BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25465_g3_i1 len=461 path=[11127:0-216 26075:217-222 26081:223-226
26085:227-240 11368:241-347 26191:348-460]

Length=461
                                                                      Score     E

gb|ABU45180.1|  unknown                                                 156   8e-43   Solanum melongena [aubergine]
ref|XP_009803267.1|  PREDICTED: serine/threonine-protein kinase H...    156   1e-42   
ref|XP_009590482.1|  PREDICTED: serine/threonine-protein kinase H...    154   6e-42   
ref|XP_011099588.1|  PREDICTED: serine/threonine-protein kinase HT1     153   1e-41   
ref|XP_004301888.1|  PREDICTED: serine/threonine-protein kinase H...    154   1e-41   
ref|XP_008241879.1|  PREDICTED: serine/threonine-protein kinase H...    153   2e-41   
ref|XP_002268484.2|  PREDICTED: serine/threonine-protein kinase H...    152   6e-41   Vitis vinifera
ref|XP_004143579.1|  PREDICTED: serine/threonine-protein kinase H...    149   3e-40   
ref|XP_009760417.1|  PREDICTED: serine/threonine-protein kinase H...    147   3e-39   
ref|XP_009356713.1|  PREDICTED: serine/threonine-protein kinase H...    147   4e-39   
gb|ABU45214.1|  unknown                                                 146   5e-39   Solanum bulbocastanum [ornamental nightshade]
ref|XP_004233716.1|  PREDICTED: serine/threonine-protein kinase H...    145   9e-39   
ref|XP_008440686.1|  PREDICTED: serine/threonine-protein kinase HT1     146   9e-39   
ref|XP_006363141.1|  PREDICTED: serine/threonine-protein kinase H...    145   2e-38   
emb|CDP02811.1|  unnamed protein product                                143   4e-38   
ref|XP_009588505.1|  PREDICTED: serine/threonine-protein kinase H...    144   6e-38   
emb|CAN83950.1|  hypothetical protein VITISV_043906                     142   1e-37   Vitis vinifera
ref|XP_010099830.1|  Serine/threonine-protein kinase HT1                142   5e-37   
gb|EYU44665.1|  hypothetical protein MIMGU_mgv1a008572mg                140   6e-37   
ref|XP_003547707.1|  PREDICTED: serine/threonine-protein kinase H...    140   7e-37   
ref|XP_006604011.1|  PREDICTED: serine/threonine-protein kinase H...    137   2e-36   
gb|ACJ84818.1|  unknown                                                 135   2e-36   Medicago truncatula
ref|XP_003526999.1|  PREDICTED: serine/threonine-protein kinase H...    138   3e-36   
ref|XP_003553431.1|  PREDICTED: serine/threonine-protein kinase H...    138   4e-36   
gb|KHN03101.1|  Serine/threonine-protein kinase HT1                     138   4e-36   
gb|KDO79483.1|  hypothetical protein CISIN_1g019780mg                   137   5e-36   
ref|XP_007161765.1|  hypothetical protein PHAVU_001G096600g             137   8e-36   
gb|KDP31798.1|  hypothetical protein JCGZ_12259                         137   1e-35   
ref|XP_006425727.1|  hypothetical protein CICLE_v10025821mg             137   2e-35   
ref|XP_004501874.1|  PREDICTED: serine/threonine-protein kinase H...    136   2e-35   
ref|XP_010251057.1|  PREDICTED: serine/threonine-protein kinase H...    136   3e-35   
emb|CBI17559.3|  unnamed protein product                                135   3e-35   
ref|XP_010534156.1|  PREDICTED: serine/threonine-protein kinase H...    135   3e-35   
ref|XP_006577840.1|  PREDICTED: uncharacterized protein LOC100804...    135   4e-35   
ref|NP_001241956.1|  uncharacterized protein LOC100804884               135   4e-35   
ref|XP_003601186.1|  Serine/threonine protein kinase TNNI3K             135   5e-35   
ref|XP_010026165.1|  PREDICTED: serine/threonine-protein kinase H...    136   5e-35   
ref|XP_006439920.1|  hypothetical protein CICLE_v10020876mg             134   6e-35   
ref|XP_007047002.1|  Serine/threonine-protein kinase HT1                135   8e-35   
ref|XP_004138086.1|  PREDICTED: serine/threonine-protein kinase H...    135   8e-35   
ref|XP_004173420.1|  PREDICTED: serine/threonine-protein kinase H...    134   9e-35   
ref|XP_006439921.1|  hypothetical protein CICLE_v10020876mg             134   2e-34   
ref|XP_007150910.1|  hypothetical protein PHAVU_004G004800g             134   2e-34   
ref|XP_007031602.1|  Kinase superfamily protein isoform 1               133   3e-34   
ref|XP_006476887.1|  PREDICTED: serine/threonine-protein kinase H...    132   3e-34   
ref|XP_009374238.1|  PREDICTED: serine/threonine-protein kinase H...    134   3e-34   
gb|KDO69480.1|  hypothetical protein CISIN_1g018656mg                   132   3e-34   
ref|XP_010027231.1|  PREDICTED: serine/threonine-protein kinase H...    133   3e-34   
ref|XP_011095128.1|  PREDICTED: serine/threonine-protein kinase HT1     133   5e-34   
gb|KDO69481.1|  hypothetical protein CISIN_1g018656mg                   132   7e-34   
ref|XP_006476886.1|  PREDICTED: serine/threonine-protein kinase H...    132   7e-34   
ref|XP_003524562.1|  PREDICTED: serine/threonine-protein kinase H...    132   7e-34   
ref|XP_007138017.1|  hypothetical protein PHAVU_009G1741000g            127   8e-34   
ref|XP_008775400.1|  PREDICTED: serine/threonine-protein kinase H...    132   1e-33   
gb|KHG13005.1|  Serine/threonine-protein kinase HT1                     131   1e-33   
ref|XP_010248651.1|  PREDICTED: serine/threonine-protein kinase H...    131   2e-33   
ref|XP_004952964.1|  PREDICTED: serine/threonine-protein kinase H...    131   2e-33   
ref|XP_010534157.1|  PREDICTED: serine/threonine-protein kinase H...    130   2e-33   
ref|XP_004512221.1|  PREDICTED: serine/threonine-protein kinase H...    132   2e-33   
dbj|BAJ93103.1|  predicted protein                                      132   2e-33   
ref|XP_010678873.1|  PREDICTED: serine/threonine-protein kinase H...    130   3e-33   
ref|XP_004299144.1|  PREDICTED: serine/threonine-protein kinase H...    130   3e-33   
gb|AIZ68212.1|  serine/threonine-protein kinase HT1-like protein        130   3e-33   
ref|XP_007036388.1|  Kinase superfamily protein                         130   3e-33   
ref|XP_010912976.1|  PREDICTED: serine/threonine-protein kinase H...    130   3e-33   
ref|XP_002525105.1|  Serine/threonine-protein kinase HT1, putative      131   4e-33   Ricinus communis
ref|XP_004142785.1|  PREDICTED: serine/threonine-protein kinase H...    130   4e-33   
ref|XP_008341380.1|  PREDICTED: serine/threonine-protein kinase H...    130   5e-33   
ref|XP_008351761.1|  PREDICTED: serine/threonine-protein kinase H...    125   5e-33   
ref|XP_004304661.1|  PREDICTED: serine/threonine-protein kinase H...    130   5e-33   
ref|XP_006395419.1|  hypothetical protein EUTSA_v10004482mg             130   5e-33   
ref|XP_009370355.1|  PREDICTED: serine/threonine-protein kinase H...    130   6e-33   
ref|XP_010108840.1|  Serine/threonine-protein kinase HT1                130   6e-33   
ref|XP_010547492.1|  PREDICTED: serine/threonine-protein kinase H...    130   6e-33   
ref|XP_011101794.1|  PREDICTED: serine/threonine-protein kinase H...    129   6e-33   
ref|XP_004231843.1|  PREDICTED: serine/threonine-protein kinase H...    129   7e-33   
ref|XP_010931355.1|  PREDICTED: serine/threonine-protein kinase H...    130   7e-33   
ref|XP_009403625.1|  PREDICTED: serine/threonine-protein kinase H...    129   7e-33   
ref|XP_002511319.1|  protein kinase atn1, putative                      129   8e-33   Ricinus communis
ref|XP_006852349.1|  hypothetical protein AMTR_s00049p00214290          129   8e-33   
ref|XP_002272486.1|  PREDICTED: serine/threonine-protein kinase HT1     129   8e-33   Vitis vinifera
ref|XP_006338623.1|  PREDICTED: serine/threonine-protein kinase H...    129   8e-33   
ref|XP_006402173.1|  hypothetical protein EUTSA_v10013975mg             129   9e-33   
ref|NP_199829.1|  protein kinase family protein                         129   9e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009415968.1|  PREDICTED: serine/threonine-protein kinase H...    129   9e-33   
gb|ABK06440.1|  flag-tagged protein kinase domain of putative mit...    129   9e-33   
ref|XP_006280738.1|  hypothetical protein CARUB_v10026707mg             129   9e-33   
ref|XP_002864043.1|  hypothetical protein ARALYDRAFT_495075             129   1e-32   
ref|XP_002452377.1|  hypothetical protein SORBIDRAFT_04g024680          129   1e-32   Sorghum bicolor [broomcorn]
ref|XP_006291373.1|  hypothetical protein CARUB_v10017518mg             129   1e-32   
ref|XP_010441670.1|  PREDICTED: serine/threonine-protein kinase H...    129   1e-32   
ref|XP_011097383.1|  PREDICTED: serine/threonine-protein kinase H...    129   1e-32   
ref|XP_002280504.1|  PREDICTED: serine/threonine-protein kinase HT1     129   1e-32   Vitis vinifera
ref|XP_008676838.1|  PREDICTED: uncharacterized protein LOC100273...    129   1e-32   
gb|AES94911.2|  tyrosine kinase family protein                          129   1e-32   
ref|XP_007209302.1|  hypothetical protein PRUPE_ppa007843mg             129   1e-32   
ref|XP_003563810.1|  PREDICTED: serine/threonine-protein kinase HT1     129   1e-32   
ref|XP_008239332.1|  PREDICTED: serine/threonine-protein kinase HT1     129   2e-32   
ref|XP_006405481.1|  hypothetical protein EUTSA_v10027816mg             129   2e-32   
gb|KFK26651.1|  hypothetical protein AALP_AA8G275800                    129   2e-32   
ref|XP_009333942.1|  PREDICTED: serine/threonine-protein kinase H...    129   2e-32   
ref|XP_007204166.1|  hypothetical protein PRUPE_ppa017499mg             127   2e-32   
ref|XP_002877059.1|  hypothetical protein ARALYDRAFT_484546             129   2e-32   
ref|XP_002323793.1|  hypothetical protein POPTR_0017s10510g             128   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_006650784.1|  PREDICTED: serine/threonine-protein kinase H...    128   2e-32   
ref|XP_008348177.1|  PREDICTED: probable serine/threonine-protein...    129   2e-32   
ref|XP_003611953.1|  Serine/threonine protein kinase                    129   2e-32   
ref|XP_008230523.1|  PREDICTED: serine/threonine-protein kinase H...    128   3e-32   
ref|XP_009134046.1|  PREDICTED: serine/threonine-protein kinase HT1     128   3e-32   
ref|XP_009595618.1|  PREDICTED: serine/threonine-protein kinase HT1     128   3e-32   
ref|XP_009151944.1|  PREDICTED: serine/threonine-protein kinase HT1     128   3e-32   
emb|CDY13723.1|  BnaA06g32000D                                          128   3e-32   
gb|AHL77719.1|  mitogen activated kinase kinase kinase Raf41            128   3e-32   
emb|CDX83708.1|  BnaC07g24480D                                          128   3e-32   
emb|CDP02051.1|  unnamed protein product                                128   3e-32   
gb|AGA37226.1|  mitogen-activated protein kinase kinase kinase Ra...    128   3e-32   
ref|XP_007215617.1|  hypothetical protein PRUPE_ppa007898mg             128   3e-32   
ref|XP_009762849.1|  PREDICTED: serine/threonine-protein kinase HT1     128   3e-32   
ref|XP_001765647.1|  predicted protein                                  127   4e-32   
gb|KDP31029.1|  hypothetical protein JCGZ_11405                         127   4e-32   
ref|XP_006429562.1|  hypothetical protein CICLE_v10011970mg             126   4e-32   
ref|XP_009362939.1|  PREDICTED: serine/threonine-protein kinase H...    127   4e-32   
ref|XP_010929905.1|  PREDICTED: serine/threonine-protein kinase H...    127   4e-32   
ref|XP_004489198.1|  PREDICTED: serine/threonine-protein kinase H...    127   5e-32   
ref|XP_008458814.1|  PREDICTED: serine/threonine-protein kinase H...    127   5e-32   
ref|XP_006470227.1|  PREDICTED: serine/threonine-protein kinase H...    127   5e-32   
gb|KDO49680.1|  hypothetical protein CISIN_1g017046mg                   126   5e-32   
ref|XP_011014032.1|  PREDICTED: serine/threonine-protein kinase H...    127   5e-32   
ref|XP_006446620.1|  hypothetical protein CICLE_v10015773mg             127   5e-32   
ref|NP_001047304.1|  Os02g0594100                                       127   6e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010558404.1|  PREDICTED: serine/threonine-protein kinase HT1     127   6e-32   
gb|ABK06438.1|  flag-tagged protein kinase domain of putative mit...    127   6e-32   
ref|XP_010027251.1|  PREDICTED: serine/threonine-protein kinase H...    126   6e-32   
emb|CDY36362.1|  BnaC04g32700D                                          127   6e-32   
ref|XP_009140020.1|  PREDICTED: serine/threonine-protein kinase HT1     127   6e-32   
gb|ACJ85360.1|  unknown                                                 127   6e-32   Medicago truncatula
ref|XP_010502764.1|  PREDICTED: serine/threonine-protein kinase H...    127   6e-32   
ref|XP_010450650.1|  PREDICTED: serine/threonine-protein kinase H...    126   6e-32   
ref|XP_003623576.1|  Protein kinase, putative                           127   6e-32   
ref|NP_189393.1|  putative serine/threonine/tyrosine kinase ATN1        127   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006650792.1|  PREDICTED: serine/threonine-protein kinase H...    127   7e-32   
gb|AFK44948.1|  unknown                                                 127   7e-32   
emb|CAA63387.1|  protein kinase                                         127   7e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009626244.1|  PREDICTED: serine/threonine-protein kinase HT1     122   7e-32   
tpg|DAA52152.1|  TPA: putative protein kinase superfamily protein       125   7e-32   
emb|CDP06394.1|  unnamed protein product                                127   7e-32   
ref|XP_010441203.1|  PREDICTED: serine/threonine-protein kinase H...    127   8e-32   
ref|XP_009799112.1|  PREDICTED: serine/threonine-protein kinase HT1     126   9e-32   
ref|XP_010442499.1|  PREDICTED: serine/threonine-protein kinase H...    126   9e-32   
ref|XP_010922729.1|  PREDICTED: serine/threonine-protein kinase H...    127   9e-32   
ref|XP_010514464.1|  PREDICTED: serine/threonine-protein kinase H...    126   1e-31   
ref|XP_002532865.1|  protein kinase atn1, putative                      127   1e-31   Ricinus communis
ref|XP_004302569.1|  PREDICTED: serine/threonine-protein kinase H...    126   1e-31   
ref|XP_008798564.1|  PREDICTED: serine/threonine-protein kinase HT1     127   1e-31   
gb|EAY92336.1|  hypothetical protein OsI_14061                          127   1e-31   Oryza sativa Indica Group [Indian rice]
gb|EYU42008.1|  hypothetical protein MIMGU_mgv1a008582mg                126   1e-31   
gb|EMS59502.1|  Serine/threonine-protein kinase HT1                     126   1e-31   
ref|NP_001051689.1|  Os03g0816100                                       125   1e-31   Oryza sativa Japonica Group [Japonica rice]
gb|KDP22773.1|  hypothetical protein JCGZ_00360                         126   1e-31   
gb|KHN44504.1|  Serine/threonine-protein kinase HT1                     126   2e-31   
ref|XP_006429561.1|  hypothetical protein CICLE_v10011970mg             126   2e-31   
gb|KDO49679.1|  hypothetical protein CISIN_1g017046mg                   126   2e-31   
ref|XP_003575273.1|  PREDICTED: serine/threonine-protein kinase H...    125   2e-31   
ref|XP_010252080.1|  PREDICTED: serine/threonine-protein kinase HT1     126   2e-31   
gb|EMT19707.1|  Serine/threonine-protein kinase HT1                     125   2e-31   
gb|EYU34748.1|  hypothetical protein MIMGU_mgv1a009136mg                125   2e-31   
ref|XP_010450649.1|  PREDICTED: serine/threonine-protein kinase H...    125   2e-31   
ref|XP_011003123.1|  PREDICTED: serine/threonine-protein kinase H...    125   2e-31   
ref|XP_009420111.1|  PREDICTED: serine/threonine-protein kinase H...    125   3e-31   
ref|XP_002298549.1|  kinase family protein                              125   3e-31   Populus trichocarpa [western balsam poplar]
emb|CDY42570.1|  BnaA04g10430D                                          125   3e-31   
gb|KFK33099.1|  hypothetical protein AALP_AA6G331100                    125   3e-31   
dbj|BAJ93644.1|  predicted protein                                      125   3e-31   
ref|NP_198870.1|  protein kinase family protein                         125   3e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ABK06439.1|  flag-tagged protein kinase domain of putative mit...    125   3e-31   
gb|KDP46404.1|  hypothetical protein JCGZ_10244                         125   4e-31   
ref|XP_004981285.1|  PREDICTED: serine/threonine-protein kinase H...    125   4e-31   
ref|XP_002872990.1|  hypothetical protein ARALYDRAFT_324798             124   4e-31   
ref|XP_001778972.1|  predicted protein                                  124   4e-31   
ref|XP_004246274.1|  PREDICTED: serine/threonine-protein kinase HT1     125   4e-31   
ref|XP_006842447.1|  hypothetical protein AMTR_s00077p00052030          125   5e-31   
gb|AAO60020.1|  putative protein kinase                                 125   5e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004141113.1|  PREDICTED: serine/threonine-protein kinase H...    124   6e-31   
emb|CBI18047.3|  unnamed protein product                                124   6e-31   
gb|KHG15965.1|  Serine/threonine-protein kinase HT1                     124   6e-31   
gb|AAP88291.1|  protein kinase                                          124   6e-31   Cucumis sativus [cucumbers]
ref|XP_002521481.1|  protein kinase atn1, putative                      124   6e-31   Ricinus communis
ref|XP_008792213.1|  PREDICTED: serine/threonine-protein kinase H...    124   7e-31   
gb|EMS60256.1|  Serine/threonine-protein kinase HT1                     125   7e-31   
ref|XP_007140092.1|  hypothetical protein PHAVU_008G083700g             123   7e-31   
ref|XP_002270753.1|  PREDICTED: serine/threonine-protein kinase HT1     124   8e-31   Vitis vinifera
ref|XP_008665663.1|  PREDICTED: serine/threonine-protein kinase HT1     124   9e-31   
ref|XP_006284021.1|  hypothetical protein CARUB_v10005142mg             124   9e-31   
ref|XP_009415969.1|  PREDICTED: serine/threonine-protein kinase H...    124   1e-30   
ref|NP_195805.2|  protein kinase family protein                         123   1e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003517008.1|  PREDICTED: serine/threonine-protein kinase H...    124   1e-30   
ref|XP_006577841.1|  PREDICTED: uncharacterized protein LOC100804...    123   1e-30   
ref|XP_004509294.1|  PREDICTED: serine/threonine-protein kinase H...    124   1e-30   
ref|XP_004174068.1|  PREDICTED: serine/threonine-protein kinase H...    119   1e-30   
ref|XP_007205401.1|  hypothetical protein PRUPE_ppa007516mg             123   2e-30   
ref|XP_003534644.1|  PREDICTED: serine/threonine-protein kinase H...    123   2e-30   
gb|ABK06441.1|  flag-tagged protein kinase domain of putative mit...    123   2e-30   
ref|XP_010091091.1|  Serine/threonine-protein kinase HT1                123   2e-30   
ref|XP_010528218.1|  PREDICTED: serine/threonine-protein kinase HT1     123   2e-30   
ref|XP_010253109.1|  PREDICTED: serine/threonine-protein kinase H...    123   2e-30   
emb|CDY04825.1|  BnaAnng00070D                                          122   2e-30   
ref|XP_004492629.1|  PREDICTED: serine/threonine-protein kinase H...    122   2e-30   
gb|KHG09867.1|  Serine/threonine-protein kinase HT1                     122   3e-30   
ref|XP_007140093.1|  hypothetical protein PHAVU_008G083700g             122   3e-30   
ref|XP_008464929.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    122   3e-30   
ref|XP_009397080.1|  PREDICTED: serine/threonine-protein kinase H...    122   4e-30   
ref|XP_002991780.1|  hypothetical protein SELMODRAFT_186310             123   4e-30   
ref|XP_006346678.1|  PREDICTED: serine/threonine-protein kinase H...    122   4e-30   
ref|XP_002989702.1|  hypothetical protein SELMODRAFT_160379             122   5e-30   
ref|XP_009346915.1|  PREDICTED: serine/threonine-protein kinase H...    122   5e-30   
ref|XP_006577842.1|  PREDICTED: uncharacterized protein LOC100804...    122   5e-30   
ref|XP_009125392.1|  PREDICTED: serine/threonine-protein kinase H...    121   5e-30   
ref|XP_008370250.1|  PREDICTED: serine/threonine-protein kinase HT1     122   5e-30   
ref|XP_009125393.1|  PREDICTED: serine/threonine-protein kinase H...    121   6e-30   
ref|XP_003522087.1|  PREDICTED: serine/threonine-protein kinase H...    122   6e-30   
gb|KHN43737.1|  Serine/threonine-protein kinase HT1                     122   6e-30   
ref|XP_009386682.1|  PREDICTED: serine/threonine-protein kinase H...    121   7e-30   
ref|XP_008393542.1|  PREDICTED: serine/threonine-protein kinase H...    121   8e-30   
ref|XP_007134693.1|  hypothetical protein PHAVU_010G068300g             121   9e-30   
ref|XP_008245023.1|  PREDICTED: serine/threonine-protein kinase H...    121   9e-30   
ref|XP_007033551.1|  Kinase superfamily protein isoform 1               121   9e-30   
ref|XP_009372005.1|  PREDICTED: serine/threonine-protein kinase HT1     121   1e-29   
ref|XP_002323067.1|  kinase family protein                              121   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011011312.1|  PREDICTED: serine/threonine-protein kinase HT1     121   1e-29   
ref|XP_010490500.1|  PREDICTED: serine/threonine-protein kinase H...    120   1e-29   
ref|XP_010497239.1|  PREDICTED: serine/threonine-protein kinase H...    118   1e-29   
ref|XP_010451930.1|  PREDICTED: serine/threonine-protein kinase H...    120   1e-29   
ref|XP_008388337.1|  PREDICTED: serine/threonine-protein kinase H...    120   1e-29   
ref|XP_010683520.1|  PREDICTED: serine/threonine-protein kinase HT1     120   2e-29   
ref|XP_010424002.1|  PREDICTED: serine/threonine-protein kinase H...    120   2e-29   
ref|XP_010035996.1|  PREDICTED: serine/threonine-protein kinase HT1     120   2e-29   
ref|XP_007156022.1|  hypothetical protein PHAVU_003G251900g             120   2e-29   
ref|XP_010102688.1|  Serine/threonine-protein kinase HT1                119   3e-29   
gb|ABR18102.1|  unknown                                                 119   4e-29   Picea sitchensis
ref|XP_008442327.1|  PREDICTED: serine/threonine-protein kinase H...    119   9e-29   
ref|XP_008442326.1|  PREDICTED: serine/threonine-protein kinase H...    119   1e-28   
ref|XP_006292390.1|  hypothetical protein CARUB_v10018602mg             119   1e-28   
ref|NP_190641.1|  putative protein kinase                               118   1e-28   Arabidopsis thaliana [mouse-ear cress]
gb|ABK06442.1|  flag-tagged protein kinase domain of putative mit...    117   2e-28   
ref|XP_009758363.1|  PREDICTED: serine/threonine-protein kinase H...    117   2e-28   
gb|EMT20146.1|  Serine/threonine-protein kinase HT1                     119   2e-28   
ref|XP_009758364.1|  PREDICTED: serine/threonine-protein kinase H...    117   3e-28   
ref|XP_010451931.1|  PREDICTED: serine/threonine-protein kinase H...    117   3e-28   
ref|XP_004137678.1|  PREDICTED: serine/threonine-protein kinase H...    117   3e-28   
ref|XP_010424001.1|  PREDICTED: serine/threonine-protein kinase H...    116   4e-28   
ref|XP_010424003.1|  PREDICTED: serine/threonine-protein kinase H...    116   4e-28   
ref|XP_004167876.1|  PREDICTED: serine/threonine-protein kinase H...    117   4e-28   
ref|XP_006293338.1|  hypothetical protein CARUB_v100186521mg            115   6e-28   
ref|XP_009386683.1|  PREDICTED: serine/threonine-protein kinase H...    115   7e-28   
ref|XP_002877763.1|  hypothetical protein ARALYDRAFT_323632             116   7e-28   
ref|XP_009112328.1|  PREDICTED: serine/threonine-protein kinase H...    115   1e-27   
emb|CDY53853.1|  BnaA07g37480D                                          115   1e-27   
ref|XP_009103493.1|  PREDICTED: serine/threonine-protein kinase HT1     115   1e-27   
gb|AHL77718.1|  mitogen activated kinase kinase kinase Raf37            115   1e-27   
emb|CDY30760.1|  BnaC07g16600D                                          115   1e-27   
emb|CDX81373.1|  BnaC09g07840D                                          115   2e-27   
ref|XP_006280565.1|  hypothetical protein CARUB_v10026506mg             114   4e-27   
gb|ABK06444.1|  flag-tagged protein kinase domain of putative mit...    114   4e-27   
ref|NP_201472.1|  protein kinase family protein                         114   5e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17690.1|  unknown                                                 113   7e-27   Picea sitchensis
ref|XP_006404009.1|  hypothetical protein EUTSA_v10011053mg             113   1e-26   
ref|XP_006393864.1|  hypothetical protein EUTSA_v10004342mg             112   1e-26   
ref|NP_190642.2|  putative protein kinase                               112   2e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CAB42902.1|  protein kinase ATN1 like protein                       112   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|ABK06443.1|  flag-tagged protein kinase domain of putative mit...    112   2e-26   
ref|XP_010431225.1|  PREDICTED: serine/threonine-protein kinase H...    112   3e-26   
ref|XP_010412701.1|  PREDICTED: serine/threonine-protein kinase H...    111   3e-26   
ref|XP_002866744.1|  hypothetical protein ARALYDRAFT_496930             111   5e-26   
ref|XP_010431226.1|  PREDICTED: serine/threonine-protein kinase H...    111   6e-26   
ref|XP_002877764.1|  hypothetical protein ARALYDRAFT_348178             110   6e-26   
ref|XP_007031604.1|  Kinase superfamily protein isoform 3               110   6e-26   
ref|XP_008458815.1|  PREDICTED: serine/threonine-protein kinase H...    109   1e-25   
emb|CAB82755.1|  protein kinase ATN1-like protein                       109   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010431223.1|  PREDICTED: serine/threonine-protein kinase H...    109   2e-25   
ref|XP_010431224.1|  PREDICTED: serine/threonine-protein kinase H...    109   2e-25   
ref|XP_010253110.1|  PREDICTED: serine/threonine-protein kinase H...    108   2e-25   
ref|XP_010253107.1|  PREDICTED: serine/threonine-protein kinase H...    108   4e-25   
ref|XP_008363127.1|  PREDICTED: serine/threonine-protein kinase H...    108   4e-25   
ref|XP_010484597.1|  PREDICTED: serine/threonine-protein kinase H...    108   5e-25   
ref|XP_010431228.1|  PREDICTED: serine/threonine-protein kinase H...    108   6e-25   
ref|XP_010465026.1|  PREDICTED: serine/threonine-protein kinase H...    108   8e-25   
ref|XP_011086066.1|  PREDICTED: serine/threonine-protein kinase HT1     108   8e-25   
ref|XP_010412700.1|  PREDICTED: serine/threonine-protein kinase H...    107   8e-25   
gb|EPS57580.1|  hypothetical protein M569_17237                         107   9e-25   
ref|XP_003623577.1|  Protein kinase, putative                           107   9e-25   
ref|XP_010444750.1|  PREDICTED: serine/threonine-protein kinase H...    107   1e-24   
ref|XP_010678874.1|  PREDICTED: serine/threonine-protein kinase H...    107   1e-24   
gb|KFK28351.1|  protein kinase                                          107   2e-24   
ref|XP_007148152.1|  hypothetical protein PHAVU_006G184700g             107   2e-24   
ref|XP_003593589.1|  Serine/threonine protein kinase B-raf              106   4e-24   
gb|EYU43388.1|  hypothetical protein MIMGU_mgv1a005321mg                105   9e-24   
ref|XP_008383730.1|  PREDICTED: serine/threonine-protein kinase H...    105   1e-23   
ref|XP_011095979.1|  PREDICTED: serine/threonine-protein kinase HT1     104   2e-23   
ref|XP_007026235.1|  Serine/threonine-protein kinase HT1                103   2e-23   
ref|XP_011013425.1|  PREDICTED: serine/threonine-protein kinase H...    105   2e-23   
ref|XP_009381194.1|  PREDICTED: serine/threonine-protein kinase H...    106   2e-23   
ref|XP_010936736.1|  PREDICTED: serine/threonine-protein kinase H...    103   3e-23   
ref|XP_003543042.1|  PREDICTED: serine/threonine-protein kinase HT1     104   3e-23   
ref|XP_003529330.1|  PREDICTED: serine/threonine-protein kinase H...    104   3e-23   
ref|XP_007159329.1|  hypothetical protein PHAVU_002G229000g             104   3e-23   
gb|ACU19556.1|  unknown                                                 104   3e-23   
ref|NP_001238530.1|  protein kinase                                     103   3e-23   
gb|KHN09999.1|  Serine/threonine-protein kinase HT1                     104   4e-23   
ref|XP_003542743.1|  PREDICTED: serine/threonine-protein kinase H...    104   4e-23   
dbj|BAD43844.1|  protein kinase ATN1-like protein                       102   4e-23   
emb|CDY02848.1|  BnaC02g10410D                                          103   4e-23   
ref|XP_009352910.1|  PREDICTED: serine/threonine-protein kinase H...    103   4e-23   
ref|XP_011086225.1|  PREDICTED: serine/threonine-protein kinase H...    102   4e-23   
gb|KDO78404.1|  hypothetical protein CISIN_1g022645mg                   102   5e-23   
emb|CDY32674.1|  BnaA02g07360D                                          103   5e-23   
ref|XP_009126724.1|  PREDICTED: serine/threonine-protein kinase H...    103   5e-23   
ref|XP_007211995.1|  hypothetical protein PRUPE_ppa004808mg             103   6e-23   
ref|XP_010101206.1|  Serine/threonine-protein kinase HT1                102   6e-23   
ref|XP_008782451.1|  PREDICTED: serine/threonine-protein kinase H...    102   7e-23   
ref|XP_006467353.1|  PREDICTED: serine/threonine-protein kinase H...    102   8e-23   
ref|XP_006449834.1|  hypothetical protein CICLE_v10015659mg             102   8e-23   
ref|XP_002316594.2|  hypothetical protein POPTR_0011s00780g             102   8e-23   
gb|KGN49067.1|  hypothetical protein Csa_6G511830                       102   9e-23   
ref|XP_008225106.1|  PREDICTED: serine/threonine-protein kinase H...    103   1e-22   
ref|XP_008440056.1|  PREDICTED: serine/threonine-protein kinase HT1     102   1e-22   
ref|XP_006343235.1|  PREDICTED: serine/threonine-protein kinase H...    102   1e-22   
ref|XP_008782450.1|  PREDICTED: serine/threonine-protein kinase H...    102   1e-22   
ref|XP_011000660.1|  PREDICTED: serine/threonine-protein kinase H...    101   1e-22   
ref|XP_004134702.1|  PREDICTED: serine/threonine-protein kinase H...    102   1e-22   
ref|XP_004485788.1|  PREDICTED: serine/threonine-protein kinase H...    102   1e-22   
ref|XP_004152474.1|  PREDICTED: serine/threonine-protein kinase H...    101   1e-22   
ref|XP_011000655.1|  PREDICTED: serine/threonine-protein kinase H...    101   1e-22   
gb|KHG28529.1|  Serine/threonine-protein kinase HT1                     101   1e-22   
ref|XP_004165940.1|  PREDICTED: serine/threonine-protein kinase H...  98.2    2e-22   
ref|XP_008439850.1|  PREDICTED: serine/threonine-protein kinase HT1     102   2e-22   
gb|EYU33864.1|  hypothetical protein MIMGU_mgv1a017667mg                101   2e-22   
ref|XP_009388691.1|  PREDICTED: serine/threonine-protein kinase H...    103   2e-22   
gb|AGA37228.1|  mitogen-activated protein kinase kinase kinase Ra...    102   2e-22   
ref|XP_009595039.1|  PREDICTED: serine/threonine-protein kinase H...    101   2e-22   
ref|XP_010676343.1|  PREDICTED: serine/threonine-protein kinase HT1     101   2e-22   
gb|KDP20979.1|  hypothetical protein JCGZ_21450                         102   3e-22   
ref|XP_011047021.1|  PREDICTED: serine/threonine-protein kinase H...    100   3e-22   
ref|XP_006383831.1|  hypothetical protein POPTR_0004s00360g             100   3e-22   
ref|XP_004232884.1|  PREDICTED: serine/threonine-protein kinase H...    101   4e-22   
ref|XP_008358762.1|  PREDICTED: serine/threonine-protein kinase H...    100   4e-22   
ref|XP_008227501.1|  PREDICTED: serine/threonine-protein kinase HT1     100   4e-22   
ref|XP_009357527.1|  PREDICTED: serine/threonine-protein kinase H...    100   4e-22   
gb|KDP20681.1|  hypothetical protein JCGZ_21152                         100   4e-22   
ref|XP_010686491.1|  PREDICTED: serine/threonine-protein kinase HT1     101   4e-22   
ref|XP_009760623.1|  PREDICTED: serine/threonine-protein kinase H...    101   4e-22   
ref|XP_008371029.1|  PREDICTED: serine/threonine-protein kinase HT1     100   4e-22   
ref|XP_011021902.1|  PREDICTED: serine/threonine-protein kinase H...    101   4e-22   
ref|XP_007213545.1|  hypothetical protein PRUPE_ppa018711mg             100   4e-22   
ref|XP_002306338.1|  kinase family protein                              101   4e-22   
ref|XP_010647093.1|  PREDICTED: serine/threonine-protein kinase HT1     101   5e-22   
ref|XP_008371374.1|  PREDICTED: serine/threonine-protein kinase H...    101   5e-22   
gb|KHG29028.1|  Serine/threonine-protein kinase HT1                     100   6e-22   
ref|XP_009340526.1|  PREDICTED: serine/threonine-protein kinase H...    100   7e-22   
ref|XP_009627519.1|  PREDICTED: serine/threonine-protein kinase H...  99.4    7e-22   
ref|XP_009780566.1|  PREDICTED: serine/threonine-protein kinase H...  99.4    7e-22   
ref|XP_009626934.1|  PREDICTED: serine/threonine-protein kinase H...  99.4    7e-22   
ref|XP_009768184.1|  PREDICTED: serine/threonine-protein kinase H...  99.4    7e-22   
emb|CDY32673.1|  BnaA02g07350D                                          100   7e-22   
ref|XP_009406161.1|  PREDICTED: serine/threonine-protein kinase H...    101   7e-22   
gb|KDO49681.1|  hypothetical protein CISIN_1g017046mg                 99.0    8e-22   
ref|XP_010925564.1|  PREDICTED: serine/threonine-protein kinase H...    101   8e-22   
emb|CDP04467.1|  unnamed protein product                              99.4    9e-22   
ref|XP_006347030.1|  PREDICTED: serine/threonine-protein kinase H...    100   9e-22   
ref|XP_008224567.1|  PREDICTED: serine/threonine-protein kinase H...  99.4    1e-21   
gb|AES92694.2|  Serine/Threonine-kinase HT1-like protein              99.0    1e-21   
ref|XP_010546527.1|  PREDICTED: serine/threonine-protein kinase HT1   99.0    1e-21   
ref|XP_007222679.1|  hypothetical protein PRUPE_ppa006326mg           99.4    1e-21   
emb|CDP17984.1|  unnamed protein product                              98.6    1e-21   
ref|XP_010048555.1|  PREDICTED: serine/threonine-protein kinase HT1     100   1e-21   
ref|XP_004293345.1|  PREDICTED: serine/threonine-protein kinase H...  99.0    1e-21   
ref|XP_004234115.1|  PREDICTED: serine/threonine-protein kinase H...  99.8    1e-21   
gb|AEQ94163.1|  kinase ATN1-like protein                              97.8    1e-21   
ref|XP_006346769.1|  PREDICTED: serine/threonine-protein kinase H...  98.6    1e-21   
ref|XP_004236673.1|  PREDICTED: serine/threonine-protein kinase HT1   98.6    1e-21   
gb|KEH31056.1|  tyrosine kinase family protein                        98.6    2e-21   
ref|XP_004298938.1|  PREDICTED: serine/threonine-protein kinase H...  98.2    2e-21   
gb|AFW60971.1|  putative protein kinase superfamily protein isofo...  98.2    2e-21   
ref|XP_004250248.2|  PREDICTED: serine/threonine-protein kinase H...  98.2    2e-21   
ref|XP_010090956.1|  Serine/threonine-protein kinase HT1              98.6    2e-21   
gb|KEH31058.1|  tyrosine kinase family protein                        98.2    2e-21   
emb|CDO99532.1|  unnamed protein product                              99.8    2e-21   
ref|XP_001755845.1|  predicted protein                                98.2    2e-21   
ref|XP_004507651.1|  PREDICTED: serine/threonine-protein kinase H...  98.2    2e-21   
ref|XP_007154003.1|  hypothetical protein PHAVU_003G082800g           98.2    2e-21   
ref|XP_002518405.1|  protein with unknown function                    98.2    2e-21   
gb|AFW57030.1|  putative protein kinase superfamily protein           97.8    2e-21   
ref|XP_007138085.1|  hypothetical protein PHAVU_009G179100g           98.2    2e-21   
ref|NP_001190878.1|  protein kinase family protein                    97.8    2e-21   
ref|XP_003528701.2|  PREDICTED: serine/threonine-protein kinase H...  97.8    3e-21   
ref|XP_003550476.2|  PREDICTED: serine/threonine-protein kinase H...  97.8    3e-21   
gb|KHN19311.1|  Serine/threonine-protein kinase HT1                   97.8    3e-21   
gb|KHN32979.1|  Serine/threonine-protein kinase HT1                   97.4    3e-21   
ref|XP_011071844.1|  PREDICTED: serine/threonine-protein kinase H...  97.8    3e-21   
ref|XP_006412620.1|  hypothetical protein EUTSA_v10025332mg           97.4    3e-21   
emb|CDX71145.1|  BnaC03g12290D                                        99.0    3e-21   
ref|XP_009355185.1|  PREDICTED: serine/threonine-protein kinase H...  97.8    3e-21   
ref|XP_008791739.1|  PREDICTED: LOW QUALITY PROTEIN: mitogen-acti...    100   3e-21   
ref|XP_003523074.1|  PREDICTED: serine/threonine-protein kinase H...  97.8    3e-21   
ref|XP_003547275.1|  PREDICTED: serine/threonine-protein kinase H...  97.8    3e-21   
emb|CDY23284.1|  BnaA08g12620D                                        97.8    3e-21   
emb|CDY36453.1|  BnaC03g67730D                                        97.8    3e-21   
ref|XP_010520229.1|  PREDICTED: serine/threonine-protein kinase H...  98.2    3e-21   
ref|XP_009108939.1|  PREDICTED: serine/threonine-protein kinase H...  97.8    3e-21   
ref|XP_009792851.1|  PREDICTED: serine/threonine-protein kinase HT1   99.0    3e-21   
emb|CDX88676.1|  BnaA03g09730D                                        98.6    3e-21   
ref|XP_006352377.1|  PREDICTED: serine/threonine-protein kinase H...  97.4    4e-21   
ref|NP_001141376.1|  uncharacterized protein LOC100273467             97.8    4e-21   
gb|ABK06449.1|  flag-tagged protein kinase domain of putative mit...  97.8    4e-21   
ref|XP_006401021.1|  hypothetical protein EUTSA_v10013257mg           99.0    4e-21   
gb|ABK06447.1|  flag-tagged protein kinase domain of putative mit...  97.4    4e-21   
emb|CDY39795.1|  BnaA09g10470D                                        97.4    4e-21   
ref|XP_010447609.1|  PREDICTED: serine/threonine-protein kinase H...  97.8    4e-21   
ref|NP_194846.1|  protein kinase family protein                       97.8    4e-21   
emb|CDY19547.1|  BnaC09g13560D                                        97.4    4e-21   
ref|XP_006285418.1|  hypothetical protein CARUB_v10006831mg           97.8    4e-21   
ref|XP_010432897.1|  PREDICTED: serine/threonine-protein kinase H...  97.8    4e-21   
gb|ACL53806.1|  unknown                                               97.8    4e-21   
ref|NP_176430.1|  protein high leaf temperature 1                     97.1    4e-21   
ref|XP_002888028.1|  hypothetical protein ARALYDRAFT_475103           97.1    4e-21   
gb|KHN40841.1|  Serine/threonine-protein kinase HT1                   96.3    5e-21   
ref|XP_010438071.1|  PREDICTED: serine/threonine-protein kinase H...  97.4    5e-21   
ref|XP_002867311.1|  kinase family protein                            97.4    5e-21   
ref|XP_002509466.1|  protein-tyrosine kinase, putative                98.6    5e-21   
ref|XP_009397459.1|  PREDICTED: serine/threonine-protein kinase H...  99.4    5e-21   
ref|XP_002510613.1|  protein kinase, putative                         99.8    5e-21   
ref|XP_010473458.1|  PREDICTED: serine/threonine-protein kinase H...  97.4    5e-21   
ref|XP_009614533.1|  PREDICTED: serine/threonine-protein kinase HT1   98.6    5e-21   
dbj|BAJ94289.1|  predicted protein                                    97.1    5e-21   
ref|XP_002444043.1|  hypothetical protein SORBIDRAFT_07g006310        97.4    5e-21   
gb|AES71532.2|  Serine/Threonine-kinase HT1-like protein              97.1    5e-21   
emb|CDY03279.1|  BnaC09g10690D                                        97.1    5e-21   
ref|XP_004505066.1|  PREDICTED: serine/threonine-protein kinase H...  98.6    5e-21   
gb|KDP31107.1|  hypothetical protein JCGZ_11483                       97.1    5e-21   
gb|KFK35905.1|  hypothetical protein AALP_AA4G051600                  97.1    5e-21   
emb|CDY08153.1|  BnaA06g15730D                                        97.1    5e-21   
ref|XP_010418233.1|  PREDICTED: serine/threonine-protein kinase H...  97.1    5e-21   
sp|Q2MHE4.1|HT1_ARATH  RecName: Full=Serine/threonine-protein kin...  97.1    5e-21   
ref|XP_002444045.1|  hypothetical protein SORBIDRAFT_07g006320        97.4    5e-21   
emb|CDY12945.1|  BnaA09g13290D                                        97.1    5e-21   
ref|XP_007033552.1|  Kinase superfamily protein isoform 2             96.7    5e-21   
ref|XP_010052902.1|  PREDICTED: serine/threonine-protein kinase HT1   97.1    5e-21   
ref|XP_010430294.1|  PREDICTED: serine/threonine-protein kinase HT1   97.1    6e-21   
ref|XP_006391896.1|  hypothetical protein EUTSA_v10023512mg           97.1    6e-21   
ref|XP_003601281.1|  Fibroblast growth factor receptor                97.1    6e-21   
ref|XP_006586766.1|  PREDICTED: serine/threonine-protein kinase H...  96.7    6e-21   
ref|XP_009112690.1|  PREDICTED: serine/threonine-protein kinase HT1   97.1    6e-21   
ref|XP_002862816.1|  hypothetical protein ARALYDRAFT_920244           97.1    6e-21   
ref|XP_006302349.1|  hypothetical protein CARUB_v10020429mg           97.1    6e-21   
ref|XP_010272434.1|  PREDICTED: serine/threonine-protein kinase H...  98.2    6e-21   
ref|XP_007147666.1|  hypothetical protein PHAVU_006G144200g           96.7    6e-21   
dbj|BAJ93315.1|  predicted protein                                    96.7    7e-21   
ref|XP_002310003.1|  hypothetical protein POPTR_0007s06210g           97.8    7e-21   
ref|XP_009113082.1|  PREDICTED: serine/threonine-protein kinase HT1   96.7    7e-21   
gb|ABR17310.1|  unknown                                               96.3    7e-21   
gb|KHG30642.1|  Serine/threonine-protein kinase HT1                   97.1    7e-21   
ref|XP_006412622.1|  hypothetical protein EUTSA_v10025332mg           97.1    7e-21   
ref|XP_009794832.1|  PREDICTED: serine/threonine-protein kinase H...  96.7    7e-21   
emb|CDX68725.1|  BnaC01g07280D                                        97.1    7e-21   
gb|KEH40245.1|  ACT-like tyrosine kinase family protein               96.3    8e-21   
ref|XP_003534727.1|  PREDICTED: serine/threonine-protein kinase H...  96.7    8e-21   
ref|XP_004304718.1|  PREDICTED: serine/threonine-protein kinase H...  97.1    8e-21   
ref|XP_009127195.1|  PREDICTED: serine/threonine-protein kinase H...  96.7    9e-21   
ref|NP_001148926.1|  LOC100282546                                     96.7    9e-21   
gb|KEH40244.1|  ACT-like tyrosine kinase family protein               96.3    9e-21   
gb|ABK06446.1|  flag-tagged protein kinase domain of putative mit...  96.3    9e-21   
gb|AES59821.2|  ACT-like tyrosine kinase family protein               96.3    9e-21   
gb|KDO75988.1|  hypothetical protein CISIN_1g011359mg                 96.7    9e-21   
gb|AES59819.2|  ACT-like tyrosine kinase family protein               96.3    9e-21   
ref|XP_009593485.1|  PREDICTED: serine/threonine-protein kinase H...  95.9    9e-21   
gb|AES59820.2|  ACT-like tyrosine kinase family protein               96.3    9e-21   
ref|NP_001061274.1|  Os08g0224100                                     96.7    1e-20   
ref|XP_008348450.1|  PREDICTED: serine/threonine-protein kinase H...  95.9    1e-20   
ref|XP_010520228.1|  PREDICTED: serine/threonine-protein kinase H...  97.8    1e-20   
ref|XP_008809632.1|  PREDICTED: dual specificity protein kinase s...  98.6    1e-20   
gb|KHG11946.1|  Serine/threonine-protein kinase HT1                   97.4    1e-20   
ref|XP_008668092.1|  PREDICTED: LOC100284719 isoform X1               96.3    1e-20   
ref|NP_001151086.1|  LOC100284719                                     96.3    1e-20   
ref|XP_009593484.1|  PREDICTED: serine/threonine-protein kinase H...  95.9    1e-20   
ref|XP_006280285.1|  hypothetical protein CARUB_v10026210mg           97.8    1e-20   
ref|XP_002448496.1|  hypothetical protein SORBIDRAFT_06g027970        96.3    1e-20   
ref|XP_010270068.1|  PREDICTED: serine/threonine-protein kinase H...  95.9    1e-20   
ref|NP_001149811.1|  serine/threonine protein kinase                  96.3    1e-20   
ref|XP_010260231.1|  PREDICTED: serine/threonine-protein kinase H...  97.1    1e-20   
ref|XP_003589570.1|  Protein kinase like protein                      96.3    1e-20   
emb|CDX72296.1|  BnaC07g43180D                                        96.3    1e-20   
ref|XP_009758365.1|  PREDICTED: serine/threonine-protein kinase H...  95.5    1e-20   
gb|ABU45200.1|  unknown                                               95.1    1e-20   
emb|CDY13414.1|  BnaA03g51320D                                        96.3    1e-20   
ref|XP_008245028.1|  PREDICTED: serine/threonine-protein kinase H...  95.5    1e-20   
ref|XP_009137995.1|  PREDICTED: serine/threonine-protein kinase H...  95.9    2e-20   
gb|ACF85163.1|  unknown                                               95.1    2e-20   
ref|XP_010270066.1|  PREDICTED: serine/threonine-protein kinase H...  95.9    2e-20   
gb|AES59818.2|  ACT-like tyrosine kinase family protein               96.3    2e-20   
gb|AGA37223.1|  mitogen-activated protein kinase kinase kinase Ra...  95.9    2e-20   
ref|XP_003589569.1|  Protein kinase like protein                      95.9    2e-20   



