BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25462_g3_i9 len=2024 path=[5006:0-152 11867:153-153 3283:154-207
3337:208-293 3423:294-313 3443:314-344 11937:345-345 3475:346-369
3499:370-452 3582:453-489 3619:490-631 3761:632-783 @3913@!:784-1142
4272:1143-1221 12047:1222-1222 7048:1223-1223 6918:1224-1320
12068:1321-1321 7145:1322-1470 4352:1471-1476 4358:1477-1522
4404:1523-1553 4435:1554-1584 4466:1585-1616 4498:1617-1657
4539:1658-1741 4623:1742-1773 4655:1774-1919 4801:1920-1971
4801:1972-2023]

Length=2024
                                                                      Score     E

ref|XP_009620066.1|  PREDICTED: beta-galactosidase 16                   504   3e-165   
ref|XP_009803576.1|  PREDICTED: beta-galactosidase 16-like isofor...    501   7e-165   
ref|XP_009803571.1|  PREDICTED: beta-galactosidase 16-like isofor...    500   5e-164   
ref|XP_006351141.1|  PREDICTED: beta-galactosidase 16-like              499   2e-163   
ref|XP_009798710.1|  PREDICTED: beta-galactosidase 16-like isofor...    495   2e-163   
ref|XP_009798708.1|  PREDICTED: beta-galactosidase 16-like isofor...    495   1e-161   
ref|XP_004250388.2|  PREDICTED: beta-galactosidase 16-like isofor...    492   6e-161   
ref|XP_010312842.1|  PREDICTED: beta-galactosidase 16-like isofor...    452   4e-147   
ref|XP_011003430.1|  PREDICTED: beta-galactosidase 16-like              458   1e-146   
ref|XP_002306647.2|  beta-galactosidase family protein                  456   5e-146   Populus trichocarpa [western balsam poplar]
emb|CDP10947.1|  unnamed protein product                                454   6e-146   
ref|XP_011003960.1|  PREDICTED: beta-galactosidase 16-like              448   1e-142   
ref|XP_011069386.1|  PREDICTED: beta-galactosidase 16                   448   1e-142   
ref|XP_002521778.1|  beta-galactosidase, putative                       446   1e-141   Ricinus communis
ref|XP_002520337.1|  beta-galactosidase, putative                       443   4e-141   Ricinus communis
ref|XP_006351205.1|  PREDICTED: beta-galactosidase 16-like              442   2e-140   
gb|EYU31765.1|  hypothetical protein MIMGU_mgv1a018569mg                439   6e-139   
ref|XP_010664184.1|  PREDICTED: beta-galactosidase 16-like              439   7e-139   
ref|XP_006434246.1|  hypothetical protein CICLE_v10004034mg             436   6e-138   
ref|XP_006472816.1|  PREDICTED: beta-galactosidase 16-like isofor...    426   2e-136   
ref|XP_007020169.1|  Beta-galactosidase                                 427   3e-136   
ref|XP_008394192.1|  PREDICTED: beta-galactosidase 6                    429   3e-136   
ref|XP_007221984.1|  hypothetical protein PRUPE_ppa002839mg             425   7e-136   
ref|XP_007019138.1|  Beta-galactosidase                                 429   3e-135   
ref|XP_006473025.1|  PREDICTED: beta-galactosidase 16-like              429   3e-135   
ref|XP_009376872.1|  PREDICTED: beta-galactosidase 16                   427   4e-135   
ref|XP_009355859.1|  PREDICTED: beta-galactosidase 6 isoform X2         425   5e-135   
gb|KDP32835.1|  hypothetical protein JCGZ_12127                         427   5e-135   
gb|AAG51670.1|AC010704_14  putative beta-galactosidase, 3' partia...    422   8e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007137444.1|  hypothetical protein PHAVU_009G127500g             425   9e-135   
ref|XP_008219605.1|  PREDICTED: beta-galactosidase 16                   427   1e-134   
gb|KDO80551.1|  hypothetical protein CISIN_1g004533mg                   425   1e-134   
ref|XP_009355858.1|  PREDICTED: beta-galactosidase 6 isoform X1         424   2e-134   
ref|XP_007019137.1|  Beta-galactosidase isoform 2                       422   2e-134   
ref|XP_002284529.2|  PREDICTED: beta-galactosidase 16-like              427   2e-134   Vitis vinifera
ref|XP_007019136.1|  Beta-galactosidase isoform 1                       426   4e-134   
ref|XP_006441550.1|  hypothetical protein CICLE_v10023501mg             425   5e-134   
ref|XP_003527942.1|  PREDICTED: beta-galactosidase 16-like              422   7e-134   
ref|XP_006472815.1|  PREDICTED: beta-galactosidase 16-like isofor...    425   9e-134   
ref|XP_004502496.1|  PREDICTED: beta-galactosidase 16-like              421   1e-133   
emb|CBI18990.3|  unnamed protein product                                425   1e-133   
ref|XP_008338665.1|  PREDICTED: beta-galactosidase 16 isoform X2        422   2e-133   
ref|XP_006434247.1|  hypothetical protein CICLE_v10003478mg             423   3e-133   
ref|XP_002889142.1|  hypothetical protein ARALYDRAFT_476906             423   6e-133   
ref|XP_010063413.1|  PREDICTED: beta-galactosidase 16-like              419   7e-133   
ref|XP_008338663.1|  PREDICTED: beta-galactosidase 16 isoform X1        422   9e-133   
ref|NP_177866.2|  beta-galactosidase 16                                 422   1e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008466741.1|  PREDICTED: beta-galactosidase 16 isoform X1        423   1e-132   
gb|KEH35318.1|  beta-like galactosidase                                 417   1e-132   
ref|XP_010471934.1|  PREDICTED: beta-galactosidase 16-like              422   1e-132   
emb|CDP10946.1|  unnamed protein product                                419   2e-132   
ref|XP_003522573.1|  PREDICTED: beta-galactosidase 16-like              418   2e-132   
dbj|BAC43014.1|  unknown protein                                        422   2e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007212740.1|  hypothetical protein PRUPE_ppa019429mg             410   2e-132   
ref|XP_010312841.1|  PREDICTED: beta-galactosidase 16                   421   5e-132   
ref|XP_010419240.1|  PREDICTED: beta-galactosidase 16                   420   5e-132   
ref|XP_003602061.1|  Beta-galactosidase                                 416   8e-132   
ref|XP_010086721.1|  Beta-galactosidase 6                               417   8e-132   
emb|CAN64508.1|  hypothetical protein VITISV_004610                     419   9e-132   Vitis vinifera
ref|XP_008466742.1|  PREDICTED: beta-galactosidase 16 isoform X2        419   1e-131   
ref|XP_006432094.1|  hypothetical protein CICLE_v10000420mg             416   3e-131   
ref|XP_011027489.1|  PREDICTED: beta-galactosidase 16                   418   5e-131   
ref|XP_010269108.1|  PREDICTED: beta-galactosidase 16-like              416   1e-130   
ref|XP_010428819.1|  PREDICTED: beta-galactosidase 16-like              417   2e-130   
gb|KGN47702.1|  hypothetical protein Csa_6G382900                       416   3e-130   
ref|XP_004171523.1|  PREDICTED: beta-galactosidase 16-like              414   3e-130   
ref|XP_004289501.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    413   4e-130   
gb|KDO80552.1|  hypothetical protein CISIN_1g003612mg                   415   7e-130   
ref|XP_002302225.2|  beta-galactosidase family protein                  415   7e-130   Populus trichocarpa [western balsam poplar]
ref|XP_004149808.1|  PREDICTED: beta-galactosidase 16-like              414   7e-130   
gb|KCW62455.1|  hypothetical protein EUGRSUZ_H05090                     411   1e-129   
ref|XP_004292712.1|  PREDICTED: beta-galactosidase 16-like              414   2e-129   
ref|XP_010243519.1|  PREDICTED: beta-galactosidase 16                   414   2e-129   
ref|XP_010025737.1|  PREDICTED: beta-galactosidase 6 isoform X1         411   2e-129   
ref|XP_008227610.1|  PREDICTED: beta-galactosidase 6                    410   3e-129   
ref|XP_006584660.1|  PREDICTED: beta-galactosidase 6-like isoform X2    407   4e-129   
ref|XP_007048527.1|  Glycosyl hydrolase family 35 protein isoform 1     410   7e-129   
ref|XP_006584659.1|  PREDICTED: beta-galactosidase 6-like isoform X1    407   5e-128   
ref|XP_006301847.1|  hypothetical protein CARUB_v10022317mg             410   6e-128   
ref|XP_007137753.1|  hypothetical protein PHAVU_009G153000g             406   1e-127   
gb|KDP31634.1|  hypothetical protein JCGZ_14859                         408   3e-127   
gb|AAG29193.1|AC078898_3  beta-galactosidase, putative                  407   3e-127   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006376211.1|  beta-galactosidase family protein                  407   3e-127   
ref|XP_006578771.1|  PREDICTED: beta-galactosidase 6-like isoform X3    397   1e-125   
ref|XP_010652936.1|  PREDICTED: beta-galactosidase 6 isoform X2         397   2e-125   
gb|KEH35626.1|  beta-galactosidase-like protein                         395   2e-125   
ref|XP_006578770.1|  PREDICTED: beta-galactosidase 6-like isoform X2    397   1e-124   
ref|XP_003522474.1|  PREDICTED: beta-galactosidase 6-like isoform X1    397   2e-124   
ref|XP_010652935.1|  PREDICTED: beta-galactosidase 6 isoform X1         397   7e-124   
ref|XP_004502987.1|  PREDICTED: beta-galactosidase 6-like isoform X2    392   3e-123   
ref|XP_003602682.1|  Beta-galactosidase                                 394   4e-123   
ref|XP_011031111.1|  PREDICTED: beta-galactosidase 6 isoform X2         390   6e-123   
ref|XP_004502986.1|  PREDICTED: beta-galactosidase 6-like isoform X1    392   2e-122   
ref|XP_003528064.1|  PREDICTED: beta-galactosidase 6-like               392   2e-122   
ref|XP_010674350.1|  PREDICTED: beta-galactosidase 6 isoform X2         390   3e-122   
ref|XP_003630451.1|  Beta-galactosidase                                 390   9e-122   
ref|XP_010674349.1|  PREDICTED: beta-galactosidase 6 isoform X1         390   2e-121   
ref|XP_011031110.1|  PREDICTED: beta-galactosidase 6 isoform X1         389   3e-121   
ref|XP_006390092.1|  hypothetical protein EUTSA_v10018129mg             392   4e-121   
ref|XP_002307056.1|  hypothetical protein POPTR_0005s07020g             387   2e-120   Populus trichocarpa [western balsam poplar]
emb|CBI21611.3|  unnamed protein product                                387   4e-120   
gb|KDO45824.1|  hypothetical protein CISIN_1g0419572mg                  381   2e-119   
gb|KDP24928.1|  hypothetical protein JCGZ_24426                         380   2e-117   
ref|XP_010521259.1|  PREDICTED: beta-galactosidase 6                    376   3e-116   
gb|KHN09646.1|  Beta-galactosidase 3                                    392   3e-116   
ref|XP_008783343.1|  PREDICTED: beta-galactosidase 7-like               375   2e-115   
emb|CDY43756.1|  BnaA06g22920D                                          367   4e-115   
gb|KDO57551.1|  hypothetical protein CISIN_1g0063012mg                  361   2e-114   
emb|CDX84445.1|  BnaC03g50550D                                          370   1e-113   
gb|KDO57552.1|  hypothetical protein CISIN_1g0063012mg                  357   9e-113   
ref|XP_006282368.1|  hypothetical protein CARUB_v10028665mg             365   5e-112   
dbj|BAF01618.1|  beta-galactosidase like protein                        365   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568978.2|  beta-galactosidase 6                                  364   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150443.1|  PREDICTED: beta-galactosidase 6                    365   1e-111   
ref|XP_002864867.1|  beta-galactosidase 6                               363   4e-111   
ref|XP_010444300.1|  PREDICTED: beta-galactosidase 6                    362   1e-110   
gb|KHN35500.1|  Beta-galactosidase 16                                   356   3e-110   
ref|XP_009130274.1|  PREDICTED: beta-galactosidase 6                    360   3e-110   
ref|XP_010095419.1|  Beta-galactosidase 16                              362   3e-110   
emb|CDY31349.1|  BnaA02g33920D                                          361   4e-110   
ref|XP_010484136.1|  PREDICTED: beta-galactosidase 6-like isoform X1    360   5e-110   
ref|XP_010461014.1|  PREDICTED: beta-galactosidase 6-like               360   6e-110   
ref|XP_010484137.1|  PREDICTED: beta-galactosidase 6-like isoform X2    360   6e-110   
gb|KHN47001.1|  Beta-galactosidase 16                                   356   7e-110   
ref|XP_010025738.1|  PREDICTED: beta-galactosidase 6 isoform X2         354   1e-109   
ref|XP_006394241.1|  hypothetical protein EUTSA_v10005464mg             357   4e-109   
emb|CAB64742.1|  putative beta-galactosidase                            357   1e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009385110.1|  PREDICTED: beta-galactosidase 7                    357   7e-108   
emb|CDY39845.1|  BnaC02g42730D                                          353   2e-107   
gb|KFK28074.1|  hypothetical protein AALP_AA8G468900                    353   2e-107   
ref|XP_010547679.1|  PREDICTED: beta-galactosidase 6-like isoform X1    350   6e-106   
ref|XP_010547680.1|  PREDICTED: beta-galactosidase 6-like isoform X2    349   1e-105   
ref|XP_006382885.1|  hypothetical protein POPTR_0005s07020g             342   7e-105   
ref|XP_009386767.1|  PREDICTED: beta-galactosidase 11-like              342   2e-102   
ref|XP_009396587.1|  PREDICTED: beta-galactosidase 11-like              340   3e-102   
ref|XP_006826593.1|  hypothetical protein AMTR_s00138p00054750          343   4e-102   
ref|XP_004961993.1|  PREDICTED: beta-galactosidase 7-like isoform X2    339   6e-101   
ref|XP_002522930.1|  beta-galactosidase, putative                       327   1e-100   Ricinus communis
emb|CAN82672.1|  hypothetical protein VITISV_014349                     330   9e-99    Vitis vinifera
ref|XP_010029662.1|  PREDICTED: beta-galactosidase 13-like              330   4e-98    
ref|XP_008811847.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    333   4e-98    
gb|EMS61058.1|  Beta-galactosidase 7                                    331   7e-98    
ref|XP_009419064.1|  PREDICTED: beta-galactosidase 11-like              329   8e-98    
gb|KCW56611.1|  hypothetical protein EUGRSUZ_I02332                     330   9e-98    
ref|XP_007041848.1|  Beta-galactosidase 14 isoform 2                    326   1e-97    
ref|XP_007041849.1|  Beta-galactosidase 14 isoform 3                    326   2e-97    
ref|XP_009406477.1|  PREDICTED: beta-galactosidase 11-like              328   2e-97    
ref|XP_008447961.1|  PREDICTED: beta-galactosidase 13-like              329   3e-97    
ref|XP_010935389.1|  PREDICTED: beta-galactosidase 11-like              328   1e-96    
gb|ACC64531.1|  beta-galactosidase 6                                    327   1e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_010233215.1|  PREDICTED: beta-galactosidase 7                    327   1e-96    
gb|AAS76480.1|  beta-galactosidase                                      328   1e-96    Gossypium hirsutum [American cotton]
dbj|BAC10578.2|  beta-galactosidase                                     325   1e-96    Capsicum annuum
gb|AAK40304.1|  beta-galactosidase                                      325   2e-96    Capsicum annuum
ref|XP_007048528.1|  Glycosyl hydrolase family 35 protein isoform 2     319   2e-96    
ref|XP_008656263.1|  PREDICTED: beta-galactosidase 7-like isoform X3    322   5e-96    
ref|XP_007041847.1|  Glycosyl hydrolase family 35 protein isoform 1     326   7e-96    
ref|XP_010266335.1|  PREDICTED: beta-galactosidase 13-like              324   2e-95    
ref|XP_006592069.1|  PREDICTED: beta-galactosidase 13-like              324   2e-95    
