BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25472_g2_i3 len=938 path=[7009:0-24 6942:25-34 8408:35-115
602:116-121 608:122-143 8961:144-164 8982:165-172 8990:173-244
6321:245-294 9156:295-310 4914:311-388 875:389-421 9226:422-454
941:455-461 948:462-489 976:490-526 1013:527-546 1033:547-549
1036:550-551 1038:552-561 1048:562-590 5120:591-641 9369:642-679
2030:680-688 2039:689-712 2063:713-744 2095:745-847 2198:848-874
8271:875-926 3117:927-937]

Length=938
                                                                      Score     E

gb|ABS29403.1|  NBS-LRR type disease resistance protein                 229   4e-71   Ipomoea batatas [batate]
gb|ABH10959.1|  putative NBS-LRR disease resistance protein RIT-2       181   3e-52   Ipomoea trifida
gb|ACE79429.1|  NBS-coding resistance gene analog                       168   3e-46   Nicotiana tabacum [American tobacco]
gb|ACE79448.1|  NBS-coding resistance gene analog                       168   5e-46   Nicotiana tabacum [American tobacco]
gb|ACF22012.1|  NBS-coding resistance gene protein                      166   3e-45   Nicotiana tabacum [American tobacco]
gb|ACE79413.1|  NBS-coding resistance gene analog                       164   2e-44   Nicotiana tabacum [American tobacco]
gb|ACE79438.1|  NBS-coding resistance gene analog                       160   3e-43   Nicotiana tabacum [American tobacco]
gb|ACE79449.1|  NBS-coding resistance gene analog                       160   3e-43   Nicotiana tabacum [American tobacco]
ref|XP_011073066.1|  PREDICTED: putative late blight resistance p...    167   4e-43   
gb|ACE79412.1|  NBS-coding resistance gene analog                       160   5e-43   Nicotiana tabacum [American tobacco]
gb|ACE79442.1|  NBS-coding resistance gene analog                       160   5e-43   Nicotiana tabacum [American tobacco]
gb|ACE79425.1|  NBS-coding resistance gene analog                       160   5e-43   Nicotiana tabacum [American tobacco]
gb|ACE79492.1|  NBS-coding resistance gene analog                       159   5e-43   Nicotiana tabacum [American tobacco]
gb|ACE79491.1|  NBS-coding resistance gene analog                       159   6e-43   Nicotiana tabacum [American tobacco]
gb|ACE79495.1|  NBS-coding resistance gene analog                       159   7e-43   Nicotiana sylvestris
gb|ACE79493.1|  NBS-coding resistance gene analog                       159   7e-43   Nicotiana tabacum [American tobacco]
gb|ACE79489.1|  NBS-coding resistance gene analog                       159   7e-43   Nicotiana tabacum [American tobacco]
gb|ACE79487.1|  NBS-coding resistance gene analog                       159   7e-43   Nicotiana tabacum [American tobacco]
gb|ACE79488.1|  NBS-coding resistance gene analog                       159   7e-43   Nicotiana tabacum [American tobacco]
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...    167   1e-42   
gb|ACE79490.1|  NBS-coding resistance gene analog                       159   1e-42   Nicotiana tabacum [American tobacco]
gb|ACF22014.1|  NBS-coding resistance gene protein                      158   2e-42   Nicotiana tabacum [American tobacco]
gb|ACF22011.1|  NBS-coding resistance gene protein                      158   2e-42   Nicotiana tabacum [American tobacco]
gb|ACE79422.1|  NBS-coding resistance gene analog                       158   3e-42   Nicotiana tabacum [American tobacco]
gb|ACE79451.1|  NBS-coding resistance gene analog                       157   3e-42   Nicotiana tabacum [American tobacco]
gb|ACE79434.1|  NBS-coding resistance gene analog                       157   4e-42   Nicotiana tabacum [American tobacco]
emb|CDP16515.1|  unnamed protein product                                164   6e-42   
gb|ACE79441.1|  NBS-coding resistance gene analog                       156   9e-42   Nicotiana tabacum [American tobacco]
gb|ABV90190.1|  NBS-LRR type disease resistance protein                 154   1e-41   Ipomoea batatas [batate]
gb|ACF22008.1|  NBS-coding resistance gene protein                      156   2e-41   Nicotiana tabacum [American tobacco]
gb|ACE79424.1|  NBS-coding resistance gene analog                       156   2e-41   Nicotiana tabacum [American tobacco]
ref|XP_006352021.1|  PREDICTED: putative late blight resistance p...    163   3e-41   
ref|XP_009796570.1|  PREDICTED: putative late blight resistance p...    160   3e-41   
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...    161   1e-40   
ref|XP_009789038.1|  PREDICTED: putative late blight resistance p...    161   1e-40   
emb|CDP20153.1|  unnamed protein product                                162   1e-40   
gb|AEW48197.1|  disease resistance protein RGH3                         161   2e-40   
emb|CDP19728.1|  unnamed protein product                                161   3e-40   
ref|XP_006367920.1|  PREDICTED: putative late blight resistance p...    156   6e-40   
ref|XP_006367916.1|  PREDICTED: putative late blight resistance p...    156   8e-40   
emb|CDP04885.1|  unnamed protein product                                159   1e-39   
ref|XP_009786668.1|  PREDICTED: putative late blight resistance p...    159   1e-39   
ref|XP_006367915.1|  PREDICTED: putative disease resistance RPP13...    154   1e-39   
ref|XP_009803726.1|  PREDICTED: putative late blight resistance p...    158   2e-39   
ref|XP_006350053.1|  PREDICTED: putative late blight resistance p...    158   2e-39   
gb|AEW48198.1|  disease resistance protein RGH4                         158   2e-39   
gb|ACE79419.1|  NBS-coding resistance gene analog                       150   3e-39   Nicotiana tabacum [American tobacco]
gb|AEW48210.1|  disease resistance protein RGH5                         157   3e-39   
ref|XP_009606269.1|  PREDICTED: putative late blight resistance p...    150   4e-39   
ref|XP_009606267.1|  PREDICTED: putative late blight resistance p...    157   4e-39   
gb|AFB17982.1|  Rx-like protein                                         150   7e-39   
gb|ACE79452.1|  NBS-coding resistance gene analog                       149   7e-39   Nicotiana tabacum [American tobacco]
emb|CDP00688.1|  unnamed protein product                                154   7e-39   
ref|XP_009793286.1|  PREDICTED: putative late blight resistance p...    153   9e-39   
dbj|BAD18094.1|  NBS-LRR protein                                        148   9e-39   Ipomoea batatas [batate]
gb|ACE79443.1|  NBS-coding resistance gene analog                       149   1e-38   Nicotiana tabacum [American tobacco]
gb|AFB17983.1|  Rx-like protein                                         150   1e-38   
gb|ACE79436.1|  NBS-coding resistance gene analog                       148   2e-38   Nicotiana tabacum [American tobacco]
gb|AAF09256.1|AF202179_1  disease resistance protein BS2                155   2e-38   Capsicum chacoense
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...    155   2e-38   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...    155   2e-38   
gb|AEW48217.1|  disease resistance protein RX5                          155   2e-38   
emb|CDP00690.1|  unnamed protein product                                152   2e-38   
gb|ACE79431.1|  NBS-coding resistance gene analog                       147   3e-38   Nicotiana tabacum [American tobacco]
gb|AGX27504.1|  NBS-LRR class resistance protein Fy8-Ry8                150   3e-38   
gb|AEW48194.1|  disease resistance protein RGH5                         155   3e-38   
gb|AEW48191.1|  disease resistance protein RGH2                         155   3e-38   
gb|ABY61745.1|  resistance protein PSH-RGH6                             154   3e-38   Solanum tuberosum [potatoes]
ref|XP_009624115.1|  PREDICTED: putative late blight resistance p...    154   6e-38   
gb|AEW48216.1|  disease resistance protein RX3                          154   6e-38   
gb|ACE79440.1|  NBS-coding resistance gene analog                       146   6e-38   Nicotiana tabacum [American tobacco]
gb|ACF21990.1|  NBS-coding resistance gene protein                      146   7e-38   Nicotiana tabacum [American tobacco]
gb|AEW48205.1|  disease resistance protein RGH2                         153   8e-38   
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...    154   8e-38   
ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...    153   9e-38   
gb|ACF21988.1|  NBS-coding resistance gene protein                      146   1e-37   Nicotiana tabacum [American tobacco]
gb|AFB17979.1|  Rx-like protein                                         148   1e-37   
ref|XP_009780398.1|  PREDICTED: putative late blight resistance p...    143   1e-37   
gb|AFB17980.1|  Rx-like protein                                         148   1e-37   
gb|EYU21437.1|  hypothetical protein MIMGU_mgv1a020693mg                153   1e-37   
gb|AEW48195.1|  disease resistance protein RGH6                         153   1e-37   
gb|ACF21987.1|  NBS-coding resistance gene protein                      145   1e-37   Nicotiana tabacum [American tobacco]
gb|AEW48214.1|  disease resistance protein RGH4                         152   1e-37   
ref|XP_009803728.1|  PREDICTED: putative late blight resistance p...    153   1e-37   
gb|AEW48193.1|  disease resistance protein RGH4                         153   2e-37   
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...    152   2e-37   
ref|XP_010312513.1|  PREDICTED: putative late blight resistance p...    152   2e-37   
gb|AEW48202.1|  disease resistance protein RGH4                         152   2e-37   
ref|XP_009780928.1|  PREDICTED: putative late blight resistance p...    152   2e-37   
emb|CDP16512.1|  unnamed protein product                                152   2e-37   
gb|AEW48186.1|  disease resistance protein RGH2                         152   3e-37   
gb|ACE79507.1|  NBS-coding resistance gene analog                       145   3e-37   Nicotiana sylvestris
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...    150   4e-37   
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...    151   4e-37   
ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...    151   4e-37   
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...    151   5e-37   
gb|AEW48189.1|  disease resistance protein RGH9                         151   5e-37   
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...    150   5e-37   
gb|AEQ61798.1|  NBS-LRR class disease resistance protein                141   6e-37   
gb|ACE79511.1|  NBS-coding resistance gene analog                       143   7e-37   Nicotiana tabacum [American tobacco]
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...    150   8e-37   
ref|XP_011093987.1|  PREDICTED: putative late blight resistance p...    150   8e-37   
ref|XP_009606292.1|  PREDICTED: putative late blight resistance p...    151   8e-37   
ref|XP_009773240.1|  PREDICTED: putative late blight resistance p...    149   9e-37   
ref|XP_009606290.1|  PREDICTED: putative late blight resistance p...    150   9e-37   
ref|XP_009765788.1|  PREDICTED: putative late blight resistance p...    145   9e-37   
ref|XP_009606291.1|  PREDICTED: putative late blight resistance p...    150   9e-37   
ref|XP_009606289.1|  PREDICTED: putative late blight resistance p...    150   9e-37   
gb|ACE79510.1|  NBS-coding resistance gene analog                       142   1e-36   Nicotiana tabacum [American tobacco]
gb|ACE79513.1|  NBS-coding resistance gene analog                       143   1e-36   Nicotiana tabacum [American tobacco]
gb|ACE79512.1|  NBS-coding resistance gene analog                       142   1e-36   Nicotiana tabacum [American tobacco]
ref|XP_009602415.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
ref|XP_009606281.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
gb|AEW48192.1|  disease resistance protein RGH3                         150   1e-36   
gb|ACE79509.1|  NBS-coding resistance gene analog                       142   1e-36   Nicotiana tabacum [American tobacco]
ref|XP_009606288.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
ref|XP_009606280.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
ref|XP_009602419.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
gb|ACE79508.1|  NBS-coding resistance gene analog                       142   1e-36   Nicotiana tabacum [American tobacco]
gb|AEW48187.1|  disease resistance protein RGH5                         150   1e-36   
ref|XP_009606282.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
ref|XP_009606272.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...    149   1e-36   
ref|XP_009606279.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
gb|AEW48188.1|  disease resistance protein RGH7                         150   1e-36   
ref|XP_009602420.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
gb|AEW48211.1|  disease resistance protein RGH1                         149   1e-36   
ref|XP_009606273.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
ref|XP_009606277.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
ref|XP_009606278.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
ref|XP_009606276.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
ref|XP_009606270.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
ref|XP_009606271.1|  PREDICTED: putative late blight resistance p...    150   1e-36   
ref|XP_009762970.1|  PREDICTED: putative late blight resistance p...    151   1e-36   
ref|XP_009604795.1|  PREDICTED: putative late blight resistance p...    149   2e-36   
ref|XP_006345283.1|  PREDICTED: uncharacterized protein LOC102590501    151   2e-36   
gb|AEW48204.1|  disease resistance protein RGH1                         149   2e-36   
gb|ACE79400.1|  NBS-coding resistance gene analog                       142   2e-36   Nicotiana tabacum [American tobacco]
ref|XP_009604792.1|  PREDICTED: putative late blight resistance p...    149   2e-36   
gb|AEW48201.1|  disease resistance protein RGH9                         149   2e-36   
gb|AFB17978.1|  Rx-like protein                                         144   2e-36   
ref|XP_009757156.1|  PREDICTED: putative late blight resistance p...    149   3e-36   
gb|AGW23829.1|  NBS-LRR class resistance protein Fy8-Ry8                148   3e-36   
ref|XP_009595164.1|  PREDICTED: putative late blight resistance p...    149   3e-36   
ref|XP_011093989.1|  PREDICTED: putative late blight resistance p...    147   3e-36   
emb|CAB50786.1|  Rx protein                                             149   4e-36   Solanum tuberosum [potatoes]
ref|XP_009759015.1|  PREDICTED: putative late blight resistance p...    148   5e-36   
ref|XP_009759016.1|  PREDICTED: putative late blight resistance p...    148   5e-36   
ref|XP_009604649.1|  PREDICTED: putative late blight resistance p...    147   5e-36   
ref|XP_011083930.1|  PREDICTED: putative late blight resistance p...    147   6e-36   
ref|XP_009773239.1|  PREDICTED: putative late blight resistance p...    148   8e-36   
ref|XP_011083960.1|  PREDICTED: putative late blight resistance p...    147   8e-36   
ref|XP_009595789.1|  PREDICTED: putative late blight resistance p...    149   9e-36   
gb|ABY61746.1|  resistance protein PSH-RGH7                             147   9e-36   Solanum tuberosum [potatoes]
ref|XP_010312507.1|  PREDICTED: putative late blight resistance p...    147   1e-35   
gb|AGW28125.1|  NBS-LRR class resistance protein Fy8-Ry8                146   1e-35   
ref|XP_009625970.1|  PREDICTED: putative late blight resistance p...    137   1e-35   
gb|AEW48215.1|  disease resistance protein RGH7                         147   1e-35   
ref|XP_011072560.1|  PREDICTED: putative late blight resistance p...    147   1e-35   
gb|AFB17976.1|  Rx-like protein                                         142   1e-35   
gb|AAF04603.1|AF195939_1  disease resistance protein Gpa2               147   1e-35   Solanum tuberosum [potatoes]
emb|CDP11160.1|  unnamed protein product                                148   1e-35   
gb|AEW48212.1|  disease resistance protein RGH1                         147   1e-35   
ref|XP_009793283.1|  PREDICTED: putative late blight resistance p...    147   1e-35   
ref|XP_009793285.1|  PREDICTED: putative late blight resistance p...    147   1e-35   
ref|XP_006367243.1|  PREDICTED: putative late blight resistance p...    148   1e-35   
gb|AEW48218.1|  disease resistance protein RX6                          147   2e-35   
ref|XP_011083958.1|  PREDICTED: putative late blight resistance p...    147   2e-35   
emb|CDP00736.1|  unnamed protein product                                146   2e-35   
ref|XP_011090484.1|  PREDICTED: putative late blight resistance p...    146   2e-35   
gb|AEW48209.1|  disease resistance protein RGH5                         146   2e-35   
ref|XP_009777040.1|  PREDICTED: putative late blight resistance p...    146   2e-35   
gb|AEW48208.1|  disease resistance protein RGH4                         146   2e-35   
gb|AEW48207.1|  disease resistance protein RGH5                         146   2e-35   
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...    147   2e-35   
gb|AEW48196.1|  disease resistance protein RGH7                         146   2e-35   
ref|XP_009761982.1|  PREDICTED: putative late blight resistance p...    145   2e-35   
ref|XP_009761980.1|  PREDICTED: putative late blight resistance p...    145   3e-35   
ref|XP_009765786.1|  PREDICTED: putative late blight resistance p...    145   3e-35   
ref|XP_009794810.1|  PREDICTED: putative late blight resistance p...    141   3e-35   
gb|EYU24542.1|  hypothetical protein MIMGU_mgv1a020452mg                145   4e-35   
ref|XP_009787580.1|  PREDICTED: putative late blight resistance p...    144   4e-35   
ref|XP_011071973.1|  PREDICTED: putative late blight resistance p...    145   4e-35   
ref|XP_009787579.1|  PREDICTED: putative late blight resistance p...    144   4e-35   
emb|CDP15268.1|  unnamed protein product                                146   4e-35   
ref|XP_011091063.1|  PREDICTED: putative late blight resistance p...    144   5e-35   
ref|XP_009766920.1|  PREDICTED: putative late blight resistance p...    145   5e-35   
gb|AEW48190.1|  disease resistance protein RX4                          145   5e-35   
gb|EYU30149.1|  hypothetical protein MIMGU_mgv1a018270mg                144   5e-35   
gb|AEW48206.1|  disease resistance protein RGH4                         145   6e-35   
gb|ACO25629.1|  NBS-coding resistance protein                           135   6e-35   Nicotiana repanda
ref|XP_009608888.1|  PREDICTED: putative late blight resistance p...    142   6e-35   
ref|XP_009626592.1|  PREDICTED: putative late blight resistance p...    145   7e-35   
ref|XP_009626593.1|  PREDICTED: putative late blight resistance p...    145   7e-35   
gb|AEW48199.1|  disease resistance protein RGH6                         145   8e-35   
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...    144   8e-35   
ref|XP_009604667.1|  PREDICTED: putative late blight resistance p...    144   9e-35   
ref|XP_009773958.1|  PREDICTED: putative late blight resistance p...    144   9e-35   
gb|AAF76163.1|AF266747_1  RGC1                                          145   9e-35   Solanum tuberosum [potatoes]
ref|XP_009602298.1|  PREDICTED: putative late blight resistance p...    144   9e-35   
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...    145   9e-35   
gb|AAM47597.1|AF513548_1  NBS/LRR resistance protein-like protein       135   1e-34   Capsicum annuum
ref|XP_011072647.1|  PREDICTED: putative late blight resistance p...    142   1e-34   
emb|CAB56299.1|  NBS-LRR protein                                        144   1e-34   Solanum acaule
ref|XP_009765789.1|  PREDICTED: putative late blight resistance p...    143   1e-34   
gb|EYU21828.1|  hypothetical protein MIMGU_mgv1a019841mg                144   1e-34   
ref|XP_006345448.1|  PREDICTED: putative late blight resistance p...    144   1e-34   
ref|XP_004251396.2|  PREDICTED: putative late blight resistance p...    144   1e-34   
ref|XP_006366309.1|  PREDICTED: putative late blight resistance p...    142   1e-34   
gb|AET22504.1|  hypothetical protein                                    144   1e-34   
emb|CDP00737.1|  unnamed protein product                                144   2e-34   
ref|XP_011077106.1|  PREDICTED: putative late blight resistance p...    144   2e-34   
emb|CDP05558.1|  unnamed protein product                                144   2e-34   
ref|XP_006345616.1|  PREDICTED: putative late blight resistance p...    141   2e-34   
ref|XP_004231117.1|  PREDICTED: putative late blight resistance p...    144   2e-34   
ref|XP_009589053.1|  PREDICTED: putative late blight resistance p...    142   2e-34   
emb|CDP05557.1|  unnamed protein product                                140   2e-34   
gb|AGX27499.1|  NBS-LRR class resistance protein Fy1-Ry1                140   2e-34   
gb|AEQ61807.1|  NBS-LRR class disease resistance protein                134   2e-34   
gb|AGX27506.1|  NBS-LRR class resistance protein Fy12-Ry1               141   2e-34   
ref|XP_009600432.1|  PREDICTED: putative late blight resistance p...    142   2e-34   
ref|XP_009774731.1|  PREDICTED: putative late blight resistance p...    143   2e-34   
ref|XP_004252073.2|  PREDICTED: putative late blight resistance p...    143   2e-34   
ref|XP_009772626.1|  PREDICTED: putative late blight resistance p...    143   3e-34   
ref|XP_009761073.1|  PREDICTED: putative late blight resistance p...    142   3e-34   
ref|XP_009615718.1|  PREDICTED: putative late blight resistance p...    140   3e-34   
ref|XP_009765695.1|  PREDICTED: putative late blight resistance p...    143   3e-34   
ref|XP_009603168.1|  PREDICTED: putative late blight resistance p...    144   3e-34   
ref|XP_009765696.1|  PREDICTED: putative late blight resistance p...    143   3e-34   
gb|EYU29927.1|  hypothetical protein MIMGU_mgv1a021755mg                143   3e-34   
ref|XP_006350137.1|  PREDICTED: putative late blight resistance p...    143   4e-34   
ref|XP_006366837.1|  PREDICTED: putative late blight resistance p...    141   4e-34   
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...    142   4e-34   
gb|AEW48200.1|  disease resistance protein RGH7                         143   4e-34   
ref|XP_011072135.1|  PREDICTED: putative late blight resistance p...    140   4e-34   
ref|XP_009777085.1|  PREDICTED: putative late blight resistance p...    140   4e-34   
gb|AGW28126.1|  NBS-LRR class resistance protein Fy12-Ry12              140   5e-34   
ref|XP_006362840.1|  PREDICTED: putative late blight resistance p...    142   5e-34   
ref|XP_006364178.1|  PREDICTED: putative late blight resistance p...    142   5e-34   
gb|ACE79506.1|  NBS-coding resistance gene analog                       136   5e-34   Nicotiana tabacum [American tobacco]
gb|ACE79501.1|  NBS-coding resistance gene analog                       136   5e-34   Nicotiana tabacum [American tobacco]
gb|ACE79502.1|  NBS-coding resistance gene analog                       136   6e-34   Nicotiana tabacum [American tobacco]
gb|ACE79503.1|  NBS-coding resistance gene analog                       136   6e-34   Nicotiana tabacum [American tobacco]
gb|AEQ61804.1|  NBS-LRR class disease resistance protein                133   6e-34   
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...    142   6e-34   
gb|ACO25633.1|  NBS-coding resistance protein                           133   7e-34   Nicotiana repanda
ref|XP_011087330.1|  PREDICTED: putative late blight resistance p...    142   7e-34   
gb|AGX27505.1|  NBS-LRR class resistance protein Fy12-Ry1               140   7e-34   
gb|ACO25632.1|  NBS-coding resistance protein                           132   7e-34   Nicotiana repanda
emb|CDP12800.1|  unnamed protein product                                142   7e-34   
gb|ACE79505.1|  NBS-coding resistance gene analog                       136   7e-34   Nicotiana tabacum [American tobacco]
ref|XP_009768089.1|  PREDICTED: putative late blight resistance p...    142   8e-34   
ref|XP_009766122.1|  PREDICTED: putative late blight resistance p...    139   8e-34   
gb|ACE79504.1|  NBS-coding resistance gene analog                       135   8e-34   Nicotiana tabacum [American tobacco]
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...    142   8e-34   
ref|XP_009600123.1|  PREDICTED: putative late blight resistance p...    142   9e-34   
ref|XP_010323848.1|  PREDICTED: putative late blight resistance p...    140   9e-34   
gb|AEQ61805.1|  NBS-LRR class disease resistance protein                132   1e-33   
gb|EYU21751.1|  hypothetical protein MIMGU_mgv1a001232mg                141   1e-33   
ref|XP_006365680.1|  PREDICTED: putative late blight resistance p...    141   1e-33   
ref|XP_006362537.1|  PREDICTED: putative late blight resistance p...    140   1e-33   
ref|XP_009603187.1|  PREDICTED: putative late blight resistance p...    140   1e-33   
ref|XP_010320708.1|  PREDICTED: putative late blight resistance p...    141   1e-33   
ref|XP_006356519.1|  PREDICTED: putative late blight resistance p...    140   1e-33   
emb|CDP10323.1|  unnamed protein product                                140   1e-33   
emb|CDP21300.1|  unnamed protein product                                142   2e-33   
ref|XP_009763931.1|  PREDICTED: putative late blight resistance p...    141   2e-33   
ref|XP_004238957.1|  PREDICTED: putative late blight resistance p...    140   2e-33   
ref|XP_009602301.1|  PREDICTED: putative late blight resistance p...    141   2e-33   
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...    141   2e-33   
gb|AGX27496.1|  NBS-LRR class resistance protein Fy1-Ry1                140   2e-33   
ref|XP_009763930.1|  PREDICTED: putative late blight resistance p...    141   2e-33   
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...    140   2e-33   
gb|AGW28124.1|  NBS-LRR class resistance protein Fy1-Ry1                140   2e-33   
ref|XP_009763644.1|  PREDICTED: putative late blight resistance p...    136   2e-33   
gb|AGX27494.1|  NBS-LRR class resistance protein Fy1-Ry1                140   2e-33   
gb|AGX27492.1|  NBS-LRR class resistance protein Fy1-Ry1                140   2e-33   
gb|AGX27495.1|  NBS-LRR class resistance protein Fy1-Ry1                140   2e-33   
ref|XP_006350138.1|  PREDICTED: putative late blight resistance p...    140   2e-33   
emb|CDP17263.1|  unnamed protein product                                141   2e-33   
ref|XP_009786702.1|  PREDICTED: putative late blight resistance p...    140   2e-33   
gb|AGX27493.1|  NBS-LRR class resistance protein Fy1-Ry1                139   2e-33   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...    140   2e-33   
emb|CDP04858.1|  unnamed protein product                                140   2e-33   
ref|XP_009786264.1|  PREDICTED: putative late blight resistance p...    140   2e-33   
gb|ACU82907.1|  nucleotide binding site-leucine rich repeat protein     131   2e-33   
ref|XP_011087335.1|  PREDICTED: putative late blight resistance p...    140   2e-33   
ref|XP_011087334.1|  PREDICTED: putative late blight resistance p...    140   2e-33   
ref|XP_004251533.1|  PREDICTED: putative late blight resistance p...    140   2e-33   
ref|XP_009786258.1|  PREDICTED: putative late blight resistance p...    140   3e-33   
ref|XP_011087329.1|  PREDICTED: putative late blight resistance p...    140   3e-33   
ref|XP_004243493.1|  PREDICTED: putative late blight resistance p...    140   3e-33   
gb|EYU23607.1|  hypothetical protein MIMGU_mgv1a019784mg                140   3e-33   
emb|CDP11642.1|  unnamed protein product                                141   4e-33   
ref|XP_004250409.1|  PREDICTED: putative late blight resistance p...    140   4e-33   
ref|XP_006365682.1|  PREDICTED: putative late blight resistance p...    139   4e-33   
emb|CDP11649.1|  unnamed protein product                                140   4e-33   
ref|XP_006423591.1|  hypothetical protein CICLE_v10027800mg             139   6e-33   
gb|EYU39515.1|  hypothetical protein MIMGU_mgv1a023519mg                139   6e-33   
ref|XP_009799380.1|  PREDICTED: putative late blight resistance p...    137   6e-33   
gb|EYU24432.1|  hypothetical protein MIMGU_mgv1a023729mg                139   7e-33   
ref|XP_006365692.1|  PREDICTED: putative late blight resistance p...    137   7e-33   
ref|XP_006356564.1|  PREDICTED: putative late blight resistance p...    138   8e-33   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...    139   8e-33   
gb|EYU24183.1|  hypothetical protein MIMGU_mgv1a021378mg                139   8e-33   
ref|XP_010907229.1|  PREDICTED: LOW QUALITY PROTEIN: probable dis...    139   8e-33   
ref|XP_009608247.1|  PREDICTED: putative late blight resistance p...    136   8e-33   
ref|XP_009597655.1|  PREDICTED: putative late blight resistance p...    139   8e-33   
ref|XP_004248174.1|  PREDICTED: putative late blight resistance p...    139   8e-33   
ref|XP_011077104.1|  PREDICTED: putative late blight resistance p...    139   9e-33   
ref|XP_011077138.1|  PREDICTED: putative late blight resistance p...    139   9e-33   
ref|XP_009597654.1|  PREDICTED: putative late blight resistance p...    139   9e-33   
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...    139   9e-33   
emb|CDP12799.1|  unnamed protein product                                139   9e-33   
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...    139   1e-32   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...    139   1e-32   
ref|XP_004238960.1|  PREDICTED: putative late blight resistance p...    137   1e-32   
ref|XP_006356561.1|  PREDICTED: putative late blight resistance p...    138   1e-32   
ref|XP_004250464.1|  PREDICTED: putative late blight resistance p...    138   1e-32   
ref|XP_009764018.1|  PREDICTED: putative late blight resistance p...    138   1e-32   
ref|XP_006345285.1|  PREDICTED: putative late blight resistance p...    138   1e-32   
ref|XP_009789218.1|  PREDICTED: putative late blight resistance p...    138   1e-32   
ref|XP_010320780.1|  PREDICTED: putative late blight resistance p...    137   1e-32   
gb|KDO44197.1|  hypothetical protein CISIN_1g047642mg                   137   1e-32   
gb|AEQ61803.1|  NBS-LRR class disease resistance protein                129   2e-32   
emb|CDP15598.1|  unnamed protein product                                138   2e-32   
ref|XP_009791923.1|  PREDICTED: putative late blight resistance p...    137   2e-32   
emb|CDP12774.1|  unnamed protein product                                139   2e-32   
ref|XP_009763120.1|  PREDICTED: putative late blight resistance p...    137   2e-32   
ref|XP_009774730.1|  PREDICTED: putative late blight resistance p...    137   2e-32   
emb|CDP21622.1|  unnamed protein product                                138   2e-32   
gb|EPS64025.1|  hypothetical protein M569_10756                         131   2e-32   
emb|CDP11823.1|  unnamed protein product                                135   2e-32   
ref|XP_009779880.1|  PREDICTED: putative late blight resistance p...    138   2e-32   
ref|XP_011072128.1|  PREDICTED: putative late blight resistance p...    138   2e-32   
gb|AEQ61799.1|  NBS-LRR class disease resistance protein                129   2e-32   
ref|XP_009800005.1|  PREDICTED: putative late blight resistance p...    137   2e-32   
ref|XP_009763119.1|  PREDICTED: putative late blight resistance p...    137   2e-32   
ref|XP_009596957.1|  PREDICTED: putative late blight resistance p...    137   2e-32   
ref|XP_010669410.1|  PREDICTED: putative disease resistance prote...    134   2e-32   
gb|EYU23518.1|  hypothetical protein MIMGU_mgv1a019595mg                138   2e-32   
gb|ABO93136.1|  NBS-LRR type disease resistance protein                 129   2e-32   
gb|ABR37220.1|  NBS-LRR type disease resistance protein                 129   2e-32   
gb|EYU24354.1|  hypothetical protein MIMGU_mgv1a019328mg                137   2e-32   
emb|CDP10349.1|  unnamed protein product                                137   2e-32   
ref|XP_009790395.1|  PREDICTED: putative late blight resistance p...    139   3e-32   
ref|XP_006487403.1|  PREDICTED: disease resistance protein RPP13-...    137   3e-32   
gb|EYU28481.1|  hypothetical protein MIMGU_mgv1a018543mg                137   3e-32   
gb|EYU31460.1|  hypothetical protein MIMGU_mgv1a020657mg                137   3e-32   
ref|XP_009790398.1|  PREDICTED: putative late blight resistance p...    138   3e-32   
gb|ACF22074.1|  NBS-coding resistance gene protein                      131   3e-32   
gb|ADH03608.1|  nucleotide binding site and leucine rich repeat p...    128   3e-32   
ref|XP_011075016.1|  PREDICTED: putative late blight resistance p...    137   3e-32   
ref|XP_011087309.1|  PREDICTED: putative disease resistance prote...    135   3e-32   
gb|ACF22068.1|  NBS-coding resistance gene protein                      131   3e-32   
ref|XP_011071867.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...    137   3e-32   
ref|XP_011070688.1|  PREDICTED: putative late blight resistance p...    135   4e-32   
gb|ACF22072.1|  NBS-coding resistance gene protein                      131   4e-32   
emb|CDP17919.1|  unnamed protein product                                137   4e-32   
emb|CDP05538.1|  unnamed protein product                                137   4e-32   
gb|ACF22071.1|  NBS-coding resistance gene protein                      131   4e-32   
gb|ABR37218.1|  NBS-LRR type disease resistance protein                 128   4e-32   
ref|XP_006365693.1|  PREDICTED: putative late blight resistance p...    137   5e-32   
gb|ACF22063.1|  NBS-coding resistance gene protein                      131   5e-32   
gb|AEQ61806.1|  NBS-LRR class disease resistance protein                128   5e-32   
emb|CDP19132.1|  unnamed protein product                                137   5e-32   
emb|CDP19794.1|  unnamed protein product                                137   5e-32   
gb|ABV90191.1|  NBS-LRR type disease resistance protein                 128   6e-32   
ref|XP_009794857.1|  PREDICTED: disease resistance protein RPP13-...    134   6e-32   
emb|CDP05441.1|  unnamed protein product                                136   6e-32   
gb|EYU29928.1|  hypothetical protein MIMGU_mgv1a001694mg                136   6e-32   
ref|XP_011088084.1|  PREDICTED: putative late blight resistance p...    134   6e-32   
gb|EYU31287.1|  hypothetical protein MIMGU_mgv1a022746mg                134   6e-32   
emb|CDP10265.1|  unnamed protein product                                135   6e-32   
emb|CDP19424.1|  unnamed protein product                                131   6e-32   
ref|XP_009622842.1|  PREDICTED: putative late blight resistance p...    136   7e-32   
ref|XP_006344326.1|  PREDICTED: putative late blight resistance p...    137   7e-32   
ref|XP_010327575.1|  PREDICTED: putative late blight resistance p...    136   7e-32   
emb|CDP11163.1|  unnamed protein product                                137   7e-32   
ref|XP_009588135.1|  PREDICTED: putative late blight resistance p...    137   7e-32   
ref|XP_009587753.1|  PREDICTED: putative late blight resistance p...    137   8e-32   
gb|ADA59477.1|  NBS-coding resistance protein-like protein RGA5         127   8e-32   
gb|ADL59397.1|  EDNR2GH7 protein                                        136   8e-32   
ref|XP_009758685.1|  PREDICTED: late blight resistance protein R1...    137   8e-32   
gb|ADL59395.1|  EDNR2GH5 protein                                        136   8e-32   
gb|AAZ07904.1|  NBS-LRR protein                                         127   9e-32   
gb|EYU17666.1|  hypothetical protein MIMGU_mgv1a021453mg                135   9e-32   
gb|EYU25697.1|  hypothetical protein MIMGU_mgv1a026211mg                133   1e-31   
gb|EYU25639.1|  hypothetical protein MIMGU_mgv1a022176mg                132   1e-31   
ref|XP_010661463.1|  PREDICTED: probable disease resistance RPP8-...    135   1e-31   
gb|ACF22064.1|  NBS-coding resistance gene protein                      129   1e-31   
ref|XP_004242250.1|  PREDICTED: putative late blight resistance p...    135   1e-31   
ref|XP_009610032.1|  PREDICTED: putative late blight resistance p...    135   1e-31   
ref|XP_010319327.1|  PREDICTED: disease resistance protein RPP13-...    132   1e-31   
ref|XP_009775077.1|  PREDICTED: putative late blight resistance p...    134   1e-31   
ref|XP_009631206.1|  PREDICTED: putative late blight resistance p...    135   1e-31   
ref|XP_009613904.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...    135   1e-31   
gb|ACE79427.1|  NBS-coding resistance gene analog                       130   2e-31   
gb|EYU31572.1|  hypothetical protein MIMGU_mgv1a024734mg                135   2e-31   
gb|EYU24185.1|  hypothetical protein MIMGU_mgv1a024774mg                135   2e-31   
ref|XP_009610033.1|  PREDICTED: putative late blight resistance p...    134   2e-31   
emb|CDP15579.1|  unnamed protein product                                136   2e-31   
ref|XP_002273976.1|  PREDICTED: disease resistance protein RPP13        135   2e-31   
ref|XP_009628577.1|  PREDICTED: putative late blight resistance p...    135   2e-31   
emb|CDP10671.1|  unnamed protein product                                134   2e-31   
ref|XP_009628574.1|  PREDICTED: putative late blight resistance p...    135   2e-31   
gb|AAU95282.1|  R1                                                      130   2e-31   
ref|XP_009623262.1|  PREDICTED: putative late blight resistance p...    135   2e-31   
emb|CDP11974.1|  unnamed protein product                                135   2e-31   
emb|CDP00691.1|  unnamed protein product                                134   2e-31   
gb|ACF22033.1|  NBS-coding resistance gene protein                      129   2e-31   
ref|XP_009761395.1|  PREDICTED: putative late blight resistance p...    130   2e-31   
ref|XP_004242251.1|  PREDICTED: putative late blight resistance p...    134   2e-31   
ref|XP_006356447.1|  PREDICTED: uncharacterized protein LOC102594363    135   2e-31   
ref|XP_011087308.1|  PREDICTED: putative late blight resistance p...    134   2e-31   
gb|ABO77136.1|  NBS-LRR type resistance protein-like proteins           126   2e-31   
gb|ACF22066.1|  NBS-coding resistance gene protein                      129   2e-31   
gb|ACF22031.1|  NBS-coding resistance gene protein                      129   3e-31   
ref|XP_006356563.1|  PREDICTED: putative late blight resistance p...    135   3e-31   
gb|EYU21177.1|  hypothetical protein MIMGU_mgv1a018978mg                134   3e-31   
gb|ACE79423.1|  NBS-coding resistance gene analog                       129   3e-31   
emb|CDP21692.1|  unnamed protein product                                134   3e-31   
ref|XP_009757967.1|  PREDICTED: putative late blight resistance p...    134   3e-31   
gb|AEO14737.1|  NBS-LRR class disease resistance protein                125   3e-31   
gb|ACE79399.1|  NBS-coding resistance gene analog                       128   3e-31   
gb|ABN42180.1|  resistance protein                                      125   4e-31   
ref|XP_011072557.1|  PREDICTED: putative late blight resistance p...    134   4e-31   
gb|EYU24428.1|  hypothetical protein MIMGU_mgv1a001134mg                134   4e-31   
gb|ACF22034.1|  NBS-coding resistance gene protein                      129   4e-31   
emb|CDP07961.1|  unnamed protein product                                127   4e-31   
emb|CDP00692.1|  unnamed protein product                                134   4e-31   
gb|ACF22032.1|  NBS-coding resistance gene protein                      129   4e-31   
ref|XP_011072192.1|  PREDICTED: putative late blight resistance p...    134   4e-31   
emb|CDP20463.1|  unnamed protein product                                134   4e-31   
gb|ADL59396.1|  EDNR2GH6 protein                                        134   4e-31   
gb|EYU26873.1|  hypothetical protein MIMGU_mgv1a025130mg                134   4e-31   
gb|EYU21178.1|  hypothetical protein MIMGU_mgv1a019709mg                134   4e-31   
ref|XP_009763533.1|  PREDICTED: putative late blight resistance p...    135   5e-31   
ref|XP_010319324.1|  PREDICTED: disease resistance protein RPP13-...    134   5e-31   
ref|XP_006356854.1|  PREDICTED: disease resistance protein RPP13-...    134   5e-31   
gb|ACO25631.1|  NBS-coding resistance protein                           125   5e-31   
ref|XP_006363500.1|  PREDICTED: putative late blight resistance p...    133   5e-31   
gb|ACE79455.1|  NBS-coding resistance gene analog                       129   5e-31   
gb|ACE79453.1|  NBS-coding resistance gene analog                       129   6e-31   
ref|XP_011091324.1|  PREDICTED: probable disease resistance prote...    134   6e-31   
gb|ACE79426.1|  NBS-coding resistance gene analog                       129   6e-31   
gb|ACE79456.1|  NBS-coding resistance gene analog                       129   6e-31   
gb|EYU21848.1|  hypothetical protein MIMGU_mgv1a023991mg                134   6e-31   
gb|ACE79435.1|  NBS-coding resistance gene analog                       129   6e-31   
gb|KDO61208.1|  hypothetical protein CISIN_1g037627mg                   133   6e-31   
ref|XP_006362539.1|  PREDICTED: putative late blight resistance p...    133   7e-31   
gb|AAV88068.1|  NBS-LRR protein                                         133   7e-31   
ref|XP_006470644.1|  PREDICTED: putative disease resistance RPP13...    133   8e-31   
emb|CDP15593.1|  unnamed protein product                                134   8e-31   
gb|EYU24351.1|  hypothetical protein MIMGU_mgv1a025953mg                131   8e-31   
gb|ADL59402.1|  R2 late blight resistance protein                       133   1e-30   
gb|AEO14738.1|  NBS-LRR class disease resistance protein                124   1e-30   
gb|ADL59400.1|  R2 late blight resistance protein                       133   1e-30   
emb|CDP15581.1|  unnamed protein product                                133   1e-30   
ref|XP_009603727.1|  PREDICTED: late blight resistance protein R1...    133   1e-30   
ref|XP_009769228.1|  PREDICTED: putative late blight resistance p...    132   1e-30   
emb|CDP04880.1|  unnamed protein product                                133   1e-30   
gb|AAU95278.1|  R1                                                      128   1e-30   
gb|ACO25625.1|  NBS-coding resistance protein                           124   1e-30   
gb|AAU95624.1|  R1                                                      128   1e-30   
ref|XP_008778031.1|  PREDICTED: putative disease resistance prote...    132   1e-30   
gb|ACO25628.1|  NBS-coding resistance protein                           124   1e-30   
ref|XP_009794525.1|  PREDICTED: putative late blight resistance p...    132   1e-30   
emb|CDP19489.1|  unnamed protein product                                133   1e-30   
gb|EYU31598.1|  hypothetical protein MIMGU_mgv1a018432mg                132   1e-30   
ref|XP_009763714.1|  PREDICTED: putative late blight resistance p...    133   1e-30   
ref|XP_011091448.1|  PREDICTED: putative disease resistance prote...    131   1e-30   
gb|EYU31457.1|  hypothetical protein MIMGU_mgv1a017859mg                132   1e-30   
gb|EYU24178.1|  hypothetical protein MIMGU_mgv1a024402mg                132   1e-30   
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg                132   1e-30   
gb|ACU82877.1|  nucleotide binding site-leucine rich repeat protein     124   2e-30   
ref|XP_009799885.1|  PREDICTED: LOW QUALITY PROTEIN: putative lat...    133   2e-30   
gb|ACU82871.1|  nucleotide binding site-leucine rich repeat protein     124   2e-30   
ref|XP_009618211.1|  PREDICTED: disease resistance protein RPP13-...    132   2e-30   
emb|CDP13440.1|  unnamed protein product                                132   2e-30   
emb|CDP08024.1|  unnamed protein product                                131   2e-30   
emb|CDP10344.1|  unnamed protein product                                132   2e-30   
gb|ACE79401.1|  NBS-coding resistance gene analog                       126   2e-30   
gb|AAF76308.1|  Prf                                                     133   2e-30   
gb|AAC49408.1|  PRF                                                     133   2e-30   
gb|ACE79483.1|  NBS-coding resistance gene analog                       126   2e-30   
emb|CDP05594.1|  unnamed protein product                                132   2e-30   
emb|CDP08423.1|  unnamed protein product                                132   2e-30   
ref|XP_010319326.1|  PREDICTED: disease resistance protein RPP13-...    132   2e-30   
ref|XP_009773945.1|  PREDICTED: putative disease resistance RPP13...    132   2e-30   
ref|XP_010319547.1|  PREDICTED: disease resistance protein RPP13-...    129   2e-30   
ref|XP_006360836.1|  PREDICTED: disease resistance protein RPP13-...    131   2e-30   
emb|CDP20519.1|  unnamed protein product                                132   3e-30   
gb|EYU21170.1|  hypothetical protein MIMGU_mgv1a025737mg                131   3e-30   
ref|XP_009787830.1|  PREDICTED: disease resistance protein RPP13-...    131   3e-30   
gb|AAU95627.1|  R1                                                      127   3e-30   
emb|CDP21195.1|  unnamed protein product                                131   3e-30   
gb|AAU95265.1|  R1                                                      127   3e-30   
emb|CDP17943.1|  unnamed protein product                                132   3e-30   
emb|CDP10807.1|  unnamed protein product                                132   3e-30   