>gb|ABU45180.1| unknown [Solanum melongena]
Length=372

 Score =   156 bits (395),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 103/147 (70%), Gaps = 1/147 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQK-ERFLREV  195
            ++K LID   L+ G  IS+G+ + VY G Y    VAIK+I+ +   + SP++  +F REV
Sbjct  39   DNKLLIDLQHLFIGPVISEGLYSIVYEGEYKSMPVAIKIIQPDMSANVSPERIVKFQREV  98

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             LL+  +HDNI+KFI  S+EPA+ LVTE+M GG+LQR+LW I+P   D K +L  AL IS
Sbjct  99   TLLSKVQHDNIVKFIGASMEPALMLVTELMKGGTLQRYLWSIRPQCPDLKLSLSFALDIS  158

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESK  456
            RAM YLH  GIIHRDLKP+N+ LSE K
Sbjct  159  RAMEYLHAIGIIHRDLKPSNLLLSEDK  185



>ref|XP_009803267.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
Length=368

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 105/147 (71%), Gaps = 1/147 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLREV  195
            + K LID  +L  G  +S+G  + VY G Y    VAIKVI+ ++  + SP+ KE+F REV
Sbjct  36   DKKLLIDLHQLSIGPLLSEGPYSLVYEGLYKSMPVAIKVIQPDRSANVSPERKEKFQREV  95

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             LL+  KHDNI+KFI  S+EPA+ LVTE+M+GG+LQ++LW I+P + D K +L  AL IS
Sbjct  96   LLLSKVKHDNIVKFIGASMEPALMLVTELMSGGTLQKYLWSIRPHSPDLKLSLSFALGIS  155

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESK  456
            RAM YLH  GIIHRDLKP+N+ L+E K
Sbjct  156  RAMEYLHAIGIIHRDLKPSNLLLTEDK  182



>ref|XP_009590482.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
Length=368

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 102/147 (69%), Gaps = 1/147 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLREV  195
            + K  ID  +L  G  +S+G  + VY G Y    VAIK+I+ ++  + SP+ KE+F REV
Sbjct  36   DKKLFIDLHQLSIGPLLSEGPYSLVYEGLYKSMPVAIKIIQPDRSANVSPERKEKFQREV  95

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             LL+  KHDNI+KFI  S+EPAM LVTE+M GG+LQ++LW I+P   D K +L  AL IS
Sbjct  96   LLLSKVKHDNIVKFIGASMEPAMMLVTELMRGGTLQKYLWSIRPHCPDLKLSLSFALGIS  155

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESK  456
            RAM YLH  GIIHRDLKP+N+ L+E K
Sbjct  156  RAMEYLHAIGIIHRDLKPSNLLLTEDK  182



>ref|XP_011099588.1| PREDICTED: serine/threonine-protein kinase HT1 [Sesamum indicum]
Length=364

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/148 (50%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLREV  195
            + K LID  EL  G  IS+G  + VY G Y    VAIKVI+ +     SP+ +E+F+REV
Sbjct  28   DKKLLIDVRELAIGPMISEGTYSVVYEGLYRSMPVAIKVIQADMSAIMSPELQEKFIREV  87

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+   HDNI+K I  +VEP M ++TE+M GG+LQ+ LW ++P   D K A+  AL IS
Sbjct  88   SMLSRVNHDNIVKLIGVAVEPTMMIITELMRGGTLQKFLWSVRPNCTDLKLAICFALDIS  147

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM YLH+N IIHRDLKP+N+ L+E K+
Sbjct  148  RAMEYLHQNRIIHRDLKPSNLLLTEDKR  175



>ref|XP_004301888.1| PREDICTED: serine/threonine-protein kinase HT1-like [Fragaria 
vesca subsp. vesca]
Length=390

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 100/145 (69%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIET-EKGTDESPQKERFLREVKLL  204
             LID + +  G  + +G  + VY G Y  K VA+K+I+  E G     +KE+F REV LL
Sbjct  47   LLIDASCVVIGQVLGEGPQSIVYEGLYNSKPVAVKIIQPDETGLINPERKEKFQREVTLL  106

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            + AKHDNI+KFI  SVEP M +VTE+M GG++Q++LW  +P  +D K ++  AL I RAM
Sbjct  107  SKAKHDNIVKFIGASVEPIMMIVTELMRGGTIQKYLWGTRPVVLDLKLSISFALDICRAM  166

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
             YLH NGIIHRDLKP+N+ LSE+KK
Sbjct  167  EYLHANGIIHRDLKPSNLLLSENKK  191



>ref|XP_008241879.1| PREDICTED: serine/threonine-protein kinase HT1-like [Prunus mume]
Length=376

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 103/144 (72%), Gaps = 2/144 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKERFLREVKLLA  207
            +LID + +  G +I++G  +TV+ G Y  K VA+K+IE  K + ES  KE+F REV LLA
Sbjct  41   WLIDPSCVEIGPKITEGPRSTVFQGLYKSKPVAVKIIEPTKESTES--KEKFQREVILLA  98

Query  208  AAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAMA  387
              KHDNI+KFI    EP++ ++TE+M GG++Q+HL +I+P T+D K ++  AL ISRAM 
Sbjct  99   KVKHDNIVKFIGACFEPSLMILTELMRGGTVQKHLRNIRPQTLDLKLSISFALDISRAME  158

Query  388  YLHENGIIHRDLKPNNIFLSESKK  459
            YLH NGIIHRDLKP N+ L+E  K
Sbjct  159  YLHANGIIHRDLKPANLLLTEDMK  182



>ref|XP_002268484.2| PREDICTED: serine/threonine-protein kinase HT1-like [Vitis vinifera]
Length=382

 Score =   152 bits (383),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 101/145 (70%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESP-QKERFLREVKLL  204
             LID + L  G  IS+G  + V+ G Y    VAIK+I+  K +  SP +KE+F REV +L
Sbjct  53   LLIDLSSLRIGSMISEGRLSVVHEGLYKSMPVAIKMIQPNKTSAVSPDRKEKFQREVTIL  112

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KH+NI+KFI  S+EP M ++TE+M GG+LQ++LW I+P + D K +L  AL ISR M
Sbjct  113  SRVKHENIVKFIGASIEPTMMIITELMKGGTLQQYLWSIRPNSPDLKLSLSFALDISRVM  172

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
             YLH NGIIHRDLKP+N+ L+E KK
Sbjct  173  EYLHANGIIHRDLKPSNLLLTEDKK  197



>ref|XP_004143579.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 gb|KGN48811.1| hypothetical protein Csa_6G502000 [Cucumis sativus]
Length=374

 Score =   149 bits (377),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 101/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQK-ERFLREV  195
            E   LID   L  G  I +G  + VY G Y  + VA+K+I+  + +  SP+K ERF REV
Sbjct  39   EPTLLIDPHCLKIGEVIGEGSCSIVYEGLYDYQPVAVKIIQPIRASAISPEKKERFQREV  98

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             LLA   H+NI+KFI  S+EP + ++TE+M GG+LQ++LW I+P T D K +L +AL +S
Sbjct  99   TLLARLNHENIIKFIGASIEPTLMIITELMRGGTLQKYLWSIRPETPDSKFSLSLALDLS  158

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M YLH NGII+RDLKP+N+ L+E K+
Sbjct  159  RVMTYLHSNGIIYRDLKPSNLLLTEDKQ  186



>ref|XP_009760417.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
sylvestris]
Length=379

 Score =   147 bits (371),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 100/144 (69%), Gaps = 1/144 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             LID  +L  G  IS+   + VY G Y  + VAIKVI+ EK ++ SP+++ +F RE+ +L
Sbjct  31   LLIDLQQLSIGPIISEARYSVVYQGLYKSQPVAIKVIQPEKCSNVSPERKVKFEREITML  90

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KHDNI+KFI  S+EPA+ LVTE+M G +LQ++LW I+P   D   +L  AL ISRAM
Sbjct  91   SRVKHDNIMKFIGVSMEPALILVTELMKGDTLQKYLWSIRPHCPDLNLSLSFALGISRAM  150

Query  385  AYLHENGIIHRDLKPNNIFLSESK  456
             YLH  GIIHRDLKP+N+ L+E K
Sbjct  151  EYLHAIGIIHRDLKPSNLLLTEDK  174



>ref|XP_009356713.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=380

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 97/145 (67%), Gaps = 1/145 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDES-PQKERFLREV  195
            +   LID + +  G  + +G    VY G Y  K VA+K+I   K T+ S   +E+FLREV
Sbjct  41   DPSILIDPSCIKIGSVLGEGPGAIVYEGLYQSKPVAVKIIRPPKTTEVSLDCQEKFLREV  100

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             LLA  KH+NI+KF+    EP+M ++TE++ GG+LQ+HLW ++P T+D K ++  A+ + 
Sbjct  101  SLLAKVKHENIVKFVGACFEPSMIILTELLRGGNLQKHLWGMRPGTLDLKCSISFAIDVC  160

Query  376  RAMAYLHENGIIHRDLKPNNIFLSE  450
            RAM YLH NGIIHRDLKP N+ L+E
Sbjct  161  RAMEYLHANGIIHRDLKPANLLLTE  185



>gb|ABU45214.1| unknown [Solanum bulbocastanum]
Length=372

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 98/145 (68%), Gaps = 1/145 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            K LID   L  G  IS+G  + VY G Y    VAIK+I+ +   + SP+++ +F REV L
Sbjct  42   KLLIDLQHLSIGHVISEGPYSVVYEGLYKSMPVAIKIIQPDMSANVSPERKVKFQREVTL  101

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            L+  KH+NI+KFI  S+EP + LVTE+M GG+LQ+ LW  +P   D K +L  AL+ISRA
Sbjct  102  LSKVKHENIVKFIGASMEPTLMLVTELMKGGTLQKFLWSTRPQCPDLKLSLSFALEISRA  161

Query  382  MAYLHENGIIHRDLKPNNIFLSESK  456
            M YLH  GIIHRDLKP+N+ L+E K
Sbjct  162  MEYLHAIGIIHRDLKPSNLLLTEDK  186



>ref|XP_004233716.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
lycopersicum]
Length=371

 Score =   145 bits (367),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (67%), Gaps = 1/145 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            K LID   L  G  IS+G  + VY G Y    VAIK+I+ +   + SP+++ +F REV L
Sbjct  41   KLLIDLQHLSIGHVISEGPYSVVYEGLYKSMPVAIKIIQPDMSANVSPERKVKFHREVTL  100

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            L+  KHDNI+KF+  S+EP + LVTE+M GG+LQ+ LW  +P   D K +L  AL ISRA
Sbjct  101  LSKVKHDNIVKFVGASMEPTLMLVTELMKGGTLQKFLWSTRPQCPDLKLSLSFALGISRA  160

Query  382  MAYLHENGIIHRDLKPNNIFLSESK  456
            M YLH  GIIHRDLKP+N+ L+E K
Sbjct  161  MEYLHAIGIIHRDLKPSNLLLTEDK  185



>ref|XP_008440686.1| PREDICTED: serine/threonine-protein kinase HT1 [Cucumis melo]
Length=391

 Score =   146 bits (368),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQK-ERFLREV  195
            E   LID   L  G  + +G  + VY G Y  + VA+K+I+  + +  SP+K ERF REV
Sbjct  57   EPTLLIDPHCLKIGEVMGEGSCSIVYEGLYNYQPVAVKIIQPIRASAISPEKKERFQREV  116