gb|AAL24374.1|  beta-galactosidase                                      312   2e-95    Arabidopsis thaliana [mouse-ear cress]
gb|KHN25472.1|  Beta-galactosidase 13                                   324   3e-95    
ref|XP_004505828.1|  PREDICTED: beta-galactosidase 13-like              324   3e-95    
ref|XP_010066272.1|  PREDICTED: beta-galactosidase 13-like              322   4e-95    
ref|XP_008656262.1|  PREDICTED: beta-galactosidase 7-like isoform X2    323   6e-95    
ref|XP_008656261.1|  PREDICTED: beta-galactosidase 7-like isoform X1    323   6e-95    
gb|KCW64119.1|  hypothetical protein EUGRSUZ_G01775                     322   1e-94    
ref|XP_004298189.1|  PREDICTED: beta-galactosidase 13-like              321   1e-94    
ref|XP_010090335.1|  Beta-galactosidase 11                              322   2e-94    
ref|XP_004135714.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    319   2e-94    
ref|XP_006590857.1|  PREDICTED: beta-galactosidase 13-like isofor...    321   2e-94    
ref|XP_010941319.1|  PREDICTED: beta-galactosidase 11-like isofor...    321   2e-94    
ref|XP_004961992.1|  PREDICTED: beta-galactosidase 7-like isoform X1    322   3e-94    
ref|XP_010941318.1|  PREDICTED: beta-galactosidase 11-like isofor...    321   3e-94    
ref|XP_006590856.1|  PREDICTED: beta-galactosidase 13-like isofor...    321   4e-94    
ref|XP_004144843.1|  PREDICTED: beta-galactosidase 13-like              319   4e-94    
dbj|BAJ94712.1|  predicted protein                                      317   5e-94    
ref|XP_010093111.1|  Beta-galactosidase 10                              315   6e-94    
ref|XP_008347518.1|  PREDICTED: beta-galactosidase 13-like              319   6e-94    
ref|XP_009396354.1|  PREDICTED: beta-galactosidase 5-like               320   7e-94    
gb|AAB61470.1|  beta-D-galactosidase                                    316   8e-94    Mangifera indica
gb|KGN43246.1|  hypothetical protein Csa_7G011860                       319   1e-93    
ref|XP_004170887.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    317   1e-93    
ref|XP_002514108.1|  beta-galactosidase, putative                       319   2e-93    Ricinus communis
ref|XP_004963754.1|  PREDICTED: beta-galactosidase 7-like               317   3e-93    
ref|XP_006451462.1|  hypothetical protein CICLE_v10007531mg             312   3e-93    
ref|XP_010028723.1|  PREDICTED: beta-galactosidase 13                   317   4e-93    
gb|EMT10431.1|  Beta-galactosidase 7                                    318   4e-93    
ref|XP_008377743.1|  PREDICTED: beta-galactosidase 13                   318   5e-93    
ref|XP_009374634.1|  PREDICTED: beta-galactosidase 13-like              316   5e-93    
gb|KDO57771.1|  hypothetical protein CISIN_1g004219mg                   312   7e-93    
ref|XP_010242207.1|  PREDICTED: beta-galactosidase                      318   7e-93    
gb|KCW55522.1|  hypothetical protein EUGRSUZ_I01412                     317   7e-93    
ref|XP_008450855.1|  PREDICTED: beta-galactosidase-like                 315   8e-93    
ref|XP_006655346.1|  PREDICTED: beta-galactosidase 7-like               316   1e-92    
gb|KDO57766.1|  hypothetical protein CISIN_1g004219mg                   312   2e-92    
gb|KDO65276.1|  hypothetical protein CISIN_1g002867mg                   311   2e-92    
ref|XP_009628690.1|  PREDICTED: beta-galactosidase 3                    317   2e-92    
ref|XP_002310540.2|  beta-galactosidase family protein                  317   2e-92    Populus trichocarpa [western balsam poplar]
gb|KCW53602.1|  hypothetical protein EUGRSUZ_J02867                     312   3e-92    
ref|XP_007201748.1|  hypothetical protein PRUPE_ppa001308mg             316   3e-92    
gb|KDO57770.1|  hypothetical protein CISIN_1g004219mg                   311   4e-92    
ref|XP_002306183.1|  glycosyl hydrolase family 35 family protein        315   5e-92    Populus trichocarpa [western balsam poplar]
gb|KCW53601.1|  hypothetical protein EUGRSUZ_J02867                     312   5e-92    
gb|KDO57764.1|  hypothetical protein CISIN_1g004219mg                   312   6e-92    
tpg|DAA48742.1|  TPA: hypothetical protein ZEAMMB73_126543              312   6e-92    
ref|XP_009789452.1|  PREDICTED: beta-galactosidase 3                    315   6e-92    
ref|XP_008224548.1|  PREDICTED: beta-galactosidase 13-like              315   7e-92    
ref|XP_006451459.1|  hypothetical protein CICLE_v10007531mg             311   8e-92    
gb|KDO65278.1|  hypothetical protein CISIN_1g002867mg                   311   8e-92    
ref|XP_009388558.1|  PREDICTED: beta-galactosidase-like                 312   9e-92    
ref|XP_006838689.1|  hypothetical protein AMTR_s00002p00246870          315   9e-92    
gb|KDO57765.1|  hypothetical protein CISIN_1g004219mg                   311   9e-92    
ref|XP_011083609.1|  PREDICTED: beta-galactosidase 3-like               315   1e-91    
ref|XP_004144120.1|  PREDICTED: beta-galactosidase-like                 313   1e-91    
gb|KDO57763.1|  hypothetical protein CISIN_1g004219mg                   312   1e-91    
ref|XP_011045966.1|  PREDICTED: beta-galactosidase-like isoform X2      314   1e-91    
ref|XP_007224244.1|  hypothetical protein PRUPE_ppa019277mg             313   2e-91    
ref|XP_009376956.1|  PREDICTED: beta-galactosidase 11-like              314   2e-91    
ref|XP_006451461.1|  hypothetical protein CICLE_v10007531mg             311   2e-91    
ref|XP_011045964.1|  PREDICTED: beta-galactosidase-like isoform X1      315   2e-91    
gb|ACC60981.1|  beta-galactosidase 1 precursor                          313   2e-91    Petunia x hybrida [garden petunia]
ref|XP_002308268.2|  hypothetical protein POPTR_0006s14680g             313   3e-91    Populus trichocarpa [western balsam poplar]
gb|KDO71286.1|  hypothetical protein CISIN_1g045037mg                   313   3e-91    
ref|XP_003523495.1|  PREDICTED: beta-galactosidase 13                   313   3e-91    
gb|KHN33673.1|  Beta-galactosidase 13                                   313   3e-91    
gb|KDP33829.1|  hypothetical protein JCGZ_07400                         313   4e-91    
ref|XP_006467171.1|  PREDICTED: beta-galactosidase 13-like              313   4e-91    
ref|XP_008236010.1|  PREDICTED: beta-galactosidase 11-like              313   4e-91    
ref|XP_008224549.1|  PREDICTED: beta-galactosidase 13-like              313   4e-91    
ref|XP_011046693.1|  PREDICTED: beta-galactosidase 13-like              313   4e-91    
ref|XP_010911843.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    313   5e-91    
dbj|BAF31233.1|  beta-D-galactosidase                                   313   5e-91    Persea americana
ref|XP_006340680.1|  PREDICTED: beta-galactosidase 3-like               313   5e-91    
ref|XP_011046271.1|  PREDICTED: beta-galactosidase 13-like              313   5e-91    
ref|XP_002445734.1|  hypothetical protein SORBIDRAFT_07g024870          313   5e-91    Sorghum bicolor [broomcorn]
ref|XP_010049746.1|  PREDICTED: beta-galactosidase-like                 310   6e-91    
ref|XP_007131709.1|  hypothetical protein PHAVU_011G035300g             312   7e-91    
ref|XP_011072090.1|  PREDICTED: beta-galactosidase 10                   313   7e-91    
ref|XP_010106660.1|  Beta-galactosidase 1                               312   7e-91    
gb|AHG94611.1|  beta-galactosidase                                      312   7e-91    
ref|XP_003607189.1|  Beta-galactosidase                                 312   8e-91    
gb|ADO34791.1|  beta-galactosidase STBG6                                312   8e-91    
ref|XP_007012844.1|  Beta-galactosidase                                 312   8e-91    
ref|XP_011022866.1|  PREDICTED: beta-galactosidase 10                   312   8e-91    
ref|NP_001234317.1|  TBG6 protein precursor                             312   8e-91    
ref|XP_002305449.1|  beta-galactosidase family protein                  310   9e-91    Populus trichocarpa [western balsam poplar]
gb|AAQ21370.1|  beta-galactosidase                                      305   9e-91    Sandersonia aurantiaca [Chinese-lantern lily]
ref|XP_008663872.1|  PREDICTED: uncharacterized protein LOC100194...    312   9e-91    
ref|XP_010033786.1|  PREDICTED: beta-galactosidase 1-like               312   9e-91    
ref|XP_006426535.1|  hypothetical protein CICLE_v10024886mg             312   1e-90    
gb|KDO65277.1|  hypothetical protein CISIN_1g002867mg                   311   1e-90    
ref|XP_006466038.1|  PREDICTED: beta-galactosidase 1-like               311   1e-90    
ref|NP_001275845.1|  beta-galactosidase                                 309   2e-90    
gb|KDO65274.1|  hypothetical protein CISIN_1g002867mg                   311   2e-90    
ref|XP_008799994.1|  PREDICTED: beta-galactosidase 5-like               311   2e-90    
ref|XP_007046795.1|  Beta-galactosidase 3 isoform 2                     307   3e-90    
ref|XP_009627536.1|  PREDICTED: beta-galactosidase                      311   3e-90    
ref|XP_011037170.1|  PREDICTED: beta-galactosidase 5-like               309   3e-90    
ref|XP_007024475.1|  Beta galactosidase 1                               310   4e-90    
dbj|BAK07425.1|  predicted protein                                      310   4e-90    
sp|P45582.1|BGAL_ASPOF  RecName: Full=Beta-galactosidase; Short=L...    310   5e-90    Asparagus officinalis
ref|XP_009783993.1|  PREDICTED: beta-galactosidase                      310   6e-90    
ref|XP_006425408.1|  hypothetical protein CICLE_v10026929mg             309   7e-90    
ref|XP_002312963.1|  glycosyl hydrolase family 35 family protein        309   8e-90    Populus trichocarpa [western balsam poplar]
ref|XP_009762312.1|  PREDICTED: beta-galactosidase-like                 306   8e-90    
ref|XP_010917686.1|  PREDICTED: beta-galactosidase 5-like               310   8e-90    
ref|XP_010654522.1|  PREDICTED: beta-galactosidase 1                    310   9e-90    
ref|XP_008811843.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    310   9e-90    
ref|XP_009395554.1|  PREDICTED: beta-galactosidase 5                    309   9e-90    
emb|CBI35944.3|  unnamed protein product                                309   9e-90    
gb|AGR44464.1|  beta-D-galactosidase 5                                  306   1e-89    
gb|KHG11061.1|  Beta-galactosidase 5 -like protein                      306   1e-89    
ref|XP_006486854.1|  PREDICTED: beta-galactosidase 13-like              309   1e-89    
ref|XP_009599425.1|  PREDICTED: beta-galactosidase-like                 306   2e-89    
ref|XP_008677698.1|  PREDICTED: uncharacterized protein LOC100384...    309   2e-89    
gb|KGN66240.1|  hypothetical protein Csa_1G588000                       306   2e-89    
gb|KHG26973.1|  Beta-galactosidase 13 -like protein                     308   2e-89    
gb|ABR16628.1|  unknown                                                 308   2e-89    Picea sitchensis
ref|XP_007221604.1|  hypothetical protein PRUPE_ppa026900mg             308   2e-89    
ref|XP_004292170.1|  PREDICTED: beta-galactosidase 13-like              306   2e-89    
ref|XP_006422606.1|  hypothetical protein CICLE_v10030124mg             308   3e-89    
gb|KGN48881.1|  hypothetical protein Csa_6G504610                       306   3e-89    
ref|XP_002278545.1|  PREDICTED: beta-galactosidase 13                   308   3e-89    
emb|CAC44500.1|  beta-galactosidase                                     307   4e-89    
gb|KDP29648.1|  hypothetical protein JCGZ_18810                         306   5e-89    
ref|XP_007046794.1|  Beta-galactosidase 3 isoform 1                     308   5e-89    
gb|ADV41669.1|  beta-D-galactosidase                                    305   5e-89    
gb|AHG94613.1|  beta-galactosidase                                      304   6e-89    
ref|XP_007204246.1|  hypothetical protein PRUPE_ppa002271mg             303   7e-89    
ref|XP_006426534.1|  hypothetical protein CICLE_v10024886mg             307   7e-89    
ref|NP_001234303.1|  beta-galactosidase precursor                       306   8e-89    
ref|XP_009631007.1|  PREDICTED: beta-galactosidase 13-like              306   8e-89    
ref|XP_002989069.1|  hypothetical protein SELMODRAFT_269483             304   8e-89    
gb|ADO34788.1|  beta-galactosidase STBG3                                306   9e-89    
ref|XP_002441139.1|  hypothetical protein SORBIDRAFT_09g021140          305   1e-88    
ref|XP_009784203.1|  PREDICTED: beta-galactosidase 13-like              306   1e-88    
gb|EPS69033.1|  beta-galactosidase                                      303   1e-88    
ref|XP_009402923.1|  PREDICTED: beta-galactosidase-like                 304   1e-88    
ref|XP_011088601.1|  PREDICTED: beta-galactosidase 13                   306   1e-88    
ref|XP_007137346.1|  hypothetical protein PHAVU_009G119400g             306   1e-88    
ref|XP_010235388.1|  PREDICTED: beta-galactosidase 11-like              306   1e-88    
ref|XP_004241849.1|  PREDICTED: beta-galactosidase-like                 306   1e-88    
ref|XP_009418405.1|  PREDICTED: beta-galactosidase 5-like isoform X2    306   2e-88    
ref|XP_008809207.1|  PREDICTED: beta-galactosidase 5-like               306   2e-88    
ref|XP_010667155.1|  PREDICTED: putative beta-galactosidase             303   2e-88    
dbj|BAD91082.1|  beta-D-galactosidase                                   306   2e-88    
ref|XP_011072510.1|  PREDICTED: beta-galactosidase-like                 305   3e-88    
ref|NP_001266133.1|  beta-galactosidase-like                            303   3e-88    
gb|KDO71054.1|  hypothetical protein CISIN_1g003044mg                   300   3e-88    
ref|XP_006366152.1|  PREDICTED: beta-galactosidase-like                 305   3e-88    
ref|XP_009622143.1|  PREDICTED: beta-galactosidase-like                 305   3e-88    
ref|XP_007137348.1|  hypothetical protein PHAVU_009G119600g             305   4e-88    
ref|XP_002527409.1|  beta-galactosidase, putative                       305   4e-88    
ref|XP_004149980.1|  PREDICTED: beta-galactosidase 3-like               305   4e-88    
ref|XP_008674765.1|  PREDICTED: beta-galactosidase 7 isoform X1         305   4e-88    
ref|XP_008242341.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    305   4e-88    
ref|XP_010536861.1|  PREDICTED: beta-galactosidase 12                   302   4e-88    
emb|CDO96919.1|  unnamed protein product                                305   4e-88    
ref|XP_006342989.1|  PREDICTED: beta-galactosidase-like                 305   4e-88    
ref|XP_004146490.1|  PREDICTED: beta-galactosidase 3-like               305   5e-88    
gb|KHG25378.1|  Beta-galactosidase 1 -like protein                      305   5e-88    
ref|XP_008452119.1|  PREDICTED: beta-galactosidase 3-like               305   5e-88    
ref|XP_006357461.1|  PREDICTED: beta-galactosidase-like                 305   6e-88    
ref|XP_004287850.1|  PREDICTED: beta-galactosidase 3-like               305   6e-88    
ref|XP_007204656.1|  hypothetical protein PRUPE_ppa001412mg             304   6e-88    
ref|XP_004158465.1|  PREDICTED: beta-galactosidase-like                 310   6e-88    
ref|XP_011092826.1|  PREDICTED: beta-galactosidase 3                    302   7e-88    