>gb|ABS29403.1| NBS-LRR type disease resistance protein [Ipomoea batatas]
Length=168

 Score =   229 bits (585),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = -2

Query  415  GGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDED  236
            GG+GKTTLA+QVYED SV+IHFDVRAWVVASQLH+KRQML+GL++SISKQ +LE +TD D
Sbjct  1    GGVGKTTLAKQVYEDSSVAIHFDVRAWVVASQLHDKRQMLIGLINSISKQDDLEKATDGD  60

Query  235  LALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKS  56
            LALKLY+CLK QRYMVVVDDVWSGEAWDDVSNCFPDD NGSRVLLTTR+A VA    S S
Sbjct  61   LALKLYKCLKCQRYMVVVDDVWSGEAWDDVSNCFPDDENGSRVLLTTRLAEVANYCSSNS  120

Query  55   YFSHQMHLLDESESWELF  2
             FSH M LLD+S+SW LF
Sbjct  121  DFSHHMQLLDQSDSWNLF  138



>gb|ABH10959.1| putative NBS-LRR disease resistance protein RIT-2 [Ipomoea trifida]
Length=166

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = -2

Query  415  GGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDED  236
            GG+GKTTLAR++YED S++ HFD RAWVVASQ H+K Q+L  LL  IS +G +++ T ED
Sbjct  1    GGVGKTTLARRLYEDSSIASHFDKRAWVVASQNHDKLQILTDLL--ISMRGCVDSDTQED  58

Query  235  -LALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSK  59
             LA KLYQ + RQRY VV+DD+WS EAWD V  CFP++GNGSRVLLTTR + VAT IGSK
Sbjct  59   QLAEKLYQNMMRQRYFVVMDDIWSVEAWDSVKACFPNNGNGSRVLLTTRSSEVATIIGSK  118

Query  58   SYFSHQMHLLDESESWELF  2
              FSHQM LL+E ESW LF
Sbjct  119  DDFSHQMQLLEEGESWNLF  137



>gb|ACE79429.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACF22013.1| NBS-coding resistance gene protein [Nicotiana tabacum]
 gb|ACF22015.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 121/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V  S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSPSRHGLEPEDKMVGLENEFEMMQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DP +  HFD+RA    SQ +  R +L+GLL SIS + N   E   D+ LA +L + LK  
Sbjct  78   DPFIMSHFDIRAKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD W+ EAWDD+  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RYLVVIDDTWTREAWDDIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ACE79448.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 121/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V  S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSPSRHGLEPEDKMVGLENEFEMMQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DP +  HFD+RA    SQ +  R +L+GLL SIS + N   E   D+ LA +L + LK  
Sbjct  78   DPFIMSHFDIRAKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD W+ EAWDD+  CFPD  NGSR+L+TTR   VA C  S     + M L++  
Sbjct  138  RYLVVIDDTWTREAWDDIKRCFPDCNNGSRILMTTRNVEVAEC-ASTGKTPYHMRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ACF22012.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 120/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V  S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSPSRHGLEPEDKMVGLENEFEMMQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DP V  HFD+RA    SQ +    +L+GLL SIS + N   E   D+ LA +L + LK  
Sbjct  78   DPFVMSHFDIRAKATVSQEYCAGNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD W+ EAWDD+  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RYLVVIDDTWTREAWDDIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ACE79413.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 121/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    + +M+G ++EFE+++  L   G++E +VVS++GMGGIGKTTLA ++Y 
Sbjct  19   SLVSTSRHGVGPQSKMIGLENEFEMMQDQLSR-GARELEVVSVVGMGGIGKTTLANKLYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DP +  HFD+RA    SQ +  R +L+ LL SIS + N   E   D+ LA +L + LK  
Sbjct  78   DPFIMSHFDIRAKATVSQEYCARNVLLRLLSSISGKTNEFQEQQEDDQLADRLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+W+ EAWDD+  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RYLVVIDDIWTREAWDDIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ACE79438.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 121/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V  S+H    +++MVG +DEFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSPSRHGLEPEDKMVGLEDEFEMMQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DP +  HF +RA    SQ +  R +L+GLL SIS + +   E+  D+ LA +L + LK  
Sbjct  78   DPFMMSHFGIRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ACE79449.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 120/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V  S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSPSRHGLEPEDKMVGLENEFEMMQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNL--ENSTDEDLALKLYQCLKRQ  200
            DP +  HFD+RA    SQ +  R +L+GLL SIS + N   E   D+ LA +L + LK  
Sbjct  78   DPFIMSHFDIRAKATVSQEYCARNVLLGLLSSISGKTNEFHEQQGDDQLADQLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+W+ EAW+ +  CFPD  NGSR+L+TTR   V  C  S     H M L++  
Sbjct  138  RYLVVIDDLWTREAWNVIRQCFPDCNNGSRILMTTRNVEVVECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>ref|XP_011073066.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=777

 Score =   167 bits (424),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 126/185 (68%), Gaps = 3/185 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S + SSQ A+ SK  MVG  D+   IK  L   GS + + +SI+GMGGIGKTTLA+ +++
Sbjct  149  SPISSSQRANSSKVRMVGLDDDLMQIKARLCG-GSSQLQTISIVGMGGIGKTTLAKNIFD  207

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN-LENSTDEDLALKLYQCLKRQR  197
            D S+  +FD+RAW+  SQ ++ R +L+GLL S+   G+ ++  ++  LA+ L++CLKR+R
Sbjct  208  DASLGYYFDIRAWMTVSQNYHVRDILLGLLGSMKMLGDDMDQESNTKLAVHLHKCLKRRR  267

Query  196  YMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESE  17
            Y+VV+DD+W  +AW ++ N FPDD NGSRVLLTTR++ +A    S     HQ+ LLD  +
Sbjct  268  YLVVLDDMWDTKAWSEMRNFFPDDVNGSRVLLTTRLSELAVYANSCPPI-HQLRLLDHYQ  326

Query  16   SWELF  2
            SW L 
Sbjct  327  SWILL  331



>gb|ACE79412.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 122/186 (66%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSTSRHGLEPEDKMVGLENEFEMVQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DP +  HF +RA    SQ +  R +L+GLL SIS + +   E+  D+ LA +L + LK  
Sbjct  78   DPFMMSHFGIRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ACE79442.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACF22007.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 122/186 (66%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSTSRHGLEPEDKMVGLENEFEMVQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNL--ENSTDEDLALKLYQCLKRQ  200
            DP +  HF +RA    SQ +  R +L+GLL SIS + +   E+  D+ LA +L + LK  
Sbjct  78   DPFMMSHFGIRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ACE79425.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 122/186 (66%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVNTSRHGLEPEDKMVGLENEFEMVQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DP +  HF +RA    SQ +  R +L+GLL SIS + +   E+  D+ LA +L + LK  
Sbjct  78   DPFMMSHFGIRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ACE79492.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=250

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            S++   + K+ MVG+ D+ + + + L    S E KV+ I+GMGGIGKTTLA++VY D S+
Sbjct  18   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  77

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVV  185
              HFDVRAW   S  HN +++L+ LL   S+ G+     DE +LA  L + LK +RY++V
Sbjct  78   RSHFDVRAWATVSSHHNVKEILLSLLR--SRMGDTFYMEDEAELADMLQKSLKSRRYLIV  135

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWDDV  CFP + N SRVLLTTR   VA C      FS QM  +D  ESW L
Sbjct  136  MDDMWSSKAWDDVRQCFPSENNESRVLLTTRDTDVA-CYAGTENFSLQMSFMDPYESWNL  194

Query  4    F  2
            F
Sbjct  195  F  195



>gb|ACE79491.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=257

 Score =   159 bits (403),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            S++   + K+ MVG+ D+ + + + L    S E KV+ I+GMGGIGKTTLA++VY D S+
Sbjct  22   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  81

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVV  185
              HFDVRAW   S  HN +++L+ LL   S+ G+     DE +LA  L + LK +RY++V
Sbjct  82   RSHFDVRAWATVSSHHNVKEILLSLLR--SRMGDTFYMEDEAELADMLQKSLKSRRYLIV  139

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWDDV  CFP + N SRVLLTTR   VA C      FS QM  +D  ESW L
Sbjct  140  MDDMWSSKAWDDVRQCFPSENNESRVLLTTRDTDVA-CYAGTENFSLQMSFMDPYESWNL  198

Query  4    F  2
            F
Sbjct  199  F  199



>gb|ACE79495.1| NBS-coding resistance gene analog [Nicotiana sylvestris]
Length=249

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            S++   + K+ MVG+ D+ + + + L    S E KV+ I+GMGGIGKTTLA++VY D S+
Sbjct  17   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  76

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVV  185
              HFDVRAW   S  HN +++L+ LL   S+ G+     DE +LA  L + LK +RY++V
Sbjct  77   RSHFDVRAWATVSSHHNVKEILLSLLR--SRMGDTFYMEDEAELADMLQKSLKSRRYLIV  134

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWDDV  CFP + N SRVLLTTR   VA C      FS QM  +D  ESW L
Sbjct  135  MDDMWSSKAWDDVRQCFPSENNESRVLLTTRDTDVA-CYAGTENFSLQMSFMDPYESWNL  193

Query  4    F  2
            F
Sbjct  194  F  194



>gb|ACE79493.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=252

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            S++   + K+ MVG+ D+ + + + L    S E KV+ I+GMGGIGKTTLA++VY D S+
Sbjct  18   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  77

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVV  185
              HFDVRAW   S  HN +++L+ LL   S+ G+     DE +LA  L + LK +RY++V
Sbjct  78   RSHFDVRAWATVSSHHNVKEILLSLLR--SRMGDTFYMEDEAELADMLQKSLKSRRYLIV  135

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWDDV  CFP + N SRVLLTTR   VA C      FS QM  +D  ESW L
Sbjct  136  MDDMWSSKAWDDVRQCFPSENNESRVLLTTRDTDVA-CYAGTENFSLQMSFMDPYESWNL  194

Query  4    F  2
            F
Sbjct  195  F  195



>gb|ACE79489.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=254

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            S++   + K+ MVG+ D+ + + + L    S E KV+ I+GMGGIGKTTLA++VY D S+
Sbjct  21   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  80

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVV  185
              HFDVRAW   S  HN +++L+ LL   S+ G+     DE +LA  L + LK +RY++V
Sbjct  81   RSHFDVRAWATVSSHHNVKEILLSLLR--SRMGDTFYMEDEAELADMLQKSLKSRRYLIV  138

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWDDV  CFP + N SRVLLTTR   VA C      FS QM  +D  ESW L
Sbjct  139  MDDMWSSKAWDDVRQCFPSENNESRVLLTTRDTDVA-CYAGTENFSLQMSFMDPYESWNL  197

Query  4    F  2
            F
Sbjct  198  F  198



>gb|ACE79487.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACE79494.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=256

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            S++   + K+ MVG+ D+ + + + L    S E KV+ I+GMGGIGKTTLA++VY D S+
Sbjct  21   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  80

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVV  185
              HFDVRAW   S  HN +++L+ LL   S+ G+     DE +LA  L + LK +RY++V
Sbjct  81   RSHFDVRAWATVSSHHNVKEILLSLLR--SRMGDTFYMEDEAELADMLQKSLKSRRYLIV  138

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWDDV  CFP + N SRVLLTTR   VA C      FS QM  +D  ESW L
Sbjct  139  MDDMWSSKAWDDVRQCFPSENNESRVLLTTRDTDVA-CYAGTENFSLQMSFMDPYESWNL  197

Query  4    F  2
            F
Sbjct  198  F  198



>gb|ACE79488.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=255

 Score =   159 bits (402),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            S++   + K+ MVG+ D+ + + + L    S E KV+ I+GMGGIGKTTLA++VY D S+
Sbjct  21   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  80

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVV  185
              HFDVRAW   S  HN +++L+ LL   S+ G+     DE +LA  L + LK +RY++V
Sbjct  81   RSHFDVRAWATVSSHHNVKEILLSLLR--SRMGDTFYMEDEAELADMLQKSLKSRRYLIV  138

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWDDV  CFP + N SRVLLTTR   VA C      FS QM  +D  ESW L
Sbjct  139  MDDMWSSKAWDDVRQCFPSENNESRVLLTTRDTDVA-CYAGTENFSLQMSFMDPYESWNL  197

Query  4    F  2
            F
Sbjct  198  F  198



>ref|XP_009622812.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=932

 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 121/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V  S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  129  SLVSPSRHGLEPEDKMVGLENEFEMMQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  187

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DP +  HFD+RA    SQ +  R +L+GLL SIS + N   E   D+ LA +L + LK  
Sbjct  188  DPFIMSHFDIRAKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCG  247

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD W+ EAWDD+  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  248  RYLVVIDDTWTREAWDDIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  306

Query  19   ESWELF  2
            ESW L 
Sbjct  307  ESWSLL  312



>gb|ACE79490.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            S++   + K+ MVG+ D+ + + + L    S E KV+ I+GMGGIGKTTLA++VY D S+
Sbjct  21   SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  80

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVV  185
              HFDVRAW   S  HN +++L+ LL   S+ G+     DE +LA  L + LK +RY++V
Sbjct  81   RSHFDVRAWATVSSHHNVKEILLSLLR--SRMGDTFYMEDEAELADMLQKSLKSRRYLIV  138

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWDDV  CFP + N SRVLLTTR   VA C      FS QM  +D  ESW L
Sbjct  139  MDDMWSSKAWDDVRQCFPSENNESRVLLTTRDTDVA-CYAGTENFSLQMSFMDPYESWNL  197

Query  4    F  2
            F
Sbjct  198  F  198



>gb|ACF22014.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 121/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTL  ++Y 
Sbjct  19   SLVSTSRHGLEPEDKMVGLENEFEMVQDQLAR-GARELEVVSIVGMGGIGKTTLVNKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DP +  HF +RA    SQ +  R +L+GLL SIS + +   E+  D+ LA +L + LK  
Sbjct  78   DPFMMSHFGIRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ACF22011.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 121/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTL  ++Y 
Sbjct  19   SLVSTSRHGLEPEDKMVGLENEFEMVQDQLAR-GARELEVVSIVGMGGIGKTTLTNKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DP +  HF +RA    SQ +  R +L+GLL SIS + +   E+  D+ LA +L + LK  
Sbjct  78   DPFMMSHFGIRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RYLVVIDDIWTREAWDGIERCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ACE79422.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 121/188 (64%), Gaps = 8/188 (4%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G+KE +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSTSRHGIEPEDKMVGLENEFEMMQDQLAR-GAKELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLE----NSTDEDLALKLYQCLK  206
            DP +  HF +RA    SQ +  R +L+ LL SIS  G +E    +  D+ LA +L + LK
Sbjct  78   DPFIMSHFGIRAKATVSQEYCARYVLLRLLSSIS--GKIEEFHEHQDDDQLADRLQKLLK  135

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
              RY+VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++
Sbjct  136  CGRYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMN  194

Query  25   ESESWELF  2
              ESW L 
Sbjct  195  FDESWSLL  202



>gb|ACE79451.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 121/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGK TLA ++Y 
Sbjct  19   SLVSTSRHGLEPEDKMVGLENEFEMVQDQLAR-GARELEVVSIVGMGGIGKITLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNL--ENSTDEDLALKLYQCLKRQ  200
            DP +  HF +RA    SQ +  R +L+GLL SIS + +   E+  D+ LA +L + LK  
Sbjct  78   DPFMMSHFGIRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ACE79434.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   157 bits (398),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 121/188 (64%), Gaps = 8/188 (4%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G+KE +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSTSRHGIEPEDKMVGLENEFEMMQDQLAR-GAKELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLE----NSTDEDLALKLYQCLK  206
            DP +  HF +RA    SQ +  R +L+ LL SIS  G +E    +  D+ LA +L + LK
Sbjct  78   DPFIMSHFGIRAKATVSQEYCARYVLLRLLSSIS--GKIEEFHEHQDDDQLADRLQKLLK  135

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
              RY+VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++
Sbjct  136  CGRYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMN  194

Query  25   ESESWELF  2
              ESW L 
Sbjct  195  FDESWSLL  202



>emb|CDP16515.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   164 bits (416),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 125/192 (65%), Gaps = 4/192 (2%)
 Frame = -2

Query  571  HDVLQRSQVISSQHASHSKEEMV-GKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTT  395
            H+V   S ++SS       +E+V    DE +++   LI  GS +  V S++GM G+GKTT
Sbjct  121  HNVPTASTMVSSPAEIPKVDEVVIDLADEKKLVIDRLIA-GSGKLGVFSVVGMAGLGKTT  179

Query  394  LARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLL-DSISKQGNLENSTDEDLALKLY  218
            LAR+VY DPSV+ HF VRAW   SQ + KR++L+ +L D +    ++   +DEDL +KLY
Sbjct  180  LARRVYNDPSVTYHFHVRAWCCISQTYQKRELLLQILGDIVELTDDVLEMSDEDLVMKLY  239

Query  217  QCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQM  38
            QCLKR RY+VV+DD+WS EAW+D    FP+D NGSR+++TTR + VA  +   S   H +
Sbjct  240  QCLKRNRYLVVMDDMWSIEAWNDFERSFPNDNNGSRIVITTRHSDVAAKVQVDST-PHPL  298

Query  37   HLLDESESWELF  2
             LL + ESWEL 
Sbjct  299  RLLSDDESWELL  310



>gb|ACE79441.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 120/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSTSRHGLEPEDKMVGLENEFEMVQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DP +  HF  RA    SQ +  R + +GLL SIS + +   E+  D+ LA +L + LK  
Sbjct  78   DPFMMSHFGTRAKATVSQEYCARYVPLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ABV90190.1| NBS-LRR type disease resistance protein [Ipomoea batatas]
Length=191

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = -2

Query  427  IIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLEN-  251
            I GMGGIGKTTLA+++Y D S    FD RAWV  SQ++N  ++   LL  ++ + + EN 
Sbjct  2    IWGMGGIGKTTLAKRIYGDASFISRFDCRAWVTISQVYNPTKVFKALLRPLAPRVDDENN  61

Query  250  -STDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVAT  74
             + + +LA  +Y+CLKRQRY +++DD+WS + W D+  CFP+D NGSR+LLTTR+  VA 
Sbjct  62   EAGNNELAEVVYKCLKRQRYFIIIDDIWSTDVWCDLQKCFPNDNNGSRMLLTTRLKNVAN  121

Query  73   CIGSKSYFSHQMHLLDESESWELF  2
            C GS     H M  L+  ESW LF
Sbjct  122  CAGSGGNLCHTMRFLNSYESWNLF  145



>gb|ACF22008.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 121/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSTSRHGLEPEDKMVGLENEFEMMQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNL--ENSTDEDLALKLYQCLKRQ  200
            DP +  HF +RA    SQ +  R +L+GLL SIS + +   E+  D+ LA +L + LK  
Sbjct  78   DPFMMSHFGIRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            R +VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RSLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>gb|ACE79424.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/186 (46%), Positives = 120/186 (65%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSTSRHGLEPEDKMVGLENEFEMVQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNL--ENSTDEDLALKLYQCLKRQ  200
            DP +  HF +RA    SQ +  R +L+GLL SIS + +   E+  D+ LA +L + LK  
Sbjct  78   DPFMMSHFGIRAKATVSQEYCARYVLLGLLSSISGKSDEFHEHQDDDQLADQLQKLLKCG  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            R  VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  RSSVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  196

Query  19   ESWELF  2
            ESW L 
Sbjct  197  ESWSLL  202



>ref|XP_006352021.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=890

 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 119/186 (64%), Gaps = 7/186 (4%)
 Frame = -2

Query  541  SSQHASHSKEE---MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYED  371
            SSQHA    +E   MVG ++EFE+++  L   G +E KVVSI+GMGGIGKTTLA ++Y D
Sbjct  55   SSQHALLEPDENMNMVGDENEFEMMQGRLTR-GGRELKVVSIVGMGGIGKTTLANKIYSD  113

Query  370  PSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN---LENSTDEDLALKLYQCLKRQ  200
            P +  HFD+R  V  SQ + +  +L+GLL S+S   +    E   D +LA +L + LK +
Sbjct  114  PFIMSHFDIRGNVTVSQEYCREYVLLGLLSSVSGMSSHEFYEQQDDGELAEQLQKLLKGR  173

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+W+ E WDD+  CFPD  NGSR+L+TTR   VA    S +   +QM LLD  
Sbjct  174  RYLVVIDDIWTRETWDDIQLCFPDCNNGSRILMTTRNMDVAKYASSGNTTPYQMSLLDFK  233

Query  19   ESWELF  2
             SW L 
Sbjct  234  RSWNLL  239



>ref|XP_009796570.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=557

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 122/186 (66%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  294  SLVSTSRHGLEPEDKMVGLENEFEMVQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  352

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNL--ENSTDEDLALKLYQCLKRQ  200
            DP +  HF +RA    SQ +  R +L+GLL SIS + +   E+  D+ LA +L + LK  
Sbjct  353  DPFMMSHFGIRAKATVSQEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLLKCG  412

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  413  RYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  471

Query  19   ESWELF  2
            ESW L 
Sbjct  472  ESWSLL  477



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 115/181 (64%), Gaps = 2/181 (1%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            SS+ +S  +  MVG  +E +++   L   GS+E KVVSI+GMGGIGKTT A ++Y DP +
Sbjct  123  SSKLSSQPENVMVGHNNELDLMLDHLTR-GSRELKVVSIVGMGGIGKTTFATRIYYDPVI  181

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSI-SKQGNLENSTDEDLALKLYQCLKRQRYMVV  185
               FD R  V  SQ    R++L+GLL+SI S    + N +D  LA +L + LK +RY++ 
Sbjct  182  VSRFDTRPMVTVSQEFYVRRLLLGLLNSITSIPREICNESDGQLADRLRKGLKGRRYLIF  241

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS EAWDD+  CFPDDGNGSR+LLTTR   VA          H+M LL   ESW L
Sbjct  242  IDDIWSTEAWDDMKLCFPDDGNGSRILLTTRNTEVAEYASMNEPPFHRMRLLSFDESWNL  301

Query  4    F  2
            F
Sbjct  302  F  302



>ref|XP_009789038.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=869

 Score =   161 bits (408),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 120/184 (65%), Gaps = 6/184 (3%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            +SQH   S+  MVG ++ FEI++  L   G+ E +V+SI+GMGGIGK+TLA ++Y DP +
Sbjct  129  TSQHDFQSENMMVGHENAFEIMQDQLAR-GATELQVISIVGMGGIGKSTLAIKLYNDPFI  187

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNL----ENSTDEDLALKLYQCLKRQRY  194
              HFD+RA V+ SQ + KR +L+G+L SIS  G +    E   D  LA +L + LK +RY
Sbjct  188  MSHFDIRAKVIVSQEYCKRNVLLGILSSISGSGTIGEFYEQQDDGQLADRLQKYLKGKRY  247

Query  193  MVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESES  14
            ++V+DD+W+  AWDDV  CFPD   GSR+LLTTR   VA    S     +QM LL+ +ES
Sbjct  248  LIVIDDIWTTIAWDDVKLCFPDCNCGSRILLTTRNMKVAE-YASSGNPPYQMRLLNFNES  306

Query  13   WELF  2
            W L 
Sbjct  307  WYLL  310



>emb|CDP20153.1| unnamed protein product [Coffea canephora]
Length=1449

 Score =   162 bits (411),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 126/194 (65%), Gaps = 6/194 (3%)
 Frame = -2

Query  574  AHDVLQRS-QVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKT  398
             H+V+  S  +IS     +  E ++   D+ E+I   L   G+ +++VVSI+GM G+GKT
Sbjct  696  VHNVVHTSGSLISPAIVPNVDEVVIDLDDQAELIMDRLTR-GTLQRQVVSIVGMPGLGKT  754

Query  397  TLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALK  224
            TLA++VY DPS++ HF +RAW   SQ++ KR++L+ +L  I +  N  LE S D DL  K
Sbjct  755  TLAKKVYNDPSITYHFHIRAWCYISQVYRKRELLLNILSDIMELTNDVLELSED-DLEFK  813

Query  223  LYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSH  44
            LYQCLK ++Y++V+DD+WS EAW+D+    PDD NGSR+L+T+R+  VA    S S  +H
Sbjct  814  LYQCLKNRKYLIVLDDLWSREAWNDLEFSLPDDKNGSRILITSRLTDVALTTKSDS-IAH  872

Query  43   QMHLLDESESWELF  2
             + L  + ESW L 
Sbjct  873  SLRLFSDDESWNLL  886



>gb|AEW48197.1| disease resistance protein RGH3 [Solanum x edinense]
Length=933

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 120/188 (64%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+R  V  SQ +  R +++GLL SIS      N  D+ LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRTKVTVSQEYCVRNVILGLLSSIS------NEPDDQLADRLQKNLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKQCFPDCNNGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>emb|CDP19728.1| unnamed protein product [Coffea canephora]
Length=1099