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             LLA   H+NI+KFI  S+EP + ++TE+M GG+LQ++LW  +P T D K +L +AL +S
Sbjct  117  TLLARLNHENIIKFIGASIEPTLMIITELMRGGTLQKYLWSFRPETPDLKFSLSIALDLS  176

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M YLH NGII+RDLKP+N+ L+E K+
Sbjct  177  RVMTYLHSNGIIYRDLKPSNLLLTEDKQ  204



>ref|XP_006363141.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
tuberosum]
Length=372

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 97/145 (67%), Gaps = 1/145 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            K LID   L  G  IS+G  + VY G Y    VAIK+I+ +   + SP+++ +F REV L
Sbjct  42   KLLIDLQHLSIGHVISEGPYSVVYEGLYKSMPVAIKIIQPDMSANVSPERKVKFQREVTL  101

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            L+  KH+NI+KFI  S+EP + LVTE+M GG+LQ+ LW  +P   D K +L  AL ISRA
Sbjct  102  LSKVKHENIVKFIGASMEPTLMLVTELMRGGTLQKFLWSTRPQCPDLKLSLSFALGISRA  161

Query  382  MAYLHENGIIHRDLKPNNIFLSESK  456
            M YLH  GIIHRDLKP+N+ L+E K
Sbjct  162  MEYLHAIGIIHRDLKPSNLLLTEDK  186



>emb|CDP02811.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 97/131 (74%), Gaps = 1/131 (1%)
 Frame = +1

Query  67   ISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQK-ERFLREVKLLAAAKHDNILKFIA  243
            IS+G  + VY G Y    VA+KVI+ +  ++ SP++ E+F REV +L+  KHDNI+KFI 
Sbjct  2    ISEGPYSIVYEGLYNSVPVAVKVIQPDISSNVSPERMEKFEREVVMLSRVKHDNIVKFIG  61

Query  244  YSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAMAYLHENGIIHRDL  423
             ++EPA+ ++TE+M GG+LQ++LW ++P   D K +L +AL ISRAM YLH NGIIHRDL
Sbjct  62   AAMEPALIVLTELMKGGTLQKYLWSLRPNCPDMKLSLNLALGISRAMQYLHANGIIHRDL  121

Query  424  KPNNIFLSESK  456
            KP+N+ L+E K
Sbjct  122  KPSNLLLTEDK  132



>ref|XP_009588505.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nicotiana 
tomentosiformis]
Length=392

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/147 (50%), Positives = 100/147 (68%), Gaps = 1/147 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K LID  +L  G  IS+   + VY G Y    VAIKVI+ EK ++ SP+++ +F RE+
Sbjct  40   DKKLLIDLQQLSIGPIISEAHYSVVYQGLYKSLPVAIKVIQPEKSSNVSPERKVKFEREI  99

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  KHD+I+KFI  S EPA+ LVTE+M G +LQ++LW I+P   D   +L  AL IS
Sbjct  100  TMLSRVKHDSIVKFIGASTEPALILVTELMKGDTLQKYLWSIRPHCPDFNLSLSFALGIS  159

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESK  456
            RAM YLH  GIIHRDLKP+N+ L+E K
Sbjct  160  RAMEYLHAIGIIHRDLKPSNLLLTEDK  186



>emb|CAN83950.1| hypothetical protein VITISV_043906 [Vitis vinifera]
Length=356

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 97/145 (67%), Gaps = 9/145 (6%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESP-QKERFLREVKLL  204
             LID + L  G  IS+G         Y    VAIK+I+  K +  SP +KE+F REV +L
Sbjct  35   LLIDLSSLRIGSMISEG--------RYKSMPVAIKMIQPNKTSAVSPDRKEKFQREVTIL  86

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KH+NI+KFI  S+EP M ++TE+M GG+LQ++LW I+P + D K +L  AL ISR M
Sbjct  87   SRVKHENIVKFIGASIEPTMMIITELMKGGTLQQYLWSIRPNSPDLKLSLSFALDISRVM  146

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
             YLH NGIIHRDLKP+N+ L+E KK
Sbjct  147  EYLHANGIIHRDLKPSNLLLTEDKK  171



>ref|XP_010099830.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
 gb|EXB80590.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
Length=435

 Score =   142 bits (357),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 99/147 (67%), Gaps = 1/147 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLREV  195
            +   LID   +  G  + +G ++ V  G +  + VA+K+I+  K ++ +P+ KE+F REV
Sbjct  54   DPSLLIDYRSIKLGRILGEGPNSIVRKGLFNSRPVAVKIIQPAKMSEINPERKEKFQREV  113

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             LLA  KH NI+KFI  +VEP + +VTE+M GG+LQ++LW  +P  +D K +L  AL +S
Sbjct  114  TLLAKMKHQNIVKFIGATVEPFLMIVTELMGGGTLQKYLWSTRPGALDWKVSLGFALDLS  173

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESK  456
            R M YLHENG+IHRDLKP+N+ LS  K
Sbjct  174  RVMEYLHENGVIHRDLKPSNVLLSRDK  200



>gb|EYU44665.1| hypothetical protein MIMGU_mgv1a008572mg [Erythranthe guttata]
Length=369

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLREV  195
            + K LID  +L  G  IS+G  + VY G Y    VA+K+I+ +  T  SP+ +E+F REV
Sbjct  35   DEKLLIDADQLAIGPMISEGHYSIVYQGLYGSLPVAVKMIQPDMSTSVSPELEEKFCREV  94

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+   H+NI+K I  ++EP M +VTE M GG+LQ+ +W ++P   D K  +  AL IS
Sbjct  95   SMLSRVNHENIVKLIGATIEPNMMIVTEYMQGGTLQKFMWGLRPNCPDLKLCIRFALDIS  154

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            +AM YLH+N IIHRDLKP+N+ L+E KK
Sbjct  155  QAMEYLHQNRIIHRDLKPSNLLLTEDKK  182



>ref|XP_003547707.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
 gb|KHN27562.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=349

 Score =   140 bits (353),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID  +L+ G +I +G    VY G Y +++VA+K++   +  ++  ++E RF RE+
Sbjct  16   DAKWLIDPKQLFVGPKIGEGAHAKVYEGKYKNQNVAVKIVNKGETPEQISRREARFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L++HLW I+P  +D + A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKHLWSIRPKCLDMRIAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP+N+ L+E  K
Sbjct  136  RAMECLHSHGIIHRDLKPDNLILTEDHK  163



>ref|XP_006604011.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X2 [Glycine 
max]
Length=269

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID  +L+ G +I +G    VY G Y +++VA+K+I   +  ++  ++E RF RE+
Sbjct  16   DAKWLIDPKQLFVGPKIGEGAHAKVYEGKYKNQNVAVKIINKGETPEQISRREARFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++LW I+P  +D + A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLWSIRPKCLDVRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP+N+ L+E  K
Sbjct  136  RAMECLHSHGIIHRDLKPDNLILTEDHK  163



>gb|ACJ84818.1| unknown [Medicago truncatula]
 gb|AFK36348.1| unknown [Medicago truncatula]
Length=208

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+ + + K+L+D   LY G +I +G    VY G Y ++ VAIK++   + T+E  ++E R
Sbjct  11   DEFNLDPKWLVDPKHLYVGPRIGEGAHAKVYEGKYKNQIVAIKIVHKGETTEEIAKREDR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP M +VTE+++GG+L+++L +++P  +D   A+  
Sbjct  71   FAREVAMLSRVQHKNLVKFIGACKEPVMVIVTELLSGGTLRKYLLNMRPKCLDTHVAIGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSE  450
            AL ISRAM  LH +GIIHRDLKP+N+ L+E
Sbjct  131  ALDISRAMECLHSHGIIHRDLKPDNLLLTE  160



>ref|XP_003526999.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
 gb|KHN19258.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=352

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+LID   L+ G QI +G    VY G Y +++VAIK++   + T++  ++E RF REV
Sbjct  16   DPKWLIDPKHLFVGPQIGEGAHAKVYEGKYKNQTVAIKIVHKGETTEDIAKREGRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L+ ++P  +DR  A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLFSMRPKCLDRHVAIGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP+N+ L+E +K
Sbjct  136  RAMECLHSHGIIHRDLKPDNLLLTEDQK  163



>ref|XP_003553431.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Glycine 
max]
Length=348

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID  +L+ G +I +G    VY G Y +++VA+K+I   +  ++  ++E RF RE+
Sbjct  16   DAKWLIDPKQLFVGPKIGEGAHAKVYEGKYKNQNVAVKIINKGETPEQISRREARFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++LW I+P  +D + A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLWSIRPKCLDVRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP+N+ L+E  K
Sbjct  136  RAMECLHSHGIIHRDLKPDNLILTEDHK  163



>gb|KHN03101.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=348

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID  +L+ G +I +G    VY G Y +++VA+K+I   +  ++  ++E RF RE+
Sbjct  16   DAKWLIDPKQLFVGPKIGEGAHAKVYEGKYKNQNVAVKIINKGETPEQISRREARFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++LW I+P  +D + A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLWSIRPKCLDVRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP+N+ L+E  K
Sbjct  136  RAMECLHSHGIIHRDLKPDNLILTEDHK  163



>gb|KDO79483.1| hypothetical protein CISIN_1g019780mg [Citrus sinensis]
Length=336

 Score =   137 bits (346),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 97/150 (65%), Gaps = 1/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLR  189
            D ++  L+D   +     I +G  + VY G Y  + VA+KVI+       S + KE+F R
Sbjct  52   DIDASVLVDHRSVLLQKMIGEGSYSIVYKGFYGCEPVAVKVIQPCNALAVSREHKEKFQR  111

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV LL+  KH+NILKF+  SV+P M ++TE+M G +LQR+LW  +P  +D K ++  AL 
Sbjct  112  EVTLLSKMKHENILKFVGASVQPTMMIITELMRGETLQRYLWSTRPKRLDLKHSISFALD  171

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            ISRAM YLH N +IHRDLKP+N+ L+E KK
Sbjct  172  ISRAMEYLHANSVIHRDLKPSNLLLTEDKK  201



>ref|XP_007161765.1| hypothetical protein PHAVU_001G096600g [Phaseolus vulgaris]
 gb|ESW33759.1| hypothetical protein PHAVU_001G096600g [Phaseolus vulgaris]
Length=352

 Score =   137 bits (346),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID  +L+ G +I +G    VY G Y +++VA+K+I   +  ++  ++E RF RE+
Sbjct  16   DAKWLIDPKQLFVGPKIGEGAHAKVYEGKYKNQNVAVKIINKGETPEQISRREARFGREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++LW I+P  +D + A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLWGIRPNCLDMRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP+N+ L+E  K
Sbjct  136  RAMECLHSHGIIHRDLKPDNLILTEDHK  163



>gb|KDP31798.1| hypothetical protein JCGZ_12259 [Jatropha curcas]
Length=350

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 98/145 (68%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLREVKLL  204
             LID   +     I++G  + VY G +  + VA+K+I+  + +    + KE+F REV L 
Sbjct  24   LLIDPCRVLVRKLIAEGPYSLVYEGEFESRPVAVKIIQPMRTSAVILEHKEKFQREVLLQ  83

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            A   H+N++K I  SVEPA+ L+TE++ GG+LQ++LW I+P  +D K  + +AL ISRAM
Sbjct  84   AKMNHENVVKLIGVSVEPALFLITELLRGGTLQKYLWSIRPRRLDLKLCISLALDISRAM  143

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
             YLH+NGIIHRDLKP+N+ L+E KK
Sbjct  144  EYLHDNGIIHRDLKPSNLLLTEEKK  168



>ref|XP_006425727.1| hypothetical protein CICLE_v10025821mg [Citrus clementina]
 ref|XP_006466751.1| PREDICTED: serine/threonine-protein kinase HT1-like [Citrus sinensis]
 gb|ESR38967.1| hypothetical protein CICLE_v10025821mg [Citrus clementina]
Length=388

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 97/150 (65%), Gaps = 1/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLR  189
            D ++  L+D   +     I +G  + VY G Y  + VA+KVI+       S + KE+F R
Sbjct  52   DIDASVLVDHRSVLLQKMIGEGSYSIVYKGFYGCEPVAVKVIQPCNALAVSREHKEKFQR  111

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV LL+  KH+NILKF+  SV+P M ++TE+M G +LQR+LW  +P  +D K ++  AL 
Sbjct  112  EVALLSKMKHENILKFVGASVQPTMMIITELMRGETLQRYLWSTRPKRLDLKHSISFALD  171

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            ISRAM YLH N +IHRDLKP+N+ L+E KK
Sbjct  172  ISRAMEYLHANSVIHRDLKPSNLLLTEDKK  201



>ref|XP_004501874.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cicer arietinum]
Length=352

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 103/150 (69%), Gaps = 1/150 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            DD + + K+LID   LY G +I +G    VY G Y ++ VAIK++   + T++  ++E R
Sbjct  11   DDFNFDPKWLIDPKHLYVGPRIGEGAHAKVYEGKYKNQIVAIKIVHKGETTEDIVKREGR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F+REV +L+  +H N++KFI   +EP M +VTE+++GG+L+++L +++P  +D   A+  
Sbjct  71   FVREVAMLSRVQHKNLVKFIGACMEPVMVIVTELLSGGTLRKYLLNMRPKCLDTHVAIGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSE  450
            AL I RAM  LH +GIIHRDLKP+N+ L+E
Sbjct  131  ALDIGRAMECLHSHGIIHRDLKPDNLLLTE  160



>ref|XP_010251057.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
Length=352

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 101/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID   L+ G +I +G    VY G Y +++VA+K++   +  +E  ++E RF REV
Sbjct  16   DAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAVKIVHRGETPEEIAKREARFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GGSL+++L +++P  +DR+ A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVVVTELLLGGSLRKYLLNMRPRCLDRRVAIGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+E  K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILTEDHK  163



>emb|CBI17559.3| unnamed protein product [Vitis vinifera]
Length=301

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  121  VAIKVIETEKGTDESP-QKERFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGS  297
            VAIK+I+  K +  SP +KE+F REV +L+  KH+NI+KFI  S+EP M ++TE+M GG+
Sbjct  3    VAIKMIQPNKTSAVSPDRKEKFQREVTILSRVKHENIVKFIGASIEPTMMIITELMKGGT  62

Query  298  LQRHLWHIKPATMDRKDALVMALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            LQ++LW I+P + D K +L  AL ISR M YLH NGIIHRDLKP+N+ L+E KK
Sbjct  63   LQQYLWSIRPNSPDLKLSLSFALDISRVMEYLHANGIIHRDLKPSNLLLTEDKK  116



>ref|XP_010534156.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Tarenaya 
hassleriana]
Length=344

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 99/144 (69%), Gaps = 1/144 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E K+LID   L+ G +I +G    VY G Y D++VAIK++   +  +E  ++E RFLREV
Sbjct  10   EPKWLIDPQLLFVGPKIGEGAHAKVYEGKYKDQTVAIKIVHRGETPEEIAKRESRFLREV  69

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KF+    EP M +VTE++ GG+L+++L +++PA +D + A+  AL I+
Sbjct  70   SMLSRVQHKNLVKFMGACKEPVMVIVTELLLGGTLRKYLLNLRPACLDTRVAIGFALDIA  129

Query  376  RAMAYLHENGIIHRDLKPNNIFLS  447
            RAM  LH +GIIHRDLKP N+ L+
Sbjct  130  RAMECLHSHGIIHRDLKPENLLLT  153



>ref|XP_006577840.1| PREDICTED: uncharacterized protein LOC100804884 isoform X1 [Glycine 
max]
 gb|KHN30950.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=352

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+LID   L+ G QI +G    VY G Y +++VA K++   + T++  ++E RF REV
Sbjct  16   DPKWLIDPNHLFVGPQIGEGAHAKVYEGKYKNQTVAFKIVHKGETTEDIAKREGRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +DR  A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLSMRPKCLDRHVAIGYALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP+N+ L+E +K
Sbjct  136  RAMECLHSHGIIHRDLKPDNLLLTEDQK  163



>ref|NP_001241956.1| uncharacterized protein LOC100804884 [Glycine max]
 gb|ACU18435.1| unknown [Glycine max]
Length=352

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+LID   L+ G QI +G    VY G Y +++VA K++   + T++  ++E RF REV
Sbjct  16   DPKWLIDPNHLFVGPQIGEGAHAKVYEGKYKNQTVAFKIVHKGETTEDIAKREGRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +DR  A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLSMRPKCLDRHVAIGYALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP+N+ L+E +K
Sbjct  136  RAMECLHSHGIIHRDLKPDNLLLTEDQK  163



>ref|XP_003601186.1| Serine/threonine protein kinase TNNI3K [Medicago truncatula]
 gb|AES71437.1| Serine/Threonine-kinase HT1-like protein [Medicago truncatula]
Length=352

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 102/150 (68%), Gaps = 1/150 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+ + + K+L+D   LY G +I +G    VY G Y ++ VAIK++   + T+E  ++E R
Sbjct  11   DEFNLDPKWLVDPKHLYVGPRIGEGAHAKVYEGKYKNQIVAIKIVHKGETTEEIAKREDR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP M +VTE+++GG+L+++L +++P  +D   A+  
Sbjct  71   FAREVAMLSRVQHKNLVKFIGACKEPVMVIVTELLSGGTLRKYLLNMRPKCLDTHVAIGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSE  450
            AL ISRAM  LH +GIIHRDLKP+N+ L+E
Sbjct  131  ALDISRAMECLHSHGIIHRDLKPDNLLLTE  160



>ref|XP_010026165.1| PREDICTED: serine/threonine-protein kinase HT1-like [Eucalyptus 
grandis]
Length=416

 Score =   136 bits (343),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 97/146 (66%), Gaps = 3/146 (2%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ--KERFLREVKL  201
             LID +E++ G  I +G  + VY G Y  KSVA+K+I    G   + Q  KERF REV L
Sbjct  71   LLIDSSEVWVGRMIGEGRHSFVYEGLYDSKSVAVKIIRP-YGESMTYQDYKERFKREVML  129

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            L+ A H NI+KF+  SV+P M +VTE+M  G+LQ+HL  I+P  +D K ++  AL I+ A
Sbjct  130  LSKATHQNIVKFVGASVQPLMMIVTELMRDGNLQKHLSSIRPQVLDLKLSIGFALDIAGA  189

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M YLH N IIHRDLKP+N+ L+E KK
Sbjct  190  MEYLHANNIIHRDLKPSNLLLTEDKK  215



>ref|XP_006439920.1| hypothetical protein CICLE_v10020876mg [Citrus clementina]
 gb|ESR53160.1| hypothetical protein CICLE_v10020876mg [Citrus clementina]
Length=299

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +KE R
Sbjct  11   DEFKLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKIVYKGETPEEIAKKESR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP M +VTE+++GG+L+++L +++P  +D + A+  
Sbjct  71   FAREVAMLSRVQHKNLVKFIGACKEPVMVIVTELLSGGTLRKYLLNMRPRCLDVRVAIGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+E  K
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTEDHK  163



>ref|XP_007047002.1| Serine/threonine-protein kinase HT1 [Theobroma cacao]
 gb|EOX91159.1| Serine/threonine-protein kinase HT1 [Theobroma cacao]
Length=397

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 96/144 (67%), Gaps = 1/144 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDES-PQKERFLREVKLL  204
             LID   +     I +G  +TV+ G Y  K VA+K+I+    +  +   KERF REV LL
Sbjct  68   LLIDPRLVLVDKMIGEGSYSTVHEGFYKLKPVAVKIIQPSNTSAVTRDHKERFQREVLLL  127

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +   H+N++KFI  SVEP M +VTE+M G +LQ++LW ++P  +D K ++ +AL ISRAM
Sbjct  128  SRMNHENVVKFIGASVEPTMMIVTELMKGETLQKYLWSVRPKRLDLKLSISLALDISRAM  187

Query  385  AYLHENGIIHRDLKPNNIFLSESK  456
             YLH NGIIHRDLKP+N+ L+E +
Sbjct  188  EYLHANGIIHRDLKPSNLLLTEDR  211



>ref|XP_004138086.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 ref|XP_004169080.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 ref|XP_008464507.1| PREDICTED: serine/threonine-protein kinase HT1 [Cucumis melo]
 ref|XP_008464508.1| PREDICTED: serine/threonine-protein kinase HT1 [Cucumis melo]
 gb|KGN63533.1| hypothetical protein Csa_1G003510 [Cucumis sativus]
Length=353

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E+K+L+D   L+ G +I +G    VY G Y +++VAIK++   +  DE  +KE RF REV
Sbjct  17   EAKWLVDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKIVHKGETVDEVAKKEARFAREV  76

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D + A+  AL I+
Sbjct  77   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPRCLDTRVAVGFALDIA  136

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  137  RAMECLHSHGIIHRDLKPENLLLTADHK  164



>ref|XP_004173420.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
Length=310

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/114 (54%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  121  VAIKVIETEKGTDESPQK-ERFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGS  297
            VA+K+I+  + +  SP+K ERF REV LLA   H+NI+KFI  S+EP + ++TE+M GG+
Sbjct  9    VAVKIIQPIRASAISPEKKERFQREVTLLARLNHENIIKFIGASIEPTLMIITELMRGGT  68

Query  298  LQRHLWHIKPATMDRKDALVMALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            LQ++LW I+P T D K +L +AL +SR M YLH NGII+RDLKP+N+ L+E K+
Sbjct  69   LQKYLWSIRPETPDSKFSLSLALDLSRVMTYLHSNGIIYRDLKPSNLLLTEDKQ  122



>ref|XP_006439921.1| hypothetical protein CICLE_v10020876mg [Citrus clementina]
 gb|ESR53161.1| hypothetical protein CICLE_v10020876mg [Citrus clementina]
Length=352

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +KE R
Sbjct  11   DEFKLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKIVYKGETPEEIAKKESR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP M +VTE+++GG+L+++L +++P  +D + A+  
Sbjct  71   FAREVAMLSRVQHKNLVKFIGACKEPVMVIVTELLSGGTLRKYLLNMRPRCLDVRVAIGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+E  K
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTEDHK  163



>ref|XP_007150910.1| hypothetical protein PHAVU_004G004800g [Phaseolus vulgaris]
 gb|ESW22904.1| hypothetical protein PHAVU_004G004800g [Phaseolus vulgaris]
Length=352

 Score =   134 bits (336),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 101/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ESK+L+D  +L+ G +I +G    VY G Y +++VA+K+I   +  +E  ++E RF REV
Sbjct  16   ESKWLVDPKQLFVGPKIGEGAHAKVYEGKYKNQNVAVKIINKGETPEEISRREARFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE+++GG+L+++L +++P  +D   A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLSGGTLRKYLLNMRPKCLDMAMAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP+N+ L+   K
Sbjct  136  RAMECLHSHGIIHRDLKPDNLILTADHK  163



>ref|XP_007031602.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY02528.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=352

 Score =   133 bits (335),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID  +L+ G +I +G    VY G Y +++VA+KV+   +  +E  ++E RF REV
Sbjct  16   DAKWLIDPQQLFVGPKIGEGAHAKVYEGKYKNQTVAVKVVRRGETPEEIARREGRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLLSMRPKCLDMRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ LSE  K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILSEDHK  163



>ref|XP_006476887.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Citrus sinensis]
Length=317

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 102/153 (67%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +KE R
Sbjct  11   DELKLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKIVHKGETPEEIAKKESR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP M +VTE+++GG+L+++L +++P  +D   A+  
Sbjct  71   FAREVAMLSRVQHRNLVKFIGACKEPVMVIVTELLSGGTLRKYLLNMRPRCLDVCVAIGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+E  K
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTEDLK  163



>ref|XP_009374238.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=380

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 92/141 (65%), Gaps = 1/141 (1%)
 Frame = +1

Query  31   LIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDES-PQKERFLREVKLLA  207
            LID + +  G  + +G    VY G Y  K VA+K+I   K    S  ++E+F REV +L+
Sbjct  45   LIDPSCIKIGSVLGEGRGAIVYEGLYQSKPVAVKIIRPPKTKYVSLDRQEKFHREVSMLS  104

Query  208  AAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAMA  387
              KHDNI+KF+    EP+M ++TE++ GG+LQ++LW  +P T D K ++  A+ + RAM 
Sbjct  105  KVKHDNIVKFVGACFEPSMIILTELLRGGNLQKYLWERRPRTPDLKCSISFAMDVCRAME  164

Query  388  YLHENGIIHRDLKPNNIFLSE  450
            YLH NGIIHRDLKP N+ L+E
Sbjct  165  YLHANGIIHRDLKPANLLLTE  185



>gb|KDO69480.1| hypothetical protein CISIN_1g018656mg [Citrus sinensis]
Length=317

 Score =   132 bits (333),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 102/153 (67%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +KE R
Sbjct  11   DELKLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKIVHKGETPEEIAKKESR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP M +VTE+++GG+L+++L +++P  +D   A+  
Sbjct  71   FAREVAMLSRVQHRNLVKFIGACKEPVMVIVTELLSGGTLRKYLLNMRPRCLDVCVAIGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+E  K
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTEDLK  163



>ref|XP_010027231.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010027239.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010027245.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW83287.1| hypothetical protein EUGRSUZ_B00222 [Eucalyptus grandis]
Length=351

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 103/154 (67%), Gaps = 1/154 (1%)
 Frame = +1

Query  1    DDDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-  177
            +DD   ++K+LID   L+ G +I +G    VY G Y +++VAIK+I   +  +E  ++E 
Sbjct  10   NDDFRMDAKWLIDAKNLFVGPRIGEGAHAKVYEGKYKNQTVAIKIIHKGETPEEIAKREA  69

Query  178  RFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALV  357
            RF REV +L+  +H N++KFI    EP M +VTE+++GG+L+++L +I+P  ++   A+ 
Sbjct  70   RFAREVAMLSRVQHKNLVKFIGACKEPIMVIVTELLSGGTLRKYLLNIRPRCLETWVAIG  129

Query  358  MALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AL I+RAM  LH +GIIHRDLKP N+ L+  +K
Sbjct  130  FALDIARAMECLHSHGIIHRDLKPENLLLTADQK  163



>ref|XP_011095128.1| PREDICTED: serine/threonine-protein kinase HT1 [Sesamum indicum]
Length=369

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 101/153 (66%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKER  180
            DD   +++ L+D   L+ G +I +G    VY G Y D+ VAIKV+     ++E S  + R
Sbjct  37   DDLCIDARVLVDPKSLFIGSKIGEGAHGKVYQGRYGDRIVAIKVLNCGNTSEERSVLESR  96

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F+REV +++  KH+N++KFI    +P M +VTE++ G SL+++L  I+P  +D   AL  
Sbjct  97   FVREVTMMSRVKHENLVKFIGACKDPLMVIVTELLPGMSLRKYLGSIRPKQLDLHVALNF  156

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH NGIIHRDLKP+N+ L+E++K
Sbjct  157  ALDIARAMECLHANGIIHRDLKPDNLLLTENQK  189



>gb|KDO69481.1| hypothetical protein CISIN_1g018656mg [Citrus sinensis]
Length=352

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 102/153 (67%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +KE R
Sbjct  11   DELKLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKIVHKGETPEEIAKKESR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP M +VTE+++GG+L+++L +++P  +D   A+  
Sbjct  71   FAREVAMLSRVQHRNLVKFIGACKEPVMVIVTELLSGGTLRKYLLNMRPRCLDVCVAIGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+E  K
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTEDLK  163



>ref|XP_006476886.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Citrus sinensis]
Length=352

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 102/153 (67%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +KE R
Sbjct  11   DELKLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKIVHKGETPEEIAKKESR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP M +VTE+++GG+L+++L +++P  +D   A+  
Sbjct  71   FAREVAMLSRVQHRNLVKFIGACKEPVMVIVTELLSGGTLRKYLLNMRPRCLDVCVAIGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+E  K
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTEDLK  163



>ref|XP_003524562.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
 gb|KHN27474.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=346

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 103/152 (68%), Gaps = 1/152 (1%)
 Frame = +1

Query  7    DDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RF  183
            D + +SK+L+D  +L+ G +I +G    VY G Y +++VA+K+I   +  +E  ++E RF
Sbjct  12   DFNLDSKWLVDPKQLFIGPKIGEGAHAKVYEGKYKNQNVAVKIINKGETLEEISRREARF  71

Query  184  LREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMA  363
             REV +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D   A+  A
Sbjct  72   AREVAMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPKCLDMTVAIGFA  131

Query  364  LQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            L I+RAM  LH +GIIHRDLKP+N+ L++  K
Sbjct  132  LDIARAMECLHSHGIIHRDLKPDNLILTDDHK  163



>ref|XP_007138017.1| hypothetical protein PHAVU_009G1741000g, partial [Phaseolus vulgaris]
 gb|ESW10011.1| hypothetical protein PHAVU_009G1741000g, partial [Phaseolus vulgaris]
Length=153

 Score =   127 bits (319),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+LID   L+ G QI +G    VY G Y +++VAIK++   +  D+  ++E RF REV
Sbjct  16   DPKWLIDPKHLFVGPQIGEGAHAKVYEGKYKNQTVAIKIVHKGETADDIAKREGRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VT+++ GG+L+++L +++P  +DR  A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTDLLLGGTLRKYLLNMRPKCLDRHVAIGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKP  429
            RAM  LH +GIIHRDLKP
Sbjct  136  RAMECLHSHGIIHRDLKP  153



>ref|XP_008775400.1| PREDICTED: serine/threonine-protein kinase HT1-like [Phoenix 
dactylifera]
Length=352

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 105/153 (69%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+LI+  +L+ G +I +G    VY G Y +++VA+K++      +E+ ++E R
Sbjct  11   DEHRMDAKWLINPKQLFVGPRIGEGAHAKVYEGKYRNQNVAVKIVNRGHTPEEAAKREAR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F+REV +L+  +H N++KFI    EP M +VTE++ GGSL++++ +++P +++ + A+  
Sbjct  71   FMREVTMLSRVQHKNLVKFIGACKEPVMVVVTELLLGGSLRKYMLNLRPRSLEPRAAVGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+  ++
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTADQR  163



>gb|KHG13005.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
Length=364

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID  +L+ G +I +G    VY G Y +++VAIKV+   +  +E  ++E RF REV
Sbjct  16   DAKWLIDPRQLFVGPKIGEGAHAKVYEGKYKNQTVAIKVVRRGETPEEIARREGRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D +  +  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLLNMRPKCLDMRVVIGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +G+IHRDLKP N+ L+E  K
Sbjct  136  RAMECLHSHGVIHRDLKPENLILTEDHK  163