gb|AIZ46896.1|  beta-galactosidase                                      294   8e-88    
ref|XP_009757670.1|  PREDICTED: beta-galactosidase-like isoform X1      304   8e-88    
ref|XP_009757671.1|  PREDICTED: beta-galactosidase-like isoform X2      304   8e-88    
ref|XP_010939579.1|  PREDICTED: beta-galactosidase 2-like               303   1e-87    
ref|XP_011000791.1|  PREDICTED: beta-galactosidase 1-like               304   1e-87    
ref|XP_002994069.1|  hypothetical protein SELMODRAFT_187747             301   1e-87    
gb|KDP41747.1|  hypothetical protein JCGZ_26765                         300   1e-87    
ref|XP_006487343.1|  PREDICTED: beta-galactosidase 3-like               301   1e-87    
ref|XP_009409593.1|  PREDICTED: beta-galactosidase-like                 301   1e-87    
gb|EYU45851.1|  hypothetical protein MIMGU_mgv1a002308mg                300   1e-87    
ref|NP_001062440.1|  Os08g0549200                                       303   1e-87    
gb|KFK30139.1|  hypothetical protein AALP_AA7G221900                    303   1e-87    
ref|XP_006342225.1|  PREDICTED: beta-galactosidase 3-like               301   1e-87    
ref|XP_003538867.1|  PREDICTED: beta-galactosidase 3-like               303   2e-87    
gb|AFD54987.1|  beta-galactosidase                                      300   2e-87    
gb|KGN66239.1|  hypothetical protein Csa_1G587990                       298   2e-87    
gb|KHN36067.1|  Beta-galactosidase 3                                    303   2e-87    
ref|XP_010275526.1|  PREDICTED: beta-galactosidase 3-like               303   2e-87    
ref|NP_001046310.1|  Os02g0219200                                       294   2e-87    
ref|XP_003517202.1|  PREDICTED: beta-galactosidase 3-like               303   2e-87    
ref|XP_004166954.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    298   2e-87    
ref|XP_009408846.1|  PREDICTED: beta-galactosidase-like                 300   2e-87    
gb|AAW47739.1|  beta-galactosidase                                      303   2e-87    
ref|XP_010313633.1|  PREDICTED: ss-galactosidase isoform X1             296   2e-87    
gb|AHC32021.1|  beta-galactosidase 3                                    304   2e-87    
ref|XP_006660363.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    303   2e-87    
ref|XP_010049745.1|  PREDICTED: beta-galactosidase-like                 300   2e-87    
gb|KHN41933.1|  Beta-galactosidase 3                                    303   2e-87    
ref|XP_008338023.1|  PREDICTED: beta-galactosidase 3-like               303   2e-87    
ref|XP_010234045.1|  PREDICTED: beta-galactosidase 4                    300   2e-87    
gb|EPS74283.1|  beta-galactosidase                                      302   2e-87    
ref|XP_011080179.1|  PREDICTED: beta-galactosidase-like                 303   2e-87    
gb|KHG11296.1|  Beta-galactosidase                                      300   2e-87    
gb|KDP33831.1|  hypothetical protein JCGZ_07402                         302   2e-87    
ref|XP_008241765.1|  PREDICTED: beta-galactosidase 3                    303   2e-87    
ref|XP_009409594.1|  PREDICTED: beta-galactosidase-like                 300   3e-87    
ref|XP_010431800.1|  PREDICTED: beta-galactosidase 14                   304   3e-87    
ref|XP_009789773.1|  PREDICTED: beta-galactosidase-like                 303   3e-87    
gb|ACC78255.1|  beta-galactosidase                                      300   3e-87    
gb|EYU32887.1|  hypothetical protein MIMGU_mgv1a001295mg                302   4e-87    
ref|XP_004158882.1|  PREDICTED: beta-galactosidase 3-like               302   4e-87    
gb|AAC77377.1|  beta-galactosidase precursor                            300   4e-87    
ref|XP_010049744.1|  PREDICTED: beta-galactosidase-like                 299   4e-87    
ref|XP_006385360.1|  beta-galactosidase 1 family protein                302   4e-87    
gb|EEE69115.1|  hypothetical protein OsJ_28192                          302   4e-87    
ref|XP_004292017.1|  PREDICTED: beta-galactosidase 3-like               302   4e-87    
gb|ABK96254.1|  unknown                                                 302   4e-87    
ref|XP_009611028.1|  PREDICTED: beta-galactosidase-like isoform X2      302   4e-87    
ref|XP_006649450.1|  PREDICTED: beta-galactosidase 5-like               302   5e-87    
ref|XP_010446366.1|  PREDICTED: beta-galactosidase 14-like              303   5e-87    
ref|NP_001234465.1|  beta-galactosidase precursor                       301   5e-87    
ref|XP_009409595.1|  PREDICTED: beta-galactosidase-like                 299   6e-87    
ref|XP_009606115.1|  PREDICTED: beta-galactosidase-like                 302   6e-87    
emb|CDP01954.1|  unnamed protein product                                302   6e-87    
ref|XP_010932916.1|  PREDICTED: beta-galactosidase 5-like               301   6e-87    
ref|XP_009761050.1|  PREDICTED: beta-galactosidase 5                    299   6e-87    
gb|ABF94150.1|  Beta-galactosidase precursor, putative, expressed       301   6e-87    
gb|EYU21377.1|  hypothetical protein MIMGU_mgv1a001631mg                300   6e-87    
ref|XP_008440778.1|  PREDICTED: beta-galactosidase 3                    302   7e-87    
ref|XP_009769408.1|  PREDICTED: beta-galactosidase-like                 301   7e-87    
gb|EEE58382.1|  hypothetical protein OsJ_09539                          301   7e-87    
gb|EEC74580.1|  hypothetical protein OsI_10152                          301   7e-87    
gb|AES74289.2|  glycoside hydrolase family 35 protein                   301   7e-87    
ref|NP_001049068.1|  Os03g0165400                                       301   8e-87    
ref|XP_011092985.1|  PREDICTED: beta-galactosidase 13-like              300   8e-87    
gb|ACC60982.1|  beta-galactosidase 2 precursor                          301   9e-87    
ref|XP_006856693.1|  hypothetical protein AMTR_s00054p00149030          297   9e-87    
ref|XP_004135712.1|  PREDICTED: beta-galactosidase-like                 298   1e-86    
gb|KHN31191.1|  Beta-galactosidase 6                                    291   1e-86    
ref|XP_009764615.1|  PREDICTED: beta-galactosidase 13-like              301   1e-86    
gb|AGW47883.1|  beta-galactosidase precursor                            301   1e-86    
emb|CDO97918.1|  unnamed protein product                                300   1e-86    
ref|XP_010262131.1|  PREDICTED: beta-galactosidase isoform X1           301   1e-86    
ref|XP_010262132.1|  PREDICTED: beta-galactosidase isoform X2           300   2e-86    
gb|ABV32546.1|  beta-galactosidase protein 1                            300   2e-86    
ref|XP_009407297.1|  PREDICTED: beta-galactosidase 2                    300   2e-86    
gb|KHF99404.1|  Beta-galactosidase 1 -like protein                      300   2e-86    
gb|EYU24087.1|  hypothetical protein MIMGU_mgv1a001258mg                300   2e-86    
ref|XP_010436953.1|  PREDICTED: beta-galactosidase 14-like isofor...    301   2e-86    
ref|NP_001043405.1|  Os01g0580200                                       300   2e-86    
ref|XP_004512085.1|  PREDICTED: beta-galactosidase 3-like               300   2e-86    
ref|XP_008450853.1|  PREDICTED: beta-galactosidase-like                 298   2e-86    
gb|KDO71053.1|  hypothetical protein CISIN_1g003044mg                   300   2e-86    
ref|XP_009372992.1|  PREDICTED: beta-galactosidase 3-like               299   2e-86    
gb|EEE54862.1|  hypothetical protein OsJ_02342                          300   2e-86    
ref|XP_011092984.1|  PREDICTED: beta-galactosidase 13-like              300   2e-86    
gb|ABY71826.1|  beta-galactosidase                                      300   2e-86    
ref|NP_001265889.1|  beta-galactosidase-like precursor                  298   2e-86    
ref|XP_006826783.1|  hypothetical protein AMTR_s00136p00108810          298   2e-86    
ref|XP_003632537.1|  PREDICTED: beta-galactosidase 10                   300   2e-86    
ref|XP_009367552.1|  PREDICTED: beta-galactosidase 1                    300   2e-86    
ref|XP_009611026.1|  PREDICTED: beta-galactosidase-like isoform X1      300   3e-86    
ref|XP_010315380.1|  PREDICTED: beta-galactosidase 13-like              298   3e-86    
ref|XP_009605185.1|  PREDICTED: beta-galactosidase 13-like              300   3e-86    
ref|XP_003548865.1|  PREDICTED: beta-galactosidase 3-like               300   3e-86    
ref|XP_006425593.1|  hypothetical protein CICLE_v10024881mg             300   3e-86    
ref|XP_010243525.1|  PREDICTED: beta-galactosidase 3 isoform X2         299   3e-86    
ref|XP_008775429.1|  PREDICTED: beta-galactosidase 2-like               300   3e-86    
gb|KDO71052.1|  hypothetical protein CISIN_1g003044mg                   300   3e-86    
gb|KHN00504.1|  Beta-galactosidase 3                                    300   3e-86    
emb|CDO97013.1|  unnamed protein product                                297   4e-86    
pdb|3W5F|A  Chain A, Crystal Structure Of Tomato Beta-galactosida...    296   4e-86    
ref|XP_003520277.1|  PREDICTED: beta-galactosidase 3-like               300   4e-86    
ref|XP_010107841.1|  Beta-galactosidase 3                               300   4e-86    
ref|XP_007138730.1|  hypothetical protein PHAVU_009G232500g             296   4e-86    
ref|XP_004974148.1|  PREDICTED: beta-galactosidase 11-like              300   5e-86    
ref|XP_004135819.1|  PREDICTED: beta-galactosidase-like                 295   5e-86    
ref|XP_008450854.1|  PREDICTED: beta-galactosidase-like                 296   5e-86    
gb|KHN27041.1|  Beta-galactosidase 3                                    299   5e-86    
ref|XP_008382310.1|  PREDICTED: beta-galactosidase 5-like               299   5e-86    
ref|XP_006648459.1|  PREDICTED: beta-galactosidase 4-like               297   6e-86    
gb|AFW81867.1|  hypothetical protein ZEAMMB73_495459                    297   6e-86    
gb|KDO57762.1|  hypothetical protein CISIN_1g004219mg                   297   6e-86    
ref|XP_010548094.1|  PREDICTED: beta-galactosidase 11                   299   6e-86    
gb|AAC25984.1|  beta-galactosidase                                      296   6e-86    
ref|XP_008337843.1|  PREDICTED: beta-galactosidase 3                    299   7e-86    
ref|XP_004500970.1|  PREDICTED: beta-galactosidase 5-like isoform X2    294   7e-86    
gb|EYU40437.1|  hypothetical protein MIMGU_mgv1a002461mg                295   7e-86    
dbj|BAF00686.1|  beta-galactosidase                                     291   7e-86    
gb|ABV32545.1|  beta-galactosidase protein 2                            299   7e-86    
ref|XP_010542431.1|  PREDICTED: beta-galactosidase 1-like               299   7e-86    
gb|KCW82506.1|  hypothetical protein EUGRSUZ_C03898                     295   7e-86    
ref|XP_004966041.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    296   7e-86    
ref|XP_007217146.1|  hypothetical protein PRUPE_ppa001382mg             299   7e-86    
ref|XP_010243524.1|  PREDICTED: beta-galactosidase 10 isoform X1        299   8e-86    
gb|ADO34789.1|  beta-galactosidase STBG4                                296   8e-86    
ref|XP_008391326.1|  PREDICTED: beta-galactosidase 1                    299   8e-86    
gb|KDO84692.1|  hypothetical protein CISIN_1g003076mg                   294   8e-86    
ref|NP_001234842.1|  ss-galactosidase precursor                         296   8e-86    
ref|XP_006451460.1|  hypothetical protein CICLE_v10007531mg             297   9e-86    
ref|XP_006423393.1|  hypothetical protein CICLE_v10030257mg             296   9e-86    
ref|XP_002282132.1|  PREDICTED: beta-galactosidase                      298   9e-86    
ref|XP_006369293.1|  beta-galactosidase 1 family protein                298   9e-86    
gb|AFW65678.1|  hypothetical protein ZEAMMB73_601729                    286   9e-86    
gb|KDO57550.1|  hypothetical protein CISIN_1g004525mg                   296   9e-86    
gb|KDP44674.1|  hypothetical protein JCGZ_19489                         298   9e-86    
gb|KDO57549.1|  hypothetical protein CISIN_1g004525mg                   296   1e-85    
emb|CBI27912.3|  unnamed protein product                                298   1e-85    
gb|KEH36209.1|  beta-galactosidase-like protein                         296   1e-85    
ref|XP_009603021.1|  PREDICTED: beta-galactosidase 5                    296   1e-85    
dbj|BAF31234.1|  beta-D-galactosidase                                   298   1e-85    
emb|CAC13966.1|  putative beta-galactosidase                            295   1e-85    
gb|KGN66238.1|  hypothetical protein Csa_1G587980                       294   1e-85    
ref|XP_011077976.1|  PREDICTED: beta-galactosidase-like                 296   1e-85    
ref|XP_010432357.1|  PREDICTED: beta-galactosidase 11-like              298   1e-85    
ref|XP_006432095.1|  hypothetical protein CICLE_v10000393mg             296   1e-85    
ref|XP_007042086.1|  Beta-galactosidase 3 isoform 4                     291   1e-85    
ref|XP_004150073.1|  PREDICTED: beta-galactosidase 3-like               298   1e-85    
ref|XP_006464917.1|  PREDICTED: beta-galactosidase 10-like isofor...    296   1e-85    
ref|XP_008451151.1|  PREDICTED: beta-galactosidase-like                 292   1e-85    
ref|XP_008799173.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    298   1e-85    
gb|KDO84694.1|  hypothetical protein CISIN_1g003076mg                   293   2e-85    
ref|XP_010447011.1|  PREDICTED: beta-galactosidase 11                   298   2e-85    
ref|XP_011010891.1|  PREDICTED: beta-galactosidase 1-like               298   2e-85    
ref|XP_004238611.1|  PREDICTED: beta-galactosidase 5                    295   2e-85    
sp|Q6Z6K4.1|BGAL4_ORYSJ  RecName: Full=Beta-galactosidase 4; Shor...    295   2e-85    
ref|XP_008460809.1|  PREDICTED: beta-galactosidase 10                   298   2e-85    
emb|CDP18451.1|  unnamed protein product                                295   2e-85    
ref|XP_002522927.1|  beta-galactosidase, putative                       297   2e-85    
ref|XP_010436954.1|  PREDICTED: beta-galactosidase 14-like isofor...    293   2e-85    
sp|A2X2H7.1|BGAL4_ORYSI  RecName: Full=Beta-galactosidase 4; Shor...    295   2e-85    
ref|XP_003589081.1|  Beta-galactosidase                                 291   2e-85    
gb|KDO65275.1|  hypothetical protein CISIN_1g002867mg                   298   2e-85    
ref|XP_008228300.1|  PREDICTED: beta-galactosidase 1                    297   2e-85    
gb|EYU22313.1|  hypothetical protein MIMGU_mgv1a001532mg                296   2e-85    
ref|XP_004147332.1|  PREDICTED: beta-galactosidase 3-like               297   3e-85    
gb|KDO68060.1|  hypothetical protein CISIN_1g035496mg                   297   3e-85    
emb|CDY70118.1|  BnaA07g36410D                                          291   3e-85    
ref|XP_008793242.1|  PREDICTED: beta-galactosidase                      297   3e-85    
ref|XP_008460995.1|  PREDICTED: beta-galactosidase 5-like               297   3e-85    
ref|XP_006380782.1|  hypothetical protein POPTR_0007s13540g             292   3e-85    
ref|XP_007042085.1|  Beta-galactosidase 3 isoform 3                     291   3e-85    
ref|XP_004158444.1|  PREDICTED: LOW QUALITY PROTEIN: beta-galacto...    295   3e-85    