 Score =   161 bits (407),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 120/191 (63%), Gaps = 15/191 (8%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIELGSKEKKV-------------VSIIGMGGIGKTTL  392
            H   +   MV    E   I +++I+L  ++KKV             VS++GM G+GKTTL
Sbjct  367  HNVPTSSMMVSSPAELPKIDEVVIDLADEKKKVIDRLKVGSGKLDVVSVVGMAGLGKTTL  426

Query  391  ARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQ  215
             R+VY+DPSV+ HF VRAW   SQ + KR++L+ +L  I K   ++   TDEDL +KLY+
Sbjct  427  VRRVYKDPSVTHHFHVRAWCCVSQAYQKRELLLQILGDIMKLTDDMLEMTDEDLEMKLYK  486

Query  214  CLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMH  35
            CLKR RY++V+DD+WS EAW D+   FP+D NGSR+L+T+R + VA  +   S   H + 
Sbjct  487  CLKRNRYLIVMDDMWSIEAWYDLEQSFPNDKNGSRILITSRHSEVAAKVQVDST-PHPLR  545

Query  34   LLDESESWELF  2
            LL + ESW+L 
Sbjct  546  LLSDDESWKLL  556



>ref|XP_006367920.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X5 [Solanum tuberosum]
Length=476

 Score =   156 bits (394),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 121/189 (64%), Gaps = 4/189 (2%)
 Frame = -2

Query  562  LQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQ  383
            +  S+  SSQ     K+ +VG  ++   IK  LI + S   +VV IIGMGGIGKTTLAR+
Sbjct  129  ISHSRDTSSQIPLDQKDIIVGLDEDLLRIKDRLI-VQSSRLEVVPIIGMGGIGKTTLARR  187

Query  382  VYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNL--ENSTDEDLALKLYQCL  209
            VY+D  ++ HF VRAW   SQ  + R++ +G+L SI    +    NST+E LA ++Y+ L
Sbjct  188  VYDDSLIAYHFYVRAWTNVSQEFDTREIFLGILRSIGAVNDEVERNSTNEQLAERVYRSL  247

Query  208  KRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLL  29
            K ++Y++V+DD+WS EAW  V   FPDD NGSR++LTTR+A VA+C  S +   HQM  L
Sbjct  248  KGRKYLIVLDDMWSIEAWQHVRRSFPDDHNGSRIVLTTRLADVASCACSVNSL-HQMRFL  306

Query  28   DESESWELF  2
               ESW L 
Sbjct  307  SMEESWTLL  315



>ref|XP_006367916.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006367917.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006367918.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006367919.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X4 [Solanum tuberosum]
Length=493

 Score =   156 bits (394),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 121/189 (64%), Gaps = 4/189 (2%)
 Frame = -2

Query  562  LQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQ  383
            +  S+  SSQ     K+ +VG  ++   IK  LI + S   +VV IIGMGGIGKTTLAR+
Sbjct  129  ISHSRDTSSQIPLDQKDIIVGLDEDLLRIKDRLI-VQSSRLEVVPIIGMGGIGKTTLARR  187

Query  382  VYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNL--ENSTDEDLALKLYQCL  209
            VY+D  ++ HF VRAW   SQ  + R++ +G+L SI    +    NST+E LA ++Y+ L
Sbjct  188  VYDDSLIAYHFYVRAWTNVSQEFDTREIFLGILRSIGAVNDEVERNSTNEQLAERVYRSL  247

Query  208  KRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLL  29
            K ++Y++V+DD+WS EAW  V   FPDD NGSR++LTTR+A VA+C  S +   HQM  L
Sbjct  248  KGRKYLIVLDDMWSIEAWQHVRRSFPDDHNGSRIVLTTRLADVASCACSVNSL-HQMRFL  306

Query  28   DESESWELF  2
               ESW L 
Sbjct  307  SMEESWTLL  315



>emb|CDP04885.1| unnamed protein product [Coffea canephora]
Length=989

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 88/193 (46%), Positives = 127/193 (66%), Gaps = 4/193 (2%)
 Frame = -2

Query  574  AHDVLQRS-QVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKT  398
             H+V + S  +IS   A    E +V   D+ E+I   LI+ GS ++ +VS++GM GIGKT
Sbjct  251  PHNVTRSSDHMISQVSAPEPDEVVVSLSDQEEVIIDRLIK-GSLQQDMVSLVGMPGIGKT  309

Query  397  TLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN-LENSTDEDLALKL  221
            TLA+++Y D  V+ HF +RAW   SQ+++KRQ+L+ +L +IS   + +   TDEDL L+L
Sbjct  310  TLAKKLYNDSRVTYHFHIRAWCCISQVYSKRQVLLDILSNISGLTDYIHKMTDEDLDLEL  369

Query  220  YQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQ  41
            YQ LK +RY++V+DD+WS EAWDD+   FPDD NGSR+L+T+RI  VA      S   + 
Sbjct  370  YQQLKGRRYLIVMDDMWSTEAWDDLERSFPDDKNGSRLLITSRIQNVALNAKPNSD-PYL  428

Query  40   MHLLDESESWELF  2
            + LL + ESW L 
Sbjct  429  LRLLTDDESWSLL  441



>ref|XP_009786668.1| PREDICTED: putative late blight resistance protein homolog R1B-17, 
partial [Nicotiana sylvestris]
Length=898

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            S++   + K+ MVG+ D+ + + + L    S E KV+ I+GMGGIGKTTLA++VY D S+
Sbjct  140  SAKDVLNVKKNMVGRDDQRKRLLEDLTRRSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  199

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVV  185
              HFDVRAW   S  HN +++L+ LL   S+ G+     DE +LA  L + LK +RY++V
Sbjct  200  RSHFDVRAWATVSSHHNVKEILLSLLR--SRMGDTFYMEDEAELADMLQKSLKSRRYLIV  257

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWDDV  CFP + N SRVLLTTR   VA C      FS QM  +D  ESW L
Sbjct  258  MDDMWSSKAWDDVRQCFPSENNESRVLLTTRDTDVA-CYAGTENFSLQMSFMDPYESWNL  316

Query  4    F  2
            F
Sbjct  317  F  317



>ref|XP_006367915.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Solanum tuberosum]
Length=383

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 119/189 (63%), Gaps = 4/189 (2%)
 Frame = -2

Query  562  LQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQ  383
            +  S+  SSQ     K+ ++G  ++   IK  LI + S   +VV IIGMGGIGKTTLAR+
Sbjct  133  ISHSRDTSSQIPMDQKDVIIGLDEDLLKIKDRLI-VQSSRLEVVPIIGMGGIGKTTLARR  191

Query  382  VYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSIS--KQGNLENSTDEDLALKLYQCL  209
            VY+D  ++ HF VRAW   SQ  + R++ +G+L SI   K     NST+E LA ++Y+ L
Sbjct  192  VYDDSLIAYHFYVRAWTNVSQEFDTREIFLGILRSIGVVKDEVERNSTNEQLAERVYRSL  251

Query  208  KRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLL  29
            K  +Y++V+DD+WS EAW  V   FPDD NGSR+LLTTR+  VA+C  S +   H+M  L
Sbjct  252  KGMKYLIVLDDMWSIEAWKHVRRSFPDDHNGSRILLTTRLVDVASCACSGNSL-HEMRFL  310

Query  28   DESESWELF  2
               ESW L 
Sbjct  311  SVEESWILL  319



>ref|XP_009803726.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=935

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 121/188 (64%), Gaps = 8/188 (4%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V +S+H    +++MVG ++EFE+++  L   G+KE +VVSI+GMGGIGKTTLA ++Y 
Sbjct  129  SLVSTSRHGIEPEDKMVGLENEFEMMQDQLAR-GAKELEVVSIVGMGGIGKTTLANKIYS  187

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLE----NSTDEDLALKLYQCLK  206
            DP +  HF +RA    SQ +  R +L+ LL SIS  G +E    +  D+ LA +L + LK
Sbjct  188  DPFIMSHFGIRAKATVSQEYCARYVLLRLLSSIS--GKIEEFHEHQDDDQLADRLQKLLK  245

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
              RY+VV+DD+W+ EAWD +  CFPD  NGSR+L+TTR   VA C  S     H M L++
Sbjct  246  CGRYLVVIDDIWTREAWDGIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMN  304

Query  25   ESESWELF  2
              ESW L 
Sbjct  305  FDESWSLL  312



>ref|XP_006350053.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=901

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 120/188 (64%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAVEQPENIMVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +++GLL SIS +       D+ LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKATVSQEYCVRNVILGLLPSISDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA C  S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAECARSGKP-PHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>gb|AEW48198.1| disease resistance protein RGH4 [Solanum x edinense]
Length=901

 Score =   158 bits (399),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 120/188 (64%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAVEQPENIMVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +++GLL SIS +       D+ LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKATVSQEYCVRNVILGLLPSISDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA C  S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAECARSGKP-PHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>gb|ACE79419.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 117/182 (64%), Gaps = 10/182 (5%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIEL--GSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
            HAS  + +MVG   E E   K+L +L  GS + +V+S+ GMGGIGK+T A++++  PSV 
Sbjct  26   HASTFENDMVGYNFEQE---KMLSQLTSGSTQMEVISVTGMGGIGKSTFAKKLFSHPSVL  82

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVV  185
              FD+  WV  S+ ++ R+ML+GLL   +I  +  L+  +D +LA+ L Q L  +RY++V
Sbjct  83   SFFDICGWVTVSEDYSYRKMLLGLLKDANIGMEEELDKKSDSNLAVCLKQSLMSRRYLIV  142

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGS-KSYFSHQMHLLDESESWE  8
            VDD+WS EAWDD+  C PDD   SRVLLTTR   VA    S K  F  QMHLLD  +SW 
Sbjct  143  VDDIWSKEAWDDIRLCLPDDDKRSRVLLTTRDVEVAQYTSSPKDPF--QMHLLDTDDSWN  200

Query  7    LF  2
            LF
Sbjct  201  LF  202



>gb|AEW48210.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=904

 Score =   157 bits (398),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 120/188 (64%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVISS-QHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++SS +HA    E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSSPEHAVEQPENIMVGRENEFEVMLDQLVR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L GLL SIS +       D+ LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKATVSQEYCVRNVLQGLLSSISDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_009606269.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=312

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 111/172 (65%), Gaps = 8/172 (5%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELG---SKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            MVG+ D+    KKLL +L    + E KV+ I+GMGGIGKTTLAR+VY D S+ +HFDVR 
Sbjct  127  MVGRDDQR---KKLLEDLTKGFTSESKVIPIVGMGGIGKTTLAREVYNDASIRLHFDVRE  183

Query  337  WVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEA  158
            W   SQ HN  ++L+ L+ S +K  +     + +LA  L + LK +RY++V+DD+W  EA
Sbjct  184  WATISQQHNVNEILLSLVHS-TKGDSFYMEGEAELANMLQKSLKGKRYLIVLDDMWKSEA  242

Query  157  WDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            WDD+  CFP   NGSR+LLTTR A V    G+K+  S +M  L+  ES  LF
Sbjct  243  WDDIRLCFPIQNNGSRILLTTRNAEVVCSAGTKN-LSLKMDFLNPDESRNLF  293



>ref|XP_009606267.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=927

 Score =   157 bits (397),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            S++   + K+ MVG+ D+ + + + L    S E KV+ I+GMGGIGKTTLA++VY D S+
Sbjct  140  SAKDVLNVKKNMVGRDDQRKRLLEDLTRGSSGELKVIPILGMGGIGKTTLAKEVYNDVSI  199

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVV  185
              HFDVRAW   S  HN +++L+ LL   S+ G+     DE +LA  L + LK +RY++V
Sbjct  200  RSHFDVRAWATVSSHHNIKEILLSLLR--SRMGDTFYMEDEAELADMLQKSLKSRRYLIV  257

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWDDV  CFP + N SR+LLTTR   VA C      FS QM  +D  ESW L
Sbjct  258  MDDMWSSKAWDDVRQCFPSENNESRILLTTRDTDVA-CYAGTENFSLQMSFMDPYESWNL  316

Query  4    F  2
            F
Sbjct  317  F  317



>gb|AFB17982.1| Rx-like protein, partial [Solanum tuberosum]
Length=320

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 108/169 (64%), Gaps = 8/169 (5%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA ++Y DP +   FD+RA   
Sbjct  19   MVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKAT  77

Query  328  ASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDD  149
             SQ +  R +L+GLL   S +      +D  LA +L + LK +RY+VV+DD+W+ EAWDD
Sbjct  78   VSQEYCVRNVLLGLLSLTSDE------SDYQLADRLQKHLKGRRYLVVIDDIWTPEAWDD  131

Query  148  VSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +  CFPD  NGSR+LLTTR   VA C  S     H M L+   ESW L 
Sbjct  132  IKLCFPDCYNGSRILLTTRNVEVAEC-ASSGKPPHHMRLMKFDESWNLL  179



>gb|ACE79452.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 115/181 (64%), Gaps = 8/181 (4%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIEL--GSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
            HAS  + +MVG   E E   K+L +L  GS + +V+S+ GMGGIGK+T A++++  PSV 
Sbjct  26   HASTFENDMVGYNFEQE---KMLCQLTSGSTQMEVISVTGMGGIGKSTFAKKLFSHPSVL  82

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVV  185
              FD+  WV  S+ ++ R+ML+GLL   +I  +  L+  +D +LA+ L Q L  +RY++V
Sbjct  83   SFFDICGWVTVSEDYSYRKMLLGLLKDANIGMEEELDKKSDSNLAVCLKQSLMSRRYLIV  142

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            VDD+WS +AWDD+  C PDD   SRVLLTTR   VA    S      QMHLLD  +SW L
Sbjct  143  VDDIWSKKAWDDIRLCLPDDDKRSRVLLTTRDVEVAQ-YASSPKDPFQMHLLDTDDSWNL  201

Query  4    F  2
            F
Sbjct  202  F  202



>emb|CDP00688.1| unnamed protein product [Coffea canephora]
Length=590

 Score =   154 bits (389),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 118/188 (63%), Gaps = 4/188 (2%)
 Frame = -2

Query  562  LQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQ  383
            LQ S V  +  +S+ ++ +VG   E   I + L  L   E  +V+I GMGGIGKTTLAR+
Sbjct  293  LQGSSVRKAPLSSNKEDIVVGLDAELTTILEGLTGLPGLE--IVTISGMGGIGKTTLARK  350

Query  382  VYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN-LENSTDEDLALKLYQCLK  206
             + DP +  HF  RAW+  SQ++  R +L+GLL SI++  + +   ++  LA  +Y+ LK
Sbjct  351  AFNDPYIVYHFYCRAWITVSQVYQVRDLLLGLLSSIARSTDKMVEKSNAQLAEAVYRSLK  410

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
              RYM+V+DD+WS +AW+DV  CFPDD NGSR+++TTR   +AT +  K    H M+LL 
Sbjct  411  GMRYMIVMDDMWSIDAWNDVKRCFPDDKNGSRIVVTTRFMELATNVSPKKP-PHCMNLLS  469

Query  25   ESESWELF  2
              + WEL 
Sbjct  470  AEQRWELL  477



>ref|XP_009793286.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
 ref|XP_009793288.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=493

 Score =   153 bits (387),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 114/179 (64%), Gaps = 4/179 (2%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIH  353
            H+S  + +MVG   E   +   L   GS E +V+S+ GMGGIGK+T A++++  PSV   
Sbjct  195  HSSTLENDMVGYNIEQSNMMSQLTG-GSTELEVISVTGMGGIGKSTFAKRLFSHPSVLSF  253

Query  352  FDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVVVD  179
            FD+R W++ S+ ++ R+ML+GLL   +  K+  L+  +D DLA  L Q L  +RY++VVD
Sbjct  254  FDIRGWIIVSEDYSYRKMLLGLLTDANFGKKEELDKKSDSDLAFCLKQSLMGRRYLIVVD  313

Query  178  DVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            D+WS EAWDD+  C PDDG  SR+LLTTR   VA    S+     +MHLLD  +SW LF
Sbjct  314  DIWSKEAWDDIRLCLPDDGKRSRILLTTRDVEVAQYASSRKD-PFRMHLLDSDDSWNLF  371



>dbj|BAD18094.1| NBS-LRR protein [Ipomoea batatas]
Length=255

 Score =   148 bits (374),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 118/208 (57%), Gaps = 34/208 (16%)
 Frame = -2

Query  529  ASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHF  350
            +S  K  MVG  DEFE I   LI   SK+ +V+SI+GMGGIGKTTL ++VYE+ S+  HF
Sbjct  21   SSEPKNVMVGCDDEFETIGHKLIS-HSKKLEVISIVGMGGIGKTTLVQRVYENTSIVSHF  79

Query  349  DVRAWVVASQLHNKRQMLVGLLDSISKQGN------LENSTDED----------------  236
            DVRAW   SQ +N  +ML+ LL  I K+ +      +E  T  D                
Sbjct  80   DVRAWTTVSQEYNLEEMLLDLLGCIGKRSSVGVGSTIEGDTSNDDPPAIDPTDLPAININ  139

Query  235  ---------LALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFP-DDGNGSRVLLTTRIA  86
                      A +L + L  +RY++V+DD+WS +AWDD+  CFP +D  GSR+LLTTR+ 
Sbjct  140  ERAIVSNDPPATRLRKALMGERYLIVIDDIWSTKAWDDIHTCFPKEDFIGSRILLTTRLK  199

Query  85   VVATCIGSKSYFSHQMHLLDESESWELF  2
             VA    S S  SH M  L+ +ESW LF
Sbjct  200  QVAN-YASVSNNSHYMRFLNFNESWNLF  226



>gb|ACE79443.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACE79444.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACF21989.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=272

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 117/182 (64%), Gaps = 10/182 (5%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIEL--GSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
            HAS  + +MVG   E E   K+L +L  GS + +V+S+ GMGGIGK+T A++++  PSV 
Sbjct  26   HASTFENDMVGYNFEQE---KMLSQLTSGSTQMEVISVTGMGGIGKSTFAKKLFSHPSVL  82

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVV  185
              FD+  WV  S+ ++ R+ML+GLL   +I  +  L+  +D +LA+ L Q L  +RY++V
Sbjct  83   SFFDICGWVTVSEDYSYRKMLLGLLKDANIGMEEELDKKSDSNLAVCLKQSLMSRRYLIV  142

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGS-KSYFSHQMHLLDESESWE  8
            VDD+WS +AWDD+  C PDD   SRVLLTTR   VA    S K  F  QMHLLD  +SW 
Sbjct  143  VDDIWSKKAWDDIRLCLPDDDKRSRVLLTTRDVEVAQYASSPKDPF--QMHLLDTDDSWN  200

Query  7    LF  2
            LF
Sbjct  201  LF  202



>gb|AFB17983.1| Rx-like protein, partial [Solanum chacoense]
Length=350

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/185 (46%), Positives = 114/185 (62%), Gaps = 9/185 (5%)
 Frame = -2

Query  553  SQVISSQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVY  377
            S V   +HA    E  MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA ++Y
Sbjct  3    SLVSLPEHAVEQPENTMVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLATKLY  61

Query  376  EDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQR  197
             DP +   FD+RA    SQ +  R +L+GLL   S +       D+ LA +L + LK +R
Sbjct  62   SDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDE------PDDQLADRLQKHLKGRR  115

Query  196  YMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESE  17
            Y+VV+DD+WS EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L++  E
Sbjct  116  YLVVIDDIWSTEAWDDIKLCFPDCINGSRILLTTRNVEVAE-YASSGKPPHHMRLMNFDE  174

Query  16   SWELF  2
            SW L 
Sbjct  175  SWNLL  179



>gb|ACE79436.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 117/182 (64%), Gaps = 10/182 (5%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIEL--GSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
            HAS  + +MVG   E E   K+L +L  GS + +V+S+ GMGG+GK+T A++++  PSV 
Sbjct  26   HASTFENDMVGYNFEQE---KMLSQLTSGSTQMEVISVTGMGGVGKSTFAKKLFSHPSVL  82

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVV  185
              FD+  WV  S+ ++ R+ML+GLL   +I  +  L+  +D +LA+ L Q L  +RY++V
Sbjct  83   SFFDICGWVTVSEDYSYRKMLLGLLKDANIGMEEELDKKSDSNLAVCLKQSLMSRRYLIV  142

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGS-KSYFSHQMHLLDESESWE  8
            VDD+WS +AWDD+  C PDD   SRVLLTTR   VA    S K  F  QMHLLD  +SW 
Sbjct  143  VDDIWSKKAWDDIRLCLPDDDKRSRVLLTTRDVEVAQYASSPKDPF--QMHLLDTDDSWN  200

Query  7    LF  2
            LF
Sbjct  201  LF  202



>gb|AAF09256.1|AF202179_1 disease resistance protein BS2 [Capsicum chacoense]
Length=905

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 111/174 (64%), Gaps = 3/174 (2%)
 Frame = -2

Query  517  KEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            K  MVG+ D+ + + + L    S E KV+ I+GMGGIGKTTLA++VY D S+   FDV A
Sbjct  149  KNNMVGRDDQRKQLLEDLTRSYSGEPKVIPIVGMGGIGKTTLAKEVYNDESILCRFDVHA  208

Query  337  WVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVVVDDVWSGE  161
            W   SQ HNK+++L+GLL S  K  +      E +LA  L + LKR+RY++V+DD+WS E
Sbjct  209  WATISQQHNKKEILLGLLHSTIKMDDRVKMIGEAELADMLQKSLKRKRYLIVLDDIWSCE  268

Query  160  AWDDVSNCFP-DDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
             WD V  CFP +D  GSR+LLTTR   VA C      FS +M  +D+ ESW LF
Sbjct  269  VWDGVRRCFPTEDNAGSRILLTTRNDEVA-CYAGVENFSLRMSFMDQDESWSLF  321



>ref|XP_009758245.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009758246.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=873

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 115/179 (64%), Gaps = 4/179 (2%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIH  353
            HAS  + +MVG   E E +   L   GS E +V+S+ GMGGIGK+T A++++  PS+   
Sbjct  141  HASTLENDMVGYNIEQENMLSQLTS-GSPELEVISVTGMGGIGKSTFAKKLFSHPSILSF  199

Query  352  FDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVVVD  179
            FD+R W+  S+ ++ R ML+GLL   +I K+ +L+  +D DLA+ L Q L  +RY++VVD
Sbjct  200  FDIRGWITVSENYSYRNMLLGLLKDANIGKEEDLDKKSDSDLAVCLKQSLMGRRYLIVVD  259

Query  178  DVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            D+WS  AWD++  C PDDG  SRVLLTTR   VA    S      +MHLLD+ +SW LF
Sbjct  260  DIWSKNAWDEIRLCLPDDGKRSRVLLTTRDVEVAQ-YASSPKDPFRMHLLDQEDSWNLF  317



>ref|XP_009758244.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=883

 Score =   155 bits (391),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 115/179 (64%), Gaps = 4/179 (2%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIH  353
            HAS  + +MVG   E E +   L   GS E +V+S+ GMGGIGK+T A++++  PS+   
Sbjct  151  HASTLENDMVGYNIEQENMLSQLTS-GSPELEVISVTGMGGIGKSTFAKKLFSHPSILSF  209

Query  352  FDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVVVD  179
            FD+R W+  S+ ++ R ML+GLL   +I K+ +L+  +D DLA+ L Q L  +RY++VVD
Sbjct  210  FDIRGWITVSENYSYRNMLLGLLKDANIGKEEDLDKKSDSDLAVCLKQSLMGRRYLIVVD  269

Query  178  DVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            D+WS  AWD++  C PDDG  SRVLLTTR   VA    S      +MHLLD+ +SW LF
Sbjct  270  DIWSKNAWDEIRLCLPDDGKRSRVLLTTRDVEVAQ-YASSPKDPFRMHLLDQEDSWNLF  327



>gb|AEW48217.1| disease resistance protein RX5 [Solanum stenotomum]
Length=936

 Score =   155 bits (392),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 119/188 (63%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG+++EFE++   L   G +E ++VSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAVEQPENIMVGRENEFEMMLDQLAR-GGRELEIVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L GLL SIS +       D+ LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKATVSQEYCVRNVLQGLLSSISDE------PDDQLADRLQKRLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTRI  VA    S     + M L++
Sbjct  236  CRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRIVEVAA-YASSGKPPYHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>emb|CDP00690.1| unnamed protein product [Coffea canephora]
Length=604

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 118/188 (63%), Gaps = 4/188 (2%)
 Frame = -2

Query  562  LQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQ  383
            LQ S V  +  +S+ ++ +VG   E   I + L  L   E  +V+I GMGGIGKTTLAR+
Sbjct  12   LQGSSVRKAPLSSNKEDIVVGLDAELTTILEGLTGLPGLE--IVTISGMGGIGKTTLARK  69

Query  382  VYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN-LENSTDEDLALKLYQCLK  206
             + DP +  HF  RAW+  SQ++  R +L+GLL SI++  + +   ++  LA  +Y+ LK
Sbjct  70   AFNDPYIVYHFYCRAWITVSQVYQVRDLLLGLLSSIARSTDKMVEKSNAQLAEAVYRSLK  129

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
              RYM+V+DD+WS +AW+DV  CFPDD NGSR+++TTR   +AT +  K    H M+LL 
Sbjct  130  GMRYMIVMDDMWSIDAWNDVKRCFPDDKNGSRIVVTTRFMELATNVSPKKP-PHCMNLLS  188

Query  25   ESESWELF  2
              + WEL 
Sbjct  189  AEQRWELL  196



>gb|ACE79431.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACE79450.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACE79460.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 117/181 (65%), Gaps = 8/181 (4%)
 Frame = -2

Query  532  HASHSKEEMVGKK-DEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            HA   + +MVG   ++  ++ +L  +  S E +V+S+ GMGGIGK+T A++++  PSV  
Sbjct  26   HAPTHENDMVGYNIEQANMLSQLTRD--SPELEVISVTGMGGIGKSTFAKKLFSHPSVLS  83

Query  355  HFDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVVV  182
             FD+R WV  S+ ++ R ML+GLL+  +I K+ +L+  +D DLA+ L Q L  +RY++VV
Sbjct  84   FFDIRGWVTVSEDYSYRNMLLGLLEDANIGKEEDLDKKSDSDLAVCLKQSLMGRRYLIVV  143

Query  181  DDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGS-KSYFSHQMHLLDESESWEL  5
            DD+WS  AWD++  C PDDG  SRVLLTTR   VA    S K  F  +MHLL   +SW L
Sbjct  144  DDIWSKNAWDEIRLCLPDDGKRSRVLLTTRDVEVAQYASSPKDPF--RMHLLGPDDSWNL  201

Query  4    F  2
            F
Sbjct  202  F  202



>gb|AGX27504.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
Length=373

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 117/187 (63%), Gaps = 7/187 (4%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVY  377
            S V SS  A +   +MVG  +D  E+  +L  E  S + +++SI+GMGGIGKTTLA  ++
Sbjct  135  SAVPSSGGAPNDGNKMVGFNEDLLELKARLCGE--SSKLQIISIVGMGGIGKTTLATNIF  192

Query  376  EDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQ--GNLENSTDEDLALKLYQCLKR  203
             D  V+ HF VR W   SQ ++ RQ+L+ L+ S++ Q   +L N  DE+L   +Y+ LK 
Sbjct  193  NDSLVAYHFHVRVWTTVSQDYHLRQVLLDLVASLTDQKTTDLSNMKDEELVECVYKTLKG  252

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            + Y++V+DD+WS + WDDV   FPDD NGSRVL+TTR++ VA    S     HQM  LDE
Sbjct  253  RTYLIVMDDMWSTKTWDDVRRFFPDDSNGSRVLMTTRLSDVAVYASSSPL--HQMRFLDE  310

Query  22   SESWELF  2
              SW L 
Sbjct  311  EWSWNLL  317



>gb|AEW48194.1| disease resistance protein RGH5 [Solanum chacoense]
Length=914

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 117/188 (62%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG ++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAFEQPENIMVGYENEFEMMLDKLVR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L GLL SIS +       D+ LA +L + LK
Sbjct  182  KLYSDPCIMSRFDIRAKATVSQEYCVRNVLQGLLSSISDE------PDDQLAARLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
              RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GGRYLVVIDDIWTTEAWDDIKLCFPDRYNGSRILLTTRNVEVAE-YASSGKPHHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>gb|AEW48191.1| disease resistance protein RGH2 [Solanum chacoense]
Length=914

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 117/188 (62%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG ++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAFEQPENIMVGYENEFEMMLDKLVR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L GLL SIS +       D+ LA +L + LK
Sbjct  182  KLYSDPCIMSRFDIRAKATVSQEYCVRNVLQGLLSSISDE------PDDQLAARLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
              RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GGRYLVVIDDIWTTEAWDDIKLCFPDRYNGSRILLTTRNVEVAE-YASSGKPHHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>gb|ABY61745.1| resistance protein PSH-RGH6 [Solanum tuberosum]
Length=873

 Score =   154 bits (390),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 117/188 (62%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG ++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAFEQPENIMVGYENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L GLL SIS +       D+ LA +L + LK
Sbjct  182  KLYSDPCIMPRFDIRAKATVSQEYCVRNVLQGLLSSISDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ E WDD+  CFPD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTETWDDIKLCFPDCNNGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FEESWNLL  302



>ref|XP_009624115.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=902

 Score =   154 bits (389),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 127/199 (64%), Gaps = 6/199 (3%)
 Frame = -2

Query  586  GRKTAHDVLQRSQVI--SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMG  413
            G +T+ D+  ++ ++  +S+ A   +  MVG ++EFE+++  L   G+ E +VVSI+GMG
Sbjct  118  GTQTSLDLKAQNTILASTSERALEPENMMVGHENEFEMMQVQLAR-GASELEVVSIVGMG  176

Query  412  GIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDE  239
            GIGKTTLA +++ DP +  HFD+RA V  SQ +  R  L+GLL SI+ + +   E   D 
Sbjct  177  GIGKTTLANKIFSDPLIMYHFDIRAKVTISQEYCARNGLLGLLSSITGKTDKPYEQQDDG  236

Query  238  DLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSK  59
             L  +L + LK +RY++V+DD+W+  AWDD+  CFPD  N SR+LLTTR   VA    S 
Sbjct  237  QLKDRLQKLLKGRRYLIVIDDIWNEAAWDDIKLCFPDCNNRSRILLTTRNVKVAE-YASS  295

Query  58   SYFSHQMHLLDESESWELF  2
                +QM LL+ +ESW+L 
Sbjct  296  GKPPYQMRLLNCNESWDLL  314



>gb|AEW48216.1| disease resistance protein RX3 [Solanum leptophyes x Solanum 
sparsipilum]
Length=937

 Score =   154 bits (389),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/188 (46%), Positives = 118/188 (63%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L+ LL SIS +       D+ LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKATVSQEYCVRNVLLALLSSISDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L+ 
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAE-YASSGKPPHHMRLMK  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>gb|ACE79440.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/181 (46%), Positives = 114/181 (63%), Gaps = 8/181 (4%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIEL--GSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
            HAS  + +MVG   E E   K+L +L  GS + +V+S+ GMGGIGK+T A++++  PSV 
Sbjct  26   HASTFENDMVGYNFEQE---KMLSQLTSGSTQMEVISVTGMGGIGKSTFAKKLFSHPSVL  82

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVV  185
              FD+  WV  S+  + R+ML+GLL   +I  +  L+  +D +LA+ L Q L  +RY++V
Sbjct  83   SFFDICGWVTVSEDCSYRKMLLGLLKDANIGMEEELDKKSDSNLAVCLKQSLMSRRYLIV  142

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            VDD+WS +AWDD+  C PDD   SRVLLTTR   VA    S      QMHLLD  +SW L
Sbjct  143  VDDIWSKKAWDDIRLCLPDDDKRSRVLLTTRDVEVAQ-YASSPKDPFQMHLLDTDDSWNL  201

Query  4    F  2
            F
Sbjct  202  F  202



>gb|ACF21990.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=272

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 115/180 (64%), Gaps = 6/180 (3%)
 Frame = -2

Query  532  HASHSKEEMVGKK-DEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            HA   + +MVG   ++  ++ +L  +  S E +V+S+ GMGGIGK+T A++++  PSV  
Sbjct  26   HAPTHENDMVGYNIEQANMLSQLTRD--SPELEVISVTGMGGIGKSTFAKKLFSHPSVLS  83

Query  355  HFDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVVV  182
             FD+R WV  S+ ++ R ML+GLL+  +I K+ +L+  +D DLA+ L Q L  +RY++VV
Sbjct  84   FFDIRGWVTVSEDYSYRNMLLGLLEDANIGKEEDLDKKSDSDLAVCLKQSLMGRRYLIVV  143

Query  181  DDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            DD+WS  AWD++  C PDDG  SRVLLTTR   VA    S      +MHLL   +SW LF
Sbjct  144  DDIWSKNAWDEIRLCLPDDGKRSRVLLTTRDVEVAQ-YASSPKDPVRMHLLGPDDSWNLF  202



>gb|AEW48205.1| disease resistance protein RGH2 [Solanum fernandezianum]
Length=873

 Score =   153 bits (387),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 118/189 (62%), Gaps = 10/189 (5%)
 Frame = -2

Query  562  LQRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLA  389
            LQ S ++S  +HA    E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA
Sbjct  122  LQTSSLVSFPEHAYEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLA  180

Query  388  RQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCL  209
             ++Y DP +   FD+RA    SQ +  R +L GLL SIS +       D+ LA +L + L
Sbjct  181  AKLYSDPCIMSRFDIRAKATVSQEYCVRNVLHGLLSSISDE------PDDQLADRLQKHL  234

Query  208  KRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLL  29
            K +RY+VV+DD+W+ E WDD+  CFPD  NGSR+ LTTR   VA    S     H M L+
Sbjct  235  KGRRYLVVIDDIWTTEGWDDIKLCFPDCYNGSRIFLTTRNVEVAEYASSGKPL-HHMRLM  293

Query  28   DESESWELF  2
            +  ESW L 
Sbjct  294  NFDESWNLL  302



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score =   154 bits (388),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 112/173 (65%), Gaps = 3/173 (2%)
 Frame = -2

Query  517  KEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            K  +VG + + E ++  L    SK + +VSI+GMGGIGKTTLARQ Y+D  +  HFD RA
Sbjct  223  KNVVVGFESDLEEMRTRLTGASSK-RDIVSIVGMGGIGKTTLARQAYDDSYIVYHFDTRA  281