>ref|XP_010248651.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
 ref|XP_010248652.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
 ref|XP_010248653.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
 ref|XP_010248654.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
 ref|XP_010248655.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
 ref|XP_010248656.1| PREDICTED: serine/threonine-protein kinase HT1-like [Nelumbo 
nucifera]
Length=352

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID   L+ G +I +G    V+ G Y +++VA+K++   +  +E  ++E RF REV
Sbjct  16   DAKWLIDPRHLFVGPRIGEGAHAKVFEGKYKNQNVAVKIVHRGETPEEIAKREARFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GGSL+++L +++P  +D + A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVVVTELLLGGSLRKYLLNMRPRCLDMRVAIGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+E  K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILTEDHK  163



>ref|XP_004952964.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Setaria italica]
 ref|XP_004952965.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Setaria italica]
 ref|XP_004952966.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X3 
[Setaria italica]
Length=350

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+LID   L+ G +I +G    VY G Y +++VAIKV+      +E  ++E RFLREV
Sbjct  16   DPKWLIDPKLLFVGPRIGEGAHAKVYEGKYKNQNVAIKVVHKGDTPEEMTKREGRFLREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI   +EP M +VTE++ GGSL+++L  ++P +++ + A+  AL I+
Sbjct  76   TMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRSLEPRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+  ++
Sbjct  136  RAMECLHAHGIIHRDLKPENLLLTADQR  163



>ref|XP_010534157.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X2 [Tarenaya 
hassleriana]
Length=337

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 97/140 (69%), Gaps = 1/140 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E K+LID   L+ G +I +G    VY G Y D++VAIK++   +  +E  ++E RFLREV
Sbjct  10   EPKWLIDPQLLFVGPKIGEGAHAKVYEGKYKDQTVAIKIVHRGETPEEIAKRESRFLREV  69

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KF+    EP M +VTE++ GG+L+++L +++PA +D + A+  AL I+
Sbjct  70   SMLSRVQHKNLVKFMGACKEPVMVIVTELLLGGTLRKYLLNLRPACLDTRVAIGFALDIA  129

Query  376  RAMAYLHENGIIHRDLKPNN  435
            RAM  LH +GIIHRDLKP++
Sbjct  130  RAMECLHSHGIIHRDLKPDH  149



>ref|XP_004512221.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cicer arietinum]
Length=424

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 96/149 (64%), Gaps = 1/149 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLR  189
            D +   L++  +L  G  I +G  + VY G Y  + VAIK+I  ++  D +P+ K +F R
Sbjct  51   DIDPCLLVNCDKLDIGEMIGEGSYSIVYKGWYESRPVAIKMILPQRTKDATPECKAKFQR  110

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EVKLL+   H N++KFI  +V+P+M ++TE++ GGSLQ++L  I P     +  L  AL 
Sbjct  111  EVKLLSGIDHRNVVKFIGATVKPSMMIITELLEGGSLQKNLKSIYPTAFSLEQCLNYALD  170

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESK  456
            IS+AM YLH NGIIHRDLKP N+ L+E K
Sbjct  171  ISQAMEYLHANGIIHRDLKPGNLLLTEDK  199



>dbj|BAJ93103.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=419

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 94/146 (64%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            K L+D   L+ G +I +G    VY G Y D+ VAIKV+ +    +E    E RF+REV +
Sbjct  84   KLLVDPKMLFVGSKIGEGAHGKVYKGKYGDQIVAIKVLNSGSTPEEKATLEDRFIREVNM  143

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            +   KHDN++KFI    EP M +V+E++ G SL+ +L  I+P+ +D   AL  AL I+RA
Sbjct  144  MCKVKHDNLVKFIGACKEPLMVIVSELLPGMSLKNYLNSIRPSQLDIHTALGYALNIARA  203

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  204  MECLHANGIIHRDLKPDNLLLTANRK  229



>ref|XP_010678873.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=352

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            +SK+L+D  +L+ G +I +G    VY G Y +++VAIK++   +  +E  +KE RF REV
Sbjct  16   DSKWLVDPNQLFVGPKIGEGAHAKVYEGKYKNQNVAIKIVHRGETPEEITKKEGRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N+++FI    EP M +VTE++ GG+L+++L +++P  +D++ A+  AL I+
Sbjct  76   AMLSRVQHKNLVEFIGACKEPVMVIVTELLLGGTLRKYLLNMRPQCLDKQVAIGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  136  RGMECLHAHGIIHRDLKPENLLLTADHK  163



>ref|XP_004299144.1| PREDICTED: serine/threonine-protein kinase HT1-like [Fragaria 
vesca subsp. vesca]
Length=350

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            +SK+LID   L+ G +I +G    VY G Y +++VAIKV+   +  +E  +++ RF REV
Sbjct  16   DSKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKVLHKGETPEEITKRQGRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
            ++L+  +H N++KFI   +EP M +VTE++ GG+L+++  +++P  +D + A+  AL I+
Sbjct  76   EMLSRVQHKNLVKFIGACMEPVMVIVTELLLGGTLRKYCLNMRPRCLDTRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLLLTADHK  163



>gb|AIZ68212.1| serine/threonine-protein kinase HT1-like protein [Ornithogalum 
saundersiae]
Length=352

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 101/153 (66%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQK-ER  180
            D+   + K+LID   L+ G +I +G    VY G Y +++VAIK++      +E  ++  R
Sbjct  11   DEPHLDPKWLIDPKLLFVGPRIGEGAHAKVYEGKYRNQNVAIKIVHKGDTPEEVAKRGSR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F+REV +LA  +H N++KFI    EP M +VTE++ GGSL++++ +++P +++ + A+  
Sbjct  71   FMREVSMLAKVQHKNLVKFIGACKEPVMVVVTELLLGGSLRKYMLNMRPRSLEPRVAVGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL ISRAM  LH +GIIHRDLKP N+ L+  +K
Sbjct  131  ALDISRAMECLHSHGIIHRDLKPENMLLTADQK  163



>ref|XP_007036388.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOY20889.1| Kinase superfamily protein [Theobroma cacao]
Length=352

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 101/153 (66%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E R
Sbjct  11   DEFKLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYRNQTVAIKILHKGETPEEITKREGR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D + A+  
Sbjct  71   FAREVAMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPRCLDMRIAIGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTADHK  163



>ref|XP_010912976.1| PREDICTED: serine/threonine-protein kinase HT1-like [Elaeis guineensis]
Length=352

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 102/153 (67%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   + K+LID  +L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E R
Sbjct  11   DEHHIDPKWLIDPKQLFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHRGETPEEKAKREGR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F+REV +L+   H N++KF+    EP M +VTE++ GGSL+++L +++P +++   A+  
Sbjct  71   FMREVAMLSRVPHKNLVKFLGACKEPVMVVVTELLLGGSLRKYLLNMRPRSLEPGVAVGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+  ++
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTADQR  163



>ref|XP_002525105.1| Serine/threonine-protein kinase HT1, putative [Ricinus communis]
 gb|EEF37232.1| Serine/threonine-protein kinase HT1, putative [Ricinus communis]
Length=410

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 99/149 (66%), Gaps = 2/149 (1%)
 Frame = +1

Query  16   DESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLRE  192
            DES  LID   +     I++G  + VY G +  K VA+K+I+  K +    + KE+F RE
Sbjct  24   DES-LLIDPRRVLVRRLIAEGSYSLVYEGEFESKPVAVKIIQPMKTSAVILEHKEKFQRE  82

Query  193  VKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQI  372
            V L +  KH N++K I  SVEPAM L+TE++ G +LQ++LW I+P  +D + A+  AL I
Sbjct  83   VVLQSRMKHVNVVKLIGASVEPAMFLITELLRGDTLQKYLWSIRPKRLDLRLAITFALDI  142

Query  373  SRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             RAM YLH+NGIIHRDLKP+N+ L++ +K
Sbjct  143  CRAMEYLHDNGIIHRDLKPSNLLLTDDRK  171



>ref|XP_004142785.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 ref|XP_004156731.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 gb|KGN51355.1| hypothetical protein Csa_5G523010 [Cucumis sativus]
Length=353

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 99/150 (66%), Gaps = 1/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLR  189
            D ++K+L+D  +++ G +I +G    V+ G Y D++VAIK+I   +  +E  + E RF R
Sbjct  13   DLDAKWLVDPKQIFVGPRIGEGAHGKVHKGKYKDQNVAIKIIRKGEAPEEIAKTEARFAR  72

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV +L+  +H N+ KFI    EP M +VTE+++GG+L+++L  I+P  +D  +A+  AL 
Sbjct  73   EVAMLSKVQHKNLAKFIGACKEPIMVIVTELLSGGTLRKYLLSIRPRCLDFSEAVGFALD  132

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  133  IARAMDCLHSHGIIHRDLKPENLILTADHK  162



>ref|XP_008341380.1| PREDICTED: serine/threonine-protein kinase HT1-like [Malus domestica]
Length=353

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 100/152 (66%), Gaps = 1/152 (1%)
 Frame = +1

Query  7    DDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RF  183
            D D ++K+LID  +L+ G +I +G    VY G Y +++VA+K++   +  +E  ++E RF
Sbjct  12   DFDLDAKWLIDPKQLFVGPRIGEGAHAKVYEGKYKNQNVAVKIVPRGETPEEIAKREARF  71

Query  184  LREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMA  363
             REV +++   H N++KFI    EP M +VTE++ GG+L+++L+ ++P  +D   A+  A
Sbjct  72   AREVAMMSKVXHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLFSMRPRCLDTHVAVGFA  131

Query  364  LQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            L I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  132  LDIARAMECLHSHGIIHRDLKPENLILTADHK  163



>ref|XP_008351761.1| PREDICTED: serine/threonine-protein kinase HT1-like [Malus domestica]
Length=171

 Score =   125 bits (315),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 96/145 (66%), Gaps = 1/145 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+LID   L+ G +I +G    VY G Y +++VAIKV+   +  +E  +KE R
Sbjct  11   DEFRLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKVVHRGETPEEIIKKEGR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP M +VTE++ GG+L+++  +++P  +D + A+  
Sbjct  71   FAREVVMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYCLNMRPRCLDIRVAVGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNN  435
            AL I+RAM  LH +GIIHRDLKP N
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPGN  155



>ref|XP_004304661.1| PREDICTED: serine/threonine-protein kinase HT1-like [Fragaria 
vesca subsp. vesca]
Length=346

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 99/150 (66%), Gaps = 1/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLR  189
            D ++K+LID   L+ G +I +G    VY G Y +++VA+K++   +  +E  ++E RF R
Sbjct  8    DLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQNVAVKIVNRGETPEEIAKREARFAR  67

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV +L+  +H N++KFI    EP M +VTE++ GG+L+++L+ ++P  +D   A+  AL 
Sbjct  68   EVAMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLFSMRPRCLDMPVAVGFALD  127

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  128  IARAMECLHSHGIIHRDLKPENLILTADHK  157



>ref|XP_006395419.1| hypothetical protein EUTSA_v10004482mg [Eutrema salsugineum]
 gb|ESQ32705.1| hypothetical protein EUTSA_v10004482mg [Eutrema salsugineum]
Length=356

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERFLREV  195
            + K+L+D   LY G +I +G    VY G Y +++VAIK+I+  +  +E S +  RF RE+
Sbjct  16   DPKWLVDPRHLYVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEISKRDNRFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVAFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ LS   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILSADHK  163



>ref|XP_009370355.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
 ref|XP_009371760.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=353

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 100/150 (67%), Gaps = 1/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLR  189
            D + K+LID  +L+ G +I +G    VY G Y +++VA+K++   +  +E  ++E RF R
Sbjct  14   DLDGKWLIDPKQLFVGPRIGEGAHAKVYEGKYKNQNVAVKIVPRGETPEEIAKREGRFAR  73

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV +++  +H N++KFI    EP M +VTE++ GG+L+++L++++P  +D   A+  AL 
Sbjct  74   EVAMMSKVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLFNMRPRCLDTCVAVGFALD  133

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  134  IARAMECLHSHGIIHRDLKPENLILTADHK  163



>ref|XP_010108840.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
 gb|EXC20355.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
Length=352

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID   L+ G +I +G    VY G Y +++VA+K++   +  +E  ++E RF REV
Sbjct  16   DAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQNVAVKIVHKGETPEEIARREARFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPRCLDTRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILTADHK  163



>ref|XP_010547492.1| PREDICTED: serine/threonine-protein kinase HT1-like [Tarenaya 
hassleriana]
Length=408

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 101/156 (65%), Gaps = 8/156 (5%)
 Frame = +1

Query  4    DDDDDESKF------LIDETELYYGVQISQGVSTTVYFGTYMD-KSVAIKVIETEKGTDE  162
            +  DD+  F      L+D  ++     I +G  + VY G +     VA+K+ E  + +  
Sbjct  49   NGSDDQFAFSISPDLLLDPNDVVPMEMIGEGGHSIVYHGLFRKLVPVAVKIFEPSRTSAV  108

Query  163  SPQ-KERFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMD  339
            S + KE+F REV LL+  KH+NI++FI   VEP + +VTE+MTGG+LQR LW+ +P  +D
Sbjct  109  STEHKEKFQREVLLLSKTKHENIVQFIGACVEPQLMIVTELMTGGTLQRFLWNSRPRRLD  168

Query  340  RKDALVMALQISRAMAYLHENGIIHRDLKPNNIFLS  447
            R+ ++  AL I++AM YLHENGIIHRDLKP+N+ ++
Sbjct  169  RELSISFALNIAQAMEYLHENGIIHRDLKPSNVLVT  204



>ref|XP_011101794.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
Length=349

 Score =   129 bits (325),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y +++VAIK+++  +  +E  ++E RF REV
Sbjct  16   DPKWLVDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAIKIVQRGETPEEIAKREARFGREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L++ L +++P  +D + A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKFLVNLRPRCLDMRVAIGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+E  K
Sbjct  136  RAMECLHSHGIIHRDLKPENLLLTEDHK  163



>ref|XP_004231843.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
lycopersicum]
Length=353

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 102/154 (66%), Gaps = 1/154 (1%)
 Frame = +1

Query  1    DDDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-  177
            +++ + E+K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E 
Sbjct  11   EEEFNLEAKWLIDPKLLFVGPKIGEGAHAKVYEGKYRNQNVAIKIVHKGETPEEIAKRES  70

Query  178  RFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALV  357
            RF REV +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D   A+ 
Sbjct  71   RFGREVAMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNLRPRCLDTGVAIR  130

Query  358  MALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AL I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  131  FALDIARAMECLHSHGIIHRDLKPENLLLTADHK  164



>ref|XP_010931355.1| PREDICTED: serine/threonine-protein kinase HT1-like [Elaeis guineensis]
Length=379

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 97/150 (65%), Gaps = 1/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLR  189
            D + K LID   L+ G +I +G    VY G Y D+ VAIKV+ +    +E    E RF+R
Sbjct  49   DIDEKLLIDPRLLFIGSKIGEGAHGKVYEGKYRDQIVAIKVLNSGNTPEEKATLEARFIR  108

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV +++  KH+N++KFI    +P M + TE++ G SL+++L  I+P  +D + A+  AL 
Sbjct  109  EVNMMSRVKHENLVKFIGACKDPIMVIATELLPGMSLKKYLLTIRPKKLDLRQAVSFALD  168

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            I+RAM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  169  IARAMDCLHANGIIHRDLKPDNLLLTANQK  198



>ref|XP_009403625.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
Length=352

 Score =   129 bits (325),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+LID   L+ G +I +G    VY G Y +++VAIKV+     ++E  ++E RF REV
Sbjct  16   DPKWLIDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAIKVMHKGDTSEELAKREARFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             LLA  +H N++KFI    EP M +VTE++ GGSL+++L +++P +++ + A+  AL I+
Sbjct  76   TLLARVQHKNLVKFIGACKEPVMVVVTELLLGGSLRKYLVNMRPRSLEPRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+  ++
Sbjct  136  RAMECLHSHGIIHRDLKPENLLLTADQR  163



>ref|XP_002511319.1| protein kinase atn1, putative [Ricinus communis]
 gb|EEF51921.1| protein kinase atn1, putative [Ricinus communis]
Length=351

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 102/153 (67%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+LID   L+ G +I +G    VY G Y +++VA+K++   +  +E  ++E R
Sbjct  11   DEVKLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAVKIVHKGETPEEISKREAR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KF+    EP M +VTE+++GG+L+++L +++P  ++ + A+  
Sbjct  71   FAREVAMLSRVQHKNLVKFVGACKEPVMVIVTELLSGGTLRKYLLNMRPRCLETRVAIGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTADHK  163



>ref|XP_006852349.1| hypothetical protein AMTR_s00049p00214290 [Amborella trichopoda]
 gb|ERN13816.1| hypothetical protein AMTR_s00049p00214290 [Amborella trichopoda]
Length=361

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 102/154 (66%), Gaps = 1/154 (1%)
 Frame = +1

Query  1    DDDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-  177
            DD+   ES++L+D   L+ G +I +G    VY G Y +++VAIK+++     +E  ++E 
Sbjct  19   DDEFQLESRWLLDPKLLFVGPRIGEGAHAKVYEGKYRNQNVAIKIVQKGDTPEEIAKREG  78

Query  178  RFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALV  357
            RF REV +L+  +H N++KFI    EP M +VTE++ GGSL++++ +++P  +D + A+ 
Sbjct  79   RFNREVAMLSRVQHKNLVKFIGACKEPVMVVVTELLLGGSLRKYMLNLRPKPLDMRFAIG  138

Query  358  MALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AL I+ AM  LH +GIIHRDLKP N+ L+  +K
Sbjct  139  FALDIAEAMDCLHSHGIIHRDLKPENLLLTADQK  172



>ref|XP_002272486.1| PREDICTED: serine/threonine-protein kinase HT1 [Vitis vinifera]
 emb|CBI34850.3| unnamed protein product [Vitis vinifera]
Length=352

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+L+D   L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E RF REV
Sbjct  16   DAKWLVDPKLLFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHRGETPEEIAKREGRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D K A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNLRPRCLDTKVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILTADHK  163



>ref|XP_006338623.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
tuberosum]
Length=353

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 102/154 (66%), Gaps = 1/154 (1%)
 Frame = +1

Query  1    DDDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-  177
            +++ + E+K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E 
Sbjct  11   EEEFNLETKWLIDPKLLFVGPKIGEGAHAKVYEGKYRNQNVAIKIVHKGETPEEIAKRES  70

Query  178  RFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALV  357
            RF REV +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D   A+ 
Sbjct  71   RFGREVAMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPRCLDTGVAIR  130

Query  358  MALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AL I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  131  FALDIARAMECLHSHGIIHRDLKPENLLLTADHK  164



>ref|XP_006402173.1| hypothetical protein EUTSA_v10013975mg [Eutrema salsugineum]
 gb|ESQ43626.1| hypothetical protein EUTSA_v10013975mg [Eutrema salsugineum]
Length=350

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E K+ ID   L+ G +I +G    VY G Y +++VAIK+I   +  +E  +++ RFLREV
Sbjct  13   EPKWEIDPQLLFVGPKIGEGAHAKVYEGKYKNQTVAIKIIHRGETPEEIAKRDSRFLREV  72

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
            ++L+  +H N++KFI    EP M +VTE++ GG+L+++L +++PA ++ + A+  AL I+
Sbjct  73   EMLSRVQHKNLVKFIGACKEPVMVIVTELLQGGTLRKYLLNLRPACLETRVAIGFALDIA  132

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  133  RGMECLHSHGIIHRDLKPENLLLTADHK  160



>ref|NP_199829.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB09389.1| protein kinase ATN1-like protein [Arabidopsis thaliana]
 gb|AAO42867.1| At5g50180 [Arabidopsis thaliana]
 dbj|BAE99926.1| protein kinase ATN1-like protein [Arabidopsis thaliana]
 gb|AED95908.1| protein kinase family protein [Arabidopsis thaliana]
Length=346

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E K+ ID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +++ RFLREV
Sbjct  10   EPKWQIDPQLLFVGPKIGEGAHAKVYEGKYKNQTVAIKIVHRGETPEEIAKRDSRFLREV  69

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
            ++L+  +H N++KFI    EP M +VTE++ GG+L+++L +++PA ++ + A+  AL I+
Sbjct  70   EMLSRVQHKNLVKFIGACKEPVMVIVTELLQGGTLRKYLLNLRPACLETRVAIGFALDIA  129

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  130  RGMECLHSHGIIHRDLKPENLLLTADHK  157



>ref|XP_009415968.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=351

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+LID   L+ G +I +G    VY G Y +++VA+KV+      +E  +KE RF+REV
Sbjct  16   DPKWLIDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAVKVMHKGDTPEEVAKKEARFMREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +LA  +H N++KFI    EP M +VT+++ GGSL+++L +++P +++ + A+  AL I+
Sbjct  76   AMLARVQHKNLVKFIGACKEPVMVVVTDLLPGGSLRKYLVNLRPRSLEPRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+  ++
Sbjct  136  RAMECLHSHGIIHRDLKPENLLLTADQR  163



>gb|ABK06440.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=357

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E K+ ID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +++ RFLREV
Sbjct  10   EPKWQIDPQLLFVGPKIGEGAHAKVYEGKYKNQTVAIKIVHRGETPEEIAKRDSRFLREV  69

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
            ++L+  +H N++KFI    EP M +VTE++ GG+L+++L +++PA ++ + A+  AL I+
Sbjct  70   EMLSRVQHKNLVKFIGACKEPVMVIVTELLQGGTLRKYLLNLRPACLETRVAIGFALDIA  129

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  130  RGMECLHSHGIIHRDLKPENLLLTADHK  157



>ref|XP_006280738.1| hypothetical protein CARUB_v10026707mg [Capsella rubella]
 gb|EOA13636.1| hypothetical protein CARUB_v10026707mg [Capsella rubella]
Length=346

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E K+ ID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +++ RFLREV
Sbjct  10   EPKWQIDPQLLFVGPKIGEGAHAKVYEGKYKNQTVAIKIVHRGETPEEIAKRDSRFLREV  69

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
            ++L+  +H N++KFI    EP M +VTE++ GG+L+++L +++PA ++ + A+  AL I+
Sbjct  70   EMLSRVQHKNLVKFIGACKEPVMVIVTELLQGGTLRKYLLNLRPACLETRVAIGFALDIA  129

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  130  RGMECLHSHGIIHRDLKPENLLLTADHK  157



>ref|XP_002864043.1| hypothetical protein ARALYDRAFT_495075 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40302.1| hypothetical protein ARALYDRAFT_495075 [Arabidopsis lyrata subsp. 
lyrata]
Length=346

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E K+ ID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +++ RFLREV
Sbjct  10   EPKWQIDPQLLFVGPKIGEGAHAKVYEGKYKNQTVAIKIVHRGETPEEIAKRDSRFLREV  69

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
            ++L+  +H N++KFI    EP M +VTE++ GG+L+++L +++PA ++ + A+  AL I+
Sbjct  70   EMLSRVQHKNLVKFIGACKEPVMVIVTELLQGGTLRKYLLNLRPACLETRVAIGFALDIA  129

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  130  RGMECLHSHGIIHRDLKPENLLLTADHK  157



>ref|XP_002452377.1| hypothetical protein SORBIDRAFT_04g024680 [Sorghum bicolor]
 gb|EES05353.1| hypothetical protein SORBIDRAFT_04g024680 [Sorghum bicolor]
Length=352

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+LID   L+ G +I +G    VY G Y +++VAIK++      +E  +KE RFLREV
Sbjct  16   DPKWLIDPKLLFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMTKKEGRFLREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI   +EP M +VTE++ GGSL+++L  ++P +++ + A+  AL I+
Sbjct  76   TILSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRSLEPRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            +AM  LH +GIIHRDLKP N+ L+  ++
Sbjct  136  QAMECLHAHGIIHRDLKPQNLLLTADQR  163



>ref|XP_006291373.1| hypothetical protein CARUB_v10017518mg [Capsella rubella]
 gb|EOA24271.1| hypothetical protein CARUB_v10017518mg [Capsella rubella]
Length=357

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y +++VAIK+I+  +  +E  +++ RF RE+
Sbjct  16   DPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDNRFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKLLDIRLAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ LSE  K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILSEDHK  163



>ref|XP_010441670.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
 ref|XP_010482325.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=338

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E K+ ID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +++ RFLREV
Sbjct  2    EHKWQIDPQLLFVGPKIGEGAHAKVYEGKYKNQTVAIKIVHRGETPEEIAKRDSRFLREV  61

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
            ++L+  +H N++KFI    EP M +VTE++ GG+L+++L +++PA ++ + A+  AL I+
Sbjct  62   EMLSRVQHKNLVKFIGACKEPVMVIVTELLQGGTLRKYLLNLRPACLETRVAIGFALDIA  121

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  122  RGMECLHSHGIIHRDLKPENLLLTADHK  149



>ref|XP_011097383.1| PREDICTED: serine/threonine-protein kinase HT1-like [Sesamum 
indicum]
Length=352

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E RF REV
Sbjct  16   DPKWLVDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAIKIVHRGETPEEIAKREARFGREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +I+P  +D + A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNIRPRCLDMRVAIGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLLLTADHK  163



>ref|XP_002280504.1| PREDICTED: serine/threonine-protein kinase HT1 [Vitis vinifera]
 ref|XP_010663094.1| PREDICTED: serine/threonine-protein kinase HT1 [Vitis vinifera]
 ref|XP_010663095.1| PREDICTED: serine/threonine-protein kinase HT1 [Vitis vinifera]
 emb|CAN63533.1| hypothetical protein VITISV_011081 [Vitis vinifera]
 emb|CBI14949.3| unnamed protein product [Vitis vinifera]
Length=352

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 99/153 (65%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   + K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E R
Sbjct  11   DEFHLDPKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHRGETPEEITKREAR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N+ KFI    EP M +VTE++ GG+L+++L +++P  +D + A+  
Sbjct  71   FAREVSMLSRVQHKNLAKFIGVCKEPVMVIVTELLLGGTLRKYLLNMRPRCLDARIAVGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLILTADHK  163



>ref|XP_008676838.1| PREDICTED: uncharacterized protein LOC100273702 isoform X1 [Zea 
mays]
 ref|XP_008676839.1| PREDICTED: uncharacterized protein LOC100273702 isoform X1 [Zea 
mays]
 gb|ACN27590.1| unknown [Zea mays]
 gb|ACR35745.1| unknown [Zea mays]
 gb|AFW62809.1| putative protein kinase superfamily protein [Zea mays]
Length=353

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+ ID   L+ G +I +G    VY G Y +++VAIK++      +E  ++E RFLREV
Sbjct  16   DPKWFIDPKLLFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMTKREGRFLREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI   +EP M +VTE++ GGSL+++L  ++P +++ + A+  AL I+
Sbjct  76   TMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRSLEPRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+  ++
Sbjct  136  RAMECLHAHGIIHRDLKPENLLLTADQR  163



>gb|AES94911.2| tyrosine kinase family protein [Medicago truncatula]
Length=413

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 97/150 (65%), Gaps = 3/150 (2%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ--KERFL  186
            D     L+D  +L  G +I +G  ++VY G Y +  VAIKVI  EK  D +P+  K  F 
Sbjct  31   DIHPSLLVDCRKLIIGEKIGEGGYSSVYKGWYENCPVAIKVILPEKTNDATPEECKASFQ  90

Query  187  REVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMAL  366
            +EV LL+  +H+N++KFI  SVEP M ++TE++ GGSL +++  I P T   +  L  AL
Sbjct  91   KEVNLLSRIQHENVIKFIGASVEPMM-IITELLEGGSLYKNMKRIHPITFSLEQCLSYAL  149

Query  367  QISRAMAYLHENGIIHRDLKPNNIFLSESK  456
             IS+AM YLH NGIIHRDLKP+N+ L+++ 
Sbjct  150  DISQAMEYLHANGIIHRDLKPDNLLLTKNN  179



>ref|XP_007209302.1| hypothetical protein PRUPE_ppa007843mg [Prunus persica]
 gb|EMJ10501.1| hypothetical protein PRUPE_ppa007843mg [Prunus persica]
Length=354

 Score =   129 bits (323),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID   L+ G +I +G    VY G Y +++VAIKV+   +  +E  ++E RF REV
Sbjct  18   DAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKVVHRGETPEEIAKREGRFAREV  77

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++  +++P  +D + A+  AL I+
Sbjct  78   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYCLNMRPRCLDIRVAVGFALDIA  137

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  138  RAMECLHSHGIIHRDLKPENLLLTADHK  165



>ref|XP_003563810.1| PREDICTED: serine/threonine-protein kinase HT1 [Brachypodium 
distachyon]
Length=383

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 94/146 (64%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            K L+D   ++ G +I +G    VY G Y DK VAIKV+ +    +E    E RF+REV +
Sbjct  50   KLLVDPKMMFVGSKIGEGAHGKVYKGKYGDKIVAIKVLNSGSTPEERATLEARFIREVNM  109

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            +   KHDN++KFI    EP M +V+E++ G SL+ +L  I+P+ +D   A+  AL I+RA
Sbjct  110  MCRVKHDNLVKFIGACKEPLMVIVSELLPGMSLKNYLNSIRPSQLDIHTAIGYALNIARA  169

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            +  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  170  LECLHANGIIHRDLKPDNLLLTANRK  195



>ref|XP_008239332.1| PREDICTED: serine/threonine-protein kinase HT1 [Prunus mume]
 ref|XP_008239333.1| PREDICTED: serine/threonine-protein kinase HT1 [Prunus mume]
Length=354

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID   L+ G +I +G    VY G Y +++VAIKV+   +  +E  ++E RF REV
Sbjct  18   DAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKVVHRGETPEEIAKREGRFAREV  77

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++  +++P  +D + A+  AL I+
Sbjct  78   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYCLNMRPRCLDIRVAVGFALDIA  137

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  138  RAMECLHSHGIIHRDLKPENLLLTADHK  165



>ref|XP_006405481.1| hypothetical protein EUTSA_v10027816mg [Eutrema salsugineum]
 gb|ESQ46934.1| hypothetical protein EUTSA_v10027816mg [Eutrema salsugineum]
Length=356