>ref|XP_009620066.1| PREDICTED: beta-galactosidase 16 [Nicotiana tomentosiformis]
Length=713

 Score =   504 bits (1297),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 248/358 (69%), Positives = 299/358 (84%), Gaps = 2/358 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +A +RSAEDIA+HVALFIARKNG++INYYMYHGGTNFGRTAA FMITSYYDQAP
Sbjct  264   YQVYGQNATLRSAEDIAYHVALFIARKNGTFINYYMYHGGTNFGRTAAEFMITSYYDQAP  323

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAA+K+CS+ +LS  PS  SL + Q+AYVF GD SGACAAFL
Sbjct  324   LDEYGLIRQPKWGHLKELHAAVKLCSETILSVFPSMQSLGEQQEAYVFSGD-SGACAAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D   S  VQFQNSSY+LP +SISILPDCKTV+FNTAKV+   NTRT  PA+KFDS E
Sbjct  383   VNIDNTKSVLVQFQNSSYELPRQSISILPDCKTVSFNTAKVSRPFNTRTAIPAVKFDSAE  442

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSA-ISVESLG  871
             +WE+F+E++   D T++R+D LL+H+NT KDVSDYLWYT S+QQ+S D +S  +SV+SLG
Sbjct  443   KWEQFQEVIPQLDATSMRSDILLEHMNTAKDVSDYLWYTSSIQQDSPDQQSVTLSVKSLG  502

Query  872   HVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             HVLH FVNG  AGSAHG FRN+SFTLEST+SLNKG NNISLLSATVGLP+SG++LEH+ L
Sbjct  503   HVLHAFVNGAHAGSAHGQFRNTSFTLESTISLNKGTNNISLLSATVGLPDSGSFLEHRAL  562

Query  1052  GPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPLIWYK  1225
             G + V I+ S+ +++++N SWGYQVGLLGE LQIY+ +GS +  W    SSQPL WYK
Sbjct  563   GVQSVIIQDSDEAKNITNYSWGYQVGLLGEKLQIYSSEGSKSANWSSLGSSQPLTWYK  620


 Score =   145 bits (366),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             ++ FD PEG+DP+ALNLGSMGKGEAWVNGQSIGRYWVS+ T+AG PSQTWYNVPRSFL+P
Sbjct  620   KSAFDAPEGDDPVALNLGSMGKGEAWVNGQSIGRYWVSFRTLAGIPSQTWYNVPRSFLQP  679

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               NLLVLFEEE GNP  IT+D +S+T
Sbjct  680   GDNLLVLFEEETGNPLDITVDTISVT  705



>ref|XP_009803576.1| PREDICTED: beta-galactosidase 16-like isoform X2 [Nicotiana sylvestris]
Length=667

 Score =   501 bits (1289),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 248/358 (69%), Positives = 302/358 (84%), Gaps = 2/358 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +A +RSAEDIA+HVALFIARKNG++INYYMYHGGTNFGRTAA FMITSYYDQAP
Sbjct  218   YQVYGQNATLRSAEDIAYHVALFIARKNGTFINYYMYHGGTNFGRTAAEFMITSYYDQAP  277

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAA+K+CS+ +LS  PS  SL + Q+AYVF GD SGACAAFL
Sbjct  278   LDEYGLIRQPKWGHLKELHAAVKLCSETILSVFPSMQSLGEQQEAYVFSGD-SGACAAFL  336