Query  337  WVVASQLHNKRQMLVGLLDSIS-KQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGE  161
            WV  SQ ++ RQ+L+GLLDS       + +  +E+LA  LY+ L  +RY++V+DD+W  +
Sbjct  282  WVTVSQEYSLRQVLIGLLDSAKILTEKMYDKREEELADCLYKGLVGRRYLIVMDDIWDTQ  341

Query  160  AWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
             WD V   FP+D NGSR+LLTTR++ VA C  S S   H+M  L E ESW L 
Sbjct  342  IWDAVRRFFPNDCNGSRILLTTRLSDVALCADSFSPL-HKMQFLKEGESWNLL  393



>ref|XP_009772438.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772439.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=877

 Score =   153 bits (387),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 115/179 (64%), Gaps = 4/179 (2%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIH  353
            HAS  + +MVG   E E +   L   GS E +V+S+ GMGGIGK+T A++++  PS+   
Sbjct  141  HASTLENDMVGYNIEQENMLSQLTS-GSPELEVISVTGMGGIGKSTFAKKLFSHPSILSF  199

Query  352  FDVRAWVVASQLHNKRQMLVGLL--DSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVD  179
            FD+R W+  S+ ++ R ML+GLL   +I K+ +L+  ++ DLA+ L Q L  +RY++VVD
Sbjct  200  FDIRGWITVSENYSYRNMLLGLLIDANIGKEEDLDKKSNSDLAVCLKQSLMGRRYLIVVD  259

Query  178  DVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            D+WS  AWD++  C PDDG  SRVLLTTR   VA    S      +MHLLD+ +SW LF
Sbjct  260  DIWSKNAWDEIRLCLPDDGKRSRVLLTTRDVEVAQ-YASSPKDPFRMHLLDQEDSWNLF  317



>gb|ACF21988.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=272

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 117/181 (65%), Gaps = 8/181 (4%)
 Frame = -2

Query  532  HASHSKEEMVGKK-DEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            HA   + +MVG   ++  ++ +L  +  S E +V+S+ GMGGIGK+T A++++  PSV  
Sbjct  26   HAPTHENDMVGYNIEQANMLSQLTRD--SPELEVISVTGMGGIGKSTFAKKLFSHPSVLS  83

Query  355  HFDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVVV  182
             FD+R WV  S+ ++ R ML+GLL+  +I K+ +L+  +D DLA+ L Q L  ++Y++VV
Sbjct  84   FFDIRGWVTVSEDYSYRNMLLGLLEDANIGKEEDLDKKSDSDLAVCLKQSLMGRKYLIVV  143

Query  181  DDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGS-KSYFSHQMHLLDESESWEL  5
            DD+WS  AWD++  C PDDG  SRVLLTTR   VA    S K  F  +MHLL   +SW L
Sbjct  144  DDIWSKNAWDEIRLCLPDDGKRSRVLLTTRDVEVAQYASSPKDPF--RMHLLGPDDSWNL  201

Query  4    F  2
            F
Sbjct  202  F  202



>gb|AFB17979.1| Rx-like protein, partial [Solanum marinasense]
Length=350

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 115/185 (62%), Gaps = 9/185 (5%)
 Frame = -2

Query  553  SQVISSQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVY  377
            S V   +HA    E  MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA ++Y
Sbjct  3    SLVSLPEHAFEQPENIMVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLATKLY  61

Query  376  EDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQR  197
             DP +   FD+RA    SQ +  R +++GLL S S +      +D+ LA +L + LK +R
Sbjct  62   SDPYIMSRFDIRAKATVSQEYCVRNVILGLLPSRSDE------SDDQLADRLQKHLKGRR  115

Query  196  YMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESE  17
            Y+VV+DD+W+ EAWDD+  CFPD   GSR+LLTTR   VA    S     H M L++  E
Sbjct  116  YLVVIDDIWTTEAWDDIKLCFPDCYKGSRILLTTRNVEVAE-YASSGKPPHHMRLMNFDE  174

Query  16   SWELF  2
            SW L 
Sbjct  175  SWNLL  179



>ref|XP_009780398.1| PREDICTED: putative late blight resistance protein homolog R1A-3, 
partial [Nicotiana sylvestris]
Length=186

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 110/169 (65%), Gaps = 3/169 (2%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MV   +E E++ + L+  G ++  V+SI GM G+GKTTLA+++Y+  ++S  FD+R W  
Sbjct  1    MVDFNEEIEMLVEQLVT-GQRQLDVISIFGMPGLGKTTLAKKLYDHEAISNRFDIRLWCC  59

Query  328  ASQLHNKRQMLVGLLDSISKQGNLEN-STDEDLALKLYQCLKRQRYMVVVDDVWSGEAWD  152
            +SQ ++KR +L  LL  I +  ++    +D++LA KLY+ LK +RY++VVDDVWS  AWD
Sbjct  60   SSQSYDKRALLFELLGHICELDDITKVKSDDELAEKLYRYLKGKRYLIVVDDVWSSNAWD  119

Query  151  DVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            D+   FPDD  GSR++LTTR+  +AT     S   H + L  E ESW L
Sbjct  120  DIKRPFPDDNKGSRIILTTRLESIATYAMIDSS-PHHLRLFTEEESWML  167



>gb|AFB17980.1| Rx-like protein, partial [Solanum marinasense]
Length=350

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 115/185 (62%), Gaps = 9/185 (5%)
 Frame = -2

Query  553  SQVISSQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVY  377
            S V   +HA    E  MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA ++Y
Sbjct  3    SLVSLPEHAFEQPENIMVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLATKLY  61

Query  376  EDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQR  197
             DP +   FD+RA    SQ +  R +++GLL S S +      +D+ LA +L + LK +R
Sbjct  62   SDPYIMSRFDIRAKATVSQEYCVRNVILGLLPSRSDE------SDDQLADRLQKHLKGRR  115

Query  196  YMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESE  17
            Y+VV+DD+W+ EAWDD+  CFPD   GSR+LLTTR   VA    S     H M L++  E
Sbjct  116  YLVVIDDIWTTEAWDDIKLCFPDCYKGSRILLTTRNVEVAE-YASSGKPPHPMRLMNFDE  174

Query  16   SWELF  2
            SW L 
Sbjct  175  SWNLL  179



>gb|EYU21437.1| hypothetical protein MIMGU_mgv1a020693mg [Erythranthe guttata]
Length=916

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 122/199 (61%), Gaps = 7/199 (4%)
 Frame = -2

Query  586  GRKTAHDVLQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGI  407
             + T H + Q +++ S++  S  K  MVG  ++   IK  L    SK  +++ ++GMGGI
Sbjct  175  SQNTEH-IFQVTRIFSAEVNSPRKTTMVGFDEDLMEIKDQLCGDSSK-LQIIPLVGMGGI  232

Query  406  GKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDED---  236
            GKTTLA  ++ DP +  HF +RAW+  SQ +N R+++  LL SIS   +  +   ED   
Sbjct  233  GKTTLATNIFHDPLIEYHFHIRAWITISQRYNIREIIRSLLSSISTNTDKLSRETEDREM  292

Query  235  -LALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSK  59
             LA+ LY+ LK +++++V+DD+WS EAWDD+   FPDD NGSR++LTTR+  VA    S 
Sbjct  293  ELAVCLYKSLKGRKFLIVLDDIWSTEAWDDIKMLFPDDRNGSRIVLTTRLVDVAVYANSF  352

Query  58   SYFSHQMHLLDESESWELF  2
              F H +  L+E +SW L 
Sbjct  353  GPF-HNIQFLNEDQSWNLL  370



>gb|AEW48195.1| disease resistance protein RGH6 [Solanum chacoense]
Length=912

 Score =   153 bits (386),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 119/188 (63%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA V  SQ +  R +++GLL SIS +       +  LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKVTVSQEYCVRNVILGLLSSISDE------PENQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>gb|ACF21987.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=261

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 117/181 (65%), Gaps = 8/181 (4%)
 Frame = -2

Query  532  HASHSKEEMVGKK-DEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            HA   + +MVG   ++  ++ +L  +  S E +V+S+ GMGGIGK+T A++++  PSV  
Sbjct  15   HAPTHENDMVGYNIEQANMLSQLTRD--SPELEVISVTGMGGIGKSTFAKKLFSHPSVLS  72

Query  355  HFDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVVV  182
             FD+R WV  S+ ++ R ML+GLL+  +I K+ +L+  +D DLA+ L Q L  +RY++VV
Sbjct  73   FFDIRGWVTVSEDYSYRNMLLGLLEDANIGKEEDLDKKSDSDLAVCLKQSLMGRRYLIVV  132

Query  181  DDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGS-KSYFSHQMHLLDESESWEL  5
            DD+WS  AWD++  C PDDG  S+VLLTTR   VA    S K  F  +MHLL   +SW L
Sbjct  133  DDIWSKNAWDEIRLCLPDDGKRSQVLLTTRDVEVAQYASSPKDPF--RMHLLGPDDSWNL  190

Query  4    F  2
            F
Sbjct  191  F  191



>gb|AEW48214.1| disease resistance protein RGH4 [Solanum leptophyes x Solanum 
sparsipilum]
Length=878

 Score =   152 bits (385),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 117/188 (62%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGK TLA 
Sbjct  123  QTSSLVSLPEHAVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKATLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L GLL SIS +       D+ LA +L + LK
Sbjct  182  KLYSDPCIMSRFDIRAKATVSQEYCVRNVLQGLLSSISDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+ LTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRIFLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_009803728.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=1076

 Score =   153 bits (387),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 113/181 (62%), Gaps = 4/181 (2%)
 Frame = -2

Query  538  SQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
            SQHA   +  MVG ++EFEII+   I  G++E +VVSI+GMGGIGKTTLA ++Y DP + 
Sbjct  302  SQHALEMENMMVGHENEFEIIQDQ-IARGARELEVVSIVGMGGIGKTTLANRIYCDPFIV  360

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQRYMVV  185
              FD+RA    SQ H  R +L+ LL S   + +   E   D  LA +L + LK +RY+VV
Sbjct  361  SRFDIRAKATLSQEHCVRNVLLRLLSSTRGKTDECYEEQDDGQLADRLQKLLKGKRYLVV  420

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+W+ EAWDD+  CFPD  NG R+LLTTR   VA    S     + M L++  ESW L
Sbjct  421  IDDIWTTEAWDDIKLCFPDCNNGGRILLTTRNVEVAE-YASSGKPPYHMRLMNFDESWNL  479

Query  4    F  2
             
Sbjct  480  L  480



>gb|AEW48193.1| disease resistance protein RGH4 [Solanum chacoense]
Length=914

 Score =   153 bits (386),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 119/188 (63%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA V  SQ +  R +++GLL SIS +       +  LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKVTVSQEYCVRNVILGLLSSISDE------PENQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNLEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 111/173 (64%), Gaps = 3/173 (2%)
 Frame = -2

Query  517  KEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            +E +VG  DE   I   L   GS+E +++SI+GMGG+GKTTLA++VY DPSV  HF  RA
Sbjct  153  EENVVGFDDEAMKISSRLTN-GSEELEIISIVGMGGLGKTTLAKKVYTDPSVEFHFYNRA  211

Query  337  WVVASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGE  161
            W+  SQL++++++ +G+LDS+      +    DE LA +L+  L+ +RY+VV+DDVW+ E
Sbjct  212  WIYVSQLYSRKEVFLGILDSLGLITDEMYKMNDEKLAGELFSHLRSKRYLVVIDDVWTME  271

Query  160  AWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            AWDD+   FP   +GSR+LLTTR   VA     +    H +  L   ESWEL 
Sbjct  272  AWDDLQMAFPKTASGSRILLTTRNTEVALHANPEG-LPHHLRFLTHEESWELL  323



>ref|XP_010312513.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312514.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312515.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
 ref|XP_010312516.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=881

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/195 (42%), Positives = 120/195 (62%), Gaps = 4/195 (2%)
 Frame = -2

Query  586  GRKTAHDVLQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGI  407
            G K+A   L  +     Q ++  +  +VG KD+F II   L    + E  V+ I+GMGGI
Sbjct  126  GTKSAE--LATTPFSPDQKSTIVENTVVGMKDDFNIILDRLTA-QTDELIVIPILGMGGI  182

Query  406  GKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLAL  227
            GKTTLAR+VY+D  +   FD  AWV  SQ +N+RQML+ ++ SI+ +G+ E S DE + +
Sbjct  183  GKTTLARKVYDDSCIRSRFDKLAWVTISQEYNERQMLLEVVSSITTKGSQEMSNDELMEI  242

Query  226  KLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFS  47
             +Y+ LK +R+++V+DD+WS EAW+ +   FP+D N SR+LLTTR+  VA  +    +  
Sbjct  243  -VYRGLKGRRFLIVIDDIWSTEAWNQMQRIFPNDDNKSRILLTTRLKYVADYVNCPDFPP  301

Query  46   HQMHLLDESESWELF  2
            H    L   +SW LF
Sbjct  302  HSKSFLSLEDSWNLF  316



>gb|AEW48202.1| disease resistance protein RGH4 [Solanum ehrenbergii]
 gb|AEW48203.1| disease resistance protein RGH7 [Solanum ehrenbergii]
Length=914

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 118/188 (63%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA V  SQ +  R +++GLL SIS +       +  LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKVTVSQEYCVRNVILGLLSSISDE------PENQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L+ 
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAE-YASSGKPPHHMRLMK  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_009780928.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
 ref|XP_009780934.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana sylvestris]
Length=935

 Score =   152 bits (385),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 114/180 (63%), Gaps = 3/180 (2%)
 Frame = -2

Query  538  SQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
             + A   +  MVG + EFE+++  L   GS E +VVSI GMGGIGKTTLA ++Y DP + 
Sbjct  135  PERAVEPENIMVGHESEFEMMQDRLAR-GSSELEVVSITGMGGIGKTTLANKLYSDPFIM  193

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVVV  182
              FD+RA V  SQ + KR +L+GLL  IS + N     D+  LA +L + LK +RY +++
Sbjct  194  SRFDIRAKVTISQEYCKRNVLLGLLSPISGRTNEYFEQDDGQLADQLQKLLKGRRYFILI  253

Query  181  DDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            DD+W+ EAWDD+  CFP+  NGSR+LLTTR   VA    S      QM LLD +ESW+L 
Sbjct  254  DDIWTSEAWDDIKLCFPEYTNGSRILLTTRNVEVAK-YASSGNPPCQMRLLDFNESWDLL  312



>emb|CDP16512.1| unnamed protein product [Coffea canephora]
Length=907

 Score =   152 bits (384),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/198 (46%), Positives = 125/198 (63%), Gaps = 8/198 (4%)
 Frame = -2

Query  583  RKTAHDVLQRSQV--ISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGG  410
            R + HD L RS +  I+        E +VG  D+  +I   LI  GS +  VVSIIGM G
Sbjct  142  RVSTHD-LPRSPMKDIAPAKIPQIDEVVVGLADQKRLIIDRLIA-GSSQLDVVSIIGMAG  199

Query  409  IGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLL-DSISKQGNLENSTDEDL  233
            +GKTTLA +VY DPSV+ HF +RAW   SQ ++K ++L+ +L D +     +   ++EDL
Sbjct  200  LGKTTLAWKVYNDPSVTYHFHIRAWCCISQAYHKGELLLQILGDIMEITEEILEMSNEDL  259

Query  232  ALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSY  53
             LKLY+CLK +RY++V+DD+WS EAW D    FP+D NGSRVL+T+R   VA  I  K+Y
Sbjct  260  ELKLYRCLKGKRYLIVMDDIWSIEAWYDFKRSFPNDNNGSRVLITSRHFDVAEKI--KAY  317

Query  52   FS-HQMHLLDESESWELF  2
             S H +  L + ESW+L 
Sbjct  318  SSPHLLRPLSDDESWKLL  335



>gb|AEW48186.1| disease resistance protein RGH2 [Solanum albicans]
Length=910

 Score =   152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 120/188 (64%), Gaps = 12/188 (6%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA V  SQ +  R +++GLL SIS +   EN  ++    +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKVTVSQEYCVRNVILGLLSSISDEP--ENQLED----RLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA   G      H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNVEVAEYSGKP---PHHMRLMN  292

Query  25   ESESWELF  2
              ESW L 
Sbjct  293  FDESWNLL  300



>gb|ACE79507.1| NBS-coding resistance gene analog [Nicotiana sylvestris]
Length=288

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 113/174 (65%), Gaps = 10/174 (6%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            +VG +D F  I+  L    +    VVSI+GMGGIGK+TLAR ++  PSVS  FD+ +WV 
Sbjct  16   LVGMEDVFNNIRDQLFG-QTPALNVVSIVGMGGIGKSTLARSLFNHPSVSRRFDISSWVT  74

Query  328  ASQLHNKRQMLV-----GLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSG  164
             SQ +N ++ML+     G+LD    +    N+++++L  ++ + LKR+RY++V+D++W+ 
Sbjct  75   VSQAYNAKEMLLDVLSFGILDG---KAMYRNTSEDELLDQVRRKLKRKRYLIVLDNIWTI  131

Query  163  EAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            EAWD+V   FPDD NGSR+++TTR+  VA C  S  +  H M LL   +SW+L 
Sbjct  132  EAWDEVRRSFPDDENGSRIMITTRLLEVANC-ASNDFSPHHMPLLSLEDSWKLL  184



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score =   150 bits (379),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 112/173 (65%), Gaps = 3/173 (2%)
 Frame = -2

Query  517  KEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            K  +VG + + E ++  L    SK + +VSI+GMGGIGKTTLARQ Y+D  +  HFD RA
Sbjct  21   KNVVVGFESDLEEMRTRLTGASSK-RDIVSIVGMGGIGKTTLARQAYDDSYIVYHFDTRA  79

Query  337  WVVASQLHNKRQMLVGLLDSIS-KQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGE  161
            WV  SQ ++ RQ+LVGLLDS       + + T+E+LA  LY+ L  +RY++V+DD+W  +
Sbjct  80   WVTVSQEYSLRQVLVGLLDSAKILTEKMYDKTEEELADCLYKGLVGRRYLIVMDDIWDTQ  139

Query  160  AWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
             WD V   FP+D N SR+LLTTR++ VA    S S   H+M  L E ESW LF
Sbjct  140  IWDAVRRFFPNDCNRSRILLTTRLSDVALYADSFSPL-HKMQFLKEGESWNLF  191



>ref|XP_009772441.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=872

 Score =   151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 114/179 (64%), Gaps = 4/179 (2%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIH  353
            HAS  + +MVG   E   +   L   GS E +V+S+ GMGGIGK+T A++++  PS+   
Sbjct  141  HASTLENDMVGYNIEQANMMSQLTS-GSPELEVISVTGMGGIGKSTFAKKLFSHPSILSF  199

Query  352  FDVRAWVVASQLHNKRQMLVGLL--DSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVD  179
            FD+R W+  S+ ++ R ML+GLL   +I K+ +L+  ++ DLA+ L Q L  +RY++VVD
Sbjct  200  FDIRGWITVSENYSYRNMLLGLLIDANIGKEEDLDKKSNSDLAVCLKQSLMGRRYLIVVD  259

Query  178  DVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            D+WS  AWD++  C PDDG  SRVLLTTR   VA    S      +MHLLD+ +SW LF
Sbjct  260  DIWSKNAWDEIRLCLPDDGKRSRVLLTTRDVEVAQ-YASSPKDPFRMHLLDQEDSWNLF  317



>ref|XP_011091064.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=856

 Score =   151 bits (382),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 116/184 (63%), Gaps = 4/184 (2%)
 Frame = -2

Query  547  VISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDP  368
            V+SS   S S   +VG  ++   +K  L  L S E +++ I+GMGGIGKTTLAR +Y DP
Sbjct  134  VVSSTPDSTSNNIVVGLDEDLIQLKDRLTGLES-ELQIIPIVGMGGIGKTTLARNLYNDP  192

Query  367  SVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLE--NSTDEDLALKLYQCLKRQRY  194
             V  HFD RAW+V SQ ++ R +L+GLL  I  +   E     +  LA+ LY+ L  +RY
Sbjct  193  LVVSHFDTRAWIVISQDYDVRAILLGLLGCIVGKLTDEVLQKNNSQLAVALYKNLTGRRY  252

Query  193  MVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESES  14
            +VV+DD+WS +AWD++   FP + N SR++LTTR + VA  +   S + HQMHLL  SES
Sbjct  253  LVVLDDIWSTDAWDNIKMFFPGNNNRSRIVLTTRESNVANYVDLSSSY-HQMHLLTNSES  311

Query  13   WELF  2
            W L 
Sbjct  312  WNLL  315



>ref|XP_009625958.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625959.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625960.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625961.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625962.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625963.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625964.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625965.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625966.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625967.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=873

 Score =   151 bits (381),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 118/180 (66%), Gaps = 6/180 (3%)
 Frame = -2

Query  532  HASHSKEEMVGKK-DEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            HA   + +MVG   ++  ++ +L    GS E +V+S+ GMGGIGK+T A++++  PS+  
Sbjct  141  HALTLENDMVGYNIEQANMLSRL--TSGSPELEVISVTGMGGIGKSTFAKKLFSHPSILS  198

Query  355  HFDVRAWVVASQLHNKRQMLVGLL--DSISKQGNLENSTDEDLALKLYQCLKRQRYMVVV  182
             FD+R W+  S+ ++ R+ML+GLL   +I K+ +L+  +D DLA+ L Q L  +RY++VV
Sbjct  199  FFDIRGWITVSEDYSYRKMLLGLLVDANIGKEEDLDKKSDSDLAVCLKQNLMGRRYLIVV  258

Query  181  DDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            DD+WS  AWD++S C PDDG  SRVLLTTR   VA    S      +MHLLD+ +SW LF
Sbjct  259  DDIWSKNAWDEISLCLPDDGKRSRVLLTTRDVEVAQ-YASSPKDPFRMHLLDQEDSWNLF  317



>gb|AEW48189.1| disease resistance protein RGH9 [Solanum albicans]
Length=912

 Score =   151 bits (382),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 120/188 (64%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA V  SQ +  R +++GLL SIS +   EN  ++    +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKVTVSQEYCVRNVILGLLSSISDEP--ENQLED----RLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score =   150 bits (379),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 128/197 (65%), Gaps = 12/197 (6%)
 Frame = -2

Query  565  VLQRSQVISSQHASHSKEEM-VGKKDEFEIIK------KLLIELGSKEKKVVSIIGMGGI  407
            V +++ +I  Q+  ++ EE+ + +++  E IK      +L+++  S E  VV IIGMGGI
Sbjct  94   VRRKADMIFHQNLEYAIEEIDLIQREVIEKIKVNKIKDRLIVQSSSLE--VVPIIGMGGI  151

Query  406  GKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNL--ENSTDEDL  233
            GKTTLAR+VY+D  ++ HF VRAW   SQ  + R++ +G+L SI    +    NST+E L
Sbjct  152  GKTTLARRVYDDSLIAYHFYVRAWTNVSQEFDTREIFLGILRSIGVVNDEVERNSTNEQL  211

Query  232  ALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSY  53
            A ++Y+ LK  +Y++V+DD+WS +AW  V   FPDD NGSR++LTTR+  VA+C+ S + 
Sbjct  212  AERVYRSLKGMKYLIVLDDMWSIKAWQHVRRSFPDDRNGSRIVLTTRLVDVASCVCSGNS  271

Query  52   FSHQMHLLDESESWELF  2
              HQM  L   ESW+L 
Sbjct  272  L-HQMRFLSMEESWDLL  287



>gb|AEQ61798.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=174

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 100/141 (71%), Gaps = 2/141 (1%)
 Frame = -2

Query  421  GMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN-LENST  245
            GMGG GKTTLA+ +++D S+  +FD+RAW+  SQ ++ R +L+GLL S+   G+ ++  +
Sbjct  1    GMGGFGKTTLAKNIFDDASLGYYFDIRAWMTVSQNYHVRDILLGLLGSMKMLGDDMDQES  60

Query  244  DEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIG  65
            +  LA+ L++CLKR+RY+VV+DD+W  +AW ++ N FPDD NGSRVLLTTR++ +A    
Sbjct  61   NTKLAVHLHKCLKRRRYLVVLDDMWDTKAWSEMRNFFPDDVNGSRVLLTTRLSELAVYAN  120

Query  64   SKSYFSHQMHLLDESESWELF  2
            S     HQ+ LLD  +SW L 
Sbjct  121  SCPPI-HQLRLLDHYQSWILL  140



>gb|ACE79511.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=245

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 112/172 (65%), Gaps = 5/172 (3%)
 Frame = -2

Query  514  EEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            EE+VG +KD   I+KKL+   G+KE  V+SI GM G+GKTTLAR+VY +PS+  HFD R 
Sbjct  25   EEVVGFEKDAESIMKKLI--GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARV  82

Query  337  WVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEA  158
            W   SQ + +R +L+ +L   +  GN E   D+D+A KL + L  +RY++V+DD+W  EA
Sbjct  83   WCSVSQTYIERTLLIEILKQ-ATGGNYEIKEDDDIADKLRKTLIGRRYLIVLDDIWEVEA  141

Query  157  WDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            W+D+  CFP   +GSRV++TTRI  VA  +  +S   + +  L   ESWEL 
Sbjct  142  WEDLGLCFPKGEDGSRVMVTTRIEQVAKHLQHRSD-PYSLRFLTLEESWELL  192



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score =   150 bits (380),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 110/173 (64%), Gaps = 3/173 (2%)
 Frame = -2

Query  517  KEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            +E +VG  DE   I   L   GS+E +++SI+GMGG+GKTTLA++VY D S+  HF  RA
Sbjct  153  EENVVGFDDEARKISSRLTN-GSEELEIISIVGMGGLGKTTLAKKVYTDSSIEFHFYNRA  211

Query  337  WVVASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGE  161
            W+  SQL++++++ +G+LDS+S     +    DE LA +L+  L+ +RY+VV+DDVW+ E
Sbjct  212  WIYVSQLYSRKEVFLGILDSLSLITDEMYKMNDEKLAGELFSHLRSKRYLVVIDDVWTME  271

Query  160  AWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            AWDD+   FP    GSR+LLTTR   VA     +    H +  L   ESWEL 
Sbjct  272  AWDDLQMAFPKTATGSRILLTTRNTEVALHANPEG-LPHHLRFLTHEESWELL  323



>ref|XP_011093987.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=821

 Score =   150 bits (379),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 112/173 (65%), Gaps = 1/173 (1%)
 Frame = -2

Query  520  SKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVR  341
            +KEEM+   +  ++  K  +  G  E +V+ I+GMGGIGKTTLAR +Y DPSV  HFDVR
Sbjct  113  AKEEMMAIMEGRDMHLKYRLIGGKSELEVIPIVGMGGIGKTTLARNLYHDPSVISHFDVR  172

Query  340  AWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGE  161
             W   SQ +++  +L GLL SI     L    +E +  +LY+ LKR+RY++V+DD+W+ +
Sbjct  173  IWATISQDYSEGGILNGLLRSIWVSHPLLLLGNERMVEELYKGLKRRRYLIVLDDIWNKK  232

Query  160  AWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
             W  +  CFPDDG GSR+++TTR+  VA  I S S + H M+ L + ESW+L 
Sbjct  233  PWTVLRKCFPDDGTGSRIIVTTRLLEVADYIASGSSY-HHMNPLKDDESWKLL  284



>ref|XP_009606292.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X16 [Nicotiana tomentosiformis]
Length=957

 Score =   151 bits (381),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_009773240.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana sylvestris]
Length=675

 Score =   149 bits (375),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 112/181 (62%), Gaps = 4/181 (2%)
 Frame = -2

Query  538  SQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
              H+      MVG ++E E +K  L+E  S E +VV+I+GMGGIGKTT AR++Y+D  + 
Sbjct  67   PHHSVQLDNNMVGHENELEDMKSTLMETSSDETQVVAIVGMGGIGKTTFARRIYDDLEIK  126

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLDSI--SKQGNLENSTDEDLALKLYQCLKRQRYMVV  185
             HFD+ AWV  S+ +  R+ML+ LL  I  ++  + E + D +LA KL Q L ++RY+VV
Sbjct  127  SHFDILAWVTMSKEYGVRKMLLQLLHCIPSTEAVSREATDDGELADKLKQKLWKRRYLVV  186

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWDD+S  FP D  GS  LLTTR   VA+   S     H M  L   ESWEL
Sbjct  187  IDDIWSTKAWDDISQWFP-DSKGSHALLTTRCGNVASYAASGKP-PHHMSPLSSKESWEL  244

Query  4    F  2
             
Sbjct  245  L  245



>ref|XP_009606290.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X14 [Nicotiana tomentosiformis]
Length=971

 Score =   150 bits (380),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_009765788.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=364

 Score =   145 bits (367),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 115/172 (67%), Gaps = 7/172 (4%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            M+G + E E++ + L+  G ++  V+SI GM G+GKTTLA+++Y+  S+S  FD+R W  
Sbjct  1    MIGFEIETEMLMEKLVT-GPRQLDVISIFGMPGLGKTTLAKRLYDHESISNRFDIRLWCC  59

Query  328  ASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWD  152
            +SQ ++K+ +L  LL+ I K   + +  +D++LA KLY+ LK +RY++VVDDVWS EAWD
Sbjct  60   SSQSYDKKSLLFELLNHICKLDTSTKEKSDDELAEKLYKHLKGKRYLIVVDDVWSQEAWD  119

Query  151  DVSNCFPDDGNGSRVLLTTRIAVVAT--CIGSKSYFSHQMHLLDESESWELF  2
            D+   FPDD  GSR++LTTR+  +AT   I S  +F   + L  E ESW L 
Sbjct  120  DIKRPFPDDDKGSRIILTTRLESIATYAMIDSSPHF---LRLFTEEESWMLL  168



>ref|XP_009606291.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X15 [Nicotiana tomentosiformis]
Length=959

 Score =   150 bits (380),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_009606289.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X13 [Nicotiana tomentosiformis]
Length=974

 Score =   150 bits (380),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>gb|ACE79510.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=250

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 112/172 (65%), Gaps = 5/172 (3%)
 Frame = -2

Query  514  EEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            EE+VG +KD   I+KKL+   G+KE  V+SI GM G+GKTTLAR+VY +PS+  HFD R 
Sbjct  32   EEVVGFEKDAESIMKKLI--GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARV  89

Query  337  WVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEA  158
            W   SQ + +R +L+ +L   +  GN E   D+D+A KL + L  +RY++V+DD+W  EA
Sbjct  90   WCSVSQTYIERTLLIEILKQ-ATGGNYEIKEDDDIADKLRKTLIGRRYLIVLDDIWEVEA  148

Query  157  WDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            W+D+  CFP   +GSRV++TTRI  VA  +  +S   + +  L   ESWEL 
Sbjct  149  WEDLGLCFPKGEDGSRVMVTTRIEQVAKHLQHRSD-PYSLRFLTLEESWELL  199



>gb|ACE79513.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=252

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 112/172 (65%), Gaps = 5/172 (3%)
 Frame = -2

Query  514  EEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            EE+VG +KD   I+KKL+   G+KE  V+SI GM G+GKTTLAR+VY +PS+  HFD R 
Sbjct  32   EEVVGFEKDAESIMKKLI--GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARV  89

Query  337  WVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEA  158
            W   SQ + +R +L+ +L   +  GN E   D+D+A KL + L  +RY++V+DD+W  EA
Sbjct  90   WCSVSQTYIERTLLIEILKQ-ATGGNYEIKEDDDIADKLRKTLIGRRYLIVLDDIWEVEA  148

Query  157  WDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            W+D+  CFP   +GSRV++TTRI  VA  +  +S   + +  L   ESWEL 
Sbjct  149  WEDLGLCFPKGEDGSRVMVTTRIEQVAKHLQHRSD-PYSLRFLTLEESWELL  199



>gb|ACE79512.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=249

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 112/172 (65%), Gaps = 5/172 (3%)
 Frame = -2

Query  514  EEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            EE+VG +KD   I+KKL+   G+KE  V+SI GM G+GKTTLAR+VY +PS+  HFD R 
Sbjct  32   EEVVGFEKDAESIMKKLI--GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARV  89

Query  337  WVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEA  158
            W   SQ + +R +L+ +L   +  GN E   D+D+A KL + L  +RY++V+DD+W  EA
Sbjct  90   WCSVSQTYIERTLLIEILKQ-ATGGNYEIKEDDDIADKLRKTLIGRRYLIVLDDIWEVEA  148

Query  157  WDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            W+D+  CFP   +GSRV++TTRI  VA  +  +S   + +  L   ESWEL 
Sbjct  149  WEDLGLCFPKGEDGSRVMVTTRIEQVAKHLQHRSD-PYSLRFLTLEESWELL  199



>ref|XP_009602415.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602416.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602417.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602418.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 118/179 (66%), Gaps = 8/179 (4%)
 Frame = -2

Query  526  SHSKEEMVGKKDEFEIIKKLLIELG---SKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            + S ++MVG+ D+    K+LL +L    + E KV+ I+GMGGIGKTTLA+ V++D ++  
Sbjct  160  NESSKDMVGRADQR---KRLLDDLTRGFNDEPKVIPIVGMGGIGKTTLAKDVFDDVTIRS  216

Query  355  HFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVVVD  179
            HFDVRAW   S+ HN + +LV LL S  ++  + +  DE +L L L + LK +RY++V+D
Sbjct  217  HFDVRAWATISKEHNVKDILVSLLRSTKEKDGIIHIEDETELPLMLQKSLKGKRYLIVLD  276

Query  178  DVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            D+W  EAWDDV  CFP +  GSR+LLTTR   VA   G+++  S ++  ++  ESW LF
Sbjct  277  DIWKNEAWDDVRLCFPSENKGSRILLTTRNIEVACSAGTEN-LSLRLDFMNPDESWNLF  334



>ref|XP_009606281.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X10 [Nicotiana tomentosiformis]
Length=992

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>gb|AEW48192.1| disease resistance protein RGH3 [Solanum chacoense]
Length=932

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 114/185 (62%), Gaps = 9/185 (5%)
 Frame = -2

Query  553  SQVISSQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVY  377
            S V   +HA    E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA ++Y
Sbjct  127  SLVSLPEHAVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLATKLY  185

Query  376  EDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQR  197
             DP +   FD+RA    SQ +  R +L+GLL   S +       D  LA +L + LK +R
Sbjct  186  TDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDE------PDYQLADRLQKHLKGRR  239