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K++ID   L+ G +I +G    +Y G Y +K+VAIK+++  +  +E  ++E RF REV
Sbjct  16   DPKWVIDPQHLFVGPKIGEGAHAKIYEGKYKNKTVAIKIVKRGESPEEIAKRESRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   SMLSRVQHKNLVKFIGACKEPIMVIVTELLQGGTLRKYLVSLRPGRLDTRLAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILTADYK  163



>gb|KFK26651.1| hypothetical protein AALP_AA8G275800 [Arabis alpina]
Length=349

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E+K+ ID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +++ RFLREV
Sbjct  13   ETKWQIDPQLLFVGPKIGEGAHAKVYEGKYKNQTVAIKIVHRGETPEEIAKRDSRFLREV  72

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
            ++L+  +H N++KF+    EP M +VTE++ GG+L+++L +++PA ++ + A+  AL I+
Sbjct  73   EMLSRVQHKNLVKFLGACKEPVMVIVTELLQGGTLRKYLLNLRPACLETRMAIGFALDIA  132

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  133  RGMECLHSHGIIHRDLKPENLLLTADHK  160



>ref|XP_009333942.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=352

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 100/153 (65%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+LID   L+ G +I +G    VY G Y +++VAIKV+   +  +E  +KE R
Sbjct  11   DEFRLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKVVHRGETPEEIIKKEGR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP M +VTE++ GG+L+++  +++P  +D + A+  
Sbjct  71   FAREVAMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYCLNMRPRCLDIRVAVGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTADHK  163



>ref|XP_007204166.1| hypothetical protein PRUPE_ppa017499mg, partial [Prunus persica]
 gb|EMJ05365.1| hypothetical protein PRUPE_ppa017499mg, partial [Prunus persica]
Length=301

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = +1

Query  121  VAIKVIETEKGTDESPQKERFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSL  300
            VA+K+IE  K + E   KE+F REV LLA  KHDNI+KFI    EP++ ++TE+M GG++
Sbjct  3    VAVKIIEPTKESTE--LKEKFQREVILLAKVKHDNIVKFIGACFEPSLMILTELMRGGTV  60

Query  301  QRHLWHIKPATMDRKDALVMALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            Q+HL +I+P T+D K ++  AL ISRAM YLH NGIIHRDLKP N+ L+E  K
Sbjct  61   QKHLRNIRPQTLDLKLSISFALDISRAMEYLHANGIIHRDLKPANLLLTEDMK  113



>ref|XP_002877059.1| hypothetical protein ARALYDRAFT_484546 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53318.1| hypothetical protein ARALYDRAFT_484546 [Arabidopsis lyrata subsp. 
lyrata]
Length=357

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 102/154 (66%), Gaps = 1/154 (1%)
 Frame = +1

Query  1    DDDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-  177
            ++D + + K+L+D   L+ G +I +G    VY G Y +++VAIK+I+  +  +E  +++ 
Sbjct  10   NEDFELDPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDN  69

Query  178  RFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALV  357
            RF RE+ +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+ 
Sbjct  70   RFAREIAMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVG  129

Query  358  MALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AL I+RAM  LH +GIIHRDLKP N+ LS   K
Sbjct  130  FALDIARAMECLHSHGIIHRDLKPENLILSADHK  163



>ref|XP_002323793.1| hypothetical protein POPTR_0017s10510g [Populus trichocarpa]
 gb|EEF03926.1| hypothetical protein POPTR_0017s10510g [Populus trichocarpa]
Length=351

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 101/154 (66%), Gaps = 1/154 (1%)
 Frame = +1

Query  1    DDDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-  177
             ++ D ++K+LID   L+ G +I +G    VY G Y ++ VAIK++   +  +E  ++E 
Sbjct  9    SEEFDLDAKWLIDPKLLFVGPKIGEGAHAKVYEGKYKNQIVAIKIVHGGETPEEIAKREA  68

Query  178  RFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALV  357
            RF REV +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D + A+ 
Sbjct  69   RFAREVAMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPRCLDMRLAVG  128

Query  358  MALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AL I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  129  FALDIARAMECLHSHGIIHRDLKPENLILTADHK  162



>ref|XP_006650784.1| PREDICTED: serine/threonine-protein kinase HT1-like [Oryza brachyantha]
Length=352

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+LID   L+ G +I +G    VY G Y +++VAIK++      +E  ++E RFLREV
Sbjct  16   DPKWLIDPKLLFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMVKREGRFLREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI   ++P M +VTE++ GGSL+++L  ++P +++ + A+  AL I+
Sbjct  76   TMLSRVQHKNLVKFIGACLQPVMVVVTELLVGGSLRKYLVGLRPRSLEPRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+  ++
Sbjct  136  RAMECLHAHGIIHRDLKPENLLLTADQR  163



>ref|XP_008348177.1| PREDICTED: probable serine/threonine-protein kinase WNK3 [Malus 
domestica]
Length=445

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 101/152 (66%), Gaps = 1/152 (1%)
 Frame = +1

Query  7    DDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RF  183
            D D ++K+LID   L+ G +I +G    VY G Y +++VA+K++   +  ++  ++E RF
Sbjct  12   DFDLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQNVAVKIVHRGETPEQIAKREARF  71

Query  184  LREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMA  363
             REV +++  +H N++KFI    EP M +VTE++ GG+L+++L+ ++P  +D   A+  A
Sbjct  72   AREVAMMSKVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLFSMRPRCLDTCVAVGFA  131

Query  364  LQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            L I+RAM  LH +GIIHRDLKP N+ L+  +K
Sbjct  132  LDIARAMECLHSHGIIHRDLKPENLILTADQK  163



>ref|XP_003611953.1| Serine/threonine protein kinase [Medicago truncatula]
Length=453

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 97/149 (65%), Gaps = 3/149 (2%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ--KERFL  186
            D     L+D  +L  G +I +G  ++VY G Y +  VAIKVI  EK  D +P+  K  F 
Sbjct  31   DIHPSLLVDCRKLIIGEKIGEGGYSSVYKGWYENCPVAIKVILPEKTNDATPEECKASFQ  90

Query  187  REVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMAL  366
            +EV LL+  +H+N++KFI  SVEP M ++TE++ GGSL +++  I P T   +  L  AL
Sbjct  91   KEVNLLSRIQHENVIKFIGASVEPMM-IITELLEGGSLYKNMKRIHPITFSLEQCLSYAL  149

Query  367  QISRAMAYLHENGIIHRDLKPNNIFLSES  453
             IS+AM YLH NGIIHRDLKP+N+ L+++
Sbjct  150  DISQAMEYLHANGIIHRDLKPDNLLLTKN  178



>ref|XP_008230523.1| PREDICTED: serine/threonine-protein kinase HT1-like [Prunus mume]
Length=352

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 100/152 (66%), Gaps = 1/152 (1%)
 Frame = +1

Query  7    DDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RF  183
            D + ++K+LID   L+ G +I +G    VY G Y +++VA+K++   +  +E  ++E RF
Sbjct  12   DFNLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAVKIVHRGETPEEIAKRESRF  71

Query  184  LREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMA  363
             REV +L+  +H N++KFI    EP M +VTE++ GG+L+++L+ ++P  +D   A+  A
Sbjct  72   AREVAMLSKVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLFSMRPRCLDICVAVGFA  131

Query  364  LQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            L I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  132  LDIARAMECLHCHGIIHRDLKPENLILTADHK  163



>ref|XP_009134046.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
 ref|XP_009134047.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
 emb|CDY64638.1| BnaA03g57020D [Brassica napus]
 emb|CDY34048.1| BnaC03g27670D [Brassica napus]
Length=351

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E K+ ID   L+ G +I +G    VY G Y +++VAIK+I   +  +E  +++ RFLREV
Sbjct  13   EPKWEIDPQLLFVGPKIGEGAHAKVYEGKYKNQTVAIKIIHRGETPEEIAKRDSRFLREV  72

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
            ++L+  +H N++KFI    EP M +VTE++ GG+L+++L +++PA ++   A+  AL I+
Sbjct  73   EMLSRVQHKNLVKFIGACKEPVMVIVTELLQGGTLRKYLVNLRPACLETPVAIGFALDIA  132

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  133  RGMECLHSHGIIHRDLKPENLLLTADHK  160



>ref|XP_009595618.1| PREDICTED: serine/threonine-protein kinase HT1 [Nicotiana tomentosiformis]
Length=369

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 96/146 (66%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLREVKL  201
            + L+D  +L+ G +I +G    VY G Y D+ VAIKV+   K ++E      RF+REV +
Sbjct  45   RVLVDPKQLFIGTKIGEGAHGKVYEGRYGDQIVAIKVLNGGKTSEERASLGSRFVREVVM  104

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            ++  KH+N++KFI    +P M +VTE++ G SL+++L  I+P  +D   AL  AL I+RA
Sbjct  105  MSRVKHENLVKFIGACKDPLMVIVTELLPGMSLRKYLVSIRPKVLDLHVALNYALDIARA  164

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  165  MECLHANGIIHRDLKPDNLLLTANQK  190



>ref|XP_009151944.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
 ref|XP_009151945.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
Length=356

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y +++VAIK+I+  +  +E  +++ RF RE+
Sbjct  16   DPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDSRFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVAFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ LS   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILSADHK  163



>emb|CDY13723.1| BnaA06g32000D [Brassica napus]
Length=356

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y +++VAIK+I+  +  +E  +++ RF RE+
Sbjct  16   DPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDSRFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVAFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ LS   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILSADHK  163



>gb|AHL77719.1| mitogen activated kinase kinase kinase Raf41 [Brassica napus]
Length=356

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y +++VAIK+I+  +  +E  +++ RF RE+
Sbjct  16   DPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDSRFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVAFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ LS   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILSADHK  163



>emb|CDX83708.1| BnaC07g24480D [Brassica napus]
Length=364

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y +++VAIK+I+  +  +E  +++ RF RE+
Sbjct  16   DPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDSRFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVAFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ LS   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILSADHK  163



>emb|CDP02051.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 95/147 (65%), Gaps = 0/147 (0%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKERFLREVK  198
            + K+LID   L+ G +I +G    VY G Y +++VAIKV + E   + + +  RF REV 
Sbjct  14   DPKWLIDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAIKVHKGETPEEIAKRDARFAREVA  73

Query  199  LLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISR  378
            +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D   A+  AL I+R
Sbjct  74   MLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLDLRPRCLDTHVAMGFALDIAR  133

Query  379  AMAYLHENGIIHRDLKPNNIFLSESKK  459
            AM  LH +GIIHRDLKP N+ L+  +K
Sbjct  134  AMECLHSHGIIHRDLKPENLLLTADRK  160



>gb|AGA37226.1| mitogen-activated protein kinase kinase kinase Raf34.1 [Brassica 
napus]
Length=352

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E K+ ID   L+ G +I +G    VY G Y +++VAIK+I   +  +E  +++ RFLREV
Sbjct  14   EPKWEIDPQLLFVGPKIGEGAHAKVYEGKYKNQTVAIKIIHRGETPEEIAKRDSRFLREV  73

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
            ++L+  +H N++KFI    EP M +VTE++ GG+L+++L +++PA ++   A+  AL I+
Sbjct  74   EMLSRVQHKNLVKFIGACKEPVMVIVTELLQGGTLRKYLVNLRPACLETPVAIGFALDIA  133

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  134  RGMECLHSHGIIHRDLKPENLLLTADHK  161



>ref|XP_007215617.1| hypothetical protein PRUPE_ppa007898mg [Prunus persica]
 gb|EMJ16816.1| hypothetical protein PRUPE_ppa007898mg [Prunus persica]
Length=352

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 100/152 (66%), Gaps = 1/152 (1%)
 Frame = +1

Query  7    DDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RF  183
            D + ++K+LID   L+ G +I +G    VY G Y +++VA+K++   +  +E  ++E RF
Sbjct  12   DFNLDAKWLIDPKLLFVGPRIGEGAHAKVYEGKYKNQTVAVKIVHRGETPEEIAKRESRF  71

Query  184  LREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMA  363
             REV +L+  +H N++KFI    EP M +VTE++ GG+L+++L+ ++P  +D   A+  A
Sbjct  72   AREVAMLSKVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLFSMRPRCLDICVAVGFA  131

Query  364  LQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            L I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  132  LDIARAMECLHSHGIIHRDLKPENLILTADHK  163



>ref|XP_009762849.1| PREDICTED: serine/threonine-protein kinase HT1 [Nicotiana sylvestris]
Length=371

 Score =   128 bits (321),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 97/146 (66%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERFLREVKL  201
            + L+D  +L+ G +I +G    VY G Y D+ VAIKV+   K ++E +    RF+REV +
Sbjct  45   RVLVDPKQLFIGTKIGEGAHGKVYEGRYGDQIVAIKVLNGGKTSEERASLGSRFVREVVM  104

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            ++  KH+N++KFI    +P M +VTE++ G SL+++L  I+P  +D   AL  AL I+RA
Sbjct  105  MSRVKHENLVKFIGACKDPLMVIVTELLPGMSLRKYLVSIRPEVLDLHVALNYALDIARA  164

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  165  MECLHANGIIHRDLKPDNLLLTANQK  190



>ref|XP_001765647.1| predicted protein [Physcomitrella patens]
 gb|EDQ69486.1| predicted protein [Physcomitrella patens]
Length=326

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIE-TEKGTDESPQKERFLREV  195
            E +FLI+   L+ G +I +G    VY G Y+D+ VA+K+++ TE   D +     F+REV
Sbjct  14   EERFLINPKLLFVGPKIGEGAHGKVYEGKYLDQKVAVKILQPTENPDDHAKMVAGFVREV  73

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +LA  +H N++KF+   +EP M +VTE+M G SL++++  ++P  +D + ++  AL I+
Sbjct  74   AMLARVEHRNLVKFVGACMEPVMVIVTELMEGRSLKKYMLALRPTLLDLRCSVKFALDIA  133

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            +AM  LH NGIIHRDLKP+N+ L+   K
Sbjct  134  QAMDCLHVNGIIHRDLKPDNLLLTADHK  161



>gb|KDP31029.1| hypothetical protein JCGZ_11405 [Jatropha curcas]
Length=352

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 101/153 (66%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   E+K+L+D   L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E R
Sbjct  11   DEFKLEAKWLVDPKHLFVGPRIGEGAHAIVYEGKYKNQTVAIKIVHRGETPEEITKRELR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  ++ + A+  
Sbjct  71   FAREVAMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNLRPRCLETRLAIGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+R++  LH +GIIHRDLKP N+ L+   K
Sbjct  131  ALDIARSIECLHSHGIIHRDLKPENLLLTADHK  163



>ref|XP_006429562.1| hypothetical protein CICLE_v10011970mg [Citrus clementina]
 gb|ESR42802.1| hypothetical protein CICLE_v10011970mg [Citrus clementina]
Length=290

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 93/145 (64%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y D+ VAIKV+     +DE    E RF+REV ++
Sbjct  53   LLVDPKLLFIGSKIGEGAHGKVYEGRYGDRIVAIKVLNRGSTSDERALLEDRFIREVNMM  112

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KHDN++KF+    +P M +VTE++ G SL+++L  ++P  +D   AL  AL I+RAM
Sbjct  113  SRVKHDNLVKFLGACKDPLMVIVTELLPGMSLRKYLVSLRPNKLDLHVALNFALDIARAM  172

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+  +K
Sbjct  173  DCLHANGIIHRDLKPDNLLLTPDQK  197



>ref|XP_009362939.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
 ref|XP_009362940.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=352

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 100/153 (65%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+LID   L+ G +I +G    VY G Y +++VAIKV+   +  +E  +KE R
Sbjct  11   DEFRLDAKWLIDPKHLFVGPRIGEGAHAKVYEGKYKNQTVAIKVVHRGETPEEIIKKEGR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F REV +L+  +H N++KFI    EP + +VTE++ GG+L+++  +++P  +D + A+  
Sbjct  71   FAREVAMLSRVQHKNLVKFIGACKEPVLVIVTELLLGGTLRKYCLNMRPRCLDIRVAVGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTADHK  163



>ref|XP_010929905.1| PREDICTED: serine/threonine-protein kinase HT1-like [Elaeis guineensis]
Length=352

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 103/153 (67%), Gaps = 1/153 (1%)
 Frame = +1

Query  4    DDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-R  180
            D+   ++K+ ID   L+ G +I +G    VY G Y +++VA+K++      +E+ ++E R
Sbjct  11   DEHRIDAKWFIDPKLLFVGPRIGEGAHAKVYEGKYKNQNVAVKIVHRGDTPEEAAKREAR  70

Query  181  FLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVM  360
            F+REV +L+  +H N+++FI    EP M +VTE++ GGSL++++ +++P +++ + A+  
Sbjct  71   FMREVAMLSRVQHKNLVQFIGACKEPVMVVVTELLLGGSLRKYMLNMRPRSLEPRVAVGF  130

Query  361  ALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            AL I+RAM  LH +GIIHRDLKP N+ L+  ++
Sbjct  131  ALDIARAMECLHSHGIIHRDLKPENLLLTADQR  163



>ref|XP_004489198.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cicer arietinum]
Length=352

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 98/144 (68%), Gaps = 1/144 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+L+D   L+ G +I +G    VY G Y +++VA+K+I   +  +E  ++E RF REV
Sbjct  16   DAKWLVDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAVKIINKGETPEEISRREARFGREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLSMRPKCLDMRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLS  447
            RAM  LH +GIIHRDLKP+N+ L+
Sbjct  136  RAMECLHSHGIIHRDLKPDNLILT  159



>ref|XP_008458814.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Cucumis melo]
Length=353

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 98/150 (65%), Gaps = 1/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLR  189
            D ++K+L+D  ++  G +I +G    V+ G Y D++VAIK+I   +  +E  + E RF R
Sbjct  13   DLDAKWLVDPKQILVGPRIGEGAHGKVHKGKYKDQNVAIKIIRKGETPEEITKTEARFAR  72

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV +L+  +H N+ KFI    EP M +VTE+++GG+L+++L  I+P  +D  +A+  AL 
Sbjct  73   EVAMLSKVQHKNLAKFIGACKEPIMVIVTELLSGGTLRKYLLSIRPRCLDFSEAVGFALD  132

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  133  IARAMDCLHSHGIIHRDLKPENLILTADHK  162



>ref|XP_006470227.1| PREDICTED: serine/threonine-protein kinase HT1-like [Citrus sinensis]
Length=352

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 100/154 (65%), Gaps = 1/154 (1%)
 Frame = +1

Query  1    DDDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-  177
            D +   +SK+L+D   L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E 
Sbjct  10   DGEFSLDSKWLVDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAIKIVNRGETPEEIAKREA  69

Query  178  RFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALV  357
            RF REV +++  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D   A+ 
Sbjct  70   RFAREVAMMSRVRHRNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPRCLDIHVAIG  129

Query  358  MALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AL I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  130  FALAIARAMECLHSHGIIHRDLKPENLILTADHK  163



>gb|KDO49680.1| hypothetical protein CISIN_1g017046mg [Citrus sinensis]
Length=290

 Score =   126 bits (316),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 93/145 (64%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y D+ VAIKV+     +DE    E RF+REV ++
Sbjct  53   LLVDPKLLFIGSKIGEGAHGKVYEGRYGDRIVAIKVLNRGSTSDERALLEGRFIREVNMM  112

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KHDN++KF+    +P M +VTE++ G SL+++L  ++P  +D   AL  AL I+RAM
Sbjct  113  SRVKHDNLVKFLGACKDPLMVIVTELLPGMSLRKYLVSLRPNKLDLHVALNFALDIARAM  172

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+  +K
Sbjct  173  DCLHANGIIHRDLKPDNLLLTPDQK  197



>ref|XP_011014032.1| PREDICTED: serine/threonine-protein kinase HT1-like [Populus 
euphratica]
 ref|XP_011014033.1| PREDICTED: serine/threonine-protein kinase HT1-like [Populus 
euphratica]
Length=351

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 100/154 (65%), Gaps = 1/154 (1%)
 Frame = +1

Query  1    DDDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-  177
             ++ D ++K+LID   L+ G +I +G    VY G Y ++ VAIK++   +  +E  ++E 
Sbjct  9    SEEFDLDAKWLIDPKLLFVGPKIGEGAHAKVYEGKYKNQIVAIKIVHGGETPEEIAKREA  68

Query  178  RFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALV  357
            RF REV +L   +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D + A+ 
Sbjct  69   RFAREVAMLYRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPRCLDMRLAVG  128

Query  358  MALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AL I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  129  FALDIARAMECLHSHGIIHRDLKPENLILTADHK  162



>ref|XP_006446620.1| hypothetical protein CICLE_v10015773mg [Citrus clementina]
 gb|ESR59860.1| hypothetical protein CICLE_v10015773mg [Citrus clementina]
Length=352

 Score =   127 bits (319),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            +SK+L+D   L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E RF REV
Sbjct  16   DSKWLVDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAIKIVNRGETPEEIAKREARFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D   A+  AL I+
Sbjct  76   AMMSRVRHRNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPRCLDIHVAIGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILTADHK  163



>ref|NP_001047304.1| Os02g0594100 [Oryza sativa Japonica Group]
 dbj|BAD16891.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF09218.1| Os02g0594100 [Oryza sativa Japonica Group]
 gb|EEC73514.1| hypothetical protein OsI_07888 [Oryza sativa Indica Group]
 gb|EEE57287.1| hypothetical protein OsJ_07350 [Oryza sativa Japonica Group]
Length=352

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+LID   L+ G +I +G    VY G Y +++VAIK++      +E  ++E RFLREV
Sbjct  16   DPKWLIDPKLLFVGPRIGEGAHAKVYEGKYKNQNVAIKIVHKGDTPEEMVKREGRFLREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI   +EP M +VTE++ GGSL+++L  ++P +++ + A+  AL I+
Sbjct  76   TMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVGLRPRSLEPRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH + IIHRDLKP N+ L+  ++
Sbjct  136  RAMECLHAHAIIHRDLKPENLLLTADQR  163



>ref|XP_010558404.1| PREDICTED: serine/threonine-protein kinase HT1 [Tarenaya hassleriana]
Length=360

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 98/149 (66%), Gaps = 2/149 (1%)
 Frame = +1

Query  16   DESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERFLRE  192
            DES  L+D   L+ G +I +G    VY G Y ++ VAIKV+      +E S  + RF+RE
Sbjct  30   DES-LLVDPKMLFIGSKIGEGAHGKVYQGRYGNQIVAIKVLHRGNNPEEKSALESRFIRE  88

Query  193  VKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQI  372
            V +++  KH+N+++FI    +P M +VTE++ G SL+++L  I+P  +D + AL  AL I
Sbjct  89   VNMMSRVKHENLVQFIGACKDPLMVIVTELLPGMSLRKYLVSIRPRVLDIRVALSFALDI  148

Query  373  SRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            +RAM  LH NGIIHRDLKP+N+ L+E+ K
Sbjct  149  ARAMDCLHANGIIHRDLKPDNLLLTENHK  177



>gb|ABK06438.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=367

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y +++VAIK+I+  +  +E  +++ RF RE+
Sbjct  16   DPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDNRFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ LS   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILSADHK  163



>ref|XP_010027251.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X2 [Eucalyptus 
grandis]
Length=318

 Score =   126 bits (317),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 97/144 (67%), Gaps = 1/144 (1%)
 Frame = +1

Query  1    DDDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-  177
            +DD   ++K+LID   L+ G +I +G    VY G Y +++VAIK+I   +  +E  ++E 
Sbjct  10   NDDFRMDAKWLIDAKNLFVGPRIGEGAHAKVYEGKYKNQTVAIKIIHKGETPEEIAKREA  69

Query  178  RFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALV  357
            RF REV +L+  +H N++KFI    EP M +VTE+++GG+L+++L +I+P  ++   A+ 
Sbjct  70   RFAREVAMLSRVQHKNLVKFIGACKEPIMVIVTELLSGGTLRKYLLNIRPRCLETWVAIG  129

Query  358  MALQISRAMAYLHENGIIHRDLKP  429
             AL I+RAM  LH +GIIHRDLKP
Sbjct  130  FALDIARAMECLHSHGIIHRDLKP  153



>emb|CDY36362.1| BnaC04g32700D [Brassica napus]
Length=349

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 99/151 (66%), Gaps = 1/151 (1%)
 Frame = +1

Query  10   DDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFL  186
            D  + K+++D   L+ G +I +G    +Y G Y +K+VAIK+I+  +  +E  +++ RF 
Sbjct  10   DQLDPKWVVDPQHLFVGPKIGEGFHAKIYEGKYKNKTVAIKIIKKGESPEEIAKRDSRFA  69

Query  187  REVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMAL  366
            REV +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL
Sbjct  70   REVSMLSKVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLVSLRPGRLDIRLAVGFAL  129

Query  367  QISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  130  DIARAMECLHSHGIIHRDLKPENLILTADYK  160



>ref|XP_009140020.1| PREDICTED: serine/threonine-protein kinase HT1 [Brassica rapa]
Length=349

 Score =   127 bits (318),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 99/151 (66%), Gaps = 1/151 (1%)
 Frame = +1

Query  10   DDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFL  186
            D  + K+++D   L+ G +I +G    +Y G Y +K+VAIK+I+  +  +E  +++ RF 
Sbjct  10   DQLDPKWVVDPQHLFVGPKIGEGSHAKIYEGKYKNKTVAIKIIKKGESPEEIAKRDSRFA  69

Query  187  REVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMAL  366
            REV +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL
Sbjct  70   REVSMLSKVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLVSLRPGRLDIRLAVGFAL  129

Query  367  QISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  130  DIARAMECLHSHGIIHRDLKPENLILTSDYK  160



>gb|ACJ85360.1| unknown [Medicago truncatula]
Length=360

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            +   L+D   L+ G +I +G    VY G Y+D+ VAIKV++    ++E    E RF REV
Sbjct  35   DENLLVDPKLLFIGSKIGEGAHGKVYQGRYVDQIVAIKVLQRGTTSEERASLENRFAREV  94

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++   HDN++KFI    +P M +VTE++ G SL+++L  I+P  +D   A+  AL I+
Sbjct  95   NMMSRVHHDNLVKFIGACKDPLMVIVTELLPGMSLRKYLTSIRPKPLDIHVAINFALDIA  154

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM +LH+NGIIHRDLKP+N+ L+ ++K
Sbjct  155  RAMDWLHDNGIIHRDLKPDNLLLTANQK  182



>ref|XP_010502764.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=356

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y +++VAIK+I+  +  +E  +++ RF RE+
Sbjct  16   DPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDNRFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKLLDIRLAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ LS   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILSADHK  163



>ref|XP_010450650.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Camelina sativa]
Length=302

 Score =   126 bits (316),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+++D   L+ G +I +G    +Y G Y +K+VAIK+++  +  +E  ++E RF REV
Sbjct  16   DPKWVVDPQHLFVGPKIGEGAHAKIYEGKYKNKTVAIKIVKRGESPEEIAKRESRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N+++FI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   SMLSRVQHKNLVEFIGACKEPIMVIVTELLLGGTLRKYLVSLRPGRLDMRLAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +G+IHRDLKP N+ L+   K
Sbjct  136  RAMECLHSHGVIHRDLKPENLILTADYK  163



>ref|XP_003623576.1| Protein kinase, putative [Medicago truncatula]
 gb|AES79794.1| Serine/Threonine-kinase HT1-like protein [Medicago truncatula]
Length=363

 Score =   127 bits (319),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            +   L+D   L+ G +I +G    VY G Y+D+ VAIKV++    ++E    E RF REV
Sbjct  35   DENLLVDPKLLFIGSKIGEGAHGKVYQGRYVDQIVAIKVLQRGTTSEERASLENRFAREV  94

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++   HDN++KFI    +P M +VTE++ G SL+++L  I+P  +D   A+  AL I+
Sbjct  95   NMMSRVHHDNLVKFIGACKDPLMVIVTELLPGMSLRKYLTSIRPKPLDIHVAINFALDIA  154

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM +LH+NGIIHRDLKP+N+ L+ ++K
Sbjct  155  RAMDWLHDNGIIHRDLKPDNLLLTANQK  182



>ref|NP_189393.1| putative serine/threonine/tyrosine kinase ATN1 [Arabidopsis thaliana]
 dbj|BAB01286.1| nearly identical to protein kinase ATN1 [Arabidopsis thaliana]
 gb|AAL24170.1| AT3g27560/MMJ24_11 [Arabidopsis thaliana]
 gb|AAL90961.1| AT3g27560/MMJ24_11 [Arabidopsis thaliana]
 gb|AEE77337.1| putative serine/threonine/tyrosine kinase ATN1 [Arabidopsis thaliana]
Length=356

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y +++VAIK+I+  +  +E  +++ RF RE+
Sbjct  16   DPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDNRFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ LS   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILSADHK  163



>ref|XP_006650792.1| PREDICTED: serine/threonine-protein kinase HT1-like [Oryza brachyantha]
Length=383

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 94/148 (64%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K L+D   L+ G +I +G    VY G Y+D+ VAIKV+      +E    E RF+REV
Sbjct  49   DKKLLVDPKMLFIGSKIGEGAHGKVYKGKYVDQIVAIKVLNNGNTPEEKATFEARFIREV  108

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             ++   KHDN++KFI    EP M +V+E++ G SL+ +L  ++P+ +D   A+  AL I+
Sbjct  109  NMMCKVKHDNLVKFIGACKEPLMVIVSELLPGMSLKNYLNSLRPSQLDIHTAISYALDIA  168

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  169  HAMECLHANGIIHRDLKPDNLLLTANRK  196



>gb|AFK44948.1| unknown [Medicago truncatula]
Length=360

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            +   L+D   L+ G +I +G    VY G Y+D+ VAIKV++    ++E    E RF REV
Sbjct  35   DENLLVDPKLLFIGSKIGEGAHGKVYQGRYVDQIVAIKVLQRGTTSEERASLENRFAREV  94

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++   HDN++KFI    +P M +VTE++ G SL+++L  I+P  +D   A+  AL I+
Sbjct  95   NMMSRVHHDNLVKFIGACKDPLMVIVTELLPGMSLRKYLTSIRPKPLDIHVAINFALDIA  154

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM +LH+NGIIHRDLKP+N+ L+ ++K
Sbjct  155  RAMDWLHDNGIIHRDLKPDNLLLTANQK  182



