       + +SY YLS+HLKPC L
Sbjct  373  -----VVANDPDKCLGVLGMSYNYLSNHLKPCFL  401



>ref|NP_001234622.1| plant resistance protein [Solanum lycopersicum]
 gb|AAC67237.1| plant resistance protein [Solanum lycopersicum]
Length=1255

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  18   GNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            GNE CP EL  +GKEI++ C GLPLV  L+AG++ G E+   +W E   +L+S       
Sbjct  692  GNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFI-LNSE  750

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
            +     IELSY +L  HLKPCLL
Sbjct  751  VEVMKVIELSYDHLPHHLKPCLL  773



>ref|XP_006362543.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006362544.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006362545.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X3 [Solanum tuberosum]
Length=698

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = +3

Query  15   KGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            +GN CP EL ++G+ ++KKC GLP ++ ++A ++    E+   W +    ++S    +E 
Sbjct  193  RGNSCPLELVNVGQLVAKKCKGLPSLIIMIAEILSEEREASS-WLKVAYDISSHVSDKEM  251

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
            I     I+ SY YL DHLKPCLL
Sbjct  252  IMK--TIQSSYDYLPDHLKPCLL  272



>gb|AAC32253.1| disease resistance gene homolog Mi-copy1 [Solanum lycopersicum]
Length=1204

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  18   GNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            GNE CP EL  +GKEI++ C GLPLV  L+AG++ G E+   +W E   +L+S       
Sbjct  641  GNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFI-LNSE  699

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
            +     IELSY +L  HLKPCLL
Sbjct  700  VEVMKVIELSYDHLPHHLKPCLL  722



>gb|AAC32252.1| disease resistance gene homolog Mi-copy2 [Solanum lycopersicum]
Length=1206

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  18   GNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            GNE CP EL  +GKEI++ C GLPLV  L+AG++ G E+   +W E   +L+S       
Sbjct  642  GNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFI-LNSE  700

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
            +     IELSY +L  HLKPCLL
Sbjct  701  VEVMKVIELSYDHLPHHLKPCLL  723



>gb|AAC97933.1| disease resistance protein [Solanum lycopersicum]
Length=1257

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  18   GNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            GNE CP EL  +GKEI++ C GLPLV  L+AG++ G E+   +W E   +L+S       
Sbjct  693  GNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFI-LNSE  751

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
            +     IELSY +L  HLKPCLL
Sbjct  752  VEVMKVIELSYDHLPHHLKPCLL  774



>ref|NP_001234063.1| root-knot nematode resistance protein [Solanum lycopersicum]
 gb|AAC67238.1| root-knot nematode resistance protein [Solanum lycopersicum]
Length=1257

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  18   GNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            GNE CP EL  +GKEI++ C GLPLV  L+AG++ G E+   +W E   +L+S       
Sbjct  693  GNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFI-LNSE  751

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
            +     IELSY +L  HLKPCLL
Sbjct  752  VEVMKVIELSYDHLPHHLKPCLL  774



>ref|XP_006356519.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=762

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 51/86 (59%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+G  CP++L   G +++  C GLPLVV L+AG++  ++    +W E     N  +  
Sbjct  200  KVFRGESCPRDLLEAGLQVALHCKGLPLVVVLIAGMIAKMDRESSLWLE---VANDLSSI  256

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
              G +S   I+ SY +L DHLKPCLL
Sbjct  257  GLGEQSMKVIQSSYDHLEDHLKPCLL  282



>gb|EYU24432.1| hypothetical protein MIMGU_mgv1a023729mg [Erythranthe guttata]
Length=860

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +3

Query  27   CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGI-RS  203
            CP ELE IGK+I KKC GLPL++ ++  L+    ++ + W+     +NS  +  + + +S
Sbjct  311  CPPELEEIGKKIVKKCKGLPLLIVVIGALLRKSSKTREYWENISENMNSILDSSKNMEQS  370

Query  204  NDAIELSYKYLSDHLKPCLL  263
             D + LSY  L  HLKPC L
Sbjct  371  VDILSLSYSNLPAHLKPCFL  390



>ref|XP_004243045.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
[Solanum lycopersicum]
Length=473

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +3

Query  27   CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIRSN  206
            CP ELE IGK++++KC GLPL + +VAG +  +E +++ W++   +++      E  +  
Sbjct  18   CPPELEDIGKQVAQKCQGLPLALLVVAGHLSKIERTQESWKDVDKSVSKVVA-NESDKCL  76