Query  196  YMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESE  17
            Y+VV+DD+W+ EAWD++  CFPD  NGSR+LLTTR   VA    S     H M L++  E
Sbjct  240  YLVVIDDIWTTEAWDNIKPCFPDCYNGSRILLTTRNVEVAE-YASSGKPPHNMRLMNFDE  298

Query  16   SWELF  2
            SW L 
Sbjct  299  SWNLL  303



>gb|ACE79509.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=252

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 112/172 (65%), Gaps = 5/172 (3%)
 Frame = -2

Query  514  EEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            EE+VG +KD   I+KKL+   G+KE  V+SI GM G+GKTTLAR+VY +PS+  HFD R 
Sbjct  33   EEVVGFEKDAESIMKKLI--GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARV  90

Query  337  WVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEA  158
            W   SQ + +R +L+ +L   +  GN E   D+D+A KL + L  +RY++V+DD+W  EA
Sbjct  91   WCSVSQTYIERTLLIEILKQ-ATGGNYEIKEDDDIADKLRKTLIGRRYLIVLDDIWEVEA  149

Query  157  WDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            W+D+  CFP   +GSRV++TTRI  VA  +  +S   + +  L   ESWEL 
Sbjct  150  WEDLGLCFPKGEDGSRVMVTTRIEQVAKHLQHRSD-PYSLRFLTLEESWELL  200



>ref|XP_009606288.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X12 [Nicotiana tomentosiformis]
Length=974

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_009606280.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X9 [Nicotiana tomentosiformis]
Length=1013

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_009602419.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=929

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 118/179 (66%), Gaps = 8/179 (4%)
 Frame = -2

Query  526  SHSKEEMVGKKDEFEIIKKLLIELG---SKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            + S ++MVG+ D+    K+LL +L    + E KV+ I+GMGGIGKTTLA+ V++D ++  
Sbjct  160  NESSKDMVGRADQR---KRLLDDLTRGFNDEPKVIPIVGMGGIGKTTLAKDVFDDVTIRS  216

Query  355  HFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVVVD  179
            HFDVRAW   S+ HN + +LV LL S  ++  + +  DE +L L L + LK +RY++V+D
Sbjct  217  HFDVRAWATISKEHNVKDILVSLLRSTKEKDGIIHIEDETELPLMLQKSLKGKRYLIVLD  276

Query  178  DVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            D+W  EAWDDV  CFP +  GSR+LLTTR   VA   G+++  S ++  ++  ESW LF
Sbjct  277  DIWKNEAWDDVRLCFPSENKGSRILLTTRNIEVACSAGTEN-LSLRLDFMNPDESWNLF  334



>gb|ACE79508.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=254

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 112/172 (65%), Gaps = 5/172 (3%)
 Frame = -2

Query  514  EEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            EE+VG +KD   I+KKL+   G+KE  V+SI GM G+GKTTLAR+VY +PS+  HFD R 
Sbjct  32   EEVVGFEKDAESIMKKLI--GGTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARV  89

Query  337  WVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEA  158
            W   SQ + +R +L+ +L   +  GN E   D+D+A KL + L  +RY++V+DD+W  EA
Sbjct  90   WCSVSQTYIERTLLIEILKQ-ATGGNYEIKEDDDIADKLRKTLIGRRYLIVLDDIWEVEA  148

Query  157  WDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            W+D+  CFP   +GSRV++TTRI  VA  +  +S   + +  L   ESWEL 
Sbjct  149  WEDLGLCFPKGEDGSRVMVTTRIEQVAKHLQHRSD-PYSLRFLTLEESWELL  199



>gb|AEW48187.1| disease resistance protein RGH5 [Solanum albicans]
Length=931

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 118/188 (63%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP++   FD+RA    SQ +  R +++GLL SIS      + +D  LA +L + LK
Sbjct  182  KLYSDPNIMSRFDIRAKATVSQEYCVRNVILGLLPSIS------DGSDNQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ E WDD+  CFPD   GSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEVWDDIKLCFPDCYKGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_009606282.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606283.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606284.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606286.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
 ref|XP_009606287.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X11 [Nicotiana tomentosiformis]
Length=981

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_009606272.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana tomentosiformis]
Length=1039

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_011077109.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=760

 Score =   149 bits (376),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 108/170 (64%), Gaps = 4/170 (2%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            +VG +D+   IK  L    SK  ++V I GMGGIGKTTLAR  Y+D  +  HF +RAWV 
Sbjct  43   VVGFEDDLTAIKHRLCGQSSK-LQLVPIFGMGGIGKTTLARNAYDDQLIMEHFQIRAWVK  101

Query  328  ASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDD  149
             SQ ++ +++L  LL SI       N  DE LA  +Y+ LK  RY++V+DDVWS +AWDD
Sbjct  102  VSQDYSIQEILSNLLVSIKPSNG--NQCDEFLAENVYKGLKGMRYLIVIDDVWSTKAWDD  159

Query  148  VSNCFPDDGNGSRVLLTTRIAVVATCIG-SKSYFSHQMHLLDESESWELF  2
            +   FPDD NGSR+++TTR+  +AT    S S   H+MH LDE +SW L 
Sbjct  160  IKMIFPDDNNGSRIIVTTRLLDIATYAQFSSSSAPHEMHFLDEDQSWNLL  209



>ref|XP_009606279.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X8 [Nicotiana tomentosiformis]
Length=1017

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>gb|AEW48188.1| disease resistance protein RGH7 [Solanum albicans]
Length=912

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 118/188 (63%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP++   FD+RA    SQ +  R +++GLL SIS      + +D  LA +L + LK
Sbjct  182  KLYSDPNIMSRFDIRAKATVSQEYCVRNVILGLLPSIS------DGSDNQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ E WDD+  CFPD   GSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEVWDDIKLCFPDCYKGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_009602420.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=916

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 118/179 (66%), Gaps = 8/179 (4%)
 Frame = -2

Query  526  SHSKEEMVGKKDEFEIIKKLLIELG---SKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            + S ++MVG+ D+    K+LL +L    + E KV+ I+GMGGIGKTTLA+ V++D ++  
Sbjct  160  NESSKDMVGRADQR---KRLLDDLTRGFNDEPKVIPIVGMGGIGKTTLAKDVFDDVTIRS  216

Query  355  HFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVVVD  179
            HFDVRAW   S+ HN + +LV LL S  ++  + +  DE +L L L + LK +RY++V+D
Sbjct  217  HFDVRAWATISKEHNVKDILVSLLRSTKEKDGIIHIEDETELPLMLQKSLKGKRYLIVLD  276

Query  178  DVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            D+W  EAWDDV  CFP +  GSR+LLTTR   VA   G+++  S ++  ++  ESW LF
Sbjct  277  DIWKNEAWDDVRLCFPSENKGSRILLTTRNIEVACSAGTEN-LSLRLDFMNPDESWNLF  334



>gb|AEW48211.1| disease resistance protein RGH1 [Solanum hougasii]
Length=814

 Score =   149 bits (377),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 109/169 (64%), Gaps = 8/169 (5%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA ++Y DP +   FD+RA   
Sbjct  42   MVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKAT  100

Query  328  ASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDD  149
             SQ +  R +L+GLL   S +       D+ LA +L + LK +RY+VV+DD+W+ EAWDD
Sbjct  101  VSQEYCVRNVLLGLLSLTSDE------PDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDD  154

Query  148  VSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +  CFPD  NGSR+LLTTR   VA    S     H M L++  ESW L 
Sbjct  155  IKLCFPDCINGSRILLTTRNVEVAE-YASSGKPPHHMRLMNFDESWNLL  202



>ref|XP_009606273.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009606275.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1038

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_009606277.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X6 [Nicotiana tomentosiformis]
Length=1032

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_009606278.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X7 [Nicotiana tomentosiformis]
Length=1031

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_009606276.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X5 [Nicotiana tomentosiformis]
Length=1036

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_009606270.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=1055

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_009606271.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=1049

 Score =   150 bits (379),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 114/187 (61%), Gaps = 2/187 (1%)
 Frame = -2

Query  559  QRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQV  380
             +  ++     ++ +  M+G+ DE + + + L    S E KV+ I+GMGGIGKTTLA++V
Sbjct  131  NKPSLVQDSSLANVENNMLGRDDERKRLLEDLTRGFSGEPKVIPIVGMGGIGKTTLAKEV  190

Query  379  YEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKR  203
            ++D ++  HFDVR+W   S  HN +++L+ LL S  +  +     DE +LA  L + LK 
Sbjct  191  FDDVTIRSHFDVRSWATVSSQHNVKEILLSLLSSRKEMNDKYYKEDEPELADMLRKSLKG  250

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            +RY++V+DD+W  +AWDDV  CFP + NGSR+LLTTR   VA C       S QM  +  
Sbjct  251  KRYLIVLDDIWKSKAWDDVRLCFPSENNGSRILLTTRDTEVA-CYAGTENLSLQMDFMHP  309

Query  22   SESWELF  2
             ESW LF
Sbjct  310  DESWNLF  316



>ref|XP_009762970.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
[Nicotiana sylvestris]
Length=1777

 Score =   151 bits (381),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 116/185 (63%), Gaps = 9/185 (5%)
 Frame = -2

Query  544   ISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPS  365
             ISSQ    + E+MVG  D    I  LL+  G+ ++ V+SI+GM G GKTT+A +++ D S
Sbjct  1048  ISSQLDWTTAEDMVGFTDVMRTITNLLVR-GTSQRDVISIVGMAGQGKTTIANKLFIDES  1106

Query  364   VSIHFDVRAWVVASQLHNKRQMLVGLL-DSISKQGNLENSTDEDLALKLYQCLKRQRYMV  188
             V + FDVRA    SQ++N+R++LV +L D + K  +L    +++LA KL + L  +RY++
Sbjct  1107  VVLQFDVRAKCYVSQVYNRREVLVSILSDVVDKPTDLSEVPEDELADKLRRLLLSKRYLI  1166

Query  187   VVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTR---IAVVATCIGSKSYFSHQMHLLDESE  17
             ++DDVW   AWD++  CFPD  N SR++LTTR   +A  A+C+ S     H + L  E E
Sbjct  1167  LIDDVWETRAWDELQTCFPDTNNSSRIMLTTRLEKVATYASCVSSL----HHLRLFSEDE  1222

Query  16    SWELF  2
             SW L 
Sbjct  1223  SWTLL  1227


 Score =   108 bits (269),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 110/183 (60%), Gaps = 5/183 (3%)
 Frame = -2

Query  541  SSQHAS--HSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDP  368
            SSQ AS   + EEMVG +D  + ++  L+  G+ +  VVS++G  G GKTT+A++++ D 
Sbjct  516  SSQSASMLSTTEEMVGFEDVVQTLRNQLVG-GTSQLDVVSVVGTFGQGKTTVAKKLFYDE  574

Query  367  SVSIHFDVRAWVVASQLHNKRQMLVGLL-DSISKQGNLENSTDEDLALKLYQCLKRQRYM  191
            S++  FDV A      ++ +R +LV +L D + K+ +L    +++LA KL++ L +++Y+
Sbjct  575  SIASLFDVHAKCFLPVVYLRRDLLVAILSDVVDKKTDLSEVPEDELADKLHKILLQRKYL  634

Query  190  VVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESW  11
            ++VDDV      D + +CFPD  NGSR++LTT +  VA     +    +++ L  + E W
Sbjct  635  ILVDDVRETVVLDFLESCFPDANNGSRIILTTELDEVAN-YARRVSSPYRLRLFSDEEIW  693

Query  10   ELF  2
             L 
Sbjct  694  MLL  696


 Score =   107 bits (267),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 70/195 (36%), Positives = 113/195 (58%), Gaps = 10/195 (5%)
 Frame = -2

Query  559  QRSQVI--SSQHASHSK------EEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIG  404
            QRS  +  SSQ AS  +      +EMVG  D  + ++  L+ +  +E  ++SI+G  G G
Sbjct  762  QRSSYVNVSSQMASTPRITEEITDEMVGFDDVLQTLRDQLVRVTPRELDIISIVGTLGQG  821

Query  403  KTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLL-DSISKQGNLENSTDEDLAL  227
            KTT+A +++ D  V   FDVRA         +R++LV +L + + K  +L  + +++LA 
Sbjct  822  KTTVANKLFTDELVVSLFDVRAKCFVPAAFQRRELLVAILRNLVEKTIDLSEAREDELAD  881

Query  226  KLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFS  47
            +L++ L  +RY++++D+V    AWD + +CFPD  NGSR+LLTTR+  VAT    +    
Sbjct  882  ELHKLLLPKRYLLLIDNVNDSVAWDYLRSCFPDANNGSRILLTTRLDEVAT-KARRVSSP  940

Query  46   HQMHLLDESESWELF  2
            H + L  + ESW L 
Sbjct  941  HYLRLFTDEESWTLL  955



>ref|XP_009604795.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=817

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 119/186 (64%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S + SS      +  +VG +D+F II+  L    + E  VVSI+GMGGIGK+TLAR ++ 
Sbjct  82   SPLRSSGRVWDEENSLVGMEDDFNIIRDQLFR-QTPELNVVSIVGMGGIGKSTLARSLFN  140

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
             PSVS  FD+ +WV  SQ ++ ++ML+ +L   +  G     N ++++L  ++++ LKR+
Sbjct  141  HPSVSPRFDISSWVTVSQAYDAKEMLLDVLSFGTPGGKAMYRNMSEDELLDQVHRKLKRK  200

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY++V+DD+W+ EAWD V   FPDD NGSR+++TTR+  VA C G+  +  H +  L   
Sbjct  201  RYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN-DFPPHHIPFLSLE  259

Query  19   ESWELF  2
            +SW+L 
Sbjct  260  DSWKLL  265



>ref|XP_006345283.1| PREDICTED: uncharacterized protein LOC102590501 [Solanum tuberosum]
Length=2691

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (66%), Gaps = 8/173 (5%)
 Frame = -2

Query  508   MVGKKDEFEIIKKLLIEL--GSK-EKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
             MVG+  E    K++L EL  GSK E KV+ I+GMGGIGKTTLA+QV+  PS+   FDVRA
Sbjct  1130  MVGRDKE---KKRMLEELRGGSKDELKVIPIVGMGGIGKTTLAKQVFNHPSIKSRFDVRA  1186

Query  337   WVVASQLHNKRQMLVGLLDSISKQGNLENSTDED-LALKLYQCLKRQRYMVVVDDVWSGE  161
             W   S+ +N +++L+ LL SI    +   S DED LA  L + LK +RY++V+DD+WS +
Sbjct  1187  WATISKEYNVKEILLSLLQSIINIDDKVYSRDEDELADLLQKKLKCRRYLIVIDDIWSNK  1246

Query  160   AWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
             AWDD   CFP D NGSR+LLTTR   VA    S S    +M+L++  ESW LF
Sbjct  1247  AWDDTKQCFPIDNNGSRILLTTRHTEVAIN-ASSSNLLLKMNLMNSDESWNLF  1298


 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/173 (50%), Positives = 114/173 (66%), Gaps = 8/173 (5%)
 Frame = -2

Query  508   MVGKKDEFEIIKKLLIEL--GSK-EKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
             MVG+  E    K++L EL  GSK E KV+ I+GMGGIGKTTLA+QV+  PS+   FDVRA
Sbjct  1934  MVGRDKE---KKRMLEELRGGSKDELKVIPIVGMGGIGKTTLAKQVFNHPSIKSRFDVRA  1990

Query  337   WVVASQLHNKRQMLVGLLDSISKQGNLENSTDED-LALKLYQCLKRQRYMVVVDDVWSGE  161
             W   S+ +N +++L+ LL SI    +   S DED LA  L + LK +RY++V+DD+WS +
Sbjct  1991  WATISKEYNVKEILLSLLQSIINIDDKVYSRDEDELADLLQKKLKCRRYLIVIDDIWSNK  2050

Query  160   AWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
             AWDD   CFP D NGSR+LLTTR   VA    S S    +M+L++  ESW LF
Sbjct  2051  AWDDTKQCFPIDNNGSRILLTTRHTEVAIN-ASSSNLLLKMNLMNSDESWNLF  2102


 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 83/126 (66%), Gaps = 1/126 (1%)
 Frame = -2

Query  523  HSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDV  344
            + K  MVG++DE E +   L    S   KV+ I+GMGGIGKTTLA++V+ D  +  HFDV
Sbjct  241  NGKNNMVGRRDEREKMMTELTRGFSGVLKVIPIVGMGGIGKTTLAKEVFNDAFIRSHFDV  300

Query  343  RAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDED-LALKLYQCLKRQRYMVVVDDVWS  167
            RAW   SQ HN + +LV LL S  ++ +  N+ DE  LA  L + LK +RY++V+DD+WS
Sbjct  301  RAWATISQEHNVKDILVSLLHSTKEKDDTVNTEDESKLADMLQKSLKSRRYLIVLDDMWS  360

Query  166  GEAWDD  149
             +AWDD
Sbjct  361  DKAWDD  366



>gb|AEW48204.1| disease resistance protein RGH1 [Solanum fernandezianum]
Length=897

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 117/188 (62%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG ++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAFEQPENIMVGHENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L+ LL S S +       D+ LA +L + LK
Sbjct  182  KLYSDPCIMSRFDIRAKATVSQEYYVRNVLLALLSSTSDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   +A    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILLTTRNVELAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  IIESWNLL  302



>gb|ACE79400.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=261

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/186 (44%), Positives = 111/186 (60%), Gaps = 14/186 (8%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S V  S+H    +++MVG ++EFE+++  L   G++E +VVSI+GMGGIGKTTLA ++Y 
Sbjct  19   SLVSPSRHGLEPEDKMVGLENEFEMMQDQLAR-GARELEVVSIVGMGGIGKTTLANKIYS  77

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DP +  HFD+RA    SQ +  R +L+GLL SIS + N   E   D+ LA +L + LK  
Sbjct  78   DPFIMSHFDIRAKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLLKCA  137

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            R            AWDD+  CFPD  NGSR+L+TTR   VA C  S     H M L++  
Sbjct  138  R----------SPAWDDIKRCFPDCNNGSRILMTTRNVEVAECASSGKTPYH-MRLMNFD  186

Query  19   ESWELF  2
            ESW L 
Sbjct  187  ESWSLL  192



>ref|XP_009604792.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009604793.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=875

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 119/186 (64%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S + SS      +  +VG +D+F II+  L    + E  VVSI+GMGGIGK+TLAR ++ 
Sbjct  140  SPLRSSGRVWDEENSLVGMEDDFNIIRDQLFR-QTPELNVVSIVGMGGIGKSTLARSLFN  198

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
             PSVS  FD+ +WV  SQ ++ ++ML+ +L   +  G     N ++++L  ++++ LKR+
Sbjct  199  HPSVSPRFDISSWVTVSQAYDAKEMLLDVLSFGTPGGKAMYRNMSEDELLDQVHRKLKRK  258

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY++V+DD+W+ EAWD V   FPDD NGSR+++TTR+  VA C G+  +  H +  L   
Sbjct  259  RYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN-DFPPHHIPFLSLE  317

Query  19   ESWELF  2
            +SW+L 
Sbjct  318  DSWKLL  323



>gb|AEW48201.1| disease resistance protein RGH9 [Solanum x edinense]
Length=838

 Score =   149 bits (376),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 109/169 (64%), Gaps = 8/169 (5%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA ++Y DP +   FD+RA   
Sbjct  42   MVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKAT  100

Query  328  ASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDD  149
             SQ +  R +L+GLL   S +       D+ LA +L + LK +RY+VV+DD+W+ EAWDD
Sbjct  101  VSQEYCVRNVLLGLLSLTSDE------PDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDD  154

Query  148  VSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +  CFPD  NGSR+LLTTR   VA    S     H M L++  ESW L 
Sbjct  155  IKLCFPDCINGSRILLTTRNVEVAE-YASSGKPPHHMRLMNFDESWNLL  202



>gb|AFB17978.1| Rx-like protein, partial [Solanum brevicaule]
Length=350

 Score =   144 bits (363),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 107/169 (63%), Gaps = 8/169 (5%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA ++Y DP     FD+RA   
Sbjct  19   MVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLATKLYSDPYFMSRFDIRAKAT  77

Query  328  ASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDD  149
             SQ +  R +L+GLL   S Q       D+ LA +L + LK +RY+VV+DD+W+ EA DD
Sbjct  78   VSQEYCVRNVLLGLLSLTSDQ------PDDQLADRLQKHLKGRRYLVVIDDIWTTEAGDD  131

Query  148  VSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +  CFPD  NGSR+LLTTR   VA    S     H M L++  ESW L 
Sbjct  132  IKLCFPDCINGSRILLTTRNVEVAE-YASSGKPPHHMRLMNFDESWNLL  179



>ref|XP_009757156.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=886

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 114/176 (65%), Gaps = 2/176 (1%)
 Frame = -2

Query  526  SHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFD  347
            + S ++MVG+ D+ + +   L    + E KV+ I+GMGGIGKTTLA+ V++D ++  HFD
Sbjct  117  NESSKDMVGRADQRKTLLDDLTRGFNDEPKVIPIVGMGGIGKTTLAKDVFDDVTIRSHFD  176

Query  346  VRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVVVDDVW  170
            VRAW   S+ HN + +LV LL S  ++  + +  DE  LA  L + LK +RY++V+DD+W
Sbjct  177  VRAWATISKEHNVKDILVSLLRSTKEKDGIIHIEDEAKLADMLQKSLKGKRYLIVLDDIW  236

Query  169  SGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
              EAWDDV  CFP +  GSR+LLTTR   VA   G+++  S ++  ++  ESW LF
Sbjct  237  KNEAWDDVRLCFPSENKGSRILLTTRNTGVACSAGTEN-LSLRLDFMNPDESWNLF  291



>gb|AGW23829.1| NBS-LRR class resistance protein Fy8-Ry8, partial [Sesamum indicum]
 gb|AGX27502.1| NBS-LRR class resistance protein Fy8-Ry8, partial [Sesamum indicum]
Length=768

 Score =   148 bits (374),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 116/187 (62%), Gaps = 7/187 (4%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVY  377
            S + SS  A +   +MVG  +D  E+  +L  E  S   +++SI+GMGGIGKTTLA  ++
Sbjct  140  SALPSSGGAPNDGNKMVGFDEDILELKARLCGE--SSTLQIISIVGMGGIGKTTLATNIF  197

Query  376  EDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSIS--KQGNLENSTDEDLALKLYQCLKR  203
             D  V  HF +R W   SQ ++ RQ+L+ L+ S++  K  +L N  DE+LA  +Y+ LK 
Sbjct  198  NDSLVVYHFHIRVWTTVSQNYHLRQVLLALVASLTDQKTTDLSNMMDEELAECVYKTLKG  257

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            + Y++V+DD+WS + WDDV   FPDD NGSRVL+TTR++ VA    S     HQM  LDE
Sbjct  258  RTYLIVMDDMWSTKTWDDVRRFFPDDHNGSRVLITTRLSDVAVYASSSPL--HQMRFLDE  315

Query  22   SESWELF  2
              SW L 
Sbjct  316  EWSWNLL  322



>ref|XP_009595164.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
 ref|XP_009595165.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana tomentosiformis]
Length=875

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 116/181 (64%), Gaps = 4/181 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            S++   + K+ M+G+ DE + + + L    S E KV+ I GMGGIGKTTLA+ V+ D S+
Sbjct  141  STKDILNVKKNMMGRDDERKRLLEDLTRGFSSECKVIPITGMGGIGKTTLAKDVFNDVSI  200

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVV  185
              HFDVRAW   SQ ++ +++L+ LL   S  G      DE DLA  L + LK +RY++V
Sbjct  201  RSHFDVRAWATISQQYDVKEILLSLLR--STMGYTFYMGDEADLADMLQKSLKSKRYLIV  258

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWD+V  CFP   NGSR+LLTTR   +A   G+K+  S +M  +D +ESW L
Sbjct  259  MDDMWSSKAWDEVKQCFPTQSNGSRILLTTRDTELACYAGTKN-LSFEMGFMDPNESWNL  317

Query  4    F  2
            F
Sbjct  318  F  318



>ref|XP_011093989.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=701

 Score =   147 bits (372),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/151 (48%), Positives = 102/151 (68%), Gaps = 1/151 (1%)
 Frame = -2

Query  454  GSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSI  275
            G  E +V+ I+GMGGIGKTTLAR +Y DPSV  HFDVR W   SQ +++  +L GLL S+
Sbjct  19   GKSELEVIPIVGMGGIGKTTLARNLYHDPSVISHFDVRIWATISQDYSEGGILNGLLRSV  78

Query  274  SKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTT  95
                 L   ++E +  +LY+ LKR+RY++V+DD+W+ + W  +  CFPDDG GSR+++TT
Sbjct  79   WVGHPLLVLSNERMVEELYKGLKRRRYLIVLDDIWNKKPWTVLRKCFPDDGTGSRIIVTT  138

Query  94   RIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            R+  VA  I S S + H M+ L + ESW+L 
Sbjct  139  RLLEVADYIASGSSY-HHMNPLKDDESWKLL  168



>emb|CAB50786.1| Rx protein [Solanum tuberosum]
Length=937

 Score =   149 bits (375),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 116/188 (62%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L+GLL   S +       D+ LA +L + LK
Sbjct  182  KLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_009759015.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana sylvestris]
Length=921

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 113/182 (62%), Gaps = 6/182 (3%)
 Frame = -2

Query  538  SQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
            SQ A   +  MVG + EFE+++  L   G+ E +VVSI+GMGGIGKTTLA ++Y DP + 
Sbjct  135  SQPALELENTMVGHETEFEMLQDQLTR-GASELEVVSIVGMGGIGKTTLANKIYSDPFIM  193

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDED---LALKLYQCLKRQRYMV  188
             HFD+RA    S  +  R +L+GLL SIS +   E    +D   LA +L + LK  RY+V
Sbjct  194  SHFDIRAKATVSLEYRARNVLLGLLFSISGK-TYEFYDQQDVGQLADRLQKLLKGGRYLV  252

Query  187  VVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWE  8
            V+DD+W+ EAWDD+  CF D  NGSR+LLTTR   VA    S      QM LL+ +ESW 
Sbjct  253  VIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAE-YASSGKPPFQMRLLNSNESWN  311

Query  7    LF  2
            L 
Sbjct  312  LL  313



>ref|XP_009759016.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana sylvestris]
Length=883

 Score =   148 bits (374),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 113/182 (62%), Gaps = 6/182 (3%)
 Frame = -2

Query  538  SQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
            SQ A   +  MVG + EFE+++  L   G+ E +VVSI+GMGGIGKTTLA ++Y DP + 
Sbjct  135  SQPALELENTMVGHETEFEMLQDQLTR-GASELEVVSIVGMGGIGKTTLANKIYSDPFIM  193

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDED---LALKLYQCLKRQRYMV  188
             HFD+RA    S  +  R +L+GLL SIS +   E    +D   LA +L + LK  RY+V
Sbjct  194  SHFDIRAKATVSLEYRARNVLLGLLFSISGK-TYEFYDQQDVGQLADRLQKLLKGGRYLV  252

Query  187  VVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWE  8
            V+DD+W+ EAWDD+  CF D  NGSR+LLTTR   VA    S      QM LL+ +ESW 
Sbjct  253  VIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAE-YASSGKPPFQMRLLNSNESWN  311

Query  7    LF  2
            L 
Sbjct  312  LL  313



>ref|XP_009604649.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=729

 Score =   147 bits (371),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 116/175 (66%), Gaps = 7/175 (4%)
 Frame = -2

Query  517  KEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            KE M+G + E E++ + L+  G ++  V+SI GM G+GKTTL +++Y+  ++S  FD+R 
Sbjct  10   KEAMIGFERETEMLMEKLVT-GPRQLDVISIFGMPGLGKTTLVKRLYDHEAISNRFDIRL  68

Query  337  WVVASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGE  161
            W  +SQ ++KR +L  LL+ I K   + +  +D++LA KLY+ LK +RY++VVDDVW+ E
Sbjct  69   WCCSSQSYDKRSLLFELLNHIFKLDTSTKEKSDDELAEKLYRYLKGKRYLIVVDDVWNDE  128

Query  160  AWDDVSNCFPDDGNGSRVLLTTRIAVVAT--CIGSKSYFSHQMHLLDESESWELF  2
            AWDD+   FPDD  GSR++LTTR+  +AT   I S  +F   + L  E ESW L 
Sbjct  129  AWDDIKRPFPDDDKGSRIILTTRLESIATYAMISSSPHF---LRLFTEEESWMLL  180



>ref|XP_011083930.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
 gb|AGW23830.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
 gb|AGX27501.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
 gb|AGX27503.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
Length=732

 Score =   147 bits (371),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVY  377
            S + SS  A +   +MVG  +D  E+  +L  E  S   +++SI+GMGGIGKTTLA  ++
Sbjct  140  SALPSSGGAPNDGNKMVGFDEDLLELKARLCGE--SSTLQIISIVGMGGIGKTTLATNIF  197

Query  376  EDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQ--GNLENSTDEDLALKLYQCLKR  203
             D  V  HF +R W   SQ ++ RQ+L+ L+ S++ Q   +L N  DE+LA  +Y+ LK 
Sbjct  198  NDSLVVYHFHIRVWTTVSQDYHLRQVLLALVASLTDQKTTDLSNMMDEELAECVYKTLKG  257

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            + Y++V+DD+WS + WDDV   FPDD NGSRVL+TTR+  V     S     HQM  LDE
Sbjct  258  RTYLIVMDDMWSTKTWDDVRRFFPDDNNGSRVLITTRLPDVVVYASSSPL--HQMRFLDE  315

Query  22   SESWELF  2
              SW L 
Sbjct  316  EWSWNLL  322



>ref|XP_009773239.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=908

 Score =   148 bits (373),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 114/181 (63%), Gaps = 4/181 (2%)
 Frame = -2

Query  538  SQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
             +H+      MVG ++E E +K  L+++ S E++ ++I GMGGIGKTT AR++Y+DP + 
Sbjct  149  PEHSPQLGNSMVGHENELEDVKCKLMKISSDERETMAITGMGGIGKTTFARKIYDDPEIK  208

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLDSI--SKQGNLENSTDEDLALKLYQCLKRQRYMVV  185
             HFD+ AWV  S+ +  R+ML+ LL  I  +++   E   D +LA KL Q L ++RY+VV
Sbjct  209  SHFDILAWVTVSKEYCVRKMLLQLLHCIPSTEEVRREARDDGELAGKLKQRLWKRRYLVV  268

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS +AWDD+S  FP D  GS +LLTTR   VA+   +     H M  L   +SWEL
Sbjct  269  IDDIWSSKAWDDISLWFP-DCKGSHILLTTRCGNVAS-YAAPGKTPHHMSSLSPEKSWEL  326

Query  4    F  2
             
Sbjct  327  L  327



>ref|XP_011083960.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Sesamum indicum]
Length=805

 Score =   147 bits (371),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -2

Query  529  ASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHF  350
            AS  K  MVG  DE   IK  L    S +  V+SI+GMGG GKTTLAR +Y+D  +  HF
Sbjct  66   ASGGKNSMVGFVDEMLQIKDRLTGQPSYKLDVISIVGMGGSGKTTLARSMYDDAFIVYHF  125

Query  349  DVRAWVVASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVVVDDV  173
              RAWV  SQ ++ R++L+GLL S+ K  G     + E+LA  LY+ LK +RY++V+DD+
Sbjct  126  YTRAWVTISQEYHLREILLGLLMSMKKLTGKKCEDSYEELAEYLYKSLKGRRYLIVLDDM  185

Query  172  WSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            W  + W+++   FPDDGNGSR++LT+RI+ VA    S S   + +  L+ +ESW+L 
Sbjct  186  WDIQVWNEIKLLFPDDGNGSRIILTSRISDVALYASSNSP-PYNIRFLNNNESWDLL  241



>ref|XP_009595789.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Nicotiana tomentosiformis]
Length=1776

 Score =   149 bits (375),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 117/185 (63%), Gaps = 9/185 (5%)
 Frame = -2

Query  544   ISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPS  365
             ISSQ      E+MVG +D  + I  LL+  G+ ++ V+SI+GM G GKTT+A +++ D S
Sbjct  1047  ISSQLDCTIAEDMVGFQDVLQTITNLLVR-GTSQRDVISIVGMAGQGKTTIANKLFIDES  1105

Query  364   VSIHFDVRAWVVASQLHNKRQMLVGLL-DSISKQGNLENSTDEDLALKLYQCLKRQRYMV  188
             V   FDVRA    SQ++++R++LV +L D + K  +L    + +LA+KL + L  +RY++
Sbjct  1106  VVPQFDVRAKCYVSQVYDRREVLVSILSDVVDKPTDLSEVPEAELAVKLRRLLFSKRYLI  1165

Query  187   VVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTR---IAVVATCIGSKSYFSHQMHLLDESE  17
             ++DDVW   AWD++ +CFPD  N SR++LTTR   +A  A+C+ S     H + L  E E
Sbjct  1166  LIDDVWETRAWDELQSCFPDTNNSSRIMLTTRLDKVANYASCVSSL----HHLRLFSEDE  1221

Query  16    SWELF  2
             SW L 
Sbjct  1222  SWTLL  1226


 Score =   114 bits (286),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/183 (36%), Positives = 114/183 (62%), Gaps = 5/183 (3%)
 Frame = -2

Query  541  SSQHASHSK--EEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDP  368
            SSQ AS     EEMVG +D  + ++  L+  G+ +  VVS++G  G GKTT+A++++ D 
Sbjct  515  SSQLASMPSITEEMVGFEDVVQTLRNQLVG-GTSQLDVVSVVGTFGQGKTTVAKKLFSDE  573

Query  367  SVSIHFDVRAWVVASQLHNKRQMLVGLL-DSISKQGNLENSTDEDLALKLYQCLKRQRYM  191
            S++  FDV A  +   ++ +R++LV +L D++ KQ +L    +++LA KL++ L +++Y+
Sbjct  574  SIASLFDVHAKCLLPVVYLRRELLVAILNDAVDKQTDLSEVPEDELADKLHKILLQRKYL  633

Query  190  VVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESW  11
            +++DDV      D + +CFPD  NGSR++LTT +  VA    ++    +++ L  + ESW
Sbjct  634  ILIDDVRETVVLDFLKSCFPDANNGSRIILTTELDEVAN-YATRVSSPYRLRLFSDEESW  692

Query  10   ELF  2
             L 
Sbjct  693  MLL  695


 Score =   101 bits (251),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 111/195 (57%), Gaps = 10/195 (5%)
 Frame = -2