>emb|CAA63387.1| protein kinase [Arabidopsis thaliana]
Length=356

 Score =   127 bits (318),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y +++VAIK+I+  +  +E  +++ RF RE+
Sbjct  16   DPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEIAKRDNRFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKRLDIRLAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ LS   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILSADHK  163



>ref|XP_009626244.1| PREDICTED: serine/threonine-protein kinase HT1, partial [Nicotiana 
tomentosiformis]
Length=153

 Score =   122 bits (306),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E+K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E RF REV
Sbjct  16   ETKWLIDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAIKIVHKGETPEEIAKREARFGREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D   A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLVNMRPRCLDTAVAIRFALDIA  135

Query  376  RAMAYLHENGIIHRDLKP  429
            R M  LH +GIIHRDLKP
Sbjct  136  RGMECLHSHGIIHRDLKP  153



>tpg|DAA52152.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=264

 Score =   125 bits (314),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 92/146 (63%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            K L+D   L+ G +I +G    VY G Y D+ VAIKV+      +E    E RF+REV +
Sbjct  80   KLLVDPKMLFVGDKIGEGAHGKVYKGKYGDQIVAIKVLNRGSTPEEKATLEARFIREVNM  139

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            +   KH+N++KFI    EP M +V+E++ G SL+ +L  I+P+ +D   A+  AL I+ A
Sbjct  140  MCKVKHENLVKFIGACKEPLMVIVSELLPGMSLKSYLHSIRPSQLDTHTAISYALDIAHA  199

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  200  MDCLHANGIIHRDLKPDNLLLTANRK  225



>emb|CDP06394.1| unnamed protein product [Coffea canephora]
Length=373

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 96/148 (65%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K L+D  +L+ G +I +G    VY G Y D+ VAIKV+     ++E    E RF REV
Sbjct  45   DQKVLVDPKQLFIGSKIGEGAHGKVYQGRYGDRIVAIKVLNHGNNSEERTALEGRFAREV  104

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  KH+N++KFI    +P M LVTE++ G SL+++L  I+P  +D   AL  AL I+
Sbjct  105  TMMSRVKHENLVKFIGACKDPLMVLVTELLPGMSLRKYLVSIRPKQLDLHVALNYALDIA  164

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH NGIIHRDLKP+N+ L+ +++
Sbjct  165  RAMDCLHANGIIHRDLKPDNLLLTANQQ  192



>ref|XP_010441203.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=353

 Score =   127 bits (318),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+++D   L+ G +I +G    +Y G Y +K+VAIK+++  +  +E  ++E RF REV
Sbjct  16   DPKWVVDPQHLFVGPKIGEGAHAKIYEGKYKNKTVAIKIVKRGESPEEIAKRESRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   SMLSRVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLVSLRPGRLDIRLAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +G+IHRDLKP N+ L+   K
Sbjct  136  RAMECLHSHGVIHRDLKPENLILTADYK  163



>ref|XP_009799112.1| PREDICTED: serine/threonine-protein kinase HT1 [Nicotiana sylvestris]
 ref|XP_009799113.1| PREDICTED: serine/threonine-protein kinase HT1 [Nicotiana sylvestris]
Length=352

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 96/148 (65%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E+K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E RF REV
Sbjct  16   ETKWLIDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAIKIVHKGETPEEIAKREARFGREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D   A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLVSMRPRCLDTAVAIRFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  136  RGMECLHSHGIIHRDLKPENLLLTADHK  163



>ref|XP_010442499.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=338

 Score =   126 bits (317),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E K+ ID   L+ G +I +G    VY G Y +++VAIK++   +  +E  +++ RFLREV
Sbjct  2    EHKWQIDPQLLFVGPKIGEGAHAKVYEGKYKNQTVAIKIVHRGETPEEIAKRDSRFLREV  61

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
            ++L+  +H N++KFI    EP   +VTE++ GG+L+++L +++PA ++ + A+  AL I+
Sbjct  62   EMLSRVQHKNLVKFIGACKEPVTVIVTELLQGGTLRKYLLNLRPACLETRVAIGFALDIA  121

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  122  RGMECLHSHGIIHRDLKPENLLLTADHK  149



>ref|XP_010922729.1| PREDICTED: serine/threonine-protein kinase HT1-like [Elaeis guineensis]
Length=379

 Score =   127 bits (318),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 96/150 (64%), Gaps = 1/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLR  189
            D + K LID   LY G +I +G    VY G Y ++ VAIKV+ +    +E    E RF+R
Sbjct  49   DIDEKLLIDPRLLYIGSKIGEGAHGKVYEGKYKEQIVAIKVLNSGNTPEEKATFEARFIR  108

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV +++  KH+N++KFI    +P M + +E++ G SL+++L  I+P  +D   A+  AL 
Sbjct  109  EVNMMSRVKHENLVKFIGACKDPIMVIASELLPGMSLKKYLLSIRPKQLDLHQAVSFALD  168

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            I+RAM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  169  IARAMDCLHANGIIHRDLKPDNLLLTANQK  198



>ref|XP_010514464.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=356

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y ++ VAIK+I++ +  +E  +++ RF RE+
Sbjct  16   DPKWLVDPRHLFVGPKIGEGAHAKVYEGKYRNQIVAIKIIKSGESPEEIAKRDNRFAREI  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   AMLSKVQHKNLVKFIGACKEPMMVIVTELLLGGTLRKYLVSLRPKLLDIRLAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ LS   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILSADHK  163



>ref|XP_002532865.1| protein kinase atn1, putative [Ricinus communis]
 gb|EEF29519.1| protein kinase atn1, putative [Ricinus communis]
Length=367

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 92/146 (63%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
              L+D   L+ G +I +G    VY G Y D+ VA+KV+      +E    E RF REV +
Sbjct  42   NLLVDPKLLFIGSKIGEGAHGKVYQGRYGDRIVAVKVLNRGSTCEERAALENRFAREVNM  101

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            ++  KHDN++KFI    EP M +VTE++ G SL+++L  I+P   D + AL  AL I+RA
Sbjct  102  MSRVKHDNLVKFIGACKEPLMVIVTELLPGMSLRKYLIGIRPNQPDLRLALNFALDIARA  161

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  162  MDCLHANGIIHRDLKPDNLLLTANQK  187



>ref|XP_004302569.1| PREDICTED: serine/threonine-protein kinase HT1-like [Fragaria 
vesca subsp. vesca]
Length=358

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 96/149 (64%), Gaps = 2/149 (1%)
 Frame = +1

Query  16   DESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLRE  192
            DES  L+D   L+ G +I +G    VY G Y ++ VAIKV+     ++E  Q E RF RE
Sbjct  29   DES-LLVDPKLLFIGAKIGEGAHGKVYQGRYGNRIVAIKVLNRGSTSEERAQLENRFARE  87

Query  193  VKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQI  372
            V ++   KH+N++KFI    +P M +VTE++ G SL+++L  I+P  +D   A+  AL I
Sbjct  88   VNMMTRVKHENLVKFIGACKDPLMVIVTELLPGMSLRKYLISIRPNPLDLHVAIKFALDI  147

Query  373  SRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            + AM  LH NGIIHRDLKP+N+ L+E++K
Sbjct  148  AHAMECLHANGIIHRDLKPDNLLLTENQK  176



>ref|XP_008798564.1| PREDICTED: serine/threonine-protein kinase HT1 [Phoenix dactylifera]
Length=379

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 95/150 (63%), Gaps = 1/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLR  189
            D + K LID   LY G +I +G    VY G Y ++ VAIKV+ +    +E    E RF+R
Sbjct  49   DIDEKLLIDPRLLYIGSKIGEGAHGKVYEGKYKEQIVAIKVLNSGNTPEEKATFEARFIR  108

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV +++  KH+N++KFI    +P M + TE++ G SL+++L  I+P   D   A+  AL 
Sbjct  109  EVNMMSRVKHENLVKFIGACKDPIMVIATELLPGMSLKKYLLSIRPKQPDLHQAVSFALD  168

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            I+RAM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  169  IARAMDCLHANGIIHRDLKPDNLLLTANQK  198



>gb|EAY92336.1| hypothetical protein OsI_14061 [Oryza sativa Indica Group]
Length=383

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 92/146 (63%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            K L+D   L+ G +I +G    VY G Y D+ VAIKV+      +E    E RF+REV +
Sbjct  51   KLLVDPKNLFIGSKIGEGAHGKVYKGKYGDQIVAIKVLNNGTTPEEKATLEARFIREVNM  110

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            +   KHDN++KFI    EP M +V+E++ G SL+ +L  ++P+ +D   A+  AL I+ A
Sbjct  111  MCKVKHDNLVKFIGACKEPLMVIVSELLPGMSLKNYLNSLRPSQLDIHTAIGYALDIAHA  170

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  171  MECLHANGIIHRDLKPDNLLLTANRK  196



>gb|EYU42008.1| hypothetical protein MIMGU_mgv1a008582mg [Erythranthe guttata]
Length=369

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            + L+D   ++ G +I +G    VY G Y D+ VAIKV+     ++E    E RF+REV +
Sbjct  44   RVLVDPKSIFIGSKIGEGAHGKVYQGRYGDRIVAIKVLTCGNTSEERTVLEGRFVREVAM  103

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            ++  KHDN++KFI    +P M +VTE++ G SL+++L  I+P  +D   AL  AL I+RA
Sbjct  104  MSRVKHDNLVKFIGACKDPLMVIVTELLHGMSLRKYLSSIRPNQLDLPVALDFALDIARA  163

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  164  MDCLHANGIIHRDLKPDNLLLTANQK  189



>gb|EMS59502.1| Serine/threonine-protein kinase HT1 [Triticum urartu]
Length=344

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 90/138 (65%), Gaps = 1/138 (1%)
 Frame = +1

Query  49   LYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLLAAAKHDN  225
            L+ G +I +G    VY G Y D+ VAIKV+ +    +E    E RF+REV ++   KHDN
Sbjct  2    LFVGSKIGEGAHGKVYKGKYGDQIVAIKVLNSGSTPEEKVTLEDRFIREVNMMCKVKHDN  61

Query  226  ILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAMAYLHENG  405
            ++KFI    EP M +V+E++ G SL+ +L  I+P+ +D   AL  AL I+RAM  LH NG
Sbjct  62   LVKFIGACKEPLMVIVSELLPGMSLKNYLNSIRPSQLDMHTALGYALNIARAMECLHANG  121

Query  406  IIHRDLKPNNIFLSESKK  459
            IIHRDLKP+N+ L+ ++K
Sbjct  122  IIHRDLKPDNLLLTANRK  139



>ref|NP_001051689.1| Os03g0816100 [Oryza sativa Japonica Group]
 gb|ABF99544.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13603.1| Os03g0816100 [Oryza sativa Japonica Group]
 dbj|BAG95983.1| unnamed protein product [Oryza sativa Japonica Group]
Length=286

 Score =   125 bits (313),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 93/148 (63%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K L+D   L+ G +I +G    VY G Y ++ VAIKV+      +E    E RF+REV
Sbjct  49   DKKLLVDPKNLFIGSKIGEGAHGKVYKGKYGEQIVAIKVLNNGTTPEEKATLEARFIREV  108

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             ++   KHDN++KFI    EP M +V+E++ G SL+ +L  ++P+ +D   A+  AL I+
Sbjct  109  NMMCKVKHDNLVKFIGACKEPLMVIVSELLPGMSLKNYLNSLRPSQLDIHTAIGYALDIA  168

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  169  HAMECLHANGIIHRDLKPDNLLLTANRK  196



>gb|KDP22773.1| hypothetical protein JCGZ_00360 [Jatropha curcas]
Length=382

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 98/149 (66%), Gaps = 2/149 (1%)
 Frame = +1

Query  16   DESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLRE  192
            DES  L+D   L+ G +I +G    VY G Y D+ VAIKV+     ++E    E RF RE
Sbjct  53   DES-LLVDPKLLFIGSKIGEGAHGKVYEGRYRDQIVAIKVLHRGSTSEERTALENRFARE  111

Query  193  VKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQI  372
            V +++  KH+N++KFI    +P M +VTE++ G SL+++L+ I+P  +D + AL  ++ I
Sbjct  112  VNMMSKVKHENLVKFIGACKDPLMVIVTELLPGMSLRKYLFSIRPKQLDLRVALKFSIDI  171

Query  373  SRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            +RAM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  172  ARAMDCLHANGIIHRDLKPDNLLLTANQK  200



>gb|KHN44504.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=389

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 94/147 (64%), Gaps = 5/147 (3%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVI---ETEKGTDESPQKERF  183
            D +   L+D  +L  G  I++   + VY G Y    V+IK++   +T   T +   K +F
Sbjct  27   DIDPSLLVDSRKLLIGELITEHSHSIVYHGWYEFNPVSIKLMLPMQTSHATSQC--KAKF  84

Query  184  LREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMA  363
             REV L++  KH NI+KFI  SVEP+M ++TE++ G SLQ++L  I P+T+  + ++  A
Sbjct  85   QREVNLISRVKHKNIIKFIGVSVEPSMMIITELLEGCSLQKYLESIYPSTLSLEQSISFA  144

Query  364  LQISRAMAYLHENGIIHRDLKPNNIFL  444
            + IS+ M YLHENGIIHRDLKP N+FL
Sbjct  145  MNISQVMEYLHENGIIHRDLKPGNLFL  171



>ref|XP_006429561.1| hypothetical protein CICLE_v10011970mg [Citrus clementina]
 ref|XP_006481177.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Citrus sinensis]
 ref|XP_006481178.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Citrus sinensis]
 gb|ESR42801.1| hypothetical protein CICLE_v10011970mg [Citrus clementina]
Length=378

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 93/145 (64%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y D+ VAIKV+     +DE    E RF+REV ++
Sbjct  53   LLVDPKLLFIGSKIGEGAHGKVYEGRYGDRIVAIKVLNRGSTSDERALLEDRFIREVNMM  112

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KHDN++KF+    +P M +VTE++ G SL+++L  ++P  +D   AL  AL I+RAM
Sbjct  113  SRVKHDNLVKFLGACKDPLMVIVTELLPGMSLRKYLVSLRPNKLDLHVALNFALDIARAM  172

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+  +K
Sbjct  173  DCLHANGIIHRDLKPDNLLLTPDQK  197



>gb|KDO49679.1| hypothetical protein CISIN_1g017046mg [Citrus sinensis]
Length=378

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 93/145 (64%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y D+ VAIKV+     +DE    E RF+REV ++
Sbjct  53   LLVDPKLLFIGSKIGEGAHGKVYEGRYGDRIVAIKVLNRGSTSDERALLEGRFIREVNMM  112

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KHDN++KF+    +P M +VTE++ G SL+++L  ++P  +D   AL  AL I+RAM
Sbjct  113  SRVKHDNLVKFLGACKDPLMVIVTELLPGMSLRKYLVSLRPNKLDLHVALNFALDIARAM  172

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+  +K
Sbjct  173  DCLHANGIIHRDLKPDNLLLTPDQK  197



>ref|XP_003575273.1| PREDICTED: serine/threonine-protein kinase HT1-like [Brachypodium 
distachyon]
 ref|XP_010235630.1| PREDICTED: serine/threonine-protein kinase HT1-like [Brachypodium 
distachyon]
Length=350

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 97/145 (67%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
            +LID   L+ G +I +G    VY G Y +++VAIK++      +E  +++ RFLREV +L
Sbjct  19   WLIDPKLLFVGPRIGEGGHAKVYEGKYKNQNVAIKIVHKGDTPEEVVKRQGRFLREVTML  78

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  +H N++KFI   +EP M +VTE++ GGSL+++L  ++P  ++ + A+  AL I+RAM
Sbjct  79   SRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRNLEPRTAVGFALDIARAM  138

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH +GIIHRDLKP N+ L+  ++
Sbjct  139  ECLHAHGIIHRDLKPENLLLTADQR  163



>ref|XP_010252080.1| PREDICTED: serine/threonine-protein kinase HT1 [Nelumbo nucifera]
Length=361

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 94/148 (64%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K LID   LY G +I +G    VY G Y D+ VAIKV+ +    +E    E RF REV
Sbjct  29   DEKLLIDPKLLYIGSKIGEGAHGKVYEGRYGDQIVAIKVLHSGNTPEERAALEGRFAREV  88

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             ++A  KH+N++KF+    +P M + TE++ G SL+++L  I+P  +D   A+  AL I+
Sbjct  89   NMMARVKHENLVKFVGACKDPLMVIATELLPGMSLRKYLTSIRPNQLDLCVAIGYALDIA  148

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  149  RAMDCLHANGIIHRDLKPDNLLLTANQK  176



>gb|EMT19707.1| Serine/threonine-protein kinase HT1 [Aegilops tauschii]
Length=328

 Score =   125 bits (313),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 90/138 (65%), Gaps = 1/138 (1%)
 Frame = +1

Query  49   LYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLLAAAKHDN  225
            L+ G +I +G    VY G Y D+ VAIKV+ +    +E    E RF+REV ++   KHDN
Sbjct  2    LFVGSKIGEGAHGKVYKGKYGDQIVAIKVLNSGSTPEEKVTLEDRFIREVNMMCKVKHDN  61

Query  226  ILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAMAYLHENG  405
            ++KFI    EP M +V+E++ G SL+ +L  I+P+ +D   AL  AL I+RAM  LH NG
Sbjct  62   LVKFIGACKEPLMVIVSELLPGMSLKNYLNSIRPSQLDIHTALGYALNIARAMECLHANG  121

Query  406  IIHRDLKPNNIFLSESKK  459
            IIHRDLKP+N+ L+ ++K
Sbjct  122  IIHRDLKPDNLLLTANRK  139



>gb|EYU34748.1| hypothetical protein MIMGU_mgv1a009136mg [Erythranthe guttata]
Length=352

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 96/148 (65%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+L+D   L+ G +I +G    VY G Y +++VAIK++      +E  ++E RF REV
Sbjct  16   DPKWLVDPKLLFVGPKIGEGAHAKVYEGKYRNQNVAIKIVHRGDTPEEITKREGRFGREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +D + A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNLRPRCLDMRVAIGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R M  LH +GIIHRDLKP N+ L+   K
Sbjct  136  RGMECLHSHGIIHRDLKPENLLLTADHK  163



>ref|XP_010450649.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Camelina sativa]
Length=355

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+++D   L+ G +I +G    +Y G Y +K+VAIK+++  +  +E  ++E RF REV
Sbjct  16   DPKWVVDPQHLFVGPKIGEGAHAKIYEGKYKNKTVAIKIVKRGESPEEIAKRESRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N+++FI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   SMLSRVQHKNLVEFIGACKEPIMVIVTELLLGGTLRKYLVSLRPGRLDMRLAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +G+IHRDLKP N+ L+   K
Sbjct  136  RAMECLHSHGVIHRDLKPENLILTADYK  163



>ref|XP_011003123.1| PREDICTED: serine/threonine-protein kinase HT1-like [Populus 
euphratica]
Length=351

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+L+D   L+ G +I +G    VY G Y +++VAIK++   +  +E  +++ RF REV
Sbjct  15   DAKWLVDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAIKIVNGGETPEEIAKRQARFAREV  74

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  ++ + A   AL I+
Sbjct  75   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPRCLEMRVAFGFALDIA  134

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  135  RAMECLHSHGIIHRDLKPENLILTADHK  162



>ref|XP_009420111.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009420112.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
Length=382

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 95/150 (63%), Gaps = 1/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLR  189
            D + K LID   LY G +I +G    VY G Y ++ VAIKV+      DE    + RF+R
Sbjct  49   DIDEKLLIDPKLLYIGAKIGEGAHGKVYEGKYHNQIVAIKVLNGGSTPDEKVTLQARFIR  108

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV +++  +H+N++KFI    +P M + TE++ G SL+++L  I+P  +D   A+  AL 
Sbjct  109  EVNMMSRVQHENLVKFIGACKDPFMVIATELLPGMSLKKYLSSIRPKQVDLHKAISFALD  168

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            I+RAM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  169  IARAMDCLHANGIIHRDLKPDNLLLTANQK  198



>ref|XP_002298549.1| kinase family protein [Populus trichocarpa]
 gb|EEE83354.1| kinase family protein [Populus trichocarpa]
Length=351

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+L+D   L+ G +I +G    VY G Y +++VAIK++   +  +E  +++ RF REV
Sbjct  15   DAKWLVDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAIKIVHGGETPEEIAKRQARFAREV  74

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  ++ + A   AL I+
Sbjct  75   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPRCLEMRVAFGFALDIA  134

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  135  RAMECLHSHGIIHRDLKPENLILTADHK  162



>emb|CDY42570.1| BnaA04g10430D [Brassica napus]
Length=349

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 98/151 (65%), Gaps = 1/151 (1%)
 Frame = +1

Query  10   DDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFL  186
            D  +  +++D   L+ G +I +G    +Y G Y +K+VAIK+I+  +  +E  +++ RF 
Sbjct  10   DQLDPNWVVDPQHLFVGPKIGEGSHAKIYEGKYKNKTVAIKIIKKGESPEEIAKRDSRFA  69

Query  187  REVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMAL  366
            REV +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL
Sbjct  70   REVSMLSKVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLVSLRPGRLDIRLAVGFAL  129

Query  367  QISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  130  DIARAMECLHSHGIIHRDLKPENLILTSDYK  160



>gb|KFK33099.1| hypothetical protein AALP_AA6G331100 [Arabis alpina]
Length=352

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+++D   L+ G +I +G    VY G Y +K+VAIK+++  +  +E  ++E RF REV
Sbjct  16   DPKWVVDPQHLFVGPKIGEGSHAKVYEGKYKNKTVAIKIVKRGESPEEIAKRESRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   SMLSRVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLVSLRPGRLDTRLAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +G+IHRDLKP ++ L+   K
Sbjct  136  RAMECLHSHGVIHRDLKPESLILTADYK  163



>dbj|BAJ93644.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=352

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            +  +LID   L+ G +I +G    VY G Y +++VAIK++      +E  +++ RFLREV
Sbjct  18   DPSWLIDPKLLFVGPRIGEGGHAKVYEGKYKNQNVAIKIVHKGDTPEEVVKRQGRFLREV  77

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI   +EP M +VTE++ GGSL+++L  ++P  ++ + A+  AL I+
Sbjct  78   TMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRNLEPRVAVGFALDIA  137

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+  ++
Sbjct  138  RAMECLHAHGIIHRDLKPENLLLTADQR  165



>ref|NP_198870.1| protein kinase family protein [Arabidopsis thaliana]
 dbj|BAB08524.1| protein kinase ATN1 [Arabidopsis thaliana]
 dbj|BAF01021.1| protein kinase like protein [Arabidopsis thaliana]
 gb|AED94561.1| protein kinase family protein [Arabidopsis thaliana]
Length=353

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+++D   L+ G +I +G    +Y G Y +K+VAIK+++  +  +E  ++E RF REV
Sbjct  16   DPKWVVDPQHLFVGPKIGEGAHAKIYEGKYKNKTVAIKIVKRGESPEEIAKRESRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P ++D + A+  AL I+
Sbjct  76   SMLSRVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLVSLRPGSLDIRVAVGYALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +G+IHRDLKP ++ L+   K
Sbjct  136  RAMECLHSHGVIHRDLKPESLILTADYK  163



>gb|ABK06439.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=364

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+++D   L+ G +I +G    +Y G Y +K+VAIK+++  +  +E  ++E RF REV
Sbjct  16   DPKWVVDPQHLFVGPKIGEGAHAKIYEGKYKNKTVAIKIVKRGESPEEIAKRESRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P ++D + A+  AL I+
Sbjct  76   SMLSRVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLVSLRPGSLDIRVAVGYALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +G+IHRDLKP ++ L+   K
Sbjct  136  RAMECLHSHGVIHRDLKPESLILTADYK  163



>gb|KDP46404.1| hypothetical protein JCGZ_10244 [Jatropha curcas]
Length=351

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 97/144 (67%), Gaps = 1/144 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID   L+ G +I +G    VY G Y +++VAIK++   +  +E  ++E RF REV
Sbjct  15   DAKWLIDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAIKLVHKGETPEEIAKREARFAREV  74

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  ++   A+  AL I+
Sbjct  75   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPRCLEMHVAIGFALDIA  134

Query  376  RAMAYLHENGIIHRDLKPNNIFLS  447
            RAM  LH +GIIHRDLKP N+ L+
Sbjct  135  RAMECLHSHGIIHRDLKPENLILT  158



>ref|XP_004981285.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Setaria italica]
 ref|XP_004981286.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Setaria italica]
 ref|XP_004981287.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X3 
[Setaria italica]
Length=424

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 93/148 (63%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            E K L+D   L+ G +I +G    VY G Y D+ VAIKV+      +E    E RF+REV
Sbjct  90   ERKLLVDPKMLFVGDKIGEGAHGKVYKGKYGDQIVAIKVLNRGSTPEEKATLEARFIREV  149

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             ++   KH+N++KFI    EP M +V+E++ G SL+ +L  I+P+ +D   A+  AL I+
Sbjct  150  NMMCKVKHENLVKFIGACKEPLMVIVSELLPGMSLKNYLNSIRPSQLDTHTAIGYALDIA  209

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  210  HAMDCLHANGIIHRDLKPDNLLLTANRK  237



>ref|XP_002872990.1| hypothetical protein ARALYDRAFT_324798 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49249.1| hypothetical protein ARALYDRAFT_324798 [Arabidopsis lyrata subsp. 
lyrata]
Length=337

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 96/149 (64%), Gaps = 2/149 (1%)
 Frame = +1

Query  16   DESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERFLRE  192
            DES  L+D   L+ G +I +G    VY G Y  + VAIKV+      DE S  + RF+RE
Sbjct  17   DES-LLVDPKLLFIGSKIGEGAHGKVYQGRYGSQIVAIKVLHRGTKPDEKSSLESRFIRE  75

Query  193  VKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQI  372
            V +++  +HDN++KFI    +P M +VTE++ G SL+++L  I+P  +  + AL  AL I
Sbjct  76   VNMMSRVQHDNLVKFIGACKDPLMVIVTELLPGMSLRKYLTSIRPHMLHLRIALSFALDI  135

Query  373  SRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            +RA+  LH NGIIHRDLKP+N+ L+E+ K
Sbjct  136  ARALDCLHANGIIHRDLKPDNLLLTENHK  164



>ref|XP_001778972.1| predicted protein [Physcomitrella patens]
 gb|EDQ56227.1| predicted protein [Physcomitrella patens]
Length=345

 Score =   124 bits (312),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLREV  195
            E +FLI+   L+ G +I +G    VY G Y+D+ VA+K+++  K  D+  +    F+REV
Sbjct  63   EDRFLINPKLLFVGPKIGEGAHGKVYEGKYLDQKVAVKILQPTKNPDDHAKLVAGFVREV  122

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +LA  +H N+++F+   +EP M +VTE+M G SL++++  ++P  +D + ++  AL I+
Sbjct  123  AMLARVEHRNLVRFVGACMEPVMVIVTELMEGRSLKKYMLTLRPNLLDLRCSVKFALDIA  182

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            +AM  LH NGIIHRDLKP+N+ L+   K
Sbjct  183  QAMECLHGNGIIHRDLKPDNLLLTADHK  210



>ref|XP_004246274.1| PREDICTED: serine/threonine-protein kinase HT1 [Solanum lycopersicum]
Length=370

 Score =   125 bits (313),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 97/146 (66%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERFLREVKL  201
            + L+D  +L+ G +I +G    VY G Y D+ VAIKV+     ++E S  + RF+REV +
Sbjct  44   RVLVDPKQLFIGTKIGEGAHGKVYEGRYGDQIVAIKVLNGGNTSEERSALEGRFVREVVM  103

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            ++  KH+N++KFI    +P M +V+E++ G SL+++L  I+P  +D   A+  AL I+RA
Sbjct  104  MSRVKHENLVKFIGACKDPLMVIVSELLPGMSLRKYLVSIRPNVLDLHVAINYALDIARA  163

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  164  MECLHANGIIHRDLKPDNLLLTANQK  189



>ref|XP_006842447.1| hypothetical protein AMTR_s00077p00052030 [Amborella trichopoda]
 gb|ERN04122.1| hypothetical protein AMTR_s00077p00052030 [Amborella trichopoda]
Length=361

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 95/148 (64%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + + LI+   L+ G +I +G    VY G Y +++VAIK++      +E  + E RF REV
Sbjct  34   DERLLINPNLLFVGSKIGEGAHGKVYAGKYGERTVAIKMLNCGNTPEERAKLEGRFAREV  93

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  +H+N++KFI    EP M + TE++ G SL+++L  I+P  +D   A+  AL I+
Sbjct  94   TMMSRVRHENLVKFIGACKEPHMVIATELLPGMSLKKYLMSIRPKQLDLHIAISFALDIA  153

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH NGIIHRDLKP+N+ L+E +K
Sbjct  154  RAMDCLHANGIIHRDLKPDNLLLTEDQK  181



>gb|AAO60020.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|ABF99545.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ29049.1| hypothetical protein OsJ_13102 [Oryza sativa Japonica Group]
Length=383

 Score =   125 bits (313),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 92/146 (63%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            K L+D   L+ G +I +G    VY G Y ++ VAIKV+      +E    E RF+REV +
Sbjct  51   KLLVDPKNLFIGSKIGEGAHGKVYKGKYGEQIVAIKVLNNGTTPEEKATLEARFIREVNM  110

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            +   KHDN++KFI    EP M +V+E++ G SL+ +L  ++P+ +D   A+  AL I+ A
Sbjct  111  MCKVKHDNLVKFIGACKEPLMVIVSELLPGMSLKNYLNSLRPSQLDIHTAIGYALDIAHA  170

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  171  MECLHANGIIHRDLKPDNLLLTANRK  196



>ref|XP_004141113.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 gb|KGN59713.1| hypothetical protein Csa_3G840390 [Cucumis sativus]
Length=352

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 98/152 (64%), Gaps = 9/152 (6%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQK-----ERF  183
            ++K+LID   L+ G +I +G    VY G Y ++ VAIK++    G  ++P++      RF
Sbjct  16   DAKWLIDPKHLFVGPKIGEGAHAKVYEGKYKNQIVAIKMV----GKGDTPERMARREARF  71