Query  207  DAIELSYKYLSDHLKPCLL  263
              + +SY YL +HLKPC L
Sbjct  77   GVLAMSYNYLPNHLKPCFL  95



>gb|ABE68835.1| root-knot nematode resistance protein [Capsicum annuum]
Length=1257

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = +3

Query  18   GNE-CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREG  194
            GNE CP EL  +GKEI++ C GLPLV  L+AG++ G E+   +W E   +L+S       
Sbjct  693  GNESCPDELLDVGKEIAENCKGLPLVADLIAGVIAGREKKRSVWLEVQSSLSSFI-LNSE  751

Query  195  IRSNDAIELSYKYLSDHLKPCLL  263
            +     IELSY +L  HLKPCLL
Sbjct  752  VEVMRVIELSYDHLPHHLKPCLL  774



>ref|XP_009611209.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=751

 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +3

Query  27   CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIRSN  206
            CP ELE IG EI+  C GLPL + L++GL+   E+ E  W+E  L L S   F +     
Sbjct  187  CPDELEVIGNEIATSCSGLPLAIVLISGLLTRREKEEDYWKEIALNL-STNLFHDVKWLM  245

Query  207  DAIELSYKYLSDHLKPCLL  263
            + IELSY  L  HL+PC L
Sbjct  246  EVIELSYNDLPHHLRPCFL  264



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            KLF    CP ELE IGK I++KC GLPL + +VAG +  + ++   W     +++S    
Sbjct  388  KLFGKRGCPFELEVIGKSIAEKCQGLPLAIVVVAGHLSKMSKTPDSWNTVAESVDSVVN-  446

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            RE  +  D + LSY YL  HLK C L
Sbjct  447  REPGQCLDILALSYNYLPQHLKACFL  472



>gb|EYU23522.1| hypothetical protein MIMGU_mgv1a018893mg, partial [Erythranthe 
guttata]
Length=805

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K F    CP ELE IGKEI KKC GLPL + ++ GL+G   ++++ W+     L S    
Sbjct  182  KTFGEAGCPSELEDIGKEIVKKCKGLPLAISVIGGLLGSSNKTQKYWKNISKNLISILNS  241

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
             +       + LSY YL  HLKPC L
Sbjct  242  GKDENCLSILSLSYNYLPAHLKPCFL  267



>ref|XP_009768632.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009768633.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009768634.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009768635.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1325

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            ++F     P EL  +GKEI + C GLPLVV L+AG++   E+   +W +    L+S   F
Sbjct  764  RVFGKESFPDELLDVGKEIVQNCKGLPLVVDLIAGVIARKEKKRSVWLDVLNNLHSFI-F  822

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++ +     I LSY++L DHLKPCLL
Sbjct  823  KKEVEVMKVIGLSYEHLPDHLKPCLL  848



>ref|XP_009587569.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1268

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 2/86 (2%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            KLF+  +CP EL  + K I++KC GLPL V LVAGL+G +E  E  W +   +L++    
Sbjct  905  KLFQDQQCPPELVDVSKRIAEKCQGLPLSVVLVAGLLGNMETKEDGWLQVAESLSTTTVG  964

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                R    IELSYK+L ++LKPC L
Sbjct  965  DSSSRG--IIELSYKHLPEYLKPCFL  988



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            KLF    CP ELE IGK I++KC GLPL + +VAG +  + ++   W     +++S    
Sbjct  403  KLFGKRGCPFELEVIGKSIAEKCQGLPLAIVVVAGHLSKMSKTPDSWNTVAESVDSVVN-  461

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            RE  +  D + LSY YL  HLK C L
Sbjct  462  REPGQCLDILALSYNYLPQHLKACFL  487



>ref|XP_009587570.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1088

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 53/86 (62%), Gaps = 2/86 (2%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            KLF+  +CP EL  + K I++KC GLPL V LVAGL+G +E  E  W +   +L++    
Sbjct  905  KLFQDQQCPPELVDVSKRIAEKCQGLPLSVVLVAGLLGNMETKEDGWLQVAESLSTTTVG  964

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                R    IELSYK+L ++LKPC L
Sbjct  965  DSSSRG--IIELSYKHLPEYLKPCFL  988



>gb|EYU21847.1| hypothetical protein MIMGU_mgv1a017843mg, partial [Erythranthe 
guttata]
Length=857

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +3

Query  24   ECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFREGIRS  203
            +CP EL  IGK+I+K C GLPL + ++ G +   E +++ W+      N+     +  R 
Sbjct  329  DCPPELVEIGKKIAKNCEGLPLSIVVIGGHLAKSERTKEHWEYISENTNTIVNSEDNERC  388