Query  559  QRSQVIS--SQHASHSK------EEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIG  404
            QRS  +S  SQ AS  +      +EMVG  D  + ++  L+ +  +E  V+SI+G  G G
Sbjct  761  QRSSYVSVSSQMASTPRITEEITDEMVGFDDVLQTLRDQLVRVTPRELDVISIVGTFGQG  820

Query  403  KTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLL-DSISKQGNLENSTDEDLAL  227
            KT +A ++  D  V   FDV A      +  +R++LV +L + + K  +L  + +++LA 
Sbjct  821  KTAVANKLLADELVVSLFDVCAKCFVPVVFERRELLVAILRNLVDKTTDLSEAREDELAD  880

Query  226  KLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFS  47
            +L++ L  +RY++++D+V    AWD + +CFPD  NGSR+LLTTR+  VAT    +    
Sbjct  881  ELHKLLLPKRYLLLIDNVNDPVAWDYLRSCFPDANNGSRILLTTRLDEVAT-KARRVSSP  939

Query  46   HQMHLLDESESWELF  2
            H + L  + ESW L 
Sbjct  940  HYLRLFTDEESWMLL  954



>gb|ABY61746.1| resistance protein PSH-RGH7 [Solanum tuberosum]
Length=930

 Score =   147 bits (372),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 107/169 (63%), Gaps = 8/169 (5%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA ++Y DP +   FD+RA   
Sbjct  142  MVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKAT  200

Query  328  ASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDD  149
             SQ +  R +L+GLL   S      +  D  LA +L + LK +RY+VV+DD+W+ EAWDD
Sbjct  201  VSQEYCVRNVLLGLLSLTS------DEPDYQLADRLQKHLKGRRYLVVIDDIWTTEAWDD  254

Query  148  VSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +  CFPD  NGSR+LLTTR   VA    S     H M L++  ESW L 
Sbjct  255  IKLCFPDCYNGSRILLTTRNVEVAE-YASSGKPPHHMRLMNSIESWNLL  302



>ref|XP_010312507.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=874

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 111/178 (62%), Gaps = 2/178 (1%)
 Frame = -2

Query  535  QHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            Q ++  +  +VG KD+F  I    +   + E  V+ I GMGGIGKTTLA++VY+D  +  
Sbjct  134  QKSTIVENTVVGMKDDFNTILDR-VTAQTNELTVIPIFGMGGIGKTTLAKKVYDDSFICS  192

Query  355  HFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDD  176
             FD  AWV  S+ +N+RQML+ ++ S++  GN E S DE + + +Y+ LK +R+++V+DD
Sbjct  193  RFDKLAWVTISEEYNERQMLLEVVSSVTTGGNQEKSDDELMEI-VYRGLKGRRFLIVIDD  251

Query  175  VWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +WS EAWD +   FP+D N SR+LLTTR+  VA  +    +  H    L   +SW LF
Sbjct  252  IWSTEAWDQMQRIFPNDDNKSRILLTTRLKYVADYVNCPDFPPHSKSFLSLEDSWNLF  309



>gb|AGW28125.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
Length=732

 Score =   146 bits (369),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 114/187 (61%), Gaps = 7/187 (4%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVY  377
            S + SS  A +   +MVG  +D  E+  +L  E  S   +++SI+GMGGIGKTTLA  ++
Sbjct  140  SALPSSGGAPNDGNKMVGFDEDLLELKARLCGE--SSTLQIISIVGMGGIGKTTLATNIF  197

Query  376  EDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQ--GNLENSTDEDLALKLYQCLKR  203
             D  V  HF +R W   SQ ++ RQ+L+ L+ S++ Q   +L N  DE+LA  +Y+ LK 
Sbjct  198  NDSLVVYHFHIRVWTTVSQDYHLRQVLLALVASLTDQKTTDLSNMMDEELAECVYKTLKG  257

Query  202  QRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDE  23
            + Y++V+DD+WS + WDDV   FPDD NGSRVL+TTR+  V     S     HQM  LDE
Sbjct  258  RTYLIVMDDMWSTKTWDDVRRFFPDDNNGSRVLITTRLLDVVVYASSSPL--HQMRFLDE  315

Query  22   SESWELF  2
              SW L 
Sbjct  316  EWSWNLL  322



>ref|XP_009625970.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=165

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 99/149 (66%), Gaps = 3/149 (2%)
 Frame = -2

Query  454  GSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLD--  281
            GS + +V+S+ GMGGIGK+T A++++ DPSV   FD R W+  S+ ++ R ML+ L    
Sbjct  18   GSTQMEVISVTGMGGIGKSTFAKKLFTDPSVLSFFDTRGWITVSENYSYRMMLLALFQYV  77

Query  280  SISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLL  101
            +I K+  L+N +D +LA+ L Q L  +RY+VV+DD+WS +AWD++  C PDDG  SRVLL
Sbjct  78   AIGKEEELDNKSDSELAVCLKQGLMGRRYLVVMDDIWSKKAWDEIRLCLPDDGKRSRVLL  137

Query  100  TTRIAVVATCIGSKSYFSHQMHLLDESES  14
            TTR   VA    S+     +MHLLD  +S
Sbjct  138  TTRDVEVAQYASSRED-PFRMHLLDPDDS  165



>gb|AEW48215.1| disease resistance protein RGH7 [Solanum leptophyes x Solanum 
sparsipilum]
Length=921

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 111/173 (64%), Gaps = 8/173 (5%)
 Frame = -2

Query  520  SKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVR  341
            S++ MVG ++EFE++   L+  G +E +VVSI+GMGGIGKTTLA ++Y DP +   FD+R
Sbjct  141  SEDIMVGYENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIR  199

Query  340  AWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGE  161
            A    SQ +  R +L GLL S S +      +D+ LA +L + LK +RY+VV+DD+W+ E
Sbjct  200  AKATVSQEYCVRNVLQGLLPSRSDE------SDDQLADRLQKHLKARRYLVVIDDIWTTE  253

Query  160  AWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            AWDD+  CFPD   GSR+LLTTR   VA    S     H M L++  ESW L 
Sbjct  254  AWDDIKLCFPDCYKGSRILLTTRNVEVAE-YASSGKPPHHMRLMNFDESWNLL  305



>ref|XP_011072560.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=903

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 128/197 (65%), Gaps = 12/197 (6%)
 Frame = -2

Query  574  AHDVLQRSQV----ISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEK--KVVSIIGMG  413
             HD L R+ V    +SS   +  K+ MVG  D   I+  ++ +L  ++   ++V IIGMG
Sbjct  133  VHDQLHRNSVPAGSLSSSPLTGQKQAMVGVDD---ILNDIMDKLTRQQSGCQIVPIIGMG  189

Query  412  GIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDL  233
            GIGKTTLAR VYE+P +  +FD RAWV  S+ +N R++L+ L+   SK+  +E  ++E+L
Sbjct  190  GIGKTTLARHVYENPLIVEYFDFRAWVTVSREYNTREILLNLVSQKSKE-TMEIMSEEEL  248

Query  232  ALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSY  53
               LY+ L  +RY++++DD+WS EAWD+V   FP++ + S++++TTR++ +A  I     
Sbjct  249  GEMLYKSLAGKRYLIIMDDMWSIEAWDNVKLFFPNNNSESKIMITTRLSNLALQISGS--  306

Query  52   FSHQMHLLDESESWELF  2
            +   M+ LDE++SWELF
Sbjct  307  YGLWMYFLDENKSWELF  323



>gb|AFB17976.1| Rx-like protein, partial [Solanum acaule]
Length=350

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 109/178 (61%), Gaps = 9/178 (5%)
 Frame = -2

Query  532  HASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            HA    E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA ++Y DP +  
Sbjct  10   HAFEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLATKLYSDPYIMS  68

Query  355  HFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDD  176
             FD+RA    SQ +  R +L+GLL   S +       D+ LA +L + LK +RY+VV+DD
Sbjct  69   RFDIRAKATVSQEYCVRNVLLGLLSLTSDE------PDDQLADRLQEHLKGRRYLVVIDD  122

Query  175  VWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +W+ +AWD +  CFPD   GSR LLTTR   VA    S     H M L++  ESW L 
Sbjct  123  IWTTKAWDGIKLCFPDCYKGSRTLLTTRNVEVAE-YASSGKPPHHMRLMNFDESWNLL  179



>gb|AAF04603.1|AF195939_1 disease resistance protein Gpa2 [Solanum tuberosum]
 emb|CAB55838.1| NBS-LRR protein [Solanum tuberosum subsp. andigenum]
Length=912

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 115/188 (61%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L+GLL   S +       D  LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDE------PDYQLADQLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCDNGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>emb|CDP11160.1| unnamed protein product [Coffea canephora]
Length=1430

 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/195 (41%), Positives = 114/195 (58%), Gaps = 13/195 (7%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGK----------KDEFEIIKKLLIELGSKEKKVVSIIGMGGIG  404
            ++V+SS+H       M+ +          +DE + +   LI+ GS  + +VSIIGM GIG
Sbjct  675  ARVLSSKHIIQVPPNMISRAAINEMVVDLRDEEQYVIDQLIK-GSPRRGIVSIIGMPGIG  733

Query  403  KTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSI-SKQGNLENSTDEDLAL  227
            KTTLA +V+  P+V  HF  RAW   SQ++ KR++ + +L  I      +   T+EDL L
Sbjct  734  KTTLAWKVFNHPNVMHHFHCRAWCAVSQVYEKRELFLEILRGILGLTDEIRQMTNEDLQL  793

Query  226  KLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFS  47
            KL QCL R R+ +V+DDVW    W+++ N FPDD NGSR+L+T+R+  VA  I   S   
Sbjct  794  KLRQCLLRNRFFIVMDDVWDAGVWNELRNSFPDDANGSRILITSRLRDVALQIEPDSD-P  852

Query  46   HQMHLLDESESWELF  2
            H + L  E ESW L 
Sbjct  853  HSLRLFSEDESWNLL  867



>gb|AEW48212.1| disease resistance protein RGH1 [Solanum leptophyes x Solanum 
sparsipilum]
 gb|AEW48213.1| disease resistance protein RGH2 [Solanum leptophyes x Solanum 
sparsipilum]
Length=905

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 118/188 (63%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG+++EFE+ +  L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAFEQPENIMVGRENEFEMTRDQLVR-GGRELEVVSIVGMGGIGKTTLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP++   FD+RA    SQ +  R +L+ LL S S +       D+ LA +L + LK
Sbjct  182  KLYSDPNIMSRFDIRAKATVSQEYCVRNVLLALLSSTSDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M  ++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAEYASSGKPPLH-MRPMN  294

Query  25   ESESWELF  2
              +SW L 
Sbjct  295  FVKSWNLL  302



>ref|XP_009793283.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009793284.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=874

 Score =   147 bits (371),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 116/180 (64%), Gaps = 6/180 (3%)
 Frame = -2

Query  532  HASHSKEEMVGKK-DEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            HA   + +MVG   ++  ++ +L  +  S E +V+S+ GMGGIGK+T A++++  PSV  
Sbjct  141  HAPTHENDMVGYNIEQANMLSQLTRD--SPELEVISVTGMGGIGKSTFAKKLFSHPSVLS  198

Query  355  HFDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVVV  182
             FD+R WV  S+ ++ R ML+GLL+  +I K+ +L+  +D DLA+ L Q L  +RY++VV
Sbjct  199  FFDIRGWVTVSEDYSYRNMLLGLLEDANIGKEEDLDKKSDSDLAVCLKQSLMGRRYLIVV  258

Query  181  DDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            DD+WS  AWD++  C PDDG  SRVLLTTR   VA    S +    +MHLL   +SW LF
Sbjct  259  DDIWSKNAWDEIRLCLPDDGKRSRVLLTTRDVEVAQ-YASSAKDPFRMHLLGPDDSWNLF  317



>ref|XP_009793285.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=870

 Score =   147 bits (370),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 116/180 (64%), Gaps = 6/180 (3%)
 Frame = -2

Query  532  HASHSKEEMVGKK-DEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            HA   + +MVG   ++  ++ +L  +  S E +V+S+ GMGGIGK+T A++++  PSV  
Sbjct  141  HAPTHENDMVGYNIEQANMLSQLTRD--SPELEVISVTGMGGIGKSTFAKKLFSHPSVLS  198

Query  355  HFDVRAWVVASQLHNKRQMLVGLLD--SISKQGNLENSTDEDLALKLYQCLKRQRYMVVV  182
             FD+R WV  S+ ++ R ML+GLL+  +I K+ +L+  +D DLA+ L Q L  +RY++VV
Sbjct  199  FFDIRGWVTVSEDYSYRNMLLGLLEDANIGKEEDLDKKSDSDLAVCLKQSLMGRRYLIVV  258

Query  181  DDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            DD+WS  AWD++  C PDDG  SRVLLTTR   VA    S +    +MHLL   +SW LF
Sbjct  259  DDIWSKNAWDEIRLCLPDDGKRSRVLLTTRDVEVAQ-YASSAKDPFRMHLLGPDDSWNLF  317



>ref|XP_006367243.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=1322

 Score =   148 bits (373),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 118/183 (64%), Gaps = 5/183 (3%)
 Frame = -2

Query  544  ISSQHASHSKEE--MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYED  371
            ISS     + EE  +VG +D+F II    +   + E  V+ I GMGGIGKTTLAR+VY+D
Sbjct  135  ISSSLEKSTIEENTIVGMEDDFNIILDR-VTTQTDELTVIPIFGMGGIGKTTLARKVYDD  193

Query  370  PSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYM  191
              +   FD +AWV  SQ +N+RQML+ L+ SI+  G+ + ++D++L   +Y+ LK ++++
Sbjct  194  SYIRSRFDKQAWVTISQEYNERQMLLELVSSIT--GSKKETSDDELMEIVYRGLKGRKFL  251

Query  190  VVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESW  11
            +V+DD+WS +AWD +   FP+D N SR+LLTTR+  VA  +    +  H    L +++SW
Sbjct  252  IVIDDIWSTKAWDQMQRTFPNDDNRSRILLTTRLKYVADYVNCPDFPPHNKSFLSQNDSW  311

Query  10   ELF  2
             LF
Sbjct  312  NLF  314



>gb|AEW48218.1| disease resistance protein RX6 [Solanum hondelmannii]
Length=937

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 115/188 (61%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG ++EFE++   L   G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHDVEQPENIMVGCENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L+GLL   S +       D+ LA +L + LK
Sbjct  182  KLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_011083958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=877

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 113/177 (64%), Gaps = 2/177 (1%)
 Frame = -2

Query  529  ASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHF  350
            AS  K  MVG  DE   IK  L    S +  V+SI+GMGG GKTTLAR +Y+D  +  HF
Sbjct  138  ASGGKNSMVGFVDEMLQIKDRLTGQPSYKLDVISIVGMGGSGKTTLARSMYDDAFIVYHF  197

Query  349  DVRAWVVASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVVVDDV  173
              RAWV  SQ ++ R++L+GLL S+ K  G     + E+LA  LY+ LK +RY++V+DD+
Sbjct  198  YTRAWVTISQEYHLREILLGLLMSMKKLTGKKCEDSYEELAEYLYKSLKGRRYLIVLDDM  257

Query  172  WSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            W  + W+++   FPDDGNGSR++LT+RI+ VA    S S   + +  L+ +ESW+L 
Sbjct  258  WDIQVWNEIKLLFPDDGNGSRIILTSRISDVALYASSNSP-PYNIRFLNNNESWDLL  313



>emb|CDP00736.1| unnamed protein product [Coffea canephora]
Length=822

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 116/176 (66%), Gaps = 3/176 (2%)
 Frame = -2

Query  526  SHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFD  347
             + + E+VG  D+ + I   LI + S+  ++V+I+GMGGIGKTTLAR+V++D S   +F 
Sbjct  91   PNQRNEVVGLDDDCQSIFDRLITVPSR-LEIVAIVGMGGIGKTTLARRVFDDLSTVYNFH  149

Query  346  VRAWVVASQLHNKRQMLVGLLDSISKQGN-LENSTDEDLALKLYQCLKRQRYMVVVDDVW  170
            VRAW   SQ+  +R +L+ LL S +   + +    +E+LA  LY+ LK +RY++V+DD+W
Sbjct  150  VRAWATVSQVFRQRDVLLALLRSTTHVTDEIYRKNNEELAQDLYRSLKGKRYLIVLDDIW  209

Query  169  SGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +  AWDDV  CFPDD N SR+L+TTR++ VA  +   S   H M+LL+   SW+L 
Sbjct  210  NTLAWDDVKLCFPDDENASRLLVTTRLSKVAHYVNPNST-PHLMNLLNLDNSWKLL  264



>ref|XP_011090484.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=757

 Score =   146 bits (368),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/181 (45%), Positives = 111/181 (61%), Gaps = 3/181 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            SS   +  K E VG   +   +K+ L    SK   ++SI+GMGGIGKTTLAR +Y D  +
Sbjct  159  SSTFVAGVKREPVGLDQDLMCMKEWLTASLSK-LDIISIVGMGGIGKTTLARNLYSDSLI  217

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVV  185
              +FD+RAWVV SQ ++ R M   L+    +  G L + + E+LA +LY+ LK +RY+VV
Sbjct  218  EYYFDIRAWVVLSQDYDARLMFRSLVCCTGEPNGELNHKSIEELAERLYKNLKGRRYLVV  277

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DDVW  + WDDV   FPDD NGSR++LT+R + VA    S +   HQM LL    SW+L
Sbjct  278  MDDVWDTKVWDDVKRFFPDDNNGSRIILTSRQSEVAIYANSSNSI-HQMRLLSPDASWDL  336

Query  4    F  2
             
Sbjct  337  L  337



>gb|AEW48209.1| disease resistance protein RGH5 [Solanum huancabambense]
Length=908

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 106/169 (63%), Gaps = 8/169 (5%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA ++Y DP +   FD+RA   
Sbjct  142  MVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKAT  200

Query  328  ASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDD  149
             SQ +  R +L+GLL   S +       D  LA +L + LK +RY+VV+DD+W+ EAWDD
Sbjct  201  VSQEYCVRNVLLGLLSLTSDE------PDYQLADRLQKHLKGRRYLVVIDDIWTTEAWDD  254

Query  148  VSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +  CFPD  NGSR+LLTTR   VA    S     H M L+   ESW L 
Sbjct  255  IKPCFPDCINGSRILLTTRNVEVAE-YASSGKPPHHMRLMKFDESWNLL  302



>ref|XP_009777040.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=902

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 124/199 (62%), Gaps = 6/199 (3%)
 Frame = -2

Query  586  GRKTAHDVLQRSQVI--SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMG  413
            G +T  D+  ++ ++  +S+ A   +  MVG ++EFE+++  L   G+ E +VVSI+GMG
Sbjct  119  GTQTNQDLKAQNPILPSTSERALEPENMMVGHENEFEMMQDQLAR-GASELEVVSIVGMG  177

Query  412  GIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDE  239
            GIGKTTLA +++ DP +   FD+RA V  SQ +  R+ L+GLL SI+ + +   E   D 
Sbjct  178  GIGKTTLANKIFSDPFIMSRFDIRAKVTISQEYCPRKGLLGLLSSITGKTDKPYEQQDDG  237

Query  238  DLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSK  59
             L  +L + LK +RY++VVDD+W+  AWDD+  CFPD  N SR+LLTTR   VA    S 
Sbjct  238  QLKDRLQKLLKGRRYLIVVDDIWNEAAWDDIKLCFPDCNNRSRILLTTRNVEVAE-YASS  296

Query  58   SYFSHQMHLLDESESWELF  2
                +QM LL+  ES +L 
Sbjct  297  GKPPYQMRLLNCHESCDLL  315



>gb|AEW48208.1| disease resistance protein RGH4 [Solanum huancabambense]
Length=877

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 106/169 (63%), Gaps = 8/169 (5%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG+++E E++   L   G +E +VVSI+GMGGIGKTTLA ++Y DP +   FD+RA   
Sbjct  142  MVGRENELEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLATKLYSDPYIMSRFDIRAKAT  200

Query  328  ASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDD  149
             SQ +  R +L GLL SIS +       D  LA +L + LK +RY+VV+DD+W+ EAWDD
Sbjct  201  VSQEYCVRNVLQGLLSSISDE------PDYQLADRLQKHLKGRRYLVVIDDIWTTEAWDD  254

Query  148  VSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +  CFPD  NGSR+LLTTR   VA    S     H M L+   ESW L 
Sbjct  255  IKLCFPDCINGSRILLTTRNVEVAE-YASSGKPPHHMRLMKFDESWNLL  302



>gb|AEW48207.1| disease resistance protein RGH5 [Solanum fernandezianum]
Length=912

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 115/188 (61%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG+++EFE++   L+  G +E +VVSI+G GGIGKTTLA 
Sbjct  123  QTSSLVSFPEHDVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGTGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L+GLL   S +       D  LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDE------PDYHLADRLRKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCYNGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score =   147 bits (370),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/173 (51%), Positives = 116/173 (67%), Gaps = 3/173 (2%)
 Frame = -2

Query  517  KEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            K  +VG   + E IK   I+  SK  +++SI+GMGGIGKTTLARQVY+DPS+  HFD R 
Sbjct  360  KNVVVGFDKDLEQIKTQWIDDSSK-LEIISIVGMGGIGKTTLARQVYDDPSIFYHFDTRG  418

Query  337  WVVASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGE  161
            WV  SQ ++ RQ+L+GLLDS       +++ +D  LA  LY+CLK +RY++V+DD+W  +
Sbjct  419  WVAVSQEYSLRQVLLGLLDSTKMLTEEMQDESDARLAEFLYKCLKGRRYLIVMDDIWDID  478

Query  160  AWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
             WD VS  FPDD NGSRVLLTTR++ VA    S S   HQM  L+  +SW L 
Sbjct  479  IWDAVSRLFPDDSNGSRVLLTTRLSDVAVYANSSSRL-HQMRFLNVDDSWNLL  530



>gb|AEW48196.1| disease resistance protein RGH7 [Solanum chacoense]
Length=914

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 118/188 (63%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG+++EFE+ +  L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAFEQPENIMVGRENEFEMTRDQLVR-GGRELEVVSIVGMGGIGKTTLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP++   FD+RA    SQ +  R +L+ LL S S +       D+ LA +L + LK
Sbjct  182  KLYSDPNIMSRFDIRAKATVSQEYCVRNVLLALLSSTSDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+L+TTR   VA    S     H M  ++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRILMTTRNVEVAEYASSGKPPLH-MRPMN  294

Query  25   ESESWELF  2
              +SW L 
Sbjct  295  FVKSWNLL  302



>ref|XP_009761982.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=741

 Score =   145 bits (367),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 119/186 (64%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S + SS+     +  +VG +D+F+II+  L    + E  VVSI+GMG IGK+TLA+ ++ 
Sbjct  31   SPLRSSERVLDEENTLVGMEDDFKIIRDQLFG-QTPELNVVSIVGMGSIGKSTLAKSLFN  89

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
             PSVS  FD+ +WV  SQ ++ ++ML+ +L   +  G     N ++++L  ++++ LKR+
Sbjct  90   HPSVSRRFDISSWVTVSQAYDAKEMLLDVLSFGTPGGKAMYRNMSEDELLDQVHRKLKRK  149

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY++V+DD+W+ EAWD V   FPDD NGSR+++TTR+  VA C G+  +  H M  L   
Sbjct  150  RYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN-DFPPHHMPFLSLE  208

Query  19   ESWELF  2
            + W+L 
Sbjct  209  DGWKLL  214



>ref|XP_009761980.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=766

 Score =   145 bits (367),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 119/186 (64%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S + SS+     +  +VG +D+F+II+  L    + E  VVSI+GMG IGK+TLA+ ++ 
Sbjct  31   SPLRSSERVLDEENTLVGMEDDFKIIRDQLFG-QTPELNVVSIVGMGSIGKSTLAKSLFN  89

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
             PSVS  FD+ +WV  SQ ++ ++ML+ +L   +  G     N ++++L  ++++ LKR+
Sbjct  90   HPSVSRRFDISSWVTVSQAYDAKEMLLDVLSFGTPGGKAMYRNMSEDELLDQVHRKLKRK  149

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY++V+DD+W+ EAWD V   FPDD NGSR+++TTR+  VA C G+  +  H M  L   
Sbjct  150  RYLIVLDDMWTIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN-DFPPHHMPFLSLE  208

Query  19   ESWELF  2
            + W+L 
Sbjct  209  DGWKLL  214



>ref|XP_009765786.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Nicotiana sylvestris]
Length=729

 Score =   145 bits (366),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 115/172 (67%), Gaps = 7/172 (4%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            M+G + E E++ + L+  G ++  V+SI GM G+GKTTLA+++Y+  S+S  FD+R W  
Sbjct  1    MIGFEIETEMLMEKLVT-GPRQLDVISIFGMPGLGKTTLAKRLYDHESISNRFDIRLWCC  59

Query  328  ASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWD  152
            +SQ ++K+ +L  LL+ I K   + +  +D++LA KLY+ LK +RY++VVDDVWS EAWD
Sbjct  60   SSQSYDKKSLLFELLNHICKLDTSTKEKSDDELAEKLYKHLKGKRYLIVVDDVWSQEAWD  119

Query  151  DVSNCFPDDGNGSRVLLTTRIAVVAT--CIGSKSYFSHQMHLLDESESWELF  2
            D+   FPDD  GSR++LTTR+  +AT   I S  +F   + L  E ESW L 
Sbjct  120  DIKRPFPDDDKGSRIILTTRLESIATYAMIDSSPHF---LRLFTEEESWMLL  168



>ref|XP_009794810.1| PREDICTED: putative late blight resistance protein homolog R1A-3, 
partial [Nicotiana sylvestris]
Length=345

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 114/178 (64%), Gaps = 3/178 (2%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIH  353
            H S  + +MVG   E E+++  L    S + +V+SI+GMGGIGK+T A++++ DPS+   
Sbjct  116  HVSTIENDMVGYNIEQELMRDQL-RGHSSQLEVISIVGMGGIGKSTFAKKMFSDPSIMSF  174

Query  352  FDVRAWVVASQLHNKRQMLVGLL-DSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDD  176
            FDVR W+  S+ ++ R++L+GLL D+I  +  L+  +D+ LA +L + LK +RY++VVDD
Sbjct  175  FDVRGWITVSKDYSLRRILLGLLQDAIGVKEMLDKVSDDALADRLQKSLKGRRYLIVVDD  234

Query  175  VWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +WS EAWD +  CFP+  N SR+LLTTR   VA    S       M  L+  ESW LF
Sbjct  235  IWSREAWDGIRLCFPEYSNKSRILLTTRDMKVAQ-YASFPKDPFPMRFLELEESWNLF  291



>gb|EYU24542.1| hypothetical protein MIMGU_mgv1a020452mg [Erythranthe guttata]
Length=871

 Score =   145 bits (367),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/150 (47%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = -2

Query  451  SKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSIS  272
            S + +V+ I+GMGGIGKTTLA   Y+DP V  +F +RAWV  SQ ++ ++++  L+DS+ 
Sbjct  169  SSKLQVIPIVGMGGIGKTTLATNAYQDPLVIENFMIRAWVTVSQDYSPQKVVSSLVDSMK  228

Query  271  KQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTR  92
            +  N E    E    K+Y+CLK  +Y++V+DDVWS EAWDDV   FPD+ NGSRV+LTTR
Sbjct  229  ELINTERYRGESDEEKVYKCLKGMKYLIVMDDVWSTEAWDDVRMIFPDENNGSRVVLTTR  288

Query  91   IAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +  VA  + S S   H+M L++  +SW+L 
Sbjct  289  LLDVAAYVDSSSLL-HEMQLMNADQSWDLL  317



>ref|XP_009787580.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=696

 Score =   144 bits (364),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 110/170 (65%), Gaps = 3/170 (2%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG  +E E++ + L+  G ++  V+SI GM G+GKTTLA+++Y+  ++S  FD+R W  
Sbjct  1    MVGFNEETEMLIEQLVR-GHRQLDVISIFGMPGLGKTTLAKKLYDHETISNRFDIRLWCC  59

Query  328  ASQLHNKRQMLVGLLDSISKQGNL-ENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWD  152
            +SQ +N R +L  LL  I +  ++ +  +D++LA KLY+ LK +RY++VVDDVWS  AWD
Sbjct  60   SSQSYNNRALLFELLGHICELDDITKEKSDDELAEKLYRYLKGKRYLIVVDDVWSPNAWD  119

Query  151  DVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            D+   FPDD  GSR++LTTR+  + T     S   H + L  E ESW L 
Sbjct  120  DIKRPFPDDNKGSRIILTTRLESITTYAMINSS-PHHLRLFTEEESWMLL  168



>ref|XP_011071973.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score =   145 bits (367),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 78/186 (42%), Positives = 114/186 (61%), Gaps = 3/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            + + SS+ A     + VG KD+F  +K  LI   S+  KVV+++GM GIGKTTL +QVY+
Sbjct  129  TPIASSRSAPSLGRKFVGLKDDFLQLKDQLIGESSR-IKVVAVVGMAGIGKTTLVKQVYD  187

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQ  200
            DPS+   F  RAW + +  ++KR +L+ LL S+ +  +     +TD  L   +Y+ LK +
Sbjct  188  DPSIGQIFHYRAWAIMAPNYSKRDILLALLRSVDRDDSKFYGEATDGQLTETIYKNLKGR  247

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY++V+DD+    AWDD+   FPDDGNGSRV+LTTR+  VA      +   H +  L + 
Sbjct  248  RYLIVLDDLCVFRAWDDLKTLFPDDGNGSRVMLTTRLRNVALYAAGSTRNIHYIRFLSKD  307

Query  19   ESWELF  2
            ESWEL 
Sbjct  308  ESWELL  313



>ref|XP_009787579.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=712

 Score =   144 bits (364),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 110/170 (65%), Gaps = 3/170 (2%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG  +E E++ + L+  G ++  V+SI GM G+GKTTLA+++Y+  ++S  FD+R W  
Sbjct  1    MVGFNEETEMLIEQLVR-GHRQLDVISIFGMPGLGKTTLAKKLYDHETISNRFDIRLWCC  59

Query  328  ASQLHNKRQMLVGLLDSISKQGNL-ENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWD  152
            +SQ +N R +L  LL  I +  ++ +  +D++LA KLY+ LK +RY++VVDDVWS  AWD
Sbjct  60   SSQSYNNRALLFELLGHICELDDITKEKSDDELAEKLYRYLKGKRYLIVVDDVWSPNAWD  119

Query  151  DVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            D+   FPDD  GSR++LTTR+  + T     S   H + L  E ESW L 
Sbjct  120  DIKRPFPDDNKGSRIILTTRLESITTYAMINSS-PHHLRLFTEEESWMLL  168



>emb|CDP15268.1| unnamed protein product [Coffea canephora]
Length=1484

 Score =   146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 119/197 (60%), Gaps = 10/197 (5%)
 Frame = -2

Query  577  TAHDVLQRS-QVISSQHASHSKEEMVGKKDEFEIIKKLLIE---LGSKEKKVVSIIGMGG  410
            + HDV   S  ++S        E ++   DE    KKL+I+    G  +  VVSI+GM G
Sbjct  738  SIHDVPTSSMNMVSPAKIPMIDEVVIDLTDE----KKLIIDRLTAGLPQLDVVSIVGMPG  793

Query  409  IGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISK-QGNLENSTDEDL  233
            +GKTTLA + Y DPSV+  F  RAW   S  + +R++L+ +L  I + + ++   +DEDL
Sbjct  794  LGKTTLALKAYNDPSVTYQFHARAWCYVSHTYRRRELLLQILGEIVELKDDILEMSDEDL  853

Query  232  ALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSY  53
             +KLYQCLK +RY++V+DD+WS EAW D    FP+D NGSR+L+T+R   VA  + + S 
Sbjct  854  EMKLYQCLKGKRYLIVMDDIWSTEAWYDFQRSFPNDNNGSRILITSRHFDVAVKLKADST  913

Query  52   FSHQMHLLDESESWELF  2
              H + LL + ESW L 
Sbjct  914  -PHPLRLLSDDESWTLL  929



>ref|XP_011091063.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=730

 Score =   144 bits (364),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 114/186 (61%), Gaps = 4/186 (2%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYE  374
            S  +SS     S   +VG  ++   +K  L  L +K  +V+ +IGMGGIGKTTLAR +Y 
Sbjct  7    SDAVSSTPDPTSTNTVVGLDEDLIKLKDRLTSLENK-LEVIPMIGMGGIGKTTLARNLYN  65

Query  373  DPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQ--GNLENSTDEDLALKLYQCLKRQ  200
            D  +  HFD  AW+V SQ ++ R +L+GLL  I  +   ++    +  LA+ LY+ L   
Sbjct  66   DRLIISHFDTCAWIVISQDYDVRAILLGLLACIVGKLTDDMLQQKNSQLAVTLYKSLTGI  125

Query  199  RYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDES  20
            RY+VV+DD+WS  AWDDV   FPD+ N SR+LLTTR   VA  +GS S + HQM LL++ 
Sbjct  126  RYLVVLDDMWSTRAWDDVRMFFPDNNNRSRILLTTREKNVANYVGSSSQY-HQMRLLNKF  184

Query  19   ESWELF  2
            ESW L 
Sbjct  185  ESWNLL  190



>ref|XP_009766920.1| PREDICTED: putative late blight resistance protein homolog R1B-16, 
partial [Nicotiana sylvestris]
Length=872

 Score =   145 bits (366),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 117/197 (59%), Gaps = 5/197 (3%)
 Frame = -2

Query  586  GRKTAHDVLQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGI  407
            G+K +++ L      S++   + K  MVG+ DE + + + L    S E KV+ I+GMGGI
Sbjct  93   GKKASNESLVLDS--STKDIPNLKNNMVGRDDERKRLLENLTRGFSGEPKVIPIVGMGGI  150

Query  406  GKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLL--DSISKQGNLENSTDEDL  233
            GKTTLA++V+ D S+  HFDVRAW   S  +N + + V LL     +K   +    +  L
Sbjct  151  GKTTLAKEVFNDASIRSHFDVRAWATISSQYNVKDIYVSLLLFTKETKDERVHMKDEAML  210

Query  232  ALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSY  53
            A  L + LK +RY++V+DD+W+ +AWDDV  CFP +  GSR+LLTTR   VA C      
Sbjct  211  ADMLQKSLKGKRYLIVMDDMWNSKAWDDVRQCFPSEDKGSRILLTTRNTEVA-CYAGTGN  269