Query  184  LREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMA  363
             REV +L+  +H N++KFI    EP M +VTE++TGG+L++ L +++P +++   A+  A
Sbjct  72   AREVAMLSKVRHKNLVKFIGACKEPMMVIVTELLTGGTLRKFLLNLRPRSLELDVAIGFA  131

Query  364  LQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            L I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  132  LDIARAMECLHSHGIIHRDLKPENLILTADHK  163



>emb|CBI18047.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 93/145 (64%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   ++ G ++ +G    VY G Y D+ VAIKV+     ++E    E RF REV ++
Sbjct  11   LLVDPKLIFIGSKVGEGAHGKVYEGRYGDQIVAIKVLHRGSTSEERAALEGRFAREVNMM  70

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KH+N++KFI    +P M +VTE++ G SL+++L  I+P  MD   AL  AL I+RAM
Sbjct  71   SRVKHENLVKFIGACKDPLMVIVTELLPGMSLRKYLTSIRPKRMDIHVALSFALDIARAM  130

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+ ++K
Sbjct  131  ECLHANGIIHRDLKPDNLLLTANQK  155



>gb|KHG15965.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
 gb|KHG24380.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
Length=353

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 92/148 (62%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            +   LID   L+ G +I +G    VY G Y D+ VAIKV+      +E    E RF REV
Sbjct  27   DQNLLIDPKSLFIGSKIGEGAHGKVYEGRYGDRIVAIKVLHRGSTVEERAALESRFAREV  86

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  KH+N++KF     +P M +VTE++ G SL+++L  I+P  +D   AL  AL I+
Sbjct  87   NMMSRVKHENLVKFFGACKDPLMAIVTELLPGMSLRKYLISIRPKVLDPHVALNFALDIA  146

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH NGIIHRDLKP+N+ L+ +++
Sbjct  147  RAMDCLHANGIIHRDLKPDNLLLTANQR  174



>gb|AAP88291.1| protein kinase [Cucumis sativus]
Length=352

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 98/152 (64%), Gaps = 9/152 (6%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQK-----ERF  183
            ++K+LID   L+ G +I +G    VY G Y ++ VAIK++    G  ++P++      RF
Sbjct  16   DAKWLIDPKHLFVGPKIGEGAHAKVYEGKYKNQIVAIKMV----GKGDTPERMARREARF  71

Query  184  LREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMA  363
             REV +L+  +H N++KFI    EP M +VTE++TGG+L++ L +++P +++   A+  A
Sbjct  72   AREVAMLSKVRHKNLVKFIGACKEPMMVIVTELLTGGTLRKFLLNLRPRSLELDVAIGFA  131

Query  364  LQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            L I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  132  LDIARAMECLHSHGIIHRDLKPENLILTADHK  163



>ref|XP_002521481.1| protein kinase atn1, putative [Ricinus communis]
 gb|EEF40971.1| protein kinase atn1, putative [Ricinus communis]
Length=353

 Score =   124 bits (311),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID   L  G +I +G    VY G Y ++ VAIKV+   +  +E  ++E RF REV
Sbjct  16   DAKWLIDPKLLLVGPKIGEGAHAKVYEGKYKNRIVAIKVVHRGETPEEIAKREARFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P +++   A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNLRPRSLELHVAIGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILTADHK  163



>ref|XP_008792213.1| PREDICTED: serine/threonine-protein kinase HT1-like [Phoenix 
dactylifera]
Length=379

 Score =   124 bits (312),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 95/150 (63%), Gaps = 1/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLR  189
            D +   LID + L+ G +I +G    VY G Y ++ VAIKV+      +E    E RF+R
Sbjct  49   DIDDNLLIDPSLLFIGSKIGEGAHGKVYEGKYREQIVAIKVLNNGNTPEEKATLEARFIR  108

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV +++  KH+N++KFI    +P M + TE++ G SL+++L  I+P  +D + A+  AL 
Sbjct  109  EVNMMSRVKHENLVKFIGACKDPIMVIATELLPGMSLKKYLLTIRPQKLDLRQAVSFALD  168

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            I+RAM  LH NG+IHRDLKP+N+ L+  +K
Sbjct  169  IARAMDCLHANGMIHRDLKPDNLLLTAHQK  198



>gb|EMS60256.1| Serine/threonine-protein kinase HT1 [Triticum urartu]
Length=450

 Score =   125 bits (313),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            +  +LID   L+ G +I +G    VY G Y +++VAIK++      +E  +++ RFLREV
Sbjct  16   DPSWLIDPKLLFVGPRIGEGGHAKVYEGKYKNQNVAIKIVHKGDTPEEVIKRQGRFLREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI   +EP M +VTE++ GGSL+++L  ++P  ++ + A+  AL I+
Sbjct  76   TMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRNLEPRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+  ++
Sbjct  136  RAMECLHAHGIIHRDLKPENLLLTADQR  163



>ref|XP_007140092.1| hypothetical protein PHAVU_008G083700g [Phaseolus vulgaris]
 gb|ESW12086.1| hypothetical protein PHAVU_008G083700g [Phaseolus vulgaris]
Length=283

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 92/145 (63%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y D+ VAIKV+     ++E    E RF REV ++
Sbjct  44   LLVDPKLLFIGSKIGEGAHGKVYEGRYRDQIVAIKVLHRGSTSEERASLENRFAREVNMM  103

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +   HDN++KFI    +P M +VTE++ G SL+++L  I+P  +D   A+  AL I+RA+
Sbjct  104  SRVHHDNLVKFIGACKDPLMVIVTELLPGMSLRKYLMSIRPKLLDLHLAINFALDIARAL  163

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
             +LH NGIIHRDLKP+N+ L+  +K
Sbjct  164  DWLHANGIIHRDLKPDNLLLTADQK  188



>ref|XP_002270753.1| PREDICTED: serine/threonine-protein kinase HT1 [Vitis vinifera]
Length=374

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 93/145 (64%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   ++ G ++ +G    VY G Y D+ VAIKV+     ++E    E RF REV ++
Sbjct  48   LLVDPKLIFIGSKVGEGAHGKVYEGRYGDQIVAIKVLHRGSTSEERAALEGRFAREVNMM  107

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KH+N++KFI    +P M +VTE++ G SL+++L  I+P  MD   AL  AL I+RAM
Sbjct  108  SRVKHENLVKFIGACKDPLMVIVTELLPGMSLRKYLTSIRPKRMDIHVALSFALDIARAM  167

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+ ++K
Sbjct  168  ECLHANGIIHRDLKPDNLLLTANQK  192



>ref|XP_008665663.1| PREDICTED: serine/threonine-protein kinase HT1 [Zea mays]
 tpg|DAA52153.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=412

 Score =   124 bits (312),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 92/146 (63%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            K L+D   L+ G +I +G    VY G Y D+ VAIKV+      +E    E RF+REV +
Sbjct  80   KLLVDPKMLFVGDKIGEGAHGKVYKGKYGDQIVAIKVLNRGSTPEEKATLEARFIREVNM  139

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            +   KH+N++KFI    EP M +V+E++ G SL+ +L  I+P+ +D   A+  AL I+ A
Sbjct  140  MCKVKHENLVKFIGACKEPLMVIVSELLPGMSLKSYLHSIRPSQLDTHTAISYALDIAHA  199

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  200  MDCLHANGIIHRDLKPDNLLLTANRK  225



>ref|XP_006284021.1| hypothetical protein CARUB_v10005142mg [Capsella rubella]
 gb|EOA16919.1| hypothetical protein CARUB_v10005142mg [Capsella rubella]
Length=353

 Score =   124 bits (310),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+++D   L+ G +I +     +Y G Y +K+VAIK+++  +  +E  ++E RF REV
Sbjct  16   DPKWVVDPQHLFVGPKIGESAHAKIYEGKYKNKTVAIKIVKRGESPEEIAKRESRFAREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L  ++P  +D + A+  AL I+
Sbjct  76   SMLSRVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLVSLRPGRLDIRLAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +G+IHRDLKP N+ L+   K
Sbjct  136  RAMECLHSHGVIHRDLKPENLILTADYK  163



>ref|XP_009415969.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=344

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 95/139 (68%), Gaps = 1/139 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+LID   L+ G +I +G    VY G Y +++VA+KV+      +E  +KE RF+REV
Sbjct  16   DPKWLIDPKLLFVGPKIGEGAHAKVYEGKYKNQNVAVKVMHKGDTPEEVAKKEARFMREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +LA  +H N++KFI    EP M +VT+++ GGSL+++L +++P +++ + A+  AL I+
Sbjct  76   AMLARVQHKNLVKFIGACKEPVMVVVTDLLPGGSLRKYLVNLRPRSLEPRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPN  432
            RAM  LH +GIIHRDLKP+
Sbjct  136  RAMECLHSHGIIHRDLKPD  154



>ref|NP_195805.2| protein kinase family protein [Arabidopsis thaliana]
 gb|AAM98213.1| protein kinase ATN1-like protein [Arabidopsis thaliana]
 gb|AAN72179.1| protein kinase ATN1-like protein [Arabidopsis thaliana]
 gb|AED90401.1| protein kinase family protein [Arabidopsis thaliana]
Length=333

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 94/154 (61%), Gaps = 1/154 (1%)
 Frame = +1

Query  1    DDDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKE  177
              DD  E   L+D   L+ G +I +G    VY G Y  + VAIKV+      D+ S  + 
Sbjct  2    SSDDTIEESLLVDPKLLFIGSKIGEGAHGKVYQGRYGRQIVAIKVVNRGSKPDQQSSLES  61

Query  178  RFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALV  357
            RF+REV +++  +H N++KFI    +P M +VTE++ G SL+++L  I+P  +    AL 
Sbjct  62   RFVREVNMMSRVQHHNLVKFIGACKDPLMVIVTELLPGMSLRKYLTSIRPQLLHLPLALS  121

Query  358  MALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AL I+RA+  LH NGIIHRDLKP+N+ L+E+ K
Sbjct  122  FALDIARALHCLHANGIIHRDLKPDNLLLTENHK  155



>ref|XP_003517008.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Glycine 
max]
 ref|XP_006573395.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X2 [Glycine 
max]
 ref|XP_006573396.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X3 [Glycine 
max]
 ref|XP_006573397.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X4 [Glycine 
max]
 gb|KHN47609.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=371

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 93/145 (64%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             LID   L+ G +I +G    VY G Y D+ VAIKV+      +E    E RF REV ++
Sbjct  47   LLIDPKLLFIGSKIGEGAHGRVYEGRYRDQIVAIKVLHRGGTLEERVALENRFAREVNMM  106

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +   H+N++KFI    +P M +VTEM+ G SL+++L  I+P  +D   A+  AL I+RAM
Sbjct  107  SRVHHENLVKFIGACKDPLMVIVTEMLPGLSLRKYLTTIRPKQLDPYVAIKFALDIARAM  166

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
             +LH NGIIHRDLKP+N+ L+E++K
Sbjct  167  DWLHANGIIHRDLKPDNLLLTENQK  191



>ref|XP_006577841.1| PREDICTED: uncharacterized protein LOC100804884 isoform X2 [Glycine 
max]
Length=342

 Score =   123 bits (309),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 93/136 (68%), Gaps = 1/136 (1%)
 Frame = +1

Query  55   YGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLLAAAKHDNIL  231
            + ++I +G    VY G Y +++VA K++   + T++  ++E RF REV +L+  +H N++
Sbjct  18   WNLEIGEGAHAKVYEGKYKNQTVAFKIVHKGETTEDIAKREGRFAREVAMLSRVQHKNLV  77

Query  232  KFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAMAYLHENGII  411
            KFI    EP M +VTE++ GG+L+++L  ++P  +DR  A+  AL I+RAM  LH +GII
Sbjct  78   KFIGACKEPVMVIVTELLLGGTLRKYLLSMRPKCLDRHVAIGYALDIARAMECLHSHGII  137

Query  412  HRDLKPNNIFLSESKK  459
            HRDLKP+N+ L+E +K
Sbjct  138  HRDLKPDNLLLTEDQK  153



>ref|XP_004509294.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cicer arietinum]
Length=399

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 93/149 (62%), Gaps = 1/149 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLR  189
            D     L+D ++L     + +G    +Y G Y    V+IKV+  +   D + + K +F R
Sbjct  49   DIHPSLLVDTSKLIIDKFVGEGSHFILYKGWYRLDPVSIKVMLPKNTLDATYECKAKFQR  108

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV L++  KH NI+KFI   VEP+M ++TE + GGSLQ+HL +I P T+D + +L  AL 
Sbjct  109  EVNLISRIKHQNIVKFIGACVEPSMMIITEFLEGGSLQKHLENIYPRTLDLEQSLSFALD  168

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESK  456
            IS+AM YLH N IIHRDLKP N+ L+E K
Sbjct  169  ISQAMEYLHANDIIHRDLKPGNLVLAEDK  197



>ref|XP_004174068.1| PREDICTED: serine/threonine-protein kinase HT1-like, partial 
[Cucumis sativus]
Length=164

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 93/144 (65%), Gaps = 9/144 (6%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQK-----ERF  183
            ++K+LID   L+ G +I +G    VY G Y ++ VAIK++    G  ++P++      RF
Sbjct  16   DAKWLIDPKHLFVGPKIGEGAHAKVYEGKYKNQIVAIKMV----GKGDTPERMARREARF  71

Query  184  LREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMA  363
             REV +L+  +H N++KFI    EP M +VTE++TGG+L++ L +++P +++   A+  A
Sbjct  72   AREVAMLSKVRHKNLVKFIGACKEPMMVIVTELLTGGTLRKFLLNLRPRSLELDVAIGFA  131

Query  364  LQISRAMAYLHENGIIHRDLKPNN  435
            L I+RAM  LH +GIIHRDLKP  
Sbjct  132  LDIARAMECLHSHGIIHRDLKPGT  155



>ref|XP_007205401.1| hypothetical protein PRUPE_ppa007516mg [Prunus persica]
 gb|EMJ06600.1| hypothetical protein PRUPE_ppa007516mg [Prunus persica]
Length=365

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 93/145 (64%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y D+ VAIKV+     ++E    E RF REV ++
Sbjct  41   LLVDPNLLFIGSKIGEGAHGKVYEGRYRDRIVAIKVLHRGSTSEERAALESRFAREVNMM  100

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KH+N++KFI    +P M +VTE++ G SL+++L  I+P  ++   A+  AL I+ AM
Sbjct  101  SRVKHENLVKFIGACKDPLMVIVTELLPGMSLRKYLMSIRPNPLELHVAIKFALDIAHAM  160

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+E++K
Sbjct  161  ECLHANGIIHRDLKPDNLLLTENQK  185



>ref|XP_003534644.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
 gb|KHN29514.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=370

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 92/145 (63%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y +K VAIKV+     ++E    E RF REV ++
Sbjct  45   LLVDPKLLFIGSKIGEGAHGKVYEGRYGNKIVAIKVLHRGSTSEERASLENRFAREVNMM  104

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +   HDN++KFI    +P M +VTE++ G SL+++L  I+P  +D   A+  AL I+RAM
Sbjct  105  SRVHHDNLVKFIGACKDPLMVIVTELLPGMSLRKYLTSIRPKLLDLDVAINFALDIARAM  164

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
             +LH NGIIHRDLKP+N+ L+  +K
Sbjct  165  DWLHANGIIHRDLKPDNLLLTADQK  189



>gb|ABK06441.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=344

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 94/152 (62%), Gaps = 1/152 (1%)
 Frame = +1

Query  7    DDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERF  183
            DD  E   L+D   L+ G +I +G    VY G Y  + VAIKV+      D+ S  + RF
Sbjct  4    DDTIEESLLVDPKLLFIGSKIGEGAHGKVYQGRYGRQIVAIKVVNRGSKPDQQSSLESRF  63

Query  184  LREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMA  363
            +REV +++  +H N++KFI    +P M +VTE++ G SL+++L  I+P  +    AL  A
Sbjct  64   VREVNMMSRVQHHNLVKFIGACKDPLMVIVTELLPGMSLRKYLTSIRPQLLHLPLALSFA  123

Query  364  LQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            L I+RA+  LH NGIIHRDLKP+N+ L+E+ K
Sbjct  124  LDIARALHCLHANGIIHRDLKPDNLLLTENHK  155



>ref|XP_010091091.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
 gb|EXB42381.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
Length=377

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 93/148 (63%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            +   L+D   L+ G +I +G    VY G Y D+ VA+KV+      +E    E RF REV
Sbjct  49   DENLLVDPKLLFIGSKIGEGAHGKVYQGRYGDRIVAVKVLHRGSTYEERASLENRFAREV  108

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  KH+N++KFI    +P M +VTE++ G SL+R+L  I+P  +D   A+  A+ I+
Sbjct  109  NMMSRVKHENLVKFIGACKDPLMVIVTELLPGMSLRRYLVGIRPGKLDLHVAVKFAIDIA  168

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  169  RAMECLHANGIIHRDLKPDNLLLTANQK  196



>ref|XP_010528218.1| PREDICTED: serine/threonine-protein kinase HT1 [Tarenaya hassleriana]
 ref|XP_010528219.1| PREDICTED: serine/threonine-protein kinase HT1 [Tarenaya hassleriana]
Length=357

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 98/148 (66%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERFLREV  195
            + K+++D   L+ G +I +G    VY G Y +++VAIK+I+  +  +E S +++RF REV
Sbjct  16   DPKWVVDPKHLFVGPKIGEGAHAKVYEGKYRNQTVAIKIIKRGESPEEISKREKRFEREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  +    A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFIGACKEPIMVIVTELLLGGTLRKYLLNLRPRHLGIDVAIGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  136  RAMECLHSHGIIHRDLKPENLILTADHK  163



>ref|XP_010253109.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Nelumbo nucifera]
Length=379

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 94/146 (64%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            K LID   LY G +I +G    VY G Y ++ +A+KV+ + K  +E    E RF REV +
Sbjct  53   KLLIDPKLLYVGSKIGEGAHGIVYEGRYGNQIIAVKVLHSGKTPEEREVLEGRFAREVTM  112

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            ++  KH+N++KFI    +P M + TE++ G SL+++L  I+P  +D   A+  AL I+RA
Sbjct  113  MSRVKHENLVKFIGACKDPLMVIATELLPGMSLRKYLTSIRPKQLDLHVAIGYALDIARA  172

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  173  MDCLHANGIIHRDLKPDNLLLTANQK  198



>emb|CDY04825.1| BnaAnng00070D [Brassica napus]
Length=335

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 91/148 (61%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERFLREV  195
            E   L+D   L+ G +I +G    VY G Y    VAIKV+   +  D+ S    RF+REV
Sbjct  12   EESLLVDPKLLFIGSKIGEGAHGKVYQGRYGSLIVAIKVLHRGRNPDDKSSLHSRFIREV  71

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  KH N++KFI    +P M +VTE++ G SL+++L  I+P  +D   AL  AL I+
Sbjct  72   NMMSRVKHHNLVKFIGACKDPLMVIVTELLPGMSLRKYLTSIRPHLLDLPVALSFALDIA  131

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RA+  LH NGIIHRDLKP+N+ L+E  K
Sbjct  132  RALDCLHANGIIHRDLKPDNLLLTEDHK  159



>ref|XP_004492629.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cicer arietinum]
Length=346

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 94/145 (65%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y+D+ VAIKV+     ++E    E RF REV ++
Sbjct  37   LLVDPKLLFIGSKIGEGAHGKVYQGRYVDQIVAIKVLHRGSTSEERASLENRFAREVNMM  96

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +   H+N++KFI    +P M +VTE++ G SL+++L  I+P  +D   A+  AL I+RAM
Sbjct  97   SRVHHNNLVKFIGACKDPLMVIVTELLPGMSLRKYLMSIRPKPLDLHLAINFALDIARAM  156

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
             +LH NGIIHRDLKP+N+ L+ +++
Sbjct  157  DWLHANGIIHRDLKPDNLLLTANQE  181



>gb|KHG09867.1| Serine/threonine-protein kinase HT1 [Gossypium arboreum]
Length=355

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 91/145 (63%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             LID   L+ G +I +G    VY G Y D+ VAIKV+      +E    E RF REV ++
Sbjct  30   LLIDPKLLFIGSKIGEGAHGKVYEGRYGDRIVAIKVLHRGSTVEERAALESRFAREVNMM  89

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KH+N++KF     +P M +VTE++ G SL+++L  I+P  +D   AL  AL I+RAM
Sbjct  90   SRVKHENLVKFFGACKDPLMAIVTELLPGMSLRKYLVSIRPKVLDLHVALNFALDIARAM  149

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+ +++
Sbjct  150  DCLHANGIIHRDLKPDNLLLTANQR  174



>ref|XP_007140093.1| hypothetical protein PHAVU_008G083700g [Phaseolus vulgaris]
 gb|ESW12087.1| hypothetical protein PHAVU_008G083700g [Phaseolus vulgaris]
Length=368

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 92/145 (63%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y D+ VAIKV+     ++E    E RF REV ++
Sbjct  44   LLVDPKLLFIGSKIGEGAHGKVYEGRYRDQIVAIKVLHRGSTSEERASLENRFAREVNMM  103

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +   HDN++KFI    +P M +VTE++ G SL+++L  I+P  +D   A+  AL I+RA+
Sbjct  104  SRVHHDNLVKFIGACKDPLMVIVTELLPGMSLRKYLMSIRPKLLDLHLAINFALDIARAL  163

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
             +LH NGIIHRDLKP+N+ L+  +K
Sbjct  164  DWLHANGIIHRDLKPDNLLLTADQK  188



>ref|XP_008464929.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
HT1-like [Cucumis melo]
Length=352

 Score =   122 bits (307),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQK-----ERF  183
            ++K+LID    + G +I +G    VY G Y ++ VAIK++    G  ++P++      RF
Sbjct  16   DAKWLIDPKHXFVGPKIGEGAHAKVYEGKYKNQIVAIKMV----GKGDTPERMARREARF  71

Query  184  LREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMA  363
             REV +L+  +H N++KFI    EP M +VTE++TGG+L++ L +++P +++   A+  A
Sbjct  72   AREVAMLSKVRHKNLVKFIGACKEPMMVIVTELLTGGTLRKFLLNLRPRSLELDVAIGFA  131

Query  364  LQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            L I+RAM  LH +GIIHRDLKP N+ L+   K
Sbjct  132  LDIARAMECLHSHGIIHRDLKPENLILTADHK  163



>ref|XP_009397080.1| PREDICTED: serine/threonine-protein kinase HT1-like [Musa acuminata 
subsp. malaccensis]
Length=382

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 93/150 (62%), Gaps = 1/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQ-KERFLR  189
            D + K LID   LY G +I +G    VY G Y D+ +AIKV+      +E+   + RF+R
Sbjct  49   DIDEKHLIDPKLLYIGAKIGEGAHGKVYEGKYCDQIIAIKVLNGGSTPEETATLRARFIR  108

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV ++   +H+N++KF     +P M + TE++ G SL+++L  I+P  +D   A+  AL 
Sbjct  109  EVNMMCRVQHENLVKFFGACKDPFMVIATELLPGMSLKKYLSTIRPKQLDLYKAISFALD  168

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            I+ AM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  169  IAHAMDCLHANGIIHRDLKPDNLLLTTNQK  198



>ref|XP_002991780.1| hypothetical protein SELMODRAFT_186310 [Selaginella moellendorffii]
 gb|EFJ07184.1| hypothetical protein SELMODRAFT_186310 [Selaginella moellendorffii]
Length=408

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 99/150 (66%), Gaps = 2/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIET-EKGTDESPQKERFLR  189
            D + +++ID   L  G ++ +G    VY G Y D SVA+K+I+  +   D +  + RF+R
Sbjct  45   DVDERWIIDPRMLLVGSKLGEGAHGKVYEGKYRDLSVAVKIIQVGDTPEDVAKARSRFVR  104

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV +L+  +H N++KFI    EP M LVTE+++G SL+++L +++P  M+ + A+  AL+
Sbjct  105  EVSMLSKVQHKNLVKFIGACEEP-MVLVTELLSGNSLRKYLVNLRPHRMELEQAITFALE  163

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            I++ M  LH NGIIHRDLKP+N+ L+  +K
Sbjct  164  IAQVMDCLHANGIIHRDLKPDNLLLTADQK  193



>ref|XP_006346678.1| PREDICTED: serine/threonine-protein kinase HT1-like [Solanum 
tuberosum]
Length=370

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 95/146 (65%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            + L+D  +L+ G +I +G    VY G Y D+ VAIKV+     ++E    E RF+REV +
Sbjct  44   RVLVDPKQLFIGTKIGEGAHGKVYEGRYGDQIVAIKVLNGGNTSEERSSLEGRFVREVVM  103

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            ++  KH+N++KFI    +P M +V+E++ G SL+++L  I+P  +D   AL  AL I+RA
Sbjct  104  MSRVKHENLVKFIGACKDPLMVIVSELLPGMSLRKYLVSIRPNVLDLHVALNYALDIARA  163

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH N IIHRDLKP+N+ L+ ++K
Sbjct  164  MECLHANVIIHRDLKPDNLLLTANQK  189



>ref|XP_002989702.1| hypothetical protein SELMODRAFT_160379 [Selaginella moellendorffii]
 gb|EFJ09179.1| hypothetical protein SELMODRAFT_160379 [Selaginella moellendorffii]
Length=408

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 99/150 (66%), Gaps = 2/150 (1%)
 Frame = +1

Query  13   DDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIET-EKGTDESPQKERFLR  189
            D + +++ID   L  G ++ +G    VY G Y D SVA+K+I+  +   D +  + RF+R
Sbjct  45   DVDERWIIDPRMLLVGSKLGEGAHGKVYEGKYRDLSVAVKIIQVGDTPEDVAKARSRFVR  104

Query  190  EVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQ  369
            EV +L+  +H N++KFI    EP M LVTE+++G SL+++L +++P  M+ + A+  AL+
Sbjct  105  EVAMLSKVQHKNLVKFIGACEEP-MVLVTELLSGNSLRKYLVNLRPHRMELEQAITFALE  163

Query  370  ISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            I++ M  LH NGIIHRDLKP+N+ L+  +K
Sbjct  164  IAQVMDCLHANGIIHRDLKPDNLLLTADQK  193



>ref|XP_009346915.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
 ref|XP_009346916.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
 ref|XP_009346917.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
 ref|XP_009346918.1| PREDICTED: serine/threonine-protein kinase HT1-like [Pyrus x 
bretschneideri]
Length=372

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 92/145 (63%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y D+ VA+KV+     T+E    E RF REV ++
Sbjct  48   LLVDPKLLFIGAKIGEGAHGKVYEGRYGDRIVAVKVLHRGSTTEERAALESRFAREVNMM  107

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KH+N++KFI    EP M +VTE++ G SL+++L  I+P  ++   A+  +L I+ AM
Sbjct  108  SRVKHENLVKFIGACKEPLMVIVTELLPGMSLRKYLMSIRPNPLELHVAIKFSLDIAHAM  167

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+ ++K
Sbjct  168  ECLHANGIIHRDLKPDNLLLTANQK  192



>ref|XP_006577842.1| PREDICTED: uncharacterized protein LOC100804884 isoform X3 [Glycine 
max]
Length=339

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 91/133 (68%), Gaps = 1/133 (1%)
 Frame = +1

Query  64   QISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLLAAAKHDNILKFI  240
            +I +G    VY G Y +++VA K++   + T++  ++E RF REV +L+  +H N++KFI
Sbjct  18   RIGEGAHAKVYEGKYKNQTVAFKIVHKGETTEDIAKREGRFAREVAMLSRVQHKNLVKFI  77

Query  241  AYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAMAYLHENGIIHRD  420
                EP M +VTE++ GG+L+++L  ++P  +DR  A+  AL I+RAM  LH +GIIHRD
Sbjct  78   GACKEPVMVIVTELLLGGTLRKYLLSMRPKCLDRHVAIGYALDIARAMECLHSHGIIHRD  137

Query  421  LKPNNIFLSESKK  459
            LKP+N+ L+E +K
Sbjct  138  LKPDNLLLTEDQK  150



>ref|XP_009125392.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Brassica 
rapa]
Length=333

 Score =   121 bits (304),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 90/148 (61%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERFLREV  195
            E   L+D   L+ G +I +G    VY G Y    VAIKV+      D+ S    RF+REV
Sbjct  12   EESLLVDPKLLFIGSKIGEGAHGKVYQGRYGSLIVAIKVLHRGSNPDDKSSLHSRFIREV  71

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  KH N++KFI    +P M +VTE++ G SL+++L  I+P  +D   AL  AL I+
Sbjct  72   NMMSRVKHHNLVKFIGACKDPLMVIVTELLPGMSLRKYLTSIRPHLLDLPVALSFALDIA  131

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RA+  LH NGIIHRDLKP+N+ L+E  K
Sbjct  132  RALDCLHANGIIHRDLKPDNLLLTEDHK  159



>ref|XP_008370250.1| PREDICTED: serine/threonine-protein kinase HT1 [Malus domestica]
 ref|XP_008370251.1| PREDICTED: serine/threonine-protein kinase HT1 [Malus domestica]
 ref|XP_008370252.1| PREDICTED: serine/threonine-protein kinase HT1 [Malus domestica]
Length=372

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 92/145 (63%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y D+ VA+KV+     T+E    E RF REV ++
Sbjct  48   LLVDPKLLFIGAKIGEGAHGKVYEGRYGDRIVAVKVLHRGSTTEERAALESRFAREVNMM  107

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KH+N++KFI    EP M +VTE++ G SL+++L  I+P  ++   A+  +L I+ AM
Sbjct  108  SRVKHENLVKFIGACKEPLMVIVTELLPGMSLRKYLMSIRPNPLELHVAIKFSLDIAHAM  167

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+ ++K
Sbjct  168  ECLHANGIIHRDLKPDNLLLTANQK  192



>ref|XP_009125393.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X2 [Brassica 
rapa]
Length=332

 Score =   121 bits (304),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 90/148 (61%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERFLREV  195
            E   L+D   L+ G +I +G    VY G Y    VAIKV+      D+ S    RF+REV
Sbjct  12   EESLLVDPKLLFIGSKIGEGAHGKVYQGRYGSLIVAIKVLHRGSNPDDKSSLHSRFIREV  71

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  KH N++KFI    +P M +VTE++ G SL+++L  I+P  +D   AL  AL I+
Sbjct  72   NMMSRVKHHNLVKFIGACKDPLMVIVTELLPGMSLRKYLTSIRPHLLDLPVALSFALDIA  131