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D + S  VQFQNSSY+LP +SISILPDCKTV+FNTAKV+TQ NTRT  PA++FD+ E
Sbjct  337   VNIDNRKSVLVQFQNSSYELPRQSISILPDCKTVSFNTAKVSTQFNTRTALPAVQFDAAE  396

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSA-ISVESLG  871
             +WE+F+E++   D T++R+D LL+H+NTTKDVSDYLWYT S+QQ+  D +S  +SV+SLG
Sbjct  397   KWEQFQEVIPQLDATSLRSDILLEHMNTTKDVSDYLWYTSSIQQDLPDQQSVTLSVKSLG  456

Query  872   HVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             HVLH FVN E AGSAHG FRN+SFTLEST+SLNKG NNISLLSATVGLP+SG++LEH+ L
Sbjct  457   HVLHAFVNREHAGSAHGQFRNTSFTLESTISLNKGTNNISLLSATVGLPDSGSFLEHRAL  516

Query  1052  GPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPLIWYK  1225
             G + V I+ +  +++++N SWGYQVGLLGE LQIY+ +GS +  W   SSSQPL WYK
Sbjct  517   GVQSVIIQDNSEAKNITNYSWGYQVGLLGEKLQIYSSEGSKSANWSSLSSSQPLTWYK  574


 Score =   144 bits (362),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             ++ FD PEG+DP+ALNLGSMGKGEAWVNGQSIGRYWVS+ T+AG PSQTWY VPRSFL+P
Sbjct  574   KSAFDAPEGDDPIALNLGSMGKGEAWVNGQSIGRYWVSFRTLAGIPSQTWYKVPRSFLQP  633

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               NLLVLFEEE GNP  IT+D +S+T
Sbjct  634   GDNLLVLFEEETGNPLDITVDTISVT  659



>ref|XP_009803571.1| PREDICTED: beta-galactosidase 16-like isoform X1 [Nicotiana sylvestris]
Length=715

 Score =   500 bits (1288),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 248/358 (69%), Positives = 302/358 (84%), Gaps = 2/358 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +A +RSAEDIA+HVALFIARKNG++INYYMYHGGTNFGRTAA FMITSYYDQAP
Sbjct  266   YQVYGQNATLRSAEDIAYHVALFIARKNGTFINYYMYHGGTNFGRTAAEFMITSYYDQAP  325

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAA+K+CS+ +LS  PS  SL + Q+AYVF GD SGACAAFL
Sbjct  326   LDEYGLIRQPKWGHLKELHAAVKLCSETILSVFPSMQSLGEQQEAYVFSGD-SGACAAFL  384

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D + S  VQFQNSSY+LP +SISILPDCKTV+FNTAKV+TQ NTRT  PA++FD+ E
Sbjct  385   VNIDNRKSVLVQFQNSSYELPRQSISILPDCKTVSFNTAKVSTQFNTRTALPAVQFDAAE  444

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSA-ISVESLG  871
             +WE+F+E++   D T++R+D LL+H+NTTKDVSDYLWYT S+QQ+  D +S  +SV+SLG
Sbjct  445   KWEQFQEVIPQLDATSLRSDILLEHMNTTKDVSDYLWYTSSIQQDLPDQQSVTLSVKSLG  504

Query  872   HVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             HVLH FVN E AGSAHG FRN+SFTLEST+SLNKG NNISLLSATVGLP+SG++LEH+ L
Sbjct  505   HVLHAFVNREHAGSAHGQFRNTSFTLESTISLNKGTNNISLLSATVGLPDSGSFLEHRAL  564

Query  1052  GPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPLIWYK  1225
             G + V I+ +  +++++N SWGYQVGLLGE LQIY+ +GS +  W   SSSQPL WYK
Sbjct  565   GVQSVIIQDNSEAKNITNYSWGYQVGLLGEKLQIYSSEGSKSANWSSLSSSQPLTWYK  622


 Score =   144 bits (362),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             ++ FD PEG+DP+ALNLGSMGKGEAWVNGQSIGRYWVS+ T+AG PSQTWY VPRSFL+P
Sbjct  622   KSAFDAPEGDDPIALNLGSMGKGEAWVNGQSIGRYWVSFRTLAGIPSQTWYKVPRSFLQP  681

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               NLLVLFEEE GNP  IT+D +S+T
Sbjct  682   GDNLLVLFEEETGNPLDITVDTISVT  707



>ref|XP_006351141.1| PREDICTED: beta-galactosidase 16-like [Solanum tuberosum]
Length=707

 Score =   499 bits (1284),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 244/357 (68%), Positives = 295/357 (83%), Gaps = 1/357 (0%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +A +RSAED+A+HVALFIARKNG++INYYMYHGGTNFGRTAA +MITSYYDQAP
Sbjct  259   YQVYGQNATLRSAEDMAYHVALFIARKNGTFINYYMYHGGTNFGRTAAEYMITSYYDQAP  318

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELH A+K+CS+ +LS  PS  SL + Q+AYVF GDS GACAAFL
Sbjct  319   LDEYGLIRQPKWGHLKELHEAVKLCSETILSVFPSMQSLGEQQEAYVFSGDS-GACAAFL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D   S  VQFQNSSY+LP KSISILPDCKTVAFNTAKV+TQ NTR   PA+KFD+ E
Sbjct  378   VNMDNTKSVVVQFQNSSYELPRKSISILPDCKTVAFNTAKVSTQFNTRITIPAIKFDAAE  437

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE+FEE++  FD T +R+D LL+H+NTTKDVSDYLWYT S+QQ+S + +S +SV+SLGH
Sbjct  438   KWEQFEEVIPQFDATTLRSDVLLEHMNTTKDVSDYLWYTSSIQQDSMEQQSTLSVKSLGH  497

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNGE  GS HG FRN++FTLE  VSLN+G NNISLLSATVGLP+SG++LE + LG
Sbjct  498   VLHAFVNGEHVGSLHGRFRNTAFTLEGAVSLNEGTNNISLLSATVGLPDSGSFLERRALG  557

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPLIWYK  1225
                V I+ S+ +++++N SWGYQVGLLGE LQIY+ + S +V W    SSQPL WYK
Sbjct  558   VESVIIQDSKEAKNITNLSWGYQVGLLGEKLQIYSLEESKSVNWSSLGSSQPLTWYK  614


 Score =   144 bits (362),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             ++VFD P+G+DP+ALNLGSMGKGEAWVNGQSIGRYWVS+ T+AG PSQTWY+VPRSFL+P
Sbjct  614   KSVFDAPKGDDPVALNLGSMGKGEAWVNGQSIGRYWVSFRTLAGIPSQTWYHVPRSFLQP  673

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               NLLVLFEEE GNP  IT+D +S+T
Sbjct  674   GDNLLVLFEEETGNPLDITVDTISVT  699



>ref|XP_009798710.1| PREDICTED: beta-galactosidase 16-like isoform X2 [Nicotiana sylvestris]
Length=621

 Score =   495 bits (1275),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 242/357 (68%), Positives = 287/357 (80%), Gaps = 1/357 (0%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAF VALFIARKNG+YINYYMYHGGTNFGRTAA FMITSYYDQAP
Sbjct  262   YQVYGQNVTLRSAEDIAFQVALFIARKNGTYINYYMYHGGTNFGRTAAEFMITSYYDQAP  321

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+REPKW HLKELHAA+K+CS+ +LS+ P+  SL Q Q+AYVF GDS GACAAFL
Sbjct  322   LDEYGLIREPKWGHLKELHAAVKLCSEAILSSFPTMQSLGQLQEAYVFSGDS-GACAAFL  380

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D + SA V+FQN +YQLPPKSISILPDC  VAFNTAKV+TQ NTR+ +P  KFDS E
Sbjct  381   VNADNRRSATVRFQNLTYQLPPKSISILPDCNIVAFNTAKVSTQFNTRSSRPVFKFDSAE  440

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE+F++++  FD T +R+ TLL+  NTTKD SDYLWYT S +Q+S + ++ +SV+SLGH
Sbjct  441   KWEQFQDVIPQFDATTLRSQTLLEQTNTTKDASDYLWYTASFEQDSQEQQARLSVKSLGH  500

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG L GSA G FRN+SFTLES V+LNKG N ISLLSATVGLP+SGA+LE ++LG
Sbjct  501   VLHAFVNGALVGSAQGQFRNTSFTLESMVALNKGTNQISLLSATVGLPDSGAFLERRSLG  560

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPLIWYK  1225
              R V I++S G +  +   WGYQVGLLGE LQIYT +GS    W    SSQ L WYK
Sbjct  561   VRSVIIQNSLGVKIFTVFPWGYQVGLLGEKLQIYTYEGSKNANWSSLGSSQQLTWYK  617



>ref|XP_009798708.1| PREDICTED: beta-galactosidase 16-like isoform X1 [Nicotiana sylvestris]
Length=739

 Score =   495 bits (1274),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 242/357 (68%), Positives = 287/357 (80%), Gaps = 1/357 (0%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAF VALFIARKNG+YINYYMYHGGTNFGRTAA FMITSYYDQAP
Sbjct  262   YQVYGQNVTLRSAEDIAFQVALFIARKNGTYINYYMYHGGTNFGRTAAEFMITSYYDQAP  321

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+REPKW HLKELHAA+K+CS+ +LS+ P+  SL Q Q+AYVF GDS GACAAFL
Sbjct  322   LDEYGLIREPKWGHLKELHAAVKLCSEAILSSFPTMQSLGQLQEAYVFSGDS-GACAAFL  380

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D + SA V+FQN +YQLPPKSISILPDC  VAFNTAKV+TQ NTR+ +P  KFDS E
Sbjct  381   VNADNRRSATVRFQNLTYQLPPKSISILPDCNIVAFNTAKVSTQFNTRSSRPVFKFDSAE  440

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE+F++++  FD T +R+ TLL+  NTTKD SDYLWYT S +Q+S + ++ +SV+SLGH
Sbjct  441   KWEQFQDVIPQFDATTLRSQTLLEQTNTTKDASDYLWYTASFEQDSQEQQARLSVKSLGH  500

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG L GSA G FRN+SFTLES V+LNKG N ISLLSATVGLP+SGA+LE ++LG
Sbjct  501   VLHAFVNGALVGSAQGQFRNTSFTLESMVALNKGTNQISLLSATVGLPDSGAFLERRSLG  560

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPLIWYK  1225
              R V I++S G +  +   WGYQVGLLGE LQIYT +GS    W    SSQ L WYK
Sbjct  561   VRSVIIQNSLGVKIFTVFPWGYQVGLLGEKLQIYTYEGSKNANWSSLGSSQQLTWYK  617


 Score =   145 bits (366),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +++F  P+G+ P+ALNLGSMGKGEAWVNGQSIGRYWVS+HT AG PSQTWYNVPRSFLKP
Sbjct  617   KSIFSAPKGDGPIALNLGSMGKGEAWVNGQSIGRYWVSFHTSAGLPSQTWYNVPRSFLKP  676

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               NLLV+FEEE GNP  ITLD +S+T
Sbjct  677   RNNLLVIFEEEMGNPLNITLDAISVT  702



>ref|XP_004250388.2| PREDICTED: beta-galactosidase 16-like isoform X1 [Solanum lycopersicum]
Length=706

 Score =   492 bits (1267),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 242/357 (68%), Positives = 292/357 (82%), Gaps = 2/357 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +A +RSAED+A+HVALFIARKNG++INYYMYHGGTNFGRTAA +MITSYYDQAP
Sbjct  259   YQVYGQNATLRSAEDMAYHVALFIARKNGTFINYYMYHGGTNFGRTAAEYMITSYYDQAP  318

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELH A+K+CS+ +LS  PS  SL + Q+AYVF GDS GACAAFL
Sbjct  319   LDEYGLIRQPKWGHLKELHEAVKLCSETILSVFPSMQSLGEQQEAYVFSGDS-GACAAFL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D   S  VQFQNSSY+LP KSISILPDCKT AFNTAKV+TQ NTR   PA+KFD+ E
Sbjct  378   VNMDNTKSV-VQFQNSSYELPRKSISILPDCKTAAFNTAKVSTQFNTRITIPAIKFDAAE  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE+FEE++  FD   +R+D LL+H+NTTKDVSDYLWYT S+QQ+S + +S +SV+SLGH
Sbjct  437   KWEQFEEVIPQFDAITLRSDVLLEHMNTTKDVSDYLWYTFSIQQDSMEQQSTLSVKSLGH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNGE  GS HG FRN++FTLE  VSLN+G NNISLLSATVGLP+SG++LE + LG
Sbjct  497   VLHAFVNGEHVGSLHGRFRNTAFTLEGAVSLNQGTNNISLLSATVGLPDSGSFLERRALG  556

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPLIWYK  1225
                V IE S+ +++++N SWGYQVGLLGE LQIY+ + S +  W    SSQPL WYK
Sbjct  557   VESVIIEDSKEAKNITNLSWGYQVGLLGEKLQIYSLEESKSAYWSSLGSSQPLTWYK  613