Query  52   FSHQMHLLDESESWELF  2
             S QM  ++  ESW+LF
Sbjct  270  LSLQMDFMNPDESWKLF  286



>gb|AEW48190.1| disease resistance protein RX4 [Solanum albicans]
Length=909

 Score =   145 bits (366),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 116/188 (62%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L+GLL   S +       D+ LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ +AWD +  CFPD   GSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTKAWDGIKLCFPDCYKGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>gb|EYU30149.1| hypothetical protein MIMGU_mgv1a018270mg, partial [Erythranthe 
guttata]
Length=727

 Score =   144 bits (364),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 99/146 (68%), Gaps = 7/146 (5%)
 Frame = -2

Query  439  KVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN  260
            ++ +I+GMGGIGK+TLA+ +Y+DP +  HF VRAW+  SQ +  + ML+GL+  I++   
Sbjct  10   EITTIVGMGGIGKSTLAKMLYDDPLIVYHFYVRAWITVSQDYRVKTMLLGLIHGINQL--  67

Query  259  LENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVV  80
                +D+ LA +LY+ LK +RY++V+DDVW  +AWDDV   FPDD NGSR++LT+R+  V
Sbjct  68   ----SDQSLAEQLYRSLKGKRYLIVMDDVWCNDAWDDVRRSFPDDKNGSRIILTSRLMEV  123

Query  79   ATCIGSKSYFSHQMHLLDESESWELF  2
            A  + +KS   H M  L   E WEL 
Sbjct  124  ALRVNAKSA-PHHMQFLSVDEGWELL  148



>gb|AEW48206.1| disease resistance protein RGH4 [Solanum fernandezianum]
Length=932

 Score =   145 bits (366),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 115/188 (61%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L+GLL   S +       D+ LA +L + LK
Sbjct  182  KLYSDPCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NGSR+ LTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCINGSRIHLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>gb|ACO25629.1| NBS-coding resistance protein [Nicotiana repanda]
Length=171

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 89/140 (64%), Gaps = 3/140 (2%)
 Frame = -2

Query  415  GGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTD  242
            GGIGKTTLA ++Y DP +  HFD+RA    SQ +  R +L+GLL SIS + N   E   D
Sbjct  1    GGIGKTTLANKIYSDPFIMSHFDIRAKATVSQEYCARNVLLGLLSSISGKTNEFQEQQDD  60

Query  241  EDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGS  62
            + LA +L + LK  RY+VV+DD W+ EAWDD+  CFPD  NGSR+L+TTR   VA C  S
Sbjct  61   DQLADRLQKLLKCGRYLVVIDDTWTREAWDDIKRCFPDCNNGSRILMTTRNVEVAECASS  120

Query  61   KSYFSHQMHLLDESESWELF  2
                 H M L++  ESW L 
Sbjct  121  GKTPYH-MRLMNFDESWSLL  139



>ref|XP_009608888.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana tomentosiformis]
Length=538

 Score =   142 bits (359),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 119/185 (64%), Gaps = 9/185 (5%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEF-EIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPS  365
            SS+  +  +  +VG +D+F  I+ +L  +  + +  V+S++GMGGIGKTTLAR+ Y+D S
Sbjct  141  SSRRYAIEQYTVVGMEDDFINILDRLTAQ--THDLTVISVVGMGGIGKTTLARKAYDDSS  198

Query  364  VSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLEN----STDEDLALKLYQCLKRQR  197
            +   FD  AWV  S+ +N+RQ+L+ ++ SIS+    E+    STD+ LA  +Y+ LK +R
Sbjct  199  IRYRFDTHAWVTVSENYNERQVLLDVIISISRDRTDESYETMSTDQ-LAEIVYKGLKGRR  257

Query  196  YMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESE  17
            +++++DD+WS EAWD +   FP+D N SR+LLTTR+  VA    S  +  H M  L   +
Sbjct  258  FLIIIDDLWSTEAWDQMQRLFPNDNNKSRILLTTRLNYVAD-YASPDFPPHSMSFLSLDD  316

Query  16   SWELF  2
            SW LF
Sbjct  317  SWNLF  321



>ref|XP_009626592.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X1 [Nicotiana tomentosiformis]
Length=920

 Score =   145 bits (366),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 113/182 (62%), Gaps = 6/182 (3%)
 Frame = -2

Query  538  SQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
            SQ A   +  MVG + EFE+++  L   GS E ++VSI+GMGGIGKTTLA ++Y  P + 
Sbjct  134  SQPALELENTMVGHETEFEMLQDQLARGGS-ELEIVSIVGMGGIGKTTLANKIYTHPFIM  192

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDED---LALKLYQCLKRQRYMV  188
             HFD+RA    S  +  R +L+GLL SIS +   E    +D   LA +L + LK  RY+V
Sbjct  193  SHFDIRAKATVSLEYRARNVLLGLLFSISVK-TYEFYGQQDVGQLADRLQKLLKGGRYLV  251

Query  187  VVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWE  8
            V+DD+W+ EAWDD+  CF D  NGSR+LLTTR   VA    S     +QM LL+ +ESW 
Sbjct  252  VIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAE-YASSGKPPYQMRLLNSNESWN  310

Query  7    LF  2
            L 
Sbjct  311  LL  312



>ref|XP_009626593.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X2 [Nicotiana tomentosiformis]
Length=879

 Score =   145 bits (365),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 113/182 (62%), Gaps = 6/182 (3%)
 Frame = -2

Query  538  SQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
            SQ A   +  MVG + EFE+++  L   GS E ++VSI+GMGGIGKTTLA ++Y  P + 
Sbjct  134  SQPALELENTMVGHETEFEMLQDQLARGGS-ELEIVSIVGMGGIGKTTLANKIYTHPFIM  192

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDED---LALKLYQCLKRQRYMV  188
             HFD+RA    S  +  R +L+GLL SIS +   E    +D   LA +L + LK  RY+V
Sbjct  193  SHFDIRAKATVSLEYRARNVLLGLLFSISVK-TYEFYGQQDVGQLADRLQKLLKGGRYLV  251

Query  187  VVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWE  8
            V+DD+W+ EAWDD+  CF D  NGSR+LLTTR   VA    S     +QM LL+ +ESW 
Sbjct  252  VIDDIWTTEAWDDIKLCFSDCNNGSRILLTTRNVDVAE-YASSGKPPYQMRLLNSNESWN  310

Query  7    LF  2
            L 
Sbjct  311  LL  312



>gb|AEW48199.1| disease resistance protein RGH6 [Solanum x edinense]
Length=913

 Score =   145 bits (365),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 116/188 (62%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +H     E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHDVEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAA  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++  DP +   FD+ A V  SQ +  R +++GLL SIS +       +  LA +L + LK
Sbjct  182  KLCSDPYIMSRFDIHAKVTVSQEYCVRNVILGLLSSISDE------PENQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  CFPD  NG R+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCFPDCINGRRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_011088087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=853

 Score =   144 bits (364),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 115/185 (62%), Gaps = 6/185 (3%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            SS+   +    +VG   +   +K  L    SK  +V++I+GMGGIGKT LAR +Y+DPSV
Sbjct  135  SSRQDPNPNNIIVGVAQDLIQLKDRLFGQPSKALQVIAIVGMGGIGKTALARNLYDDPSV  194

Query  361  SIHFDVRAWVVASQ---LHNKRQMLVGLLDSI--SKQGNLENSTDEDLALKLYQCLKRQR  197
              HFD  AW   SQ   +   +++L+GLLD +    +  +   T+++LAL+L+Q L  +R
Sbjct  195  ISHFDACAWATISQDYSMEKLQEILLGLLDCLIGKPEDEMLEETNDELALRLHQALIGRR  254

Query  196  YMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESE  17
            Y++++DD+W  + WDD+   FPD  NGSR+++TTR   VA   G++S   HQM+LL + E
Sbjct  255  YLIILDDMWDVKLWDDIRRFFPDQSNGSRIIVTTRELGVADYTGTES-LHHQMNLLKDDE  313

Query  16   SWELF  2
            SW L 
Sbjct  314  SWNLL  318



>ref|XP_009604667.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009604674.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=717

 Score =   144 bits (362),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 112/170 (66%), Gaps = 3/170 (2%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            M+G + E E++ + L+  G ++  V+SI GM G+GKTTL +++Y+  ++S  FD+R W  
Sbjct  1    MIGFERETEMLMEKLVT-GPRQLDVISIFGMPGLGKTTLVKRLYDHEAISNRFDIRLWCC  59

Query  328  ASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWD  152
            +SQ ++KR +L  LL+ I K   + +  +D++LA KLY+ LK +RY++VVDDVW+ EAWD
Sbjct  60   SSQSYDKRSLLFELLNHIFKLDTSTKEKSDDELAEKLYRYLKGKRYLIVVDDVWNDEAWD  119

Query  151  DVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            D+   FPDD  GSR++LTTR+  +AT     S   H + L  E ESW L 
Sbjct  120  DIKRPFPDDDKGSRIILTTRLESIAT-YAMISSSPHFLRLFTEEESWMLL  168



>ref|XP_009773958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009773959.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=884

 Score =   144 bits (364),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 113/174 (65%), Gaps = 10/174 (6%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            +VG +D F  I+  L    +    VVSI+GMGGIGK+TLAR ++  PSVS  FD+ +WV 
Sbjct  151  LVGMEDVFNNIRDQLFG-QTPALNVVSIVGMGGIGKSTLARSLFNHPSVSRRFDISSWVT  209

Query  328  ASQLHNKRQMLV-----GLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSG  164
             SQ +N ++ML+     G+LD    +    N+++++L  ++ + LKR+RY++V+D++W+ 
Sbjct  210  VSQAYNAKEMLLDVLSFGILDG---KAMYRNTSEDELLDQVRRKLKRKRYLIVLDNIWTI  266

Query  163  EAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            EAWD+V   FPDD NGSR+++TTR+  VA C  S  +  H M LL   +SW+L 
Sbjct  267  EAWDEVRRSFPDDENGSRIMITTRLLEVANC-ASNDFSPHHMPLLSLEDSWKLL  319



>gb|AAF76163.1|AF266747_1 RGC1 [Solanum tuberosum]
Length=933

 Score =   145 bits (365),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 107/169 (63%), Gaps = 8/169 (5%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA ++Y DP +   FD+RA   
Sbjct  142  MVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLAAKLYSDPYIMSRFDIRAKAT  200

Query  328  ASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDD  149
             SQ +  R + +GLL   S +       D+ LA +L + LK +RY+VV+DD+W+ EAWDD
Sbjct  201  VSQEYCVRNVFLGLLSLTSDE------PDDQLADRLQKHLKGRRYLVVIDDIWTTEAWDD  254

Query  148  VSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +  CFPD  NGSR+LLTTR   VA    S     H M +++  ESW L 
Sbjct  255  IKLCFPDCYNGSRILLTTRNVEVAE-NASSGKPPHHMRIMNFDESWNLL  302



>ref|XP_009602298.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602299.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009602300.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=872

 Score =   144 bits (364),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 111/179 (62%), Gaps = 4/179 (2%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIH  353
            HAS  + +MVG   E   +   L   GS E +V+S+ GMGGIGK+T A+ ++  P +   
Sbjct  141  HASTLENDMVGYNIEQANMLGQLTS-GSPELEVISVTGMGGIGKSTFAKNLFSHPLILSF  199

Query  352  FDVRAWVVASQLHNKRQMLVGLL--DSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVD  179
            FD+R W+  S+ +  R++L+GLL   +I K+ +L+   D DLA+ L Q L  +RY++VVD
Sbjct  200  FDIRGWITVSEDYIYRKILLGLLIDANIGKEEDLDKKNDSDLAVCLKQRLMGRRYLIVVD  259

Query  178  DVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            D+WS  AWD++  C PDDG  SRVLLTTR   VA    S      +MHLLD+ +SW LF
Sbjct  260  DIWSKNAWDEIRLCLPDDGKRSRVLLTTRDVEVAQ-YASSPKDPFRMHLLDQEDSWNLF  317



>ref|XP_011072119.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=996

 Score =   145 bits (365),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 107/151 (71%), Gaps = 2/151 (1%)
 Frame = -2

Query  451  SKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSIS  272
            S + +++SI+GMGGIGKTTLARQ+Y+DPS+  HFD R WV  SQ ++ RQ+L+GLLDS  
Sbjct  283  SSKLEIISIVGMGGIGKTTLARQIYDDPSIFYHFDTRGWVAVSQEYSLRQVLLGLLDSTK  342

Query  271  K-QGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTT  95
                 +++ +D  LA  LY+CLK +RY++V+DD+W  + WD V   FPDD NGSRVLLTT
Sbjct  343  MLTEEMQDESDPRLAEFLYKCLKGRRYLIVMDDIWDIDIWDAVRRLFPDDSNGSRVLLTT  402

Query  94   RIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            R++ VA    S S   HQM  L+E++SW L 
Sbjct  403  RLSDVAVYANSSSRL-HQMRFLNEADSWNLL  432



>gb|AAM47597.1|AF513548_1 NBS/LRR resistance protein-like protein [Capsicum annuum]
Length=175

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 90/141 (64%), Gaps = 3/141 (2%)
 Frame = -2

Query  421  GMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISK-QGNLENST  245
            GMGG+GKTTLARQVY+D  +  HF +RAW+  SQ+H  R+ML+G+L   S    N    +
Sbjct  1    GMGGVGKTTLARQVYDDIYMEHHFYIRAWITVSQMHQHREMLLGILRCFSLVNDNTYLKS  60

Query  244  DEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIG  65
             E LA ++Y+ LK +RY++ +DDVW   AWD V   FPDD NGSRV+LT+RIA V     
Sbjct  61   TEQLAEQVYRSLKGRRYLIAMDDVWDTSAWDVVKRSFPDDKNGSRVILTSRIANVGIYAS  120

Query  64   SKSYFSHQMHLLDESESWELF  2
            S S   H M  L   ES +LF
Sbjct  121  SGS--PHYMQCLSVEESLKLF  139



>ref|XP_011072647.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=541

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 122/185 (66%), Gaps = 9/185 (5%)
 Frame = -2

Query  544  ISSQHASHSKEEMVGKKDEF-EIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDP  368
            +SS      K+ MVG+ D   EI+ KL  +    +  ++ I+GMGGIGKTTLAR VYE+P
Sbjct  148  LSSSILQGHKQAMVGRDDALNEIMDKLTRQ--QSDCLIIPIVGMGGIGKTTLARNVYENP  205

Query  367  SVSIHFDVRAWVVASQLHNKRQMLVGLL--DSISKQGNLENSTDEDLALKLYQCLKRQRY  194
             +  +FD+RAWV  SQ +N R++L+ L+  ++  ++  L    DE L   LY+CL  +RY
Sbjct  206  LIVEYFDIRAWVTVSQEYNTREILLELVCPNNKERKEALREIPDEGLGEMLYKCLCGRRY  265

Query  193  MVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCI-GSKSYFSHQMHLLDESE  17
            ++V+DD+WS EAW++V   FP++ + SR+++TTR+A +A  I GS+     +++ LD S+
Sbjct  266  LIVMDDIWSIEAWNNVKLFFPNNNSESRIMVTTRLANLAWQISGSRGL---KVNFLDTSQ  322

Query  16   SWELF  2
            SW+LF
Sbjct  323  SWDLF  327



>emb|CAB56299.1| NBS-LRR protein [Solanum acaule]
Length=938

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 115/188 (61%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S   HA    E  MVG+++EFE++   L+  G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPDHAFEQPENIMVGRENEFEMMLDQLVR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y DP +   FD+RA    SQ +  R +L+GLL   S +       D+ LA +L + LK
Sbjct  182  KLYSDPYIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDE------PDDQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ +AWD +  CFPD   GSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTKAWDGIKLCFPDCYKGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_009765789.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=732

 Score =   143 bits (361),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 110/169 (65%), Gaps = 3/169 (2%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG + E E++   L+  G ++  V+SI GM G+GKTTLA+++Y+  S+S  FD+R W  
Sbjct  1    MVGFERETEMLMDQLVT-GPRQLDVISIFGMPGLGKTTLAKRLYDHESISNRFDIRLWCC  59

Query  328  ASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWD  152
            +SQ ++KR +L  LL+ I K   + +  +D++LA  LY+ LK +RY++VVDDVWS E WD
Sbjct  60   SSQSYDKRSLLFELLNHICKLDTSTKEKSDDELAEMLYKHLKGKRYLIVVDDVWSCEVWD  119

Query  151  DVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            D+   FPDD  GSR++LTTR+  +AT     S   H + L  E ESW L
Sbjct  120  DIKRPFPDDDKGSRIILTTRLESIATYAMINSS-HHHLRLFTEEESWML  167



>gb|EYU21828.1| hypothetical protein MIMGU_mgv1a019841mg [Erythranthe guttata]
Length=784

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/204 (40%), Positives = 128/204 (63%), Gaps = 15/204 (7%)
 Frame = -2

Query  586  GRKTAHDVLQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSK------EKKVVSI  425
            GR   HD+   S  ++   A+ S+  +  ++D    + +LLIE+  K         ++ I
Sbjct  152  GRIEDHDLHINSSTLAG--AASSRSHLTTRRDAVVGLDELLIEVMDKLTGQQSNLHIIPI  209

Query  424  IGMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLEN--  251
            +GMGGIGKTTLAR VY  P +  HFD+RAWV  SQ +N +++L+ +L  ISK+ NLE+  
Sbjct  210  VGMGGIGKTTLARNVYAKPLIMQHFDIRAWVTVSQNYNVQEILLEILLCISKEKNLESLS  269

Query  250  -STDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVAT  74
              ++ +L   +++ L  +RY++V+DD+WS EAWD V+  FP++G GSR+++TTR++ VA+
Sbjct  270  WMSEGELGETVHKTLWGRRYLIVLDDIWSVEAWDKVNLFFPENGQGSRIMITTRLSDVAS  329

Query  73   CIGSKSYFSHQMHLLDESESWELF  2
             IGS       M  L+E +SW+L 
Sbjct  330  -IGSHGVV---MDFLNEDKSWDLL  349



>ref|XP_006345448.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
[Solanum tuberosum]
Length=888

 Score =   144 bits (364),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 113/175 (65%), Gaps = 6/175 (3%)
 Frame = -2

Query  517  KEEMVGKKDEFE-IIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVR  341
            +  +VG  D+ E +I++LL    S E++VV+I GMGGIGKTTLA++ Y+ P V   FDV 
Sbjct  146  ENNVVGLDDDLEKVIERLLGY--SSEREVVAITGMGGIGKTTLAKKAYDYPRVRSRFDVH  203

Query  340  AWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQRYMVVVDDVWS  167
            AWV  S+ +  R++L+ L+  I       L   T++ LA  LY+ LK +RY++V+DD+WS
Sbjct  204  AWVTVSREYGMRRLLLSLVRCIPGMTTDKLVEKTEDQLAESLYRKLKDRRYLIVIDDIWS  263

Query  166  GEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
             + WDDV+ CFPDD NGSR++LT+R+  VA      S   H+M +L   +SW+L 
Sbjct  264  TKVWDDVTRCFPDDDNGSRIILTSRLKDVAAYANPDSPL-HEMGVLSLDDSWKLL  317



>ref|XP_004251396.2| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
 gb|AET22503.1| hypothetical protein [Solanum lycopersicum]
Length=888

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 115/197 (58%), Gaps = 9/197 (5%)
 Frame = -2

Query  586  GRKTAHDVLQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEK-KVVSIIGMGG  410
            GR T       +Q +SSQ        +VG  D+F  I   L   G  +K  VV I GMGG
Sbjct  136  GRSTPSSSRDVTQSLSSQ----KDHVVVGLYDDFLRIADKLT--GYPDKLDVVVIFGMGG  189

Query  409  IGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN-LENSTDEDL  233
            IGKTTLA+++Y D  +  HF VRAW+  S+ +  R ML+ LL   SK    ++   +E+L
Sbjct  190  IGKTTLAKRIYHDKLIEEHFYVRAWITVSERYKVRNMLLDLLVCTSKVAFIMDEMENEEL  249

Query  232  ALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSY  53
              +LY+ LK QRY++V+DDVW  EAWDDV   FP+D NGSRV++T+RI  VA  I   + 
Sbjct  250  GERLYKSLKGQRYLIVMDDVWYTEAWDDVRRYFPNDNNGSRVMVTSRIMKVARYINPLNP  309

Query  52   FSHQMHLLDESESWELF  2
              HQM  L   ESW+L 
Sbjct  310  -PHQMRFLTVEESWKLL  325



>ref|XP_006366309.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=614

 Score =   142 bits (358),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 110/180 (61%), Gaps = 3/180 (2%)
 Frame = -2

Query  538  SQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVS  359
            S+++ H K  ++   ++   +K  LI   SK   VVSI+GMGGIGKTTLAR+VY+D  + 
Sbjct  129  SEYSPHLKATVLDLDNDLMTVKSRLIGPHSK-LDVVSIVGMGGIGKTTLARKVYDDIYME  187

Query  358  IHFDVRAWVVASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVVV  182
             HF +RAW+  SQ+H  R+ML+G+L   S    N    + E LA ++Y+ LK +RY++ +
Sbjct  188  HHFYIRAWITVSQMHQLREMLLGILRCFSLVNDNTYLKSTEQLAEQVYRSLKGRRYLIAM  247

Query  181  DDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            DDVW   AWD V   FPDD NGSRV+LT+R+A  A    S S   H M  L    S +LF
Sbjct  248  DDVWDTTAWDVVKRSFPDDKNGSRVILTSRLA-NAGIYASSSSPPHYMRCLSVDHSLKLF  306



>gb|AET22504.1| hypothetical protein [Solanum lycopersicum]
 gb|AET22505.1| hypothetical protein [Solanum pimpinellifolium]
Length=886

 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 115/197 (58%), Gaps = 9/197 (5%)
 Frame = -2

Query  586  GRKTAHDVLQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEK-KVVSIIGMGG  410
            GR T       +Q +SSQ        +VG  D+F  I   L   G  +K  VV I GMGG
Sbjct  136  GRSTPSSSRDVTQSLSSQ----KDHVVVGLYDDFLRIADKLT--GYPDKLDVVVIFGMGG  189

Query  409  IGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN-LENSTDEDL  233
            IGKTTLA+++Y D  +  HF VRAW+  S+ +  R ML+ LL   SK    ++   +E+L
Sbjct  190  IGKTTLAKRIYHDKLIEEHFYVRAWITVSERYKVRNMLLDLLVCTSKVAFIMDEMENEEL  249

Query  232  ALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSY  53
              +LY+ LK QRY++V+DDVW  EAWDDV   FP+D NGSRV++T+RI  VA  I   + 
Sbjct  250  GERLYKSLKGQRYLIVMDDVWYTEAWDDVRRYFPNDNNGSRVMVTSRIMKVARYINPLNP  309

Query  52   FSHQMHLLDESESWELF  2
              HQM  L   ESW+L 
Sbjct  310  -PHQMRFLTVEESWKLL  325



>emb|CDP00737.1| unnamed protein product [Coffea canephora]
Length=1006

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 121/182 (66%), Gaps = 5/182 (3%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            SS      K E VG  D+  ++ + L  + S+  +VV+I+GMGGIGKTTLAR++++DPS 
Sbjct  284  SSLSPPAQKNEAVGLDDDLMLMSERLSRVPSR-LEVVTIVGMGGIGKTTLARKIFDDPST  342

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENS--TDEDLALKLYQCLKRQRYMV  188
              +F   AWV  SQ++  R +L+GLL  +++  + EN   ++E+LA  LY+ LK +RY++
Sbjct  343  ICNFHACAWVQVSQVYRLRNLLLGLLKCVTQLKD-ENCAKSNEELAEDLYRSLKGKRYLI  401

Query  187  VVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWE  8
            V+DDVWS   WDDV   FPDD N SR++LTTR+  VA  + SKS  SH+M LLD  +SW+
Sbjct  402  VIDDVWSTRTWDDVKRIFPDDKNASRIVLTTRVGEVADYVNSKSA-SHRMRLLDIDQSWD  460

Query  7    LF  2
            L 
Sbjct  461  LL  462



>ref|XP_011077106.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
 ref|XP_011077107.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=897

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 112/183 (61%), Gaps = 5/183 (3%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            SS  A    + MVG +D+   IK  L    S+  + V I GMGGIGKTTLAR  Y+D  +
Sbjct  165  SSVLAPAKNDAMVGFEDDLMAIKTRLCG-ESRNLEFVPIYGMGGIGKTTLARNAYDDRLI  223

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSIS---KQGNLENSTDEDLALKLYQCLKRQRYM  191
              HFD RAW+  SQ ++ ++ML  ++DSI+   +  + +  + E +A   Y+ LK +RY+
Sbjct  224  IQHFDTRAWLTVSQDYSIQEMLFAIIDSINAFNETFDEKKHSYERMAEHAYKGLKGRRYL  283

Query  190  VVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESW  11
            VV+DD+WS +AWDD+   FPDD NGSR++LTTR+  VA      S   H+MH +D  +SW
Sbjct  284  VVLDDIWSTKAWDDMRRIFPDDNNGSRIILTTRLQDVAAYADPSSPL-HEMHFMDMDQSW  342

Query  10   ELF  2
             L 
Sbjct  343  NLL  345



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 115/174 (66%), Gaps = 5/174 (3%)
 Frame = -2

Query  517  KEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            +E +VG  +E   + + L + G ++ +V+S++GMGG+GKTTLA++VY DPS+  HF +RA
Sbjct  153  EENVVGFDEEARTVVERLTD-GPEQLEVISVVGMGGLGKTTLAKKVYSDPSIEYHFYIRA  211

Query  337  WVVASQLHNKRQMLVGLLDSISK-QGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGE  161
            WV  SQ + +R++ +G+LDS+      +    D+ LA +L++ L+  RY++V+DDVW+ E
Sbjct  212  WVYMSQQYCRREVFLGILDSMGLITDQVYKMNDDRLAEELFRHLRSNRYLIVIDDVWTTE  271

Query  160  AWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFS-HQMHLLDESESWELF  2
            AW+D+   FP+   GSR+LLT+R   VA  + +  Y + H++  L   ESWEL 
Sbjct  272  AWNDIKMAFPNTACGSRILLTSRNTEVA--MHANPYCNPHRLRFLTNEESWELL  323



>ref|XP_006345616.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=530

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 107/181 (59%), Gaps = 2/181 (1%)
 Frame = -2

Query  544  ISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPS  365
             S++     +  ++G +D+F  I   LI     E  V+ I GMGGIGKTTLAR+VY+D  
Sbjct  20   FSAEKGRVEENTIIGMEDDFNTIFDRLIS-QRNELTVIPIFGMGGIGKTTLARKVYDDSY  78

Query  364  VSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVV  185
            +   FD  AWV  S  +NKRQML+ L+ SI+   N E  +D+ L + +Y+ LK +R+++V
Sbjct  79   IRSRFDRHAWVTVSNEYNKRQMLLELVYSITG-SNQEMMSDDQLMVNVYRGLKGRRFLIV  137

Query  184  VDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            +DD+WS EAW  +   FP+D   SR+L+TTR+  VA  +    +  H+   L   + W L
Sbjct  138  IDDIWSNEAWKKMKRIFPNDDKKSRILITTRLKYVADYVSCPDFPPHRKSFLSLEDGWSL  197

Query  4    F  2
            F
Sbjct  198  F  198



>ref|XP_004231117.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Solanum lycopersicum]
Length=880

 Score =   144 bits (362),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 113/175 (65%), Gaps = 6/175 (3%)
 Frame = -2

Query  517  KEEMVGKKDEFE-IIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVR  341
            + ++VG  D+ E +I++LL    S E++VV+I GMGGIGKTTLA++ Y+ P V   FDV 
Sbjct  142  ENDVVGLDDDLEKVIERLLGY--SSEREVVAITGMGGIGKTTLAKKAYDYPRVRSRFDVH  199

Query  340  AWVVASQLHNKRQMLVGLLDSIS--KQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWS  167
            AWV  S+ +  R++L+ L   I       L   T++ LA  LY+ LK +RY++V+DD+WS
Sbjct  200  AWVTVSREYGMRRLLLSLARCIPGMTADKLVEKTEDQLAESLYRKLKDRRYLIVIDDIWS  259

Query  166  GEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
             + WDDV+ CFPDD NGSR++LT+R+  VA      S   H+M +L   +SW+L 
Sbjct  260  TKVWDDVTRCFPDDDNGSRIILTSRLKDVAAYANPDSPL-HEMGVLSLDDSWKLL  313



>ref|XP_009589053.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009589054.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=635

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 112/172 (65%), Gaps = 5/172 (3%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            +VG KD+F  I   L    + +  V+ ++GMGGIGKTTLAR+VY+D ++   FD  AWV 
Sbjct  150  VVGMKDDFNTILDRLTA-QTDQLTVIPVVGMGGIGKTTLARKVYDDSTIRYRFDKHAWVT  208

Query  328  ASQLHNKRQMLVGLLDSISKQGNLENS---TDEDLALKLYQCLKRQRYMVVVDDVWSGEA  158
             SQ++N+RQ+L+ L+ SIS+    E++   +++ LA  +Y+ +  +R+++V+DD+WS EA
Sbjct  209  ISQVYNERQILLELVSSISQDKTDESNQKMSNDQLAEIVYRGVIGRRFLIVIDDLWSTEA  268

Query  157  WDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            WD +   FP++ N SR+LLTTR++ VA    S  +  H M  L   ESW LF
Sbjct  269  WDQIQRIFPNENNRSRILLTTRLSYVAD-YASPDFPHHNMSFLSFDESWILF  319



>emb|CDP05557.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 121/191 (63%), Gaps = 8/191 (4%)
 Frame = -2

Query  556  RSQVISSQHAS---HSKEE--MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTL  392
            R++  S +HAS    ++EE  +VG  ++   +K+ L  L  K   +++I+GMGGIGKTTL
Sbjct  134  RARNHSVEHASGWSSTQEETLVVGIDNDLLKVKEKLTGLPHK-LDILTIVGMGGIGKTTL  192

Query  391  ARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN-LENSTDEDLALKLYQ  215
            AR+V+ DP +  HF VRAWV  SQ +  R +L+GLL S+++ G+ +    ++ LA  LY+
Sbjct  193  ARKVFNDPLIEYHFYVRAWVTVSQKYVLRDVLLGLLCSLTRLGDEIFKEKNDQLAELLYR  252

Query  214  CLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMH  35
             LK QRY++V D VW G+   D+   FPDD NGSR++LT+R+  V  C+   S+  H M 
Sbjct  253  TLKGQRYLIVFDAVWDGKILYDLRRSFPDDRNGSRIVLTSRLIDVNMCVNLDSH-HHHMS  311

Query  34   LLDESESWELF  2
             L  ++SWEL 
Sbjct  312  FLSLNDSWELL  322



>gb|AGX27499.1| NBS-LRR class resistance protein Fy1-Ry1 [Sesamum indicum]
Length=471

 Score =   140 bits (354),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 103/152 (68%), Gaps = 3/152 (2%)
 Frame = -2

Query  454  GSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSI  275
            G  + +V+ I+GMGGIGKTTLAR +Y+D  VS+HFDVRAW   SQ ++  ++L+GLL  +
Sbjct  19   GGSKLEVIPIVGMGGIGKTTLARNLYKDRLVSVHFDVRAWATISQDYDVGKILLGLLRLV  78

Query  274  SKQGNLE--NSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLL  101
            +++   E     +E+L  +LY+ L  +RY++++DD+WS  +W+D+   FPD+ NGSR+++
Sbjct  79   TRRPTYEMLQMGNEELGQRLYRTLFGRRYLIILDDMWSSSSWNDIRMFFPDNDNGSRIII  138

Query  100  TTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
            TTR + +A  I  +S   H M  L + ESW L
Sbjct  139  TTRNSSLANFIAFRSP-HHNMQFLKDDESWNL  169



>gb|AEQ61807.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=174

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 92/141 (65%), Gaps = 2/141 (1%)
 Frame = -2

Query  421  GMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISK-QGNLENST  245
            GMGG+GKTTLAR +Y D  +  +FD+RAWVV SQ ++ R M   L+    +  G L + +
Sbjct  1    GMGGVGKTTLARNLYSDSLIEYYFDIRAWVVLSQDYDARLMFRSLVCCTGEPNGELNHKS  60

Query  244  DEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIG  65
             E+LA +LY+ LK +RY+VV+DDVW  + WDDV   FPDD NGSR++LT+R + VA    
Sbjct  61   IEELAERLYKNLKGRRYLVVMDDVWDTKVWDDVKRFFPDDNNGSRIILTSRQSEVAIYAN  120

Query  64   SKSYFSHQMHLLDESESWELF  2
            S +   HQM LL    SW+L 
Sbjct  121  SSNSI-HQMRLLSPDASWDLL  140



>gb|AGX27506.1| NBS-LRR class resistance protein Fy12-Ry1, partial [Sesamum indicum]
Length=616

 Score =   141 bits (356),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 110/174 (63%), Gaps = 5/174 (3%)
 Frame = -2

Query  514  EEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAW  335
            + MVG +++    K  L   GS + + V I GMGGIGKTTLAR  Y D  +  HFD+RAW
Sbjct  171  DAMVGFEEDLLATKTRLYG-GSSKLEFVPIYGMGGIGKTTLARNAYGDSLIVEHFDIRAW  229

Query  334  VVASQLHNKRQMLVGLLDSI---SKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSG  164
            +  SQ ++ +QML  L+DSI   +++ + E  + E ++ ++Y+  K +RY+VV+DDVWS 
Sbjct  230  LTVSQDYSVQQMLFALVDSIKPFNEKFDGEKHSYEQMSEQVYKSFKGRRYLVVLDDVWST  289

Query  163  EAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +AWDDV    PDD NGSR+++TTR+  VA    S S   H+M  +D  +SW L 
Sbjct  290  KAWDDVRRILPDDSNGSRIIITTRLQDVAAYADSSSPL-HEMRFMDVDQSWILL  342



>ref|XP_009600432.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=697

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 110/174 (63%), Gaps = 13/174 (7%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG  +E E++ + L+  G ++  V+SI GM G+GKTTLA+++Y+  ++S  FD+R W  
Sbjct  1    MVGFNEETEMLIEQLVR-GHRQLDVISIFGMPGLGKTTLAKKLYDHEAISNRFDIRLWCC  59

Query  328  ASQLHNKRQMLVGLL------DSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWS  167
            +SQ ++ R +L  LL      D I+K+ N     D +LA KLY+ LK +RY++VVDDVWS
Sbjct  60   SSQSYDNRALLFELLGHICELDDITKEKN-----DNELAEKLYRYLKGKRYLIVVDDVWS  114

Query  166  GEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWEL  5
              AWDD+   FPDD  GSR++LTTR+  +AT     S   H + L  E ESW L
Sbjct  115  PNAWDDIKRPFPDDDKGSRIILTTRLESIATYAMINSS-PHHLRLFTEEESWML  167