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RA+  LH NGIIHRDLKP+N+ L+E  K
Sbjct  132  RALDCLHANGIIHRDLKPDNLLLTEDHK  159



>ref|XP_003522087.1| PREDICTED: serine/threonine-protein kinase HT1-like [Glycine 
max]
Length=371

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 92/145 (63%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             LID   L+ G +I +G    VY G Y D+ VAIKV+      +E    E RF REV ++
Sbjct  47   LLIDPKLLFIGSKIGEGAHGRVYEGRYRDRIVAIKVLHRGGTLEEKVALENRFAREVNMM  106

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +   H+N++KFI     P M +VTEM+ G SL+++L  I+P  +D   A+  +L ++RAM
Sbjct  107  SRVHHENLVKFIGACKAPLMVIVTEMLPGLSLRKYLTTIRPKQLDPYVAIKFSLDVARAM  166

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
             +LH NGIIHRDLKP+N+ L+E++K
Sbjct  167  DWLHANGIIHRDLKPDNLLLTENQK  191



>gb|KHN43737.1| Serine/threonine-protein kinase HT1 [Glycine soja]
Length=371

 Score =   122 bits (305),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 92/145 (63%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             LID   L+ G +I +G    VY G Y D+ VAIKV+      +E    E RF REV ++
Sbjct  47   LLIDPKLLFIGSKIGEGAHGRVYEGRYRDRIVAIKVLHRGGTLEEKVALENRFAREVNMM  106

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +   H+N++KFI     P M +VTEM+ G SL+++L  I+P  +D   A+  +L ++RAM
Sbjct  107  SRVHHENLVKFIGACKAPLMVIVTEMLPGLSLRKYLTTIRPKQLDPYVAIKFSLDVARAM  166

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
             +LH NGIIHRDLKP+N+ L+E++K
Sbjct  167  DWLHANGIIHRDLKPDNLLLTENQK  191



>ref|XP_009386682.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=349

 Score =   121 bits (304),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 99/148 (67%), Gaps = 2/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            + K+LID   L+ G +I +G    VY G Y +++VA+KV+      ++  ++E R++REV
Sbjct  16   DPKWLIDPELLFVGPKIGEGAHAEVYEGKYKNQNVAVKVMHKGDSQEDVAKREARYMREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +LA  +H N++KFI    EP M +VTE++ GGSL+++L +++P  ++ + A+  AL I+
Sbjct  76   AMLARGQHKNLVKFIGACKEP-MVVVTELLLGGSLRKYLINMRPRNLEPRVAVGFALDIA  134

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ L+  ++
Sbjct  135  RAMECLHSHGIIHRDLKPENLLLTADQR  162



>ref|XP_008393542.1| PREDICTED: serine/threonine-protein kinase HT1-like [Malus domestica]
Length=342

 Score =   121 bits (303),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +1

Query  106  YMDKSVAIKVIETEKGTDES-PQKERFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEM  282
            Y  K VA+K+I   K    S  ++E+F REV +L+  KHDNI+KF+    EP+M ++TE+
Sbjct  32   YQSKPVAVKIIRPPKTKYVSLDRQEKFHREVSMLSKVKHDNIVKFVGACFEPSMIILTEL  91

Query  283  MTGGSLQRHLWHIKPATMDRKDALVMALQISRAMAYLHENGIIHRDLKPNNIFLSE  450
            + GG+LQ++LW  +P T D K ++  A+ + RAM YLH NGIIHRDLKP N+ L+E
Sbjct  92   LRGGNLQKYLWERRPGTPDLKCSISFAMDVCRAMEYLHANGIIHRDLKPANLLLTE  147



>ref|XP_007134693.1| hypothetical protein PHAVU_010G068300g [Phaseolus vulgaris]
 gb|ESW06687.1| hypothetical protein PHAVU_010G068300g [Phaseolus vulgaris]
Length=370

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 95/149 (64%), Gaps = 2/149 (1%)
 Frame = +1

Query  16   DESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLRE  192
            DES  LID   L+ G +I +G    VY G Y ++ VAIKV+      +E    E RF RE
Sbjct  43   DES-LLIDPKLLFIGSKIGEGAHGRVYEGRYRERIVAIKVLHRGSTLEERVSLENRFARE  101

Query  193  VKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQI  372
            V +++   H+N++KFI    +P M +VTEM+ G SL+R+L  I+P  +D   A+  AL I
Sbjct  102  VNMMSRVHHENLVKFIGACKDPLMVIVTEMLPGLSLRRYLITIRPKPLDLYVAIKFALDI  161

Query  373  SRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            + AM +LH NGIIHRDLKP+N+ L+E+++
Sbjct  162  ALAMNWLHANGIIHRDLKPDNLLLTENQE  190



>ref|XP_008245023.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Prunus 
mume]
Length=365

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 93/145 (64%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y D+ VAIKV+     ++E    E RF REV ++
Sbjct  41   LLVDPKLLFIGSKIGEGAHGKVYEGRYRDRIVAIKVLHRGSTSEERTALESRFAREVNMM  100

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KH+N++KFI    +P M +VTE++ G SL+++L  I+P  ++   A+  AL I+ AM
Sbjct  101  SRVKHENLVKFIGACKDPLMVIVTELLPGMSLRKYLMSIRPNPLELLVAIKFALDIAHAM  160

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+E+++
Sbjct  161  ECLHANGIIHRDLKPDNLLLTENQR  185



>ref|XP_007033551.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04477.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=381

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 91/147 (62%), Gaps = 1/147 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            +   LID   L+ G +I +G    VY G Y D+ VAIKV+      +E    E RF REV
Sbjct  53   DQNLLIDPKLLFIGSKIGEGAHGKVYEGRYGDRIVAIKVLHRGSTVEERTALESRFAREV  112

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  KH+N++KF     +P M +VTE++ G SL+++L  I+P  +D   AL  AL I+
Sbjct  113  NMMSRVKHENLVKFFGACKDPLMVIVTELLPGMSLRKYLISIRPKVLDFHVALNFALDIA  172

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESK  456
            RAM  LH NGIIHRDLKP+N+ L+ ++
Sbjct  173  RAMECLHANGIIHRDLKPDNLLLTANQ  199



>ref|XP_009372005.1| PREDICTED: serine/threonine-protein kinase HT1 [Pyrus x bretschneideri]
Length=373

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 95/151 (63%), Gaps = 4/151 (3%)
 Frame = +1

Query  10   DDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFL  186
            DD+    L+D   L+ G +I +G    VY G Y ++ VA+KV+     T+E    E RF 
Sbjct  46   DDN---LLVDPKLLFIGAKIGEGAHGKVYEGRYGNQIVAVKVLHRGSTTEERAALEGRFA  102

Query  187  REVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMAL  366
            REV +++  KH+N++KFI    EP M +VTE++ G SL+++L  I+P  ++   A+  AL
Sbjct  103  REVNMMSRVKHENLVKFIGACKEPLMVIVTELLPGMSLRKYLMSIRPNPLELHVAIKFAL  162

Query  367  QISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             I+ AM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  163  DIAHAMECLHANGIIHRDLKPDNLLLTANQK  193



>ref|XP_002323067.1| kinase family protein [Populus trichocarpa]
 gb|EEF04828.1| kinase family protein [Populus trichocarpa]
Length=356

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 96/154 (62%), Gaps = 1/154 (1%)
 Frame = +1

Query  1    DDDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-  177
            +++   +   LID   L+ G +I +G    VY G Y D  VAIKV+     ++E    E 
Sbjct  20   EENGSIDQNLLIDPKLLFIGNKIGEGAHGEVYKGRYGDLIVAIKVLHPGTTSEERAALED  79

Query  178  RFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALV  357
            RF REV +++  KH+N++KFI    +P M +VTE++ G SL+++L  I+P  +D   A+ 
Sbjct  80   RFAREVNMMSRVKHENLVKFIGACKDPFMVIVTELLPGMSLRKYLVSIRPKQLDLYVAIN  139

Query  358  MALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AL ++RAM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  140  FALDVARAMDCLHANGIIHRDLKPDNLLLTANQK  173



>ref|XP_011011312.1| PREDICTED: serine/threonine-protein kinase HT1 [Populus euphratica]
Length=356

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/154 (41%), Positives = 96/154 (62%), Gaps = 1/154 (1%)
 Frame = +1

Query  1    DDDDDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-  177
            +++   +   LID   L+ G +I +G    VY G Y D  VAIKV+     ++E    E 
Sbjct  20   EENGSIDQNLLIDPKLLFIGNKIGEGAHGEVYKGRYGDLIVAIKVLHQGTTSEERAALED  79

Query  178  RFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALV  357
            RF REV +++  KH+N++KFI    +P M +VTE++ G SL+++L  I+P  +D   A+ 
Sbjct  80   RFAREVNMMSRVKHENLVKFIGACKDPFMVIVTELLPGMSLRKYLVSIRPKQLDLYVAIK  139

Query  358  MALQISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             AL ++RAM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  140  FALDVARAMDCLHANGIIHRDLKPDNLLLTANQK  173



>ref|XP_010490500.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=325

 Score =   120 bits (301),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 93/147 (63%), Gaps = 2/147 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKERFLREVK  198
            +   L+D   L+ G +I QG    VY G Y  + VAIKV++ +  +  S +  RF+REV 
Sbjct  4    DQSLLLDPKLLFIGSKIGQGAHGKVYQGRYGSEIVAIKVVKPDDKS--SLESRRFIREVN  61

Query  199  LLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISR  378
            +++  +H N++KFI    +P M +VTE++ G SL+++L  I+P  +    AL  AL ISR
Sbjct  62   MMSRVQHPNLVKFIGACKDPLMVIVTELLPGMSLRKYLASIRPQVLHLPLALSFALDISR  121

Query  379  AMAYLHENGIIHRDLKPNNIFLSESKK  459
            A+  LH NGIIHRDLKP+N+ L+E+ K
Sbjct  122  ALDCLHANGIIHRDLKPDNLLLTENHK  148



>ref|XP_010497239.1| PREDICTED: serine/threonine-protein kinase HT1-like [Camelina 
sativa]
Length=226

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 90/146 (62%), Gaps = 1/146 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERFLREV  195
            +   L+D   L+ G +I QG    VY G Y  + VAIKV+      DE S  +  F+REV
Sbjct  25   DQSLLLDPKLLFIGSKIGQGAHGKVYQGRYGSEIVAIKVVHRGTKPDEKSSLESHFIREV  84

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  +H N++KFI    +P M +VTE++ G SL+++L  I+P  +    AL  AL IS
Sbjct  85   NMMSRVQHPNLVKFIGACKDPLMVIVTELLPGLSLRKYLATIRPQLLHLPLALSFALDIS  144

Query  376  RAMAYLHENGIIHRDLKPNNIFLSES  453
            RA+  LH NGIIHRDLKP+N+ L+E+
Sbjct  145  RALDCLHANGIIHRDLKPDNLLLTEN  170



>ref|XP_010451930.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Camelina 
sativa]
Length=349

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 91/146 (62%), Gaps = 1/146 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERFLREV  195
            +   L+D   L+ G +I QG    VY G Y  + VAIKV+      DE S  + RF+REV
Sbjct  25   DQSLLLDPKLLFIGSKIGQGAHGKVYQGRYGSEIVAIKVVHRGTKPDEKSSLESRFIREV  84

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  +H N++KFI    +P M +VTE++ G SL+++L  I+P  +    AL  AL IS
Sbjct  85   NMMSRVQHPNLVKFIGACKDPLMVIVTELLPGLSLRKYLATIRPQVLHLPLALSFALDIS  144

Query  376  RAMAYLHENGIIHRDLKPNNIFLSES  453
            RA+  LH NGIIHRDLKP+N+ L+E+
Sbjct  145  RALDCLHANGIIHRDLKPDNLLLTEN  170



>ref|XP_008388337.1| PREDICTED: serine/threonine-protein kinase HT1-like [Malus domestica]
Length=373

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 95/151 (63%), Gaps = 4/151 (3%)
 Frame = +1

Query  10   DDDESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFL  186
            DD+    L+D   L+ G +I +G    VY G Y D+ +A+K++     T+E    E RF 
Sbjct  46   DDN---LLVDPKLLFIGAKIGEGAHGKVYEGRYGDQIMAVKILHRGSTTEERAALEGRFA  102

Query  187  REVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMAL  366
            REV +++  KH+N++KFI    EP M +VTE++ G SL+++L  I+P  ++   A+  AL
Sbjct  103  REVNMMSRVKHENLVKFIGACKEPLMVIVTELLPGMSLRKYLMSIRPNPLELHVAIKFAL  162

Query  367  QISRAMAYLHENGIIHRDLKPNNIFLSESKK  459
             I+ AM  LH NGIIHRDLKP+N+ L+ ++K
Sbjct  163  DIAHAMECLHANGIIHRDLKPDNLLLTANQK  193



>ref|XP_010683520.1| PREDICTED: serine/threonine-protein kinase HT1 [Beta vulgaris 
subsp. vulgaris]
Length=359

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 94/149 (63%), Gaps = 2/149 (1%)
 Frame = +1

Query  16   DESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLRE  192
            DES  L+D   L+ G ++ +G    VY G Y D  VAIKV+     T+E    E RF+RE
Sbjct  26   DES-LLVDPRLLFIGSKVGEGAHGKVYEGRYGDSIVAIKVLNRGSTTEERAVLESRFIRE  84

Query  193  VKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQI  372
            V ++   KH+N++KFI    +P M +VTE++ G SL+++L  ++P  ++    L  AL I
Sbjct  85   VNMMCRVKHENLVKFIGACKDPLMVIVTELLPGLSLRKYLNRLRPKQLELNVVLSYALDI  144

Query  373  SRAMAYLHENGIIHRDLKPNNIFLSESKK  459
            +RAM  LH NGIIHRDLKP+N+ L+ +++
Sbjct  145  ARAMDCLHANGIIHRDLKPDNLLLTANQE  173



>ref|XP_010424002.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Camelina sativa]
Length=349

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 91/146 (62%), Gaps = 1/146 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDE-SPQKERFLREV  195
            +   L+D   L+ G +I QG    VY G Y  + VAIKV+      DE S  + RF+REV
Sbjct  25   DQSLLLDPKLLFIGSKIGQGAHGKVYQGRYGSEIVAIKVVHRGTKPDEKSSLESRFIREV  84

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  +H N++KFI    +P M +VTE++ G SL+++L  I+P  +    AL  AL IS
Sbjct  85   NMMSRVQHPNLVKFIGACKDPLMVIVTELLPGLSLRKYLATIRPQLLHLPLALSFALDIS  144

Query  376  RAMAYLHENGIIHRDLKPNNIFLSES  453
            RA+  LH NGIIHRDLKP+N+ L+E+
Sbjct  145  RALDCLHANGIIHRDLKPDNLLLTEN  170



>ref|XP_010035996.1| PREDICTED: serine/threonine-protein kinase HT1 [Eucalyptus grandis]
 gb|KCW47515.1| hypothetical protein EUGRSUZ_K01281 [Eucalyptus grandis]
Length=374

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/146 (42%), Positives = 92/146 (63%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
              L++   L  G +I +G    V+ G Y D+ VAIKV+   K  +E    E RF REV +
Sbjct  47   NLLVNPKLLLIGSKIGEGAHGRVFEGRYGDQIVAIKVLNGGKTPEEGAALENRFAREVNM  106

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            ++  KH+N++KFI    +P M +VTE++ G SL+++L+ I+P  +D   A+  AL I+RA
Sbjct  107  MSRVKHENLVKFIGACKDPYMVIVTELLPGMSLRKYLFSIRPNVLDLNVAINYALDIARA  166

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH NGIIHRDLKP+N+ L+ + +
Sbjct  167  MECLHANGIIHRDLKPDNLLLTANHR  192



>ref|XP_007156022.1| hypothetical protein PHAVU_003G251900g [Phaseolus vulgaris]
 gb|ESW28016.1| hypothetical protein PHAVU_003G251900g [Phaseolus vulgaris]
Length=400

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 90/148 (61%), Gaps = 8/148 (5%)
 Frame = +1

Query  16   DESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVI-ETEKGTDESPQKERFLRE  192
            D  K +IDE        I++G+++ VY G Y    V+IKV+   +     S  K +F RE
Sbjct  54   DTRKLIIDEP-------IAEGLNSIVYKGWYEFNPVSIKVVLPMQTSNASSACKAKFQRE  106

Query  193  VKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQI  372
            V L++  KH NI+KFI  SVEP M ++TE++ G SL ++L  I P T+  + ++  AL I
Sbjct  107  VNLISRIKHQNIVKFIGASVEPRMMIITELLEGCSLPKYLESIYPNTLSLEQSISFALDI  166

Query  373  SRAMAYLHENGIIHRDLKPNNIFLSESK  456
            S+AM YLH NGIIHRDLKP N+ L   K
Sbjct  167  SQAMEYLHANGIIHRDLKPGNLLLRNDK  194



>ref|XP_010102688.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
 gb|EXB93906.1| Serine/threonine-protein kinase HT1 [Morus notabilis]
Length=348

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 98/148 (66%), Gaps = 5/148 (3%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++K+LID  +L+ G +I +G    VY     +++VAIK++   +  +E  ++E RF REV
Sbjct  16   DAKWLIDPKQLFVGPRIGEGAHAKVY----KNQTVAIKIVHKGETPEEISKREGRFAREV  71

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI    EP M +VTE++ GG+L+++L +++P  ++ + A+  AL I+
Sbjct  72   AMLSRVQHKNLVKFIGACKEPVMVIVTELLLGGTLRKYLLNMRPRCLETRVAVGFALDIA  131

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH +GIIHRDLKP N+ ++   K
Sbjct  132  RAMECLHSHGIIHRDLKPENLLMTADHK  159



>gb|ABR18102.1| unknown [Picea sitchensis]
Length=363

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/146 (43%), Positives = 97/146 (66%), Gaps = 1/146 (1%)
 Frame = +1

Query  25   KFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKL  201
            ++LID   LY G  I +G    VY G Y D++VAIK+I+     +E  ++E RF RE+ L
Sbjct  19   RWLIDPKLLYVGPMIGEGAHGKVYEGKYRDQNVAIKIIQAGDVPEEIARREARFAREIAL  78

Query  202  LAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRA  381
            LA  +H N++KFI    EP + +VTE++ GGSL++++  ++P  +D + A+  AL I++A
Sbjct  79   LARVQHKNLVKFIGACKEPVLVVVTELLLGGSLRKYMLSVRPKRLDLRLAVSFALDIAQA  138

Query  382  MAYLHENGIIHRDLKPNNIFLSESKK  459
            M  LH +GIIHRDLKP+N+ L+  +K
Sbjct  139  MECLHAHGIIHRDLKPDNLLLTADQK  164



>ref|XP_008442327.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X2 [Cucumis 
melo]
Length=373

 Score =   119 bits (297),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 92/145 (63%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y D+ VAIKV+      +E    E RF REV ++
Sbjct  45   LLVDPKLLFIGSKIGEGAHGKVYEGRYRDQIVAIKVLHRGSTPEERAALESRFAREVNMM  104

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KH+N++KFI    EP M +VTE++ G SL+++L + +   +D + A+  AL ++RAM
Sbjct  105  SRVKHENLVKFIGACKEPLMVIVTELLPGMSLRKYLMNNRKQQLDPRMAINFALDVARAM  164

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+ +++
Sbjct  165  DCLHANGIIHRDLKPDNLLLTANQR  189



>ref|XP_008442326.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X1 [Cucumis 
melo]
Length=386

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 92/145 (63%), Gaps = 1/145 (1%)
 Frame = +1

Query  28   FLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREVKLL  204
             L+D   L+ G +I +G    VY G Y D+ VAIKV+      +E    E RF REV ++
Sbjct  45   LLVDPKLLFIGSKIGEGAHGKVYEGRYRDQIVAIKVLHRGSTPEERAALESRFAREVNMM  104

Query  205  AAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQISRAM  384
            +  KH+N++KFI    EP M +VTE++ G SL+++L + +   +D + A+  AL ++RAM
Sbjct  105  SRVKHENLVKFIGACKEPLMVIVTELLPGMSLRKYLMNNRKQQLDPRMAINFALDVARAM  164

Query  385  AYLHENGIIHRDLKPNNIFLSESKK  459
              LH NGIIHRDLKP+N+ L+ +++
Sbjct  165  DCLHANGIIHRDLKPDNLLLTANQR  189



>ref|XP_006292390.1| hypothetical protein CARUB_v10018602mg [Capsella rubella]
 gb|EOA25288.1| hypothetical protein CARUB_v10018602mg [Capsella rubella]
Length=406

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +1

Query  22   SKFLIDETELYYGVQISQGVSTTVYFGTYMDK-SVAIKVIETEKGTDES-PQKERFLREV  195
            S+ L+D  +L  G  I  G   TVY G + ++  VA+K+++  K +  S  +K+ F REV
Sbjct  22   SELLLDPNDLLVGSMIGVGDYFTVYQGWFRNQFPVAVKIVQPRKASAVSIEEKKLFQREV  81

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             LL+  KHDNI++F   S+EP + +VTE++ GG+LQ+++ + +P+  D + +L  AL IS
Sbjct  82   VLLSKMKHDNIVEFFGASIEPQLMIVTELIEGGTLQKYMLNCRPSPPDVRMSLGFALDIS  141

Query  376  RAMAYLHENGIIHRDLKPNNIFLS  447
            RAM +LH  GIIHRDL P N+ ++
Sbjct  142  RAMEFLHSKGIIHRDLNPRNLLVT  165



>ref|NP_190641.1| putative protein kinase [Arabidopsis thaliana]
 emb|CAB62441.1| protein kinase ATN1-like protein [Arabidopsis thaliana]
 gb|AEE78701.1| putative protein kinase [Arabidopsis thaliana]
Length=377

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 102/160 (64%), Gaps = 12/160 (8%)
 Frame = +1

Query  4    DDDDDES----------KFLIDETELYYGVQISQGVSTTVYFGTYMD-KSVAIKVIETEK  150
            DD++DES          + L++  ++  G  I +G ++ VY G   +   VA+K+++  K
Sbjct  23   DDNNDESDNQFDFNISRELLLNPKDIMRGEMIGEGGNSIVYKGRLKNIVPVAVKIVQPGK  82

Query  151  GTDESPQ-KERFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKP  327
             +  S Q K++F +EV +L++ KH+NI++F+   +EP + +VTE++ GG+LQR + + +P
Sbjct  83   TSAVSIQDKQQFQKEVLVLSSMKHENIVRFVGACIEPQLMIVTELVRGGTLQRFMLNSRP  142

Query  328  ATMDRKDALVMALQISRAMAYLHENGIIHRDLKPNNIFLS  447
            + +D K +L  AL ISRAM YLH  GIIHRDL P N+ ++
Sbjct  143  SPLDLKVSLSFALDISRAMEYLHSKGIIHRDLNPRNVLVT  182



>gb|ABK06442.1| flag-tagged protein kinase domain of putative mitogen-activated 
protein kinase kinase kinase [synthetic construct]
Length=388

 Score =   117 bits (294),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 102/160 (64%), Gaps = 12/160 (8%)
 Frame = +1

Query  4    DDDDDES----------KFLIDETELYYGVQISQGVSTTVYFGTYMD-KSVAIKVIETEK  150
            DD++DES          + L++  ++  G  I +G ++ VY G   +   VA+K+++  K
Sbjct  23   DDNNDESDNQFDFNISRELLLNPKDIMRGEMIGEGGNSIVYKGRLKNIVPVAVKIVQPGK  82

Query  151  GTDESPQ-KERFLREVKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKP  327
             +  S Q K++F +EV +L++ KH+NI++F+   +EP + +VTE++ GG+LQR + + +P
Sbjct  83   TSAVSIQDKQQFQKEVLVLSSMKHENIVRFVGACIEPQLMIVTELVRGGTLQRFMLNSRP  142

Query  328  ATMDRKDALVMALQISRAMAYLHENGIIHRDLKPNNIFLS  447
            + +D K +L  AL ISRAM YLH  GIIHRDL P N+ ++
Sbjct  143  SPLDLKVSLSFALDISRAMEYLHSKGIIHRDLNPRNVLVT  182



>ref|XP_009758363.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Nicotiana sylvestris]
Length=345

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 96/148 (65%), Gaps = 2/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ESK+LID   L  G +I +G    VY G Y +++VAIKV+   +  +E  ++E  F REV
Sbjct  16   ESKWLIDPKLLLVGPKIGEGAHAKVYEGKYKNQNVAIKVVHKGETPEEIDKREAHFGREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KF+   +EP M +VTE++ GG+L+++L + +P  +D + A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFMGACMEPIMVIVTELL-GGTLRKYLVNTRPRCLDMRVAIGYALDIA  134

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R +  LH +GIIHRDLKP N+ L+   K
Sbjct  135  RGIECLHSHGIIHRDLKPENLLLTADYK  162



>gb|EMT20146.1| Serine/threonine-protein kinase HT1 [Aegilops tauschii]
Length=566

 Score =   119 bits (298),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 58/138 (42%), Positives = 92/138 (67%), Gaps = 1/138 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            +  +LID   L+ G +I +G    VY G Y +++VAIK++      +E  +++ RFLREV
Sbjct  16   DPSWLIDPKLLFVGPRIGEGGHAKVYEGKYKNQNVAIKIVHKGDTPEEVIKRQGRFLREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KFI   +EP M +VTE++ GGSL+++L  ++P  ++ + A+  AL I+
Sbjct  76   TMLSRVQHKNLVKFIGACLEPVMVVVTELLVGGSLRKYLVSLRPRNLEPRVAVGFALDIA  135

Query  376  RAMAYLHENGIIHRDLKP  429
            RAM  LH +GIIHRDLKP
Sbjct  136  RAMECLHAHGIIHRDLKP  153



>ref|XP_009758364.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X2 
[Nicotiana sylvestris]
Length=322

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 96/148 (65%), Gaps = 2/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ESK+LID   L  G +I +G    VY G Y +++VAIKV+   +  +E  ++E  F REV
Sbjct  16   ESKWLIDPKLLLVGPKIGEGAHAKVYEGKYKNQNVAIKVVHKGETPEEIDKREAHFGREV  75

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +L+  +H N++KF+   +EP M +VTE++ GG+L+++L + +P  +D + A+  AL I+
Sbjct  76   AMLSRVQHKNLVKFMGACMEPIMVIVTELL-GGTLRKYLVNTRPRCLDMRVAIGYALDIA  134

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            R +  LH +GIIHRDLKP N+ L+   K
Sbjct  135  RGIECLHSHGIIHRDLKPENLLLTADYK  162



>ref|XP_010451931.1| PREDICTED: serine/threonine-protein kinase HT1 isoform X2 [Camelina 
sativa]
Length=349

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 92/147 (63%), Gaps = 2/147 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGT-YMDKSVAIKVIETEKGTDE-SPQKERFLRE  192
            +   L+D   L+ G +I QG    VY G+ Y  + VAIKV+      DE S  + RF+RE
Sbjct  25   DQSLLLDPKLLFIGSKIGQGAHGKVYQGSRYGSEIVAIKVVHRGTKPDEKSSLESRFIRE  84

Query  193  VKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQI  372
            V +++  +H N++KFI    +P M +VTE++ G SL+++L  I+P  +    AL  AL I
Sbjct  85   VNMMSRVQHPNLVKFIGACKDPLMVIVTELLPGLSLRKYLATIRPQVLHLPLALSFALDI  144

Query  373  SRAMAYLHENGIIHRDLKPNNIFLSES  453
            SRA+  LH NGIIHRDLKP+N+ L+E+
Sbjct  145  SRALDCLHANGIIHRDLKPDNLLLTEN  171



>ref|XP_004137678.1| PREDICTED: serine/threonine-protein kinase HT1-like [Cucumis 
sativus]
 gb|KGN58698.1| hypothetical protein Csa_3G728150 [Cucumis sativus]
Length=373

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 94/148 (64%), Gaps = 1/148 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGTYMDKSVAIKVIETEKGTDESPQKE-RFLREV  195
            ++  L+D   L+ G +I +G    VY G Y ++ VAIKV+      +E    E RF REV
Sbjct  42   DNNLLVDPKLLFIGSKIGEGAHGKVYEGRYRNEIVAIKVLHRGSTPEERAALESRFAREV  101

Query  196  KLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQIS  375
             +++  KH+N++KFI    EP M +VTE++ G SL+++L + +   +D + A+  AL ++
Sbjct  102  NMMSRVKHENLVKFIGACKEPLMVIVTELLPGMSLRKYLMNNRKQQLDPRMAINFALDVA  161

Query  376  RAMAYLHENGIIHRDLKPNNIFLSESKK  459
            RAM  LH NGIIHRDLKP+N+ L+ +++
Sbjct  162  RAMDCLHANGIIHRDLKPDNLLLTANQR  189



>ref|XP_010424001.1| PREDICTED: serine/threonine-protein kinase HT1-like isoform X1 
[Camelina sativa]
Length=350

 Score =   116 bits (291),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 92/147 (63%), Gaps = 2/147 (1%)
 Frame = +1

Query  19   ESKFLIDETELYYGVQISQGVSTTVYFGT-YMDKSVAIKVIETEKGTDE-SPQKERFLRE  192
            +   L+D   L+ G +I QG    VY G+ Y  + VAIKV+      DE S  + RF+RE
Sbjct  25   DQSLLLDPKLLFIGSKIGQGAHGKVYQGSRYGSEIVAIKVVHRGTKPDEKSSLESRFIRE  84

Query  193  VKLLAAAKHDNILKFIAYSVEPAMRLVTEMMTGGSLQRHLWHIKPATMDRKDALVMALQI  372
            V +++  +H N++KFI    +P M +VTE++ G SL+++L  I+P  +    AL  AL I
Sbjct  85   VNMMSRVQHPNLVKFIGACKDPLMVIVTELLPGLSLRKYLATIRPQLLHLPLALSFALDI  144

Query  373  SRAMAYLHENGIIHRDLKPNNIFLSES  453
            SRA+  LH NGIIHRDLKP+N+ L+E+
Sbjct  145  SRALDCLHANGIIHRDLKPDNLLLTEN  171



Lambda      K        H        a         alpha
   0.317    0.133    0.371    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 531634108022