 Score =   146 bits (368),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             ++VFD P+G+DP+ALNLGSMGKGEAWVNGQSIGRYWVS+ T+AG PSQTWYNVPRSFL+P
Sbjct  613   KSVFDAPKGDDPVALNLGSMGKGEAWVNGQSIGRYWVSFRTLAGIPSQTWYNVPRSFLQP  672

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               NLLVLFEEE GNP  IT+D +S+T
Sbjct  673   GDNLLVLFEEETGNPLDITIDTISVT  698



>ref|XP_010312842.1| PREDICTED: beta-galactosidase 16-like isoform X2 [Solanum lycopersicum]
Length=584

 Score =   452 bits (1163),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 222/323 (69%), Positives = 269/323 (83%), Gaps = 2/323 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +A +RSAED+A+HVALFIARKNG++INYYMYHGGTNFGRTAA +MITSYYDQAP
Sbjct  259   YQVYGQNATLRSAEDMAYHVALFIARKNGTFINYYMYHGGTNFGRTAAEYMITSYYDQAP  318

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELH A+K+CS+ +LS  PS  SL + Q+AYVF GDS GACAAFL
Sbjct  319   LDEYGLIRQPKWGHLKELHEAVKLCSETILSVFPSMQSLGEQQEAYVFSGDS-GACAAFL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D   S  VQFQNSSY+LP KSISILPDCKT AFNTAKV+TQ NTR   PA+KFD+ E
Sbjct  378   VNMDNTKSV-VQFQNSSYELPRKSISILPDCKTAAFNTAKVSTQFNTRITIPAIKFDAAE  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE+FEE++  FD   +R+D LL+H+NTTKDVSDYLWYT S+QQ+S + +S +SV+SLGH
Sbjct  437   KWEQFEEVIPQFDAITLRSDVLLEHMNTTKDVSDYLWYTFSIQQDSMEQQSTLSVKSLGH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNGE  GS HG FRN++FTLE  VSLN+G NNISLLSATVGLP+SG++LE + LG
Sbjct  497   VLHAFVNGEHVGSLHGRFRNTAFTLEGAVSLNQGTNNISLLSATVGLPDSGSFLERRALG  556

Query  1055  PRKVTIESSEGSEDLSNDSWGYQ  1123
                V IE S+ +++++N SWGYQ
Sbjct  557   VESVIIEDSKEAKNITNLSWGYQ  579



>ref|XP_011003430.1| PREDICTED: beta-galactosidase 16-like [Populus euphratica]
Length=788

 Score =   458 bits (1178),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 223/357 (62%), Positives = 278/357 (78%), Gaps = 6/357 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  MRSA+DIAFHVALFIA K GSY+NYYMYHGGTNFGRTA++F ITSYYDQAP
Sbjct  259   YQVYGEETYMRSAQDIAFHVALFIA-KTGSYVNYYMYHGGTNFGRTASAFTITSYYDQAP  317

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAIK CS++LL     TFSL   QQAYVF+G+S G CAAFL
Sbjct  318   LDEYGLIRQPKWGHLKELHAAIKSCSKLLLHGEHKTFSLGPLQQAYVFQGNS-GQCAAFL  376

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NNDGK   +V FQ++SY+LP KSISILPDCKT+ FNTA V  Q  TR+M+P  KF+S  
Sbjct  377   VNNDGKQEVEVLFQSNSYKLPQKSISILPDCKTMTFNTANVNAQYTTRSMKPNQKFNSVG  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEE+ E +  FD T++RA+ LL+H++TTKD SDYLWYT   QQ   + +S  + +S GH
Sbjct  437   KWEEYNEPIPEFDKTSLRANRLLEHMSTTKDTSDYLWYTFRFQQNLPNAQSVFNAQSRGH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH +VNG  AG  HG+ +N+SF+L++TV L  G NN++LLSATVGLP+SGAYLE +  G
Sbjct  497   VLHAYVNGVHAGYGHGSHQNTSFSLQTTVPLKNGTNNVALLSATVGLPDSGAYLERRVAG  556

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPLIWYK  1225
              R+V I+    ++D +   WGYQVGLLGE LQIYTE GSN V+W +F +++PL+WYK
Sbjct  557   LRRVRIQ----NKDFTTYMWGYQVGLLGERLQIYTENGSNKVKWNKFGTNRPLMWYK  609


 Score =   149 bits (375),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P GNDP+ALNLGSMGKGEAWVNGQSIGRYWVS+HT  G+PSQTWYN+PR+FLKP
Sbjct  609   KTLFDAPAGNDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSKGSPSQTWYNIPRAFLKP  668

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE G P GIT+D VS+T
Sbjct  669   TGNLLVLLEEEKGYPPGITVDTVSVT  694



>ref|XP_002306647.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE93643.2| beta-galactosidase family protein [Populus trichocarpa]
Length=788

 Score =   456 bits (1173),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 222/357 (62%), Positives = 279/357 (78%), Gaps = 6/357 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  MRSA+DIAFHVALFIA K GSY+NYYMYHGGTNFGRTA++F ITSYYDQAP
Sbjct  259   YQVYGEETYMRSAQDIAFHVALFIA-KTGSYVNYYMYHGGTNFGRTASAFTITSYYDQAP  317

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAIK CS++LL     TFSL   QQAYVF+G+S G CAAFL
Sbjct  318   LDEYGLIRQPKWGHLKELHAAIKSCSKLLLHGAHKTFSLGPLQQAYVFQGNS-GQCAAFL  376

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NNDGK   +V FQ++SY+LP KSISILPDCKT+ FNTAKV  Q  TR+M+P  KF+S  
Sbjct  377   VNNDGKQEVEVLFQSNSYKLPQKSISILPDCKTMTFNTAKVNAQYTTRSMKPNQKFNSVG  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEE+ E +  FD T++RA+ LL+H++TTKD SDYLWYT   QQ   + +S  + +S GH
Sbjct  437   KWEEYNEPIPEFDKTSLRANRLLEHMSTTKDTSDYLWYTFRFQQNLPNAQSVFNAQSHGH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH +VNG  AG  HG+ +N+SF+L++TV L  G N+++LLSATVGLP+SGAYLE +  G
Sbjct  497   VLHAYVNGVHAGFGHGSHQNTSFSLQTTVRLKNGTNSVALLSATVGLPDSGAYLERRVAG  556

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPLIWYK  1225
              R+V I+    ++D +  +WGYQVGLLGE LQIYTE GSN V+W +  +++PL+WYK
Sbjct  557   LRRVRIQ----NKDFTTYTWGYQVGLLGERLQIYTENGSNKVKWNKLGTNRPLMWYK  609


 Score =   149 bits (375),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P GNDP+ALNLGSMGKGEAWVNGQSIGRYWVS+HT  G+PSQTWYN+PR+FLKP
Sbjct  609   KTLFDAPAGNDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSQGSPSQTWYNIPRAFLKP  668

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE G P GIT+D VS+T
Sbjct  669   TGNLLVLLEEEKGYPPGITVDTVSVT  694



>emb|CDP10947.1| unnamed protein product [Coffea canephora]
Length=720

 Score =   454 bits (1167),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 232/367 (63%), Positives = 285/367 (78%), Gaps = 22/367 (6%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG    +RSAEDIAF+VALFIARKNGS+INYYMYHGGTNFGRTA+S++ITSYYDQAP
Sbjct  257   YQVYGDKTPLRSAEDIAFNVALFIARKNGSFINYYMYHGGTNFGRTASSYIITSYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYG L +PKW HLK+LHAAIK+CS  +LS   +  +L Q Q+AY++ G+ SG CAA L
Sbjct  317   LDEYGFLSQPKWGHLKDLHAAIKLCSHTILSGVATIATLGQQQEAYIYNGE-SGECAALL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAK---------VTTQSNTRTMQ  667
             +NND   +  VQFQNSSY+LP  SISILPDCK VAFNTAK         VT Q N R + 
Sbjct  376   LNNDNATTVVVQFQNSSYELPSTSISILPDCKNVAFNTAKAILLKKFEQVTAQCNERLIL  435

Query  668   PALKFDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKS  847
             P LKFDS ++W EF+E+V  FD+T +R+++LL+H+NTTKD SDYLWYT+S+  +SS+ + 
Sbjct  436   PKLKFDSADQWSEFKEVVPTFDETTLRSNSLLEHMNTTKDRSDYLWYTVSV--DSSETQP  493

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              +SV+SLGHVLH FVNG  AGSAHGT  N SFTLE T++L++G+NNISLLSATVGLP+SG
Sbjct  494   VLSVDSLGHVLHAFVNGAPAGSAHGTHNNPSFTLERTINLSQGLNNISLLSATVGLPDSG  553

Query  1028  AYLEHKTLGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS-  1204
             AYLE + LG ++VTIE  +G++DLSN SWGYQVGLL E         S+A QW +F +S 
Sbjct  554   AYLERRALGLQRVTIEDKQGTKDLSNSSWGYQVGLLEE---------SSAAQWSKFGASP  604

Query  1205  QPLIWYK  1225
             QPL WYK
Sbjct  605   QPLTWYK  611


 Score =   134 bits (336),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             + +FD PEG+DPL+LNLGSMGKGEAW+NG+SIGRYWVS+ T  G+PSQTWY++PRSFL+P
Sbjct  611   KVLFDAPEGDDPLSLNLGSMGKGEAWINGESIGRYWVSFLTADGSPSQTWYHIPRSFLQP  670

Query  1651  TGNLLVLFEEEYGNPYGITLDKVS  1722
              GN LVLFEEE GNP  IT+  VS
Sbjct  671   KGNQLVLFEEESGNPLQITIGSVS  694



>ref|XP_011003960.1| PREDICTED: beta-galactosidase 16-like [Populus euphratica]
Length=818

 Score =   448 bits (1153),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 218/358 (61%), Positives = 270/358 (75%), Gaps = 2/358 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+VYG DA +RSAEDIAFHV LFI  KNGS++NYYMYHGGTNFGRTA++F+ TSYYDQAP
Sbjct  260   YRVYGEDAPIRSAEDIAFHVTLFIVAKNGSFVNYYMYHGGTNFGRTASAFVTTSYYDQAP  319

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL  +PKW HLKELHAAI++CS  LLS     F L   QQAY+F    SG CAAFL
Sbjct  320   LDEYGLTTQPKWGHLKELHAAIQLCSTPLLSGVQVNFYLGPQQQAYIFNA-VSGECAAFL  378

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND +++A V F+N+SY LPP SISILPDCK VAFNTAKV+TQ   RTM      D+ +
Sbjct  379   INNDSRNAASVPFRNASYDLPPMSISILPDCKNVAFNTAKVSTQYTARTMGRGEVLDAAD  438

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W+EF E +  FD T+ R++TLL+ +NTTKD SDYLWYTL LQ ESSD ++ + V SLGH
Sbjct  439   MWQEFTEAIPNFDSTSTRSETLLEQMNTTKDSSDYLWYTLRLQHESSDTQTILDVSSLGH  498

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              LH FVNG+  GS  G+ +N  F  E++VSL+KG+NN+SLLS  VG+P+SGA+LE++  G
Sbjct  499   ALHAFVNGQAVGSVQGSHKNPRFKFETSVSLSKGINNVSLLSVMVGMPDSGAFLENRAAG  558

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS-SSQPLIWYK  1225
              R V I   + + D +NDSWGYQ+GL GE  QIYTE+GS+ V+W++FS +  PL WYK
Sbjct  559   LRTVMIRDKQDNNDFTNDSWGYQIGLQGETSQIYTEQGSSQVRWKKFSVAGNPLTWYK  616


 Score =   119 bits (298),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 1/86 (1%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T  D P G+ P+ALNL SMGKGEAWVNG+SIGRYW SY T  G+ +QTWYNVPRSFLKP
Sbjct  616   KTRVDAPPGDVPVALNLASMGKGEAWVNGRSIGRYWPSYRTPNGS-AQTWYNVPRSFLKP  674

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
              GNLLVL EE+ GNP  ++LD VSI+
Sbjct  675   AGNLLVLQEEKGGNPLQVSLDTVSIS  700



>ref|XP_011069386.1| PREDICTED: beta-galactosidase 16 [Sesamum indicum]
Length=810

 Score =   448 bits (1152),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 227/358 (63%), Positives = 274/358 (77%), Gaps = 3/358 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+   +RSA+DIA+ VALFI + NGSYINYYMYHGGTNFGR A+SF+ITSYYDQAP
Sbjct  256   YDIYGNKTKIRSAQDIAYQVALFIVKMNGSYINYYMYHGGTNFGRMASSFVITSYYDQAP  315

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKW HLKELHAA+K+CS  LL    S FSL   Q+AYV+  D+   CAAFL
Sbjct  316   LDEYGLTRQPKWGHLKELHAAVKLCSDTLLYGQQSNFSLGALQEAYVYSRDNR-ECAAFL  374

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N D  + A+VQF N ++QLP KSISILPDC  VAFNTAKV+TQ +TR+ Q A+  DS E
Sbjct  375   FNMDKVNDAEVQFLNRTFQLPAKSISILPDCTNVAFNTAKVSTQMSTRSTQKAVGLDSPE  434