>ref|XP_009774731.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009774733.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=787

 Score =   143 bits (360),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/182 (43%), Positives = 119/182 (65%), Gaps = 6/182 (3%)
 Frame = -2

Query  541  SSQHASHSK-EEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDP  368
            S++H   S  EE+VG  KD   I+KKL++  G+KE  V+SI GM G+GKTTLAR+VY +P
Sbjct  18   STKHNFPSTDEEVVGFVKDAESIMKKLIV--GTKELDVISIFGMPGLGKTTLARKVYNNP  75

Query  367  SVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMV  188
            S+  +FDV+AW   SQ +N+R +L+ +    ++  + E   D D+A KL + LK +RY++
Sbjct  76   SIVNYFDVKAWCSVSQAYNRRTLLLEIFKQATRDKS-EIKEDVDIADKLQKTLKGRRYLI  134

Query  187  VVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWE  8
            V+DD+W  +AW+D+  CFP   +GSRV++TTRI  VA  +  ++   + +  L   ESWE
Sbjct  135  VLDDIWEIDAWEDLGLCFPKGEDGSRVMVTTRIEEVAKHLQHRND-PYSLRFLTSEESWE  193

Query  7    LF  2
            L 
Sbjct  194  LL  195



>ref|XP_004252073.2| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=917

 Score =   143 bits (361),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 111/173 (64%), Gaps = 8/173 (5%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIEL--GSK-EKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            MVG+  E E   ++L EL  GSK E KV+ I+GMGGIGKTTLA+QV+  PS+   FDVRA
Sbjct  155  MVGRDKEKE---RMLEELRGGSKDELKVIPIVGMGGIGKTTLAKQVFNHPSIQSRFDVRA  211

Query  337  WVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-DLALKLYQCLKRQRYMVVVDDVWSGE  161
            W    + +N +++L+ LL SI    +   S DE +LA  L + LK +RY++V+DD+W  +
Sbjct  212  WATICKEYNVKEILLSLLQSIINIDDKVYSRDEAELADLLQKKLKCRRYLIVIDDIWCYK  271

Query  160  AWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            AWDD   CFP D NGSR+LLTTR   VA    S S    +M+L++  ESW L 
Sbjct  272  AWDDTRQCFPIDNNGSRILLTTRHTEVAI-YASSSNLHLKMNLMNADESWNLL  323



>ref|XP_009772626.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772627.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772628.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=791

 Score =   143 bits (360),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 119/185 (64%), Gaps = 5/185 (3%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVY  377
            +Q  +  +   + EE+VG  KD   I+KKL++  G+KE  V+SI GM G+GKTTLAR+VY
Sbjct  15   AQPSTKHNFPSTDEEVVGFVKDAESIMKKLIV--GTKELDVISIFGMPGLGKTTLARKVY  72

Query  376  EDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQR  197
             +PS+  +FDV+AW   SQ +N+R +L+ +    ++  + E   D D+A KL + LK +R
Sbjct  73   NNPSIVNYFDVKAWCSVSQAYNRRTLLLEIFKQATRDKS-EIKEDVDIADKLQKTLKGRR  131

Query  196  YMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESE  17
            Y++V+DD+W  +AW+D+  CFP   +GSRV++TTRI  VA  +  ++   + +  L   E
Sbjct  132  YLIVLDDIWEIDAWEDLGLCFPKGEDGSRVMVTTRIEEVAKHLQHRND-PYSLRFLTSEE  190

Query  16   SWELF  2
            SWEL 
Sbjct  191  SWELL  195



>ref|XP_009761073.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009761075.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009761076.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=764

 Score =   142 bits (359),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 112/172 (65%), Gaps = 5/172 (3%)
 Frame = -2

Query  514  EEMVG-KKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            EE+VG +KD   I+KKL+   G+KE  V+SI GM G+GKTTLAR+VY +PS+  HFD R 
Sbjct  28   EEVVGFEKDAESIMKKLIG--GTKELDVISIFGMPGLGKTTLARKVYNNPSIVNHFDARV  85

Query  337  WVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEA  158
            W   SQ + +R +L+ +L   +  GN E   D+D+A KL + L  +RY++V+DD+W  EA
Sbjct  86   WCSVSQTYIERTLLIEILKQ-ATGGNYEIKEDDDIADKLRKTLIGRRYLIVLDDIWEVEA  144

Query  157  WDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            W+D+  CFP   +GSRV++TTRI  VA  +  +S   + +  L   ESWEL 
Sbjct  145  WEDLGLCFPKGEDGSRVMVTTRIEQVAKHLQHRSD-PYSLRFLTLEESWELL  195



>ref|XP_009615718.1| PREDICTED: putative late blight resistance protein homolog R1B-12, 
partial [Nicotiana tomentosiformis]
Length=469

 Score =   140 bits (353),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 105/156 (67%), Gaps = 3/156 (2%)
 Frame = -2

Query  535  QHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSI  356
            +H+      MVG ++E E +K  L+++ S E++ ++I GMGGIGKTT AR++Y+DP +  
Sbjct  311  EHSPQLGNNMVGHENELEDVKCKLMKISSDERETMAITGMGGIGKTTFARKIYDDPEIKS  370

Query  355  HFDVRAWVVASQLHNKRQMLVGLLDSI--SKQGNLENSTDEDLALKLYQCLKRQRYMVVV  182
            HFD+ AWV  S+ +  R+ML+ LL  I  +++   E   D +LA KL Q L ++RY+VV+
Sbjct  371  HFDILAWVTVSKEYCVRKMLLQLLHCIPSTEEVRREARDDGELAGKLKQRLWKRRYLVVI  430

Query  181  DDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVAT  74
            DD+WS +AWDD+S  FP D  GS +LLTTR   VA+
Sbjct  431  DDIWSSKAWDDISIWFP-DCKGSHILLTTRCGNVAS  465



>ref|XP_009765695.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=896

 Score =   143 bits (361),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 111/179 (62%), Gaps = 5/179 (3%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIH  353
            H S    +MVG   E E ++  L    S + +V+SI+GMGGIGK+T A +++ DPS+   
Sbjct  145  HVSTLVNDMVGYNIEQEHMRSQLTG-HSSQLEVISIVGMGGIGKSTFANKMFSDPSILSF  203

Query  352  FDVRAWVVASQLHNKRQMLVGLL-DSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDD  176
            FDVR W+  S  ++ R+ML+ LL D++     L+  TD +LA  L + LK +RY++VVDD
Sbjct  204  FDVRGWITVSMNYSLRKMLLTLLQDTVGAAKELDEKTDGELADHLQKSLKGRRYLIVVDD  263

Query  175  VWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGS-KSYFSHQMHLLDESESWELF  2
            +WS EAWDDV  CFP++ N SR+LLTTR   VA    S K  F   M  L+  ESW LF
Sbjct  264  MWSREAWDDVRLCFPENNNRSRILLTTRDMKVAQYASSPKDLFP--MRFLEPKESWHLF  320



>ref|XP_009603168.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=1128

 Score =   144 bits (362),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 113/172 (66%), Gaps = 5/172 (3%)
 Frame = -2

Query  511  EMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWV  332
            +MVG KDE E ++  L    S + +V+SI GMGGIGK+T A++++ DPS+   FDVR W+
Sbjct  374  DMVGYKDEQESMRGKLTG-HSSQLEVISIAGMGGIGKSTFAKKMFSDPSILEFFDVRGWI  432

Query  331  VASQLHNKRQMLVGLL-DSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAW  155
              S+ ++ R+ML+ LL D+ + + NL+N +D DLA  L + L  +RY++VVDD+WS EAW
Sbjct  433  TVSRDYSVRKMLLSLLQDATAVKENLDNVSDGDLAGLLKKRLNSRRYLIVVDDIWSIEAW  492

Query  154  DDVSNCFPDDGNGSRVLLTTRIAVVATCIGS-KSYFSHQMHLLDESESWELF  2
            DD+   FP++ N SR+LLTTR   VA    S K  F   M  L+  ESW LF
Sbjct  493  DDIRQWFPENSNTSRILLTTRDMKVARYASSPKDPFP--MRFLEPKESWNLF  542


 Score =   142 bits (358),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 102/153 (67%), Gaps = 4/153 (3%)
 Frame = -2

Query  454  GSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLL-DS  278
            GS E +V+SI+GMGGIGK+T AR++Y DPS+    DVRAW+  S+ ++ R ML+ LL D+
Sbjct  162  GSSELEVISIVGMGGIGKSTFARKMYSDPSIVSFHDVRAWITVSKDYSLRNMLLCLLRDA  221

Query  277  ISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLT  98
            I     L+  +D +LA +L + L  +RY++VVDD+WS EAWDDV  CFP++ N SR+LLT
Sbjct  222  IGMTKELDKRSDGELAERLRKHLMAKRYLIVVDDIWSREAWDDVRLCFPENNNRSRILLT  281

Query  97   TRIAVVATCIGS-KSYFSHQMHLLDESESWELF  2
            TR   VA    S K  F  QM LL+  E   LF
Sbjct  282  TRDMKVAQYASSPKDLF--QMRLLNPKERLSLF  312



>ref|XP_009765696.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=882

 Score =   143 bits (360),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 81/179 (45%), Positives = 111/179 (62%), Gaps = 5/179 (3%)
 Frame = -2

Query  532  HASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIH  353
            H S    +MVG   E E ++  L    S + +V+SI+GMGGIGK+T A +++ DPS+   
Sbjct  145  HVSTLVNDMVGYNIEQEHMRSQLTG-HSSQLEVISIVGMGGIGKSTFANKMFSDPSILSF  203

Query  352  FDVRAWVVASQLHNKRQMLVGLL-DSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDD  176
            FDVR W+  S  ++ R+ML+ LL D++     L+  TD +LA  L + LK +RY++VVDD
Sbjct  204  FDVRGWITVSMNYSLRKMLLTLLQDTVGAAKELDEKTDGELADHLQKSLKGRRYLIVVDD  263

Query  175  VWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGS-KSYFSHQMHLLDESESWELF  2
            +WS EAWDDV  CFP++ N SR+LLTTR   VA    S K  F   M  L+  ESW LF
Sbjct  264  MWSREAWDDVRLCFPENNNRSRILLTTRDMKVAQYASSPKDLFP--MRFLEPKESWHLF  320



>gb|EYU29927.1| hypothetical protein MIMGU_mgv1a021755mg, partial [Erythranthe 
guttata]
Length=842

 Score =   143 bits (360),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 77/171 (45%), Positives = 116/171 (68%), Gaps = 7/171 (4%)
 Frame = -2

Query  508  MVGKKDEF-EIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWV  332
            MVG  DE   +++KL  +     + V+ I+GMGGIGKTTLA  +YE+  ++ +FD+RAWV
Sbjct  152  MVGFVDELLHLMEKLTGQ--QSNRLVIPIVGMGGIGKTTLATNLYENSFITQYFDIRAWV  209

Query  331  VASQLHNKRQMLVGLLDSISKQ-GNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAW  155
              SQ ++ R+++ GLL S SK    ++   +++L  +L++ L  +RY++V+DDVWS E W
Sbjct  210  TVSQEYSAREIIFGLLSSQSKSTSEMDRKNEDELGDQLHKNLSGRRYLIVLDDVWSAEIW  269

Query  154  DDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
              +   FPD+ NGSR+++TTR++ VA   GS S+FS  M LLDE +SWELF
Sbjct  270  YKIKFFFPDNNNGSRIVVTTRMSNVAVHFGS-SHFS--MKLLDEVKSWELF  317



>ref|XP_006350137.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like, 
partial [Solanum tuberosum]
Length=911

 Score =   143 bits (360),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/193 (42%), Positives = 114/193 (59%), Gaps = 14/193 (7%)
 Frame = -2

Query  580  KTAHDVLQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGK  401
            K     ++RS+VI           MVG ++EF+++   L   G +E +VVSI+GMGGIGK
Sbjct  132  KIPELAVERSEVI-----------MVGYENEFKMMLDQLAR-GERELEVVSIVGMGGIGK  179

Query  400  TTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKL  221
            TTLA ++Y DP +   FD+RA    SQ +  R + + LL  IS +   +   D  LA +L
Sbjct  180  TTLATKLYNDPCMMYRFDIRAKATVSQEYCVRNVFLDLLSCISDKP-YDQLHDGQLADRL  238

Query  220  YQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQ  41
             + LK +RY+VV+DD+W+ +AWDD+  CFPD  NGSR+LLTTR   VA    S     H 
Sbjct  239  QKLLKGKRYLVVIDDIWTTKAWDDIQICFPDFHNGSRILLTTRNVEVAE-YASSGKLPHH  297

Query  40   MHLLDESESWELF  2
            M L++  ESW L 
Sbjct  298  MRLMNFDESWNLL  310



>ref|XP_006366837.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=618

 Score =   141 bits (355),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 112/170 (66%), Gaps = 6/170 (4%)
 Frame = -2

Query  508  MVGKKDEF-EIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWV  332
            +VG +D+   II++L   + ++E  ++ I+GMGGIGKTTLA+  Y+DP +  HFD+  WV
Sbjct  149  VVGLEDDLMRIIRRLKGSMSTRE--IIPILGMGGIGKTTLAKMAYDDPQIRNHFDIHVWV  206

Query  331  VASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEAWD  152
              SQ +  R +L+G++  I  +  ++  TD +L   +Y+ LK +RY+VV+DD+WS E WD
Sbjct  207  TISQEYQTRYLLLGVVSCIFNE--IKQGTDNELMDMIYKKLKGRRYLVVMDDIWSNEVWD  264

Query  151  DVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
             +S  FPDD NGSR++LT+R+  VAT     +   H++ LL+  +SW+L 
Sbjct  265  LMSRTFPDDDNGSRIILTSRLKGVATHADPDTP-PHEVSLLNADDSWKLL  313



>ref|XP_009608887.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=838

 Score =   142 bits (359),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/185 (42%), Positives = 119/185 (64%), Gaps = 9/185 (5%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEF-EIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPS  365
            SS+  +  +  +VG +D+F  I+ +L  +  + +  V+S++GMGGIGKTTLAR+ Y+D S
Sbjct  141  SSRRYAIEQYTVVGMEDDFINILDRLTAQ--THDLTVISVVGMGGIGKTTLARKAYDDSS  198

Query  364  VSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLEN----STDEDLALKLYQCLKRQR  197
            +   FD  AWV  S+ +N+RQ+L+ ++ SIS+    E+    STD+ LA  +Y+ LK +R
Sbjct  199  IRYRFDTHAWVTVSENYNERQVLLDVIISISRDRTDESYETMSTDQ-LAEIVYKGLKGRR  257

Query  196  YMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESE  17
            +++++DD+WS EAWD +   FP+D N SR+LLTTR+  VA    S  +  H M  L   +
Sbjct  258  FLIIIDDLWSTEAWDQMQRLFPNDNNKSRILLTTRLNYVAD-YASPDFPPHSMSFLSLDD  316

Query  16   SWELF  2
            SW LF
Sbjct  317  SWNLF  321



>gb|AEW48200.1| disease resistance protein RGH7 [Solanum x edinense]
Length=908

 Score =   143 bits (360),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 114/188 (61%), Gaps = 10/188 (5%)
 Frame = -2

Query  559  QRSQVIS-SQHASHSKEE-MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLAR  386
            Q S ++S  +HA    E  MVG+++EFE++   L   G +E +VVSI+GMGGIGKTTLA 
Sbjct  123  QTSSLVSLPEHAVEQPENIMVGRENEFEMMLDQLAR-GGRELEVVSIVGMGGIGKTTLAT  181

Query  385  QVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLK  206
            ++Y D  +   FD+RA    SQ +  R +L+GLL   S +       D  LA +L + LK
Sbjct  182  KLYSDLCIMSRFDIRAKATVSQEYCVRNVLLGLLSLTSDE------PDYQLADRLQKHLK  235

Query  205  RQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
             +RY+VV+DD+W+ EAWDD+  C PD  NGSR+LLTTR   VA    S     H M L++
Sbjct  236  GRRYLVVIDDIWTTEAWDDIKLCLPDCINGSRILLTTRNVEVAE-YASSGKPPHHMRLMN  294

Query  25   ESESWELF  2
              ESW L 
Sbjct  295  FDESWNLL  302



>ref|XP_011072135.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
[Sesamum indicum]
Length=540

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/196 (42%), Positives = 119/196 (61%), Gaps = 15/196 (8%)
 Frame = -2

Query  562  LQRSQVISSQHASHS--------KEEMVGKKDEFEIIKKLLIELGSK-EKKVVSIIGMGG  410
            LQ  + ISS  A  S           MVG  +  E I   L   G K + +++ I+GMGG
Sbjct  131  LQAQKPISSLPACSSTVLPSSAKSSTMVGFDERLERIMDELT--GHKCDLQILPIVGMGG  188

Query  409  IGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLA  230
            IGKTTLAR V++ P +  +FD+R W   SQ ++ R +LV LL+    Q N  + T  +L 
Sbjct  189  IGKTTLARNVFDHPYIVHYFDMRIWFTISQEYSSRGILVHLLNDGRNQEN--SKTLAELG  246

Query  229  LKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYF  50
             +LY+ L  ++Y++V+DDVWS + WDD+   FPD+ NGSR+L+TTR+  VA  +GS+S  
Sbjct  247  QRLYKNLFGRKYLIVMDDVWSIDVWDDLKRLFPDNKNGSRILVTTRLFNVAVSLGSQS--  304

Query  49   SHQMHLLDESESWELF  2
             + M  LDES+SW+LF
Sbjct  305  PYMMEFLDESKSWDLF  320



>ref|XP_009777085.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=547

 Score =   140 bits (353),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 111/183 (61%), Gaps = 5/183 (3%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            SS+  +  +  +VG +D+F  I   L    + E  V+ ++GMGGIGKTTLAR+ Y+D S+
Sbjct  141  SSRRYASEQNTVVGMEDDFNAILDRLTA-QTHELTVIPVVGMGGIGKTTLARKAYDDSSI  199

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQG---NLENSTDEDLALKLYQCLKRQRYM  191
               FD+ +WV  S+ +N+RQ+L+ ++ SIS+     + E  +   LA  +Y+ LK +R++
Sbjct  200  RYRFDIHSWVTVSENYNERQVLLDVIISISRDRTDESYETMSINQLAEIVYKGLKGRRFL  259

Query  190  VVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESW  11
            +++DD+WS E WD +   FP+D N SR+LLTTR+  VA    S  +  H M  L    SW
Sbjct  260  IIIDDLWSTEVWDQMQRLFPNDNNKSRILLTTRLNYVAD-YASPDFPPHSMSFLSLDNSW  318

Query  10   ELF  2
             LF
Sbjct  319  NLF  321



>gb|AGW28126.1| NBS-LRR class resistance protein Fy12-Ry12, partial [Sesamum 
indicum]
Length=499

 Score =   140 bits (352),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 109/172 (63%), Gaps = 5/172 (3%)
 Frame = -2

Query  508  MVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAWVV  329
            MVG +++    K  L   GS + + + I GMGGIGKTTLAR  Y D  +  HFD+RAW+ 
Sbjct  173  MVGFEEDLLATKTRLYG-GSSKLEFIPIYGMGGIGKTTLARNAYGDSLIVEHFDIRAWLT  231

Query  328  ASQLHNKRQMLVGLLDSI---SKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSGEA  158
             SQ ++ +QML  L+DSI   +++ + E  + E ++ ++Y+  K +RY+VV+DD+WS +A
Sbjct  232  VSQDYSVQQMLFALVDSIKPFNEKFDGEKHSYEQMSEQVYKSFKGRRYLVVLDDMWSTKA  291

Query  157  WDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            WDDV    PDD NGSR+++TTR+  VA    S S   H+M  +D  +SW L 
Sbjct  292  WDDVRRILPDDSNGSRIIITTRLQDVAAYADSSSPL-HEMRFMDVDQSWILL  342



>ref|XP_006362840.1| PREDICTED: putative late blight resistance protein homolog R1B-17-like 
[Solanum tuberosum]
Length=876

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 117/197 (59%), Gaps = 5/197 (3%)
 Frame = -2

Query  586  GRKTAHDVLQRSQVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEK-KVVSIIGMGG  410
            GR T    +       +Q  S  K+ +VG  D+F +I   L   G  +K  VV I GMGG
Sbjct  119  GRSTPSSSVNGCSRDVTQTLSSQKDVVVGLDDDFLLIADKLT--GYPDKLDVVVIFGMGG  176

Query  409  IGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN-LENSTDEDL  233
            IGKTTLA++++ D  +  HF VRAW+  S+ +  R ML+ LL   SK    ++   +E+L
Sbjct  177  IGKTTLAKRIFHDKLIEEHFYVRAWITVSERYKVRNMLLDLLGCTSKVPFIMDEMENEEL  236

Query  232  ALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSY  53
            A +LY+ LK QRY++V+DDVW+ +AWDDV   FP+D  GSRV++T+RI  VA  I   + 
Sbjct  237  AERLYKSLKGQRYLIVMDDVWNTKAWDDVRRYFPNDKIGSRVMVTSRIMKVARFINPLNP  296

Query  52   FSHQMHLLDESESWELF  2
              HQM  L   ESW+L 
Sbjct  297  -PHQMRFLTVDESWKLL  312



>ref|XP_006364178.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=860

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 114/180 (63%), Gaps = 2/180 (1%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            SS+ ++  ++ +VG KD+   I    I   +KE   +S++GMGGIGKTTLAR+V++D  +
Sbjct  145  SSRQSTTEEKTVVGMKDDLNTILNC-INAQTKELIAISVVGMGGIGKTTLARKVFDDSMI  203

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDEDLALKLYQCLKRQRYMVVV  182
               FD  AWV  S+ +NKRQML+ ++ SI+   N E  +++ L   +Y+ LK +R+++V+
Sbjct  204  RSQFDKHAWVTISEDYNKRQMLLDVVSSITGI-NQEIMSNDKLMETVYKGLKGRRFLIVI  262

Query  181  DDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            DD+WS EAW+ +   FP+D N SR++LTTR+  VA    S  +  H M  L   +SW LF
Sbjct  263  DDLWSTEAWNLMRRIFPNDYNKSRIILTTRLKNVANHASSSDFPPHDMSFLSLDDSWNLF  322



>gb|ACE79506.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=279

 Score =   136 bits (342),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 112/182 (62%), Gaps = 4/182 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            SS      +  +VG +D F  I+  L    +    VVSI+GMGGIGK+TLAR ++  PSV
Sbjct  10   SSGRVLDEENTLVGMEDVFNNIRDQLFG-QTPALNVVSIVGMGGIGKSTLARSLFNHPSV  68

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQRYMV  188
               FD+ +WV  SQ  + ++ML+ +L   +  G     + ++++L  ++++ LKR+RY++
Sbjct  69   YHRFDISSWVTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLI  128

Query  187  VVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWE  8
            V+DD+W+ EAWD V   FPDD NGSR+++TTR+  VA C G+  +  H M  L   +SW+
Sbjct  129  VLDDMWTIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN-DFPPHHMPFLSLEDSWK  187

Query  7    LF  2
            L 
Sbjct  188  LL  189



>gb|ACE79501.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=283

 Score =   136 bits (343),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 112/182 (62%), Gaps = 4/182 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            SS      +  +VG +D F  I+  L    +    VVSI+GMGGIGK+TLAR ++  PSV
Sbjct  10   SSGRVLDEENTLVGMEDVFNNIRDQLFG-QTPALNVVSIVGMGGIGKSTLARSLFNHPSV  68

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQRYMV  188
               FD+ +WV  SQ  + ++ML+ +L   +  G     + ++++L  ++++ LKR+RY++
Sbjct  69   YHRFDISSWVTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLI  128

Query  187  VVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWE  8
            V+DD+W+ EAWD V   FPDD NGSR+++TTR+  VA C G+  +  H M  L   +SW+
Sbjct  129  VLDDMWTIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN-DFPPHHMPFLSLEDSWK  187

Query  7    LF  2
            L 
Sbjct  188  LL  189



>gb|ACE79502.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=282

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 112/182 (62%), Gaps = 4/182 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            SS      +  +VG +D F  I+  L    +    VVSI+GMGGIGK+TLAR ++  PSV
Sbjct  11   SSGRVLDEENTLVGMEDVFNNIRDQLFG-QTPALNVVSIVGMGGIGKSTLARSLFNHPSV  69

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQRYMV  188
               FD+ +WV  SQ  + ++ML+ +L   +  G     + ++++L  ++++ LKR+RY++
Sbjct  70   YHRFDISSWVTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLI  129

Query  187  VVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWE  8
            V+DD+W+ EAWD V   FPDD NGSR+++TTR+  VA C G+  +  H M  L   +SW+
Sbjct  130  VLDDMWTIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN-DFPPHHMPFLSLEDSWK  188

Query  7    LF  2
            L 
Sbjct  189  LL  190



>gb|ACE79503.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=285

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 112/182 (62%), Gaps = 4/182 (2%)
 Frame = -2

Query  541  SSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSV  362
            SS      +  +VG +D F  I+  L    +    VVSI+GMGGIGK+TLAR ++  PSV
Sbjct  10   SSGRVLDEENTLVGMEDVFNNIRDQLFG-QTPALNVVSIVGMGGIGKSTLARSLFNHPSV  68

Query  361  SIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGN--LENSTDEDLALKLYQCLKRQRYMV  188
               FD+ +WV  SQ  + ++ML+ +L   +  G     + ++++L  ++++ LKR+RY++
Sbjct  69   YHRFDISSWVTVSQACDAKEMLLDVLSFGTPGGKAMYRDMSEDELLDQVHRELKRKRYLI  128

Query  187  VVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWE  8
            V+DD+W+ EAWD V   FPDD NGSR+++TTR+  VA C G+  +  H M  L   +SW+
Sbjct  129  VLDDMWTIEAWDQVRRSFPDDENGSRIMITTRLLEVANCAGN-DFPPHHMPFLSLEDSWK  187

Query  7    LF  2
            L 
Sbjct  188  LL  189



>gb|AEQ61804.1| NBS-LRR class disease resistance protein [Sesamum indicum]
Length=176

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 95/143 (66%), Gaps = 4/143 (3%)
 Frame = -2

Query  421  GMGGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSI---SKQGNLEN  251
            GMGG+GKTTLAR  Y+D  +  HF +RAWV  SQ ++ ++ML  L+DSI   S++ + E 
Sbjct  1    GMGGVGKTTLARSAYDDALIIEHFHIRAWVTVSQDYSIQEMLFTLVDSIKAFSEKFDEEK  60

Query  250  STDEDLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATC  71
             + E +A  +Y+ LK +RY+VV+DD+WS +AWDDV   FPDD NGSR+++TTR+  VA  
Sbjct  61   HSYEQMAEHVYKNLKGRRYLVVLDDMWSTKAWDDVRRIFPDDNNGSRIMITTRLQDVAAY  120

Query  70   IGSKSYFSHQMHLLDESESWELF  2
              S     H+M  +D  +SW L 
Sbjct  121  ADSSCPL-HEMRFMDADQSWILL  142



>ref|XP_010324491.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=875

 Score =   142 bits (358),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 112/180 (62%), Gaps = 10/180 (6%)
 Frame = -2

Query  517  KEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRA  338
            + EMVG  +E   +++ LI   S + +V+SI GMGGIGK+T A++++ DPSV   FDVR 
Sbjct  143  ENEMVGHINEQANMRRRLITGHSSQLEVISIAGMGGIGKSTFAKKLFSDPSVVGFFDVRG  202

Query  337  WVVASQLHNKRQMLVGLLD-------SISKQGNLENSTDEDLALKLYQCLKRQRYMVVVD  179
            W+  S+ ++ R+ML+ LL         I+ Q       + +LA +L +  K +RY++VVD
Sbjct  203  WITVSKDYSSRKMLISLLQDATGVKVEINPQYQEVEVINAELADRLQKSFKGKRYLIVVD  262

Query  178  DVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGS-KSYFSHQMHLLDESESWELF  2
            D+WS EAWDD+S  FP++ N SR+LLTTR   VA    S K+ F  QM  LD  ESW LF
Sbjct  263  DIWSTEAWDDISQWFPENNNRSRILLTTRSMEVARHASSPKNPF--QMRFLDPEESWNLF  320



>gb|ACO25633.1| NBS-coding resistance protein [Nicotiana repanda]
Length=168

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 96/139 (69%), Gaps = 4/139 (3%)
 Frame = -2

Query  415  GGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-  239
            GG+GKTTLA++VY+D ++ +HFDV AW   SQ HN +++L+ LL     +G+  N  DE 
Sbjct  1    GGVGKTTLAKEVYDDAAIRLHFDVCAWATISQQHNVKEILLSLLRHT--KGDKFNMDDEA  58

Query  238  DLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSK  59
            +LA  L + LK +RY++V+DD+W  EAWDDV  CFP + NGSR+LLTTR   VA   G++
Sbjct  59   ELADMLQKSLKGKRYLIVLDDMWKSEAWDDVRLCFPSENNGSRILLTTRNIEVACSAGTE  118

Query  58   SYFSHQMHLLDESESWELF  2
            +  S QM L+   +SW+LF
Sbjct  119  N-LSLQMDLMGPVDSWKLF  136



>ref|XP_011087330.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
 ref|XP_011087331.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
 ref|XP_011087332.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=837

 Score =   142 bits (357),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 120/188 (64%), Gaps = 5/188 (3%)
 Frame = -2

Query  553  SQVISSQHASHSKEEMVGKKDEFEIIKKLLIEL-GSKEKKVVSIIGMGGIGKTTLARQVY  377
            S++  ++     K  +VG  ++   ++  L  L  +  +KVV I+GMGGIGK+TLAR +Y
Sbjct  122  SRIRMAKQDQDPKNVVVGITEDVNKLRDWLTNLQDTGARKVVPIVGMGGIGKSTLARHLY  181

Query  376  EDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDED--LALKLYQCLKR  203
            +D  +  HFD RAW   SQ +N  ++L+ LL  ++ +   E   +ED  L L+L+Q LKR
Sbjct  182  DDSFIISHFDTRAWSTVSQNYNVHKILLDLLGCVTGKPTDEMLGEEDDQLGLRLHQNLKR  241

Query  202  QRYMVVVDDVWSGEAWDDVS-NCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLD  26
            +RY++V+DD+W+ E W+ ++   FPDDGNGSR+++TTR + VA   GS S   H M+LL 
Sbjct  242  RRYLIVLDDIWNIEPWEHIARRYFPDDGNGSRIIVTTRESKVADDTGSGSPH-HLMNLLK  300

Query  25   ESESWELF  2
            + ESW+L 
Sbjct  301  DDESWKLL  308



>gb|AGX27505.1| NBS-LRR class resistance protein Fy12-Ry1, partial [Sesamum indicum]
Length=616

 Score =   140 bits (352),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 110/174 (63%), Gaps = 5/174 (3%)
 Frame = -2

Query  514  EEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYEDPSVSIHFDVRAW  335
            + MVG +++    K  L   GS + + + I GMGGIGKTTLAR  Y D  +  HFD+RAW
Sbjct  171  DAMVGFEEDLLATKTRLYG-GSSKLEFIPIYGMGGIGKTTLARNAYGDSLIVEHFDIRAW  229

Query  334  VVASQLHNKRQMLVGLLDSI---SKQGNLENSTDEDLALKLYQCLKRQRYMVVVDDVWSG  164
            +  SQ ++ +QML  L+DSI   +++ + E  + E ++ ++Y+  K +RY+VV+DD+WS 
Sbjct  230  LTVSQDYSVQQMLFALVDSIKPFNEKFDGEKHSYEQMSEQVYKSFKGRRYLVVLDDMWST  289

Query  163  EAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESESWELF  2
            +AWDDV    PDD NGSR+++TTR+  VA    S S   H+M  +D  +SW L 
Sbjct  290  KAWDDVRRILPDDSNGSRIIITTRLQDVAAYADSSSPL-HEMRFMDVDQSWILL  342



>gb|ACO25632.1| NBS-coding resistance protein [Nicotiana repanda]
Length=168

 Score =   132 bits (333),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 96/139 (69%), Gaps = 4/139 (3%)
 Frame = -2

Query  415  GGIGKTTLARQVYEDPSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLENSTDE-  239
            GG+GKTTLA++VY+D ++ +HFDV AW   SQ HN +++L+ LL     +G+  N  DE 
Sbjct  1    GGVGKTTLAKEVYDDAAIRLHFDVCAWATISQQHNVKEILLSLLRHT--KGDKFNMDDEA  58

Query  238  DLALKLYQCLKRQRYMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSK  59
            +LA  L + LK +RY++V+DD+W  EAWDDV  CFP + NGSR+LLTTR   VA   G++
Sbjct  59   ELADMLQKSLKGKRYLIVLDDMWKSEAWDDVRLCFPSENNGSRILLTTRNIEVACSAGTE  118

Query  58   SYFSHQMHLLDESESWELF  2
            +  S QM L+   +SW+LF
Sbjct  119  N-LSLQMDLMGPVDSWKLF  136



>emb|CDP12800.1| unnamed protein product [Coffea canephora]
Length=1162

 Score =   142 bits (359),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 107/185 (58%), Gaps = 4/185 (2%)
 Frame = -2

Query  550  QVISSQHASHSKEEMVGKKDEFEIIKKLLIELGSKEKKVVSIIGMGGIGKTTLARQVYED  371
            Q+ S   A  S E+ VG KDE E I   L   GS    +V ++GM G+GKTTLA  VY D
Sbjct  467  QMPSHVTAPISSEDFVGLKDEVETIINRLTR-GSMLLDIVPVVGMAGLGKTTLADTVYCD  525

Query  370  PSVSIHFDVRAWVVASQLHNKRQMLVGLLDSISKQGNLE--NSTDEDLALKLYQCLKRQR  197
            PSV IHF +R W   SQ + KR ++  +L  I+   + E    T++DLA KLY+CLKR R
Sbjct  526  PSVIIHFPIRVWCTVSQAYIKRNLIAQILSCIASGSSDEYLKMTEDDLAEKLYKCLKRNR  585

Query  196  YMVVVDDVWSGEAWDDVSNCFPDDGNGSRVLLTTRIAVVATCIGSKSYFSHQMHLLDESE  17
            Y++++DD+W    W+ +    PDD N SR+L T+R   ++  I   S   H +  L + E
Sbjct  586  YLIILDDMWDIGVWNLLKTSLPDDANQSRILFTSRFQNLSMQIKPDSK-PHHLRSLTDKE  644

Query  16   SWELF  2
            SWEL 
Sbjct  645  SWELL  649



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1997200541776