Query  204  NDAIELSYKYLSDHLKPCLL  263
              A++LSY +L  HLKPC L
Sbjct  389  LKALQLSYNHLPVHLKPCFL  408



>ref|XP_006596445.1| PREDICTED: disease resistance protein RPP13-like isoform X1 [Glycine 
max]
Length=866

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+G ECP +LE +G+ I K CGGLPL + ++AGLV   E+S++ W           E 
Sbjct  315  KIFRGEECPSDLEPLGRSIVKICGGLPLAIVVLAGLVAKKEKSQREWSRIKEVSWHLTED  374

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            + G+   D ++LSY  L   LKPC L
Sbjct  375  KTGVM--DILKLSYNNLPGRLKPCFL  398



>emb|CDP21430.1| unnamed protein product [Coffea canephora]
Length=735

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F   ECP+ L  +G EI KKC GL   V +VAG++  ++    +W++F  +L S    
Sbjct  186  KVFGEEECPQALHELGMEIVKKCWGLAFAVVVVAGILATIKHDILLWEKFAESLTSTM-V  244

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
                +   ++ELSY++L DHLK CLL
Sbjct  245  SGADQWKKSLELSYEHLPDHLKDCLL  270



>ref|XP_006356561.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=767

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 3/86 (3%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+G  CP +L   G ++++ C GLPLVV LVAG +  ++    +W E    L+S A  
Sbjct  200  KVFQGESCPPDLLEAGLQVAQHCKGLPLVVVLVAGFIAKMKRETSLWLEVANNLSSLAL-  258

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
              G +S   I+ SY +L DHLKPCLL
Sbjct  259  --GEQSMKVIQSSYDHLEDHLKPCLL  282



>ref|XP_006596446.1| PREDICTED: disease resistance protein RPP13-like isoform X2 [Glycine 
max]
Length=670

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 51/86 (59%), Gaps = 2/86 (2%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+F+G ECP +LE +G+ I K CGGLPL + ++AGLV   E+S++ W           E 
Sbjct  326  KIFRGEECPSDLEPLGRSIVKICGGLPLAIVVLAGLVAKKEKSQREWSRIKEVSWHLTED  385

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            + G+   D ++LSY  L   LKPC L
Sbjct  386  KTGVM--DILKLSYNNLPGRLKPCFL  409



>emb|CDP07957.1| unnamed protein product [Coffea canephora]
Length=1275

 Score = 47.0 bits (110),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 49/87 (56%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    VKLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAE  182
            +KLF    CP EL  +G++I+ +C GL L   L+AGL+  +   ++ W +   +LN+   
Sbjct  724  IKLFGKESCPPELVKVGQKIAAECKGLTLAADLIAGLLRTMASKKECWAQVANSLNTHLL  783

Query  183  FREGIRSNDAIELSYKYLSDHLKPCLL  263
              +  R    +ELSY  L DHLKPC L
Sbjct  784  EDQDGRCMQILELSYNQLPDHLKPCFL  810



>gb|EYU31457.1| hypothetical protein MIMGU_mgv1a017859mg, partial [Erythranthe 
guttata]
Length=810

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +3

Query  6    KLFKGNECPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEF  185
            K+FK    P EL+ IGKEI+K CGGLPL + ++AG++     ++ +W++F   + S    
Sbjct  293  KVFKEEYYPLELKIIGKEIAKSCGGLPLAIVVIAGVLFKGGNNQSLWKKFARNVKSVVAT  352

Query  186  REGIRSNDAIELSYKYLSDHLKPCLL  263
            ++G R    + LSY  L  HL+PC L
Sbjct  353  KDG-RFEAILTLSYNNLPHHLRPCFL  377



>ref|XP_009600340.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=402

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 1/80 (1%)
 Frame = +3

Query  27   CPKELESIGKEISKKCgglplvvglvaglvggvEESEQMWQEFFLTLNSCAEFR-EGIRS  203
            CP+ELE IGKEI+K C GLP+ + L+  L+  +++    W +    L++ A+   E    
Sbjct  192  CPQELEEIGKEIAKNCAGLPIAIILIGSLLARLDKKRGYWTKVAKRLSASAKVAGEAEWY  251

Query  204  NDAIELSYKYLSDHLKPCLL  263
             D IE +YK+L  HLKPC L
Sbjct  252  IDIIESNYKHLPHHLKPCFL  271



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521539397520