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W+E+ E +  FDD+ +R+D+LL+ +NTTKD SDYLWYT S QQ S D +S I+V S GH
Sbjct  435   IWKEWNEAIPAFDDSLLRSDSLLEQMNTTKDASDYLWYTTSYQQ-SEDSQSVITVNSRGH  493

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG L GSAHG FRN SFTLE+TV LN G+NNISLLS  VGLP+SGA+LE +  G
Sbjct  494   VLHTFVNGALVGSAHGAFRNQSFTLETTVPLNSGLNNISLLSNMVGLPDSGAFLERRAAG  553

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
                VTI+ ++  ++L+N SWGYQVGLLGE LQ +TE+GS+  QW  F SSSQPL WYK
Sbjct  554   LHTVTIQENQVVKNLTNYSWGYQVGLLGERLQFHTEEGSSHAQWLNFNSSSQPLTWYK  611


 Score =   141 bits (356),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P GNDP+ALNLGSMGKGEAW+NG+SIGRYW+S+HT  G+PSQ WY++PRSFLKPT N
Sbjct  614   FDAPGGNDPVALNLGSMGKGEAWINGESIGRYWISFHTPDGSPSQIWYHIPRSFLKPTDN  673

Query  1660  LLVLFEEEYGNPYGITLDKVSIT  1728
             LLVLFEEE GNP GI++D VSI+
Sbjct  674   LLVLFEEEIGNPLGISVDIVSIS  696



>ref|XP_002521778.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF40588.1| beta-galactosidase, putative [Ricinus communis]
Length=828

 Score =   446 bits (1147),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 213/359 (59%), Positives = 277/359 (77%), Gaps = 3/359 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y + G +  +RS EDIAF V  FI  K GS++NYYMYHGGTNFGRTA++F+ TSYYDQAP
Sbjct  257   YVITGENIRIRSVEDIAFQVTQFIVAKKGSFVNYYMYHGGTNFGRTASAFVPTSYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             +DEYGL+R+PKW HLKE+HAAIK+C   LLS    T SL Q QQA+VF G  SG CAAFL
Sbjct  317   IDEYGLIRQPKWGHLKEMHAAIKLCLTPLLSGGQVTISLGQQQQAFVFTG-LSGECAAFL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND  ++A VQF+N+SY LPP SISILPDCKTVAFNTAKV+TQ  TR+M  +   D  +
Sbjct  376   LNNDTANTASVQFRNASYDLPPNSISILPDCKTVAFNTAKVSTQYTTRSMTRSKLLDGED  435

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W +++E +V FD+T+++++ +L+ ++TTKD SDYLWYT   QQESSD ++ ++V SLGH
Sbjct  436   KWVQYQEAIVNFDETSVKSEAILEQMSTTKDASDYLWYTFRFQQESSDTQAVLNVRSLGH  495

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG+  G A G+ +N  FTL+STVSL++G+NN+SLLS  VG+P+SGAY+E +  G
Sbjct  496   VLHAFVNGQAVGYAQGSHKNPQFTLQSTVSLSEGVNNVSLLSVMVGMPDSGAYMERRAAG  555

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
              RKV I+  EG+++ +N SWGYQVGLLGE LQI+T++GS+ VQW  FS +   PL WYK
Sbjct  556   LRKVKIQEKEGNKEFTNYSWGYQVGLLGEKLQIFTDQGSSQVQWANFSKNALNPLTWYK  614


 Score =   109 bits (273),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 67/100 (67%), Gaps = 15/100 (15%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTW----------  1620
             +T+FD P  + P+ALNLGSMGKGEAWVNGQSIGRYW SY    G+ SQ W          
Sbjct  614   KTLFDAPLEDAPVALNLGSMGKGEAWVNGQSIGRYWPSYRASDGS-SQIWYAYFNTGAIF  672

Query  1621  ----YNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
                 YNVPRSFLKP GNLLV+ EE  GNP  I++D  SI+
Sbjct  673   RAVRYNVPRSFLKPKGNLLVVLEESGGNPLQISVDTASIS  712



>ref|XP_002520337.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF42123.1| beta-galactosidase, putative [Ricinus communis]
Length=771

 Score =   443 bits (1139),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 218/358 (61%), Positives = 270/358 (75%), Gaps = 7/358 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQV+G +  +R+AEDIAFHVALFIAR NGSY+NYYMYHGGTNFGRT ++F+ TSYYDQAP
Sbjct  241   YQVFGGEPYIRTAEDIAFHVALFIAR-NGSYVNYYMYHGGTNFGRTGSAFVTTSYYDQAP  299

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLK+LHA IK CS+ L+  T  TF L + Q+AYVFR + SG C AFL
Sbjct  300   LDEYGLIRQPKWGHLKDLHAKIKSCSKTLIRGTHQTFPLGRLQEAYVFR-EKSGDCVAFL  358

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NNDG+    V+FQN SY+LP KSISILPDCK++ FNTAKV TQ  TR+   + +F S  
Sbjct  359   VNNDGRRDVTVRFQNRSYELPHKSISILPDCKSITFNTAKVNTQYATRSATLSQEFSSVG  418

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEE++E V  FD T++RA TLLDH++TTKD SDYLWYT   Q   S P+S +   S GH
Sbjct  419   KWEEYKETVATFDSTSLRAKTLLDHLSTTKDTSDYLWYTFRFQNHFSRPQSTLRAYSRGH  478

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH +VNG  AGSAHG+  ++SFTLE++V L  G NN++LLS TVGLP+SGAYLE +  G
Sbjct  479   VLHAYVNGVYAGSAHGSHESTSFTLENSVRLKNGTNNVALLSVTVGLPDSGAYLERRVAG  538

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
               +V I+    ++D +  SWGYQVGLLGE LQIYT+ G N V W EF  ++QPL WYK
Sbjct  539   LHRVRIQ----NKDFTTYSWGYQVGLLGEKLQIYTDNGLNKVSWNEFRGTTQPLTWYK  592


 Score =   130 bits (328),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G+DP+ALNL SMGKGEAWVNGQSIGRYWVS+ T  G PSQT Y++P+SF+KP
Sbjct  592   KTQFDAPAGSDPIALNLHSMGKGEAWVNGQSIGRYWVSFSTSKGNPSQTRYHIPQSFVKP  651

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE G P GIT+D +SI+
Sbjct  652   TGNLLVLLEEEKGYPPGITVDSISIS  677



>ref|XP_006351205.1| PREDICTED: beta-galactosidase 16-like [Solanum tuberosum]
Length=813

 Score =   442 bits (1138),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 221/360 (61%), Positives = 274/360 (76%), Gaps = 3/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +A  RSAE++A+ VALFIARKNG+YINYYMYHGGTNFGR+AA FMIT YYDQAP
Sbjct  262   YQVYGENAKYRSAEEMAYQVALFIARKNGTYINYYMYHGGTNFGRSAAEFMITGYYDQAP  321

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+ +PKW H KELHAA+K+CS+ +LS  P+  SL   Q+AYV+  DS   C+A L
Sbjct  322   LDEYGLISQPKWGHFKELHAAVKLCSENILSTFPTMHSLGPLQEAYVYGEDSGTKCSALL  381

Query  515   INND-GKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             +N D    +  VQF+N +YQLPPKSISIL DCKTV FNTAKV+TQ NTRT     KFD  
Sbjct  382   VNTDHSNRNVTVQFRNLTYQLPPKSISILHDCKTVVFNTAKVSTQFNTRTPTTVFKFDRA  441

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLG  871
             E+WE+F E++  FD T +R+ TLL+  NTTKDVSDYLWYT SL+QES + +  +SV+SLG
Sbjct  442   EKWEQFHEIIPRFDATTLRSQTLLEQTNTTKDVSDYLWYTTSLEQESEEQQVKLSVKSLG  501

Query  872   HVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             HVLH FVNG L G  HG FR +SF +EST+SLNKG N IS LSAT+GLPNSGA+LE ++L
Sbjct  502   HVLHAFVNGHLVGYGHGQFRKTSFLVESTISLNKGKNEISFLSATIGLPNSGAFLERRSL  561

Query  1052  GPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ-PLIWYK  1225
             G   V I++ + G ++ ++ SWGYQVGLLGE LQIY+ + + +V W +  SS+  L WYK
Sbjct  562   GVHSVMIQNDNRGLKNFTDFSWGYQVGLLGEKLQIYSSERTKSVNWSKLGSSKLQLTWYK  621


 Score =   145 bits (366),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +++FD P+G+DP+ LNLGSMGKGEAWVNGQSIGR+W+S+HT  G PSQTWYNVPRSFLKP
Sbjct  621   KSIFDAPKGDDPVTLNLGSMGKGEAWVNGQSIGRFWLSFHTPQGVPSQTWYNVPRSFLKP  680

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               N+LVLFEEE GNP GIT+D +SIT
Sbjct  681   KDNVLVLFEEEIGNPLGITIDTISIT  706



>gb|EYU31765.1| hypothetical protein MIMGU_mgv1a018569mg [Erythranthe guttata]
Length=817

 Score =   439 bits (1128),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 213/359 (59%), Positives = 277/359 (77%), Gaps = 4/359 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+   +RS EDIA+ VALFI + NGS+INYYMYHGGTNFGR A++F+ITSYYDQAP
Sbjct  259   YDIYGNITKIRSPEDIAYQVALFIVKMNGSFINYYMYHGGTNFGRNASAFIITSYYDQAP  318

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HL+ELHAA+K+CS+ LL+   S FSL   Q+AYV+  + +G CAAFL
Sbjct  319   LDEYGLIRQPKWGHLQELHAAVKLCSETLLNGVQSNFSLGVLQEAYVYTRE-NGECAAFL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N DG+H A +QF+N +YQLPPKSISILPDCKTVAFNTAKV+TQ  TRT QPA+K D  +
Sbjct  378   LNRDGEHGANIQFRNRTYQLPPKSISILPDCKTVAFNTAKVSTQFGTRTRQPAVKLDKAD  437

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WE++ E++  FD+T+IR++ LL+ +NTTKD SDYLWY  S  Q + + KS I+V S GH
Sbjct  438   IWEKWNEIIPVFDNTSIRSNLLLEQMNTTKDSSDYLWYIASYNQ-TEESKSEITVNSRGH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             +L  FVNG   GS HG FRN  FT+++T+ L  G+N+ISLLS  VGLP+SGA++E +  G
Sbjct  497   LLRAFVNGVQIGSGHGFFRNQGFTVKTTIPLTSGVNDISLLSVMVGLPDSGAHMERRASG  556

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              + V+I+ ++  ++L+  SWGYQVGLLGE LQ+YTE+G+N   W +   SSSQPL WYK
Sbjct  557   LQSVSIQENKVFKNLTISSWGYQVGLLGEKLQLYTEEGTNKAVWCDINSSSSQPLTWYK  615


 Score =   134 bits (338),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             ++ FD P G+DPLALNLGSMGKGEAWVNGQSIGRYW+S+    G+PSQ WY+VPRSFLKP
Sbjct  615   KSKFDAPGGSDPLALNLGSMGKGEAWVNGQSIGRYWISFLNPDGSPSQIWYHVPRSFLKP  674

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               NLLVLFEEE GNP GI++D VSIT
Sbjct  675   KDNLLVLFEEEGGNPTGISVDTVSIT  700



>ref|XP_010664184.1| PREDICTED: beta-galactosidase 16-like [Vitis vinifera]
Length=817

 Score =   439 bits (1128),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 216/361 (60%), Positives = 274/361 (76%), Gaps = 4/361 (1%)
 Frame = +2

Query  152   SYQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQA  331
             SY ++G DA  R  EDIAFHVALF+A+ NGS+INYYMYHGGTNFGRTA++++ T+YYD+A
Sbjct  260   SYPLFGEDARPRPVEDIAFHVALFVAKMNGSFINYYMYHGGTNFGRTASAYVQTAYYDEA  319

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLA-QFQQAYVFRGDSSGACAA  508
             PLDEYGL+++P W HLKELHAA+K+CS+ LL    S  SL  + Q+AYVFRG  SG CAA
Sbjct  320   PLDEYGLIQQPTWGHLKELHAAVKLCSETLLQGAQSNLSLGTKLQEAYVFRGQ-SGKCAA  378

Query  509   FLINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDS  688
             FL+NND +    V FQN+SY+LP KSISILPDCK  AFNTAK++TQ NTR++Q   KF+S
Sbjct  379   FLVNNDSRTDVTVVFQNTSYELPRKSISILPDCKNEAFNTAKISTQQNTRSIQTVTKFNS  438

Query  689   TeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESL  868
             TE+WEE++E ++ FDDT+ RA+TLL+H+NTTKD SDYLWYT     + S+ +S +S  S 
Sbjct  439   TEQWEEYKESILNFDDTSSRANTLLEHMNTTKDASDYLWYTFRYNNDPSNGQSVLSTNSR  498

Query  869   GHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKT  1048
              H LH F+NG   GS HG+  N SF+L++TVS   G+NN+SLLS  VGLP+SGAYLE + 
Sbjct  499   AHALHAFINGRHTGSQHGSSSNLSFSLDNTVSFRAGINNVSLLSVMVGLPDSGAYLERRV  558

Query  1049  LGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQP--LIWY  1222
              G R+V I+S+   +D +N+ WGYQVGLLGE LQIYT+ GS  VQW +F SS    L WY
Sbjct  559   AGLRRVRIQSNGSLKDFTNNPWGYQVGLLGEKLQIYTDVGSQKVQWSKFGSSTSGLLTWY  618

Query  1223  K  1225
             K
Sbjct  619   K  619


 Score =   132 bits (332),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +TVFD P GN+P+ALNL SM KGE WVNGQSIGRYWVS+ T +G PSQ WY++PRSFLKP
Sbjct  619   KTVFDAPAGNEPVALNLVSMRKGEVWVNGQSIGRYWVSFLTPSGKPSQIWYHIPRSFLKP  678

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             TGNLLVL EEE G+P GI++ KVSI
Sbjct  679   TGNLLVLLEEETGHPVGISIGKVSI  703



>ref|XP_006434246.1| hypothetical protein CICLE_v10004034mg [Citrus clementina]
 gb|ESR47486.1| hypothetical protein CICLE_v10004034mg [Citrus clementina]
Length=821

 Score =   436 bits (1121),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 212/359 (59%), Positives = 272/359 (76%), Gaps = 4/359 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +A +RSAEDIA+HVALFIA+  GSY+NYYMYHGGTNFGRTA+++++T YYDQAP
Sbjct  262   YQVYGDEARIRSAEDIAYHVALFIAKMKGSYVNYYMYHGGTNFGRTASAYVLTGYYDQAP  321

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELH+A+K+C + +LS    + + +  Q+A++F+G S   CAAFL
Sbjct  322   LDEYGLLRQPKWGHLKELHSAVKLCLKPMLSGVLVSMNFSTLQEAFIFQGSSE--CAAFL  379

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D +++A V F N  Y+LPP SISILPDCKTVAFNTAKV+TQ  TR+M+   K DS E
Sbjct  380   VNKDKRNNATVYFSNLMYELPPLSISILPDCKTVAFNTAKVSTQYGTRSMEQRQKLDSVE  439

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEE++E +  +D+T++RA+ LL+ +NTTKD SDYLWY    + + SD +S + V SLGH
Sbjct  440   QWEEYKEAIPTYDETSLRANFLLEQMNTTKDASDYLWYNFRFKHDPSDSESVLKVSSLGH  499

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH F+NGE  GSAHG   + SFTLE  V L  G NN+SLLS  VGLP+SGAYLE +  G
Sbjct  500   VLHAFINGEFVGSAHGKHSDKSFTLEKMVHLINGTNNVSLLSVMVGLPDSGAYLERRVAG  559

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
              R V+I+ ++  +D S+ SWGYQVGLLGE LQI+T+ GS  V W  + SS  QPL WYK
Sbjct  560   LRNVSIQGAKELKDFSSFSWGYQVGLLGEKLQIFTDYGSRIVPWSRYGSSTHQPLTWYK  618


 Score =   135 bits (339),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +TVFD P G+DP+A+NL  MGKGEAWVNGQSIGRYWVS+ T  GTPSQ+WY++PRSFLKP
Sbjct  618   KTVFDAPTGSDPVAINLIPMGKGEAWVNGQSIGRYWVSFLTPQGTPSQSWYHIPRSFLKP  677

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE G P GI++D VS+T
Sbjct  678   TGNLLVLLEEENGYPPGISIDTVSVT  703



>ref|XP_006472816.1| PREDICTED: beta-galactosidase 16-like isoform X2 [Citrus sinensis]
Length=626

 Score =   426 bits (1095),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 215/358 (60%), Positives = 267/358 (75%), Gaps = 7/358 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQV+G    +RSA+DIAFHVALFIA KNGSY+NYYMYHGGTNFGRTAA+FMIT YYDQAP
Sbjct  270   YQVWGGKPYIRSAQDIAFHVALFIA-KNGSYVNYYMYHGGTNFGRTAAAFMITGYYDQAP  328

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+REPKW HLKELHAAIK+CS+ LL+ T +  SL Q Q+A+VF  ++SG CAAFL
Sbjct  329   LDEYGLVREPKWGHLKELHAAIKLCSRPLLTGTQNVISLGQLQEAFVFE-ETSGVCAAFL  387

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND + +  V F+N SY+LP KSISILPDCKTVAFNT +V+TQ N R+    LKFDS E
Sbjct  388   VNNDERKAVTVLFRNISYELPRKSISILPDCKTVAFNTERVSTQYNKRSKTSNLKFDSDE  447

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEE+ E ++ FD+T +RA+ LLD I+  KD SDY WYT      SS+ ++ + V+S GH
Sbjct  448   KWEEYREAILNFDNTLLRAEGLLDQISAAKDASDYFWYTFRFHYNSSNAQAPLDVQSHGH  507

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             +LH FVNGE  GSAHG+  N SFTL +TV L +G N+ +LLS TVGLP+SGA+LE K  G
Sbjct  508   ILHAFVNGEYTGSAHGSHDNVSFTLRNTVHLRQGTNDGALLSVTVGLPDSGAFLERKVAG  567

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-SQPLIWYK  1225
               +V ++     +  +N SWGYQVGL+GE LQIY+  G N V W    S ++ L WYK
Sbjct  568   VHRVRVQ----DKSFTNCSWGYQVGLIGEKLQIYSNLGLNKVLWSSIRSPTRQLTWYK  621



>ref|XP_007020169.1| Beta-galactosidase [Theobroma cacao]
 gb|EOY17394.1| Beta-galactosidase [Theobroma cacao]
Length=684

 Score =   427 bits (1099),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 213/370 (58%), Positives = 268/370 (72%), Gaps = 15/370 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG +   RS +DIAF VALF+AR NG+++NYYMYHGGTNFGRT +S++ TSYYD+ P
Sbjct  268   YQAYGEEPYTRSPQDIAFQVALFVAR-NGTFVNYYMYHGGTNFGRTTSSYVTTSYYDEGP  326

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAIK CS  +L  T    SL + Q  Y++R   SG CAAFL
Sbjct  327   LDEYGLIRQPKWGHLKELHAAIKSCSNPILFGTQFMLSLGERQTGYIYR-QKSGECAAFL  385

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAK-------------VTTQSNT  655
             +NND   +  V FQNSSY+L P SISILPDCK VAFNTAK             +  ++NT
Sbjct  386   VNNDDTKTVVVPFQNSSYELSPNSISILPDCKNVAFNTAKASLNLILEKYEVEINVENNT  445

Query  656   RTMQPALKFDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESS  835
             R++    KF+ +E WEEF +++  F  T+ R++TLL+H+NTTKD+SDYLWYT   + ESS
Sbjct  446   RSITTGKKFNGSEMWEEFRDIIPTFAQTSKRSNTLLEHMNTTKDMSDYLWYTSMYRHESS  505

Query  836   DPKSAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGL  1015
             + K+ + V+S GH LH FVNG L GS HG+ +N+ FTLE+T+ LN+G NNISLLS  VGL
Sbjct  506   NSKAVLKVDSAGHALHAFVNGVLIGSTHGSHKNTRFTLENTIPLNEGNNNISLLSVMVGL  565

Query  1016  PNSGAYLEHKTLGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF  1195
             P+SGAYLE +  G R+V I   + S+DL+N SWGYQVGLLGE LQIY E+ S+ VQWR F
Sbjct  566   PDSGAYLESRVAGLRRVRIHDIQNSKDLTNYSWGYQVGLLGEKLQIYLEQTSSKVQWRPF  625

Query  1196  SSSQPLIWYK  1225
             +S  PL WYK
Sbjct  626   TSPNPLTWYK  635


 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTW  1620
             +T FD P GN+ L LNLGSMGKGEAWVNGQSIGRYWVS+ T  G+P QTW
Sbjct  635   KTSFDAPAGNESLGLNLGSMGKGEAWVNGQSIGRYWVSFVTSQGSPYQTW  684



>ref|XP_008394192.1| PREDICTED: beta-galactosidase 6 [Malus domestica]
Length=724

 Score =   429 bits (1102),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 269/360 (75%), Gaps = 4/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHVALFIAR NGSYINYYMYHGGTNFGRT ++++ITSYYDQAP
Sbjct  265   YQVYGGEPYIRSAEDIAFHVALFIAR-NGSYINYYMYHGGTNFGRTGSAYVITSYYDQAP  323

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAAIK CS  LL+ TP+ FSL Q Q AYVF  +S+G C AFL
Sbjct  324   LDEYGLLRQPKWGHLKELHAAIKSCSTTLLNGTPTNFSLGQLQAAYVFSEESAGRCVAFL  383

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND K +A VQF+N+S++L PKSI+IL DC+   FNTA+V T+ N R ++    FD+ +
Sbjct  384   INNDEKSNATVQFRNASHELLPKSIAILSDCEKEIFNTARVNTKQNKRIIRSTKIFDAMD  443

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W++F +++  F++T++++DTLL+H+N TKDVSDYLWYTLS Q   S  +  + VESLGH
Sbjct  444   KWQKFTDVIPNFENTSLQSDTLLEHMNVTKDVSDYLWYTLSFQHNISCAEPVLVVESLGH  503

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H F+N    G+ HG+     F +E  + LN G NNISLLS  VGLP+SGA+LE +  G
Sbjct  504   VTHAFINNMYIGNGHGSHDTKQFVMEKPIGLNNGTNNISLLSVMVGLPDSGAFLERRFAG  563

Query  1055  PRKVTIESSEGS-EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              R+V I+ S+    + +N  WGYQVGLLGE +QIY E+  + V+W +   SS+QPL WYK
Sbjct  564   LRRVEIQCSKKELYNFTNYDWGYQVGLLGEKMQIYKEENIDNVEWSDVGGSSNQPLTWYK  623


 Score =   112 bits (279),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +TVF+ P GND + LNL SMGKGEAWVN QSIGRYWVS+ T  G PSQT Y+VPRSFLK 
Sbjct  623   KTVFEPPVGNDAVILNLSSMGKGEAWVNDQSIGRYWVSFLTSKGKPSQTMYHVPRSFLKN  682

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             + NLLVL EE  GNP   +L+ +S++
Sbjct  683   SENLLVLLEEYGGNPLHTSLNTISLS  708



>ref|XP_007221984.1| hypothetical protein PRUPE_ppa002839mg [Prunus persica]
 gb|EMJ23183.1| hypothetical protein PRUPE_ppa002839mg [Prunus persica]
Length=628

 Score =   425 bits (1092),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 218/359 (61%), Positives = 268/359 (75%), Gaps = 9/359 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAE+IA+ VALFIA+  GSY+NYYMYHGGTNFGRTA++F++TSYYD+AP
Sbjct  75    YQVYGGEPYIRSAEEIAYQVALFIAKNRGSYVNYYMYHGGTNFGRTASAFVVTSYYDEAP  134

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYG +R+PKW HLKELHAA+K+ S  LLS   ++ SL Q Q AYVF+   SG CAAFL
Sbjct  135   LDEYGSIRQPKWGHLKELHAAVKLASSALLSGDQTSISLGQLQDAYVFK-VQSGECAAFL  193

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N   KH A V FQ SSYQLPPKSISILPDCK VAFNTAKV+ Q  TR+ Q   KFD+ E
Sbjct  194   VNKGPKH-ATVPFQESSYQLPPKSISILPDCKKVAFNTAKVSAQHATRSWQVTQKFDTAE  252

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEE++E +  ++ T +RA  L + I+ TKD SDYLWYT S Q + S+ +S +SV+S GH
Sbjct  253   NWEEYKEAIPNYEKTTLRASALPEQISITKDESDYLWYTFSFQHD-SNAQSTLSVKSHGH  311

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG   GSAHG  RN SF+LE TV+L+KG+N ISLLSA VGLP++GAYLE K  G
Sbjct  312   VLHTFVNGVFTGSAHGRHRNESFSLEQTVTLSKGINYISLLSAMVGLPDNGAYLERKVGG  371

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
               +V +E     +D S  SWGYQVGL GE LQI+++ GS+ VQW +  +S  QPL WYK
Sbjct  372   LHEVRVE----DQDFSKSSWGYQVGLDGEKLQIHSDSGSSKVQWSKLGNSDHQPLTWYK  426


 Score =   141 bits (356),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             + +FD   G+D +ALNLGSMGKGEAWVNGQSIGR+WVS+ T  G PSQTWYNVPRSFLKP
Sbjct  426   KILFDAAAGHDSIALNLGSMGKGEAWVNGQSIGRFWVSFQTPKGKPSQTWYNVPRSFLKP  485

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE G+P GI+LDKVSIT
Sbjct  486   TGNLLVLLEEENGDPLGISLDKVSIT  511



>ref|XP_007019138.1| Beta-galactosidase [Theobroma cacao]
 gb|EOY16363.1| Beta-galactosidase [Theobroma cacao]
Length=805

 Score =   429 bits (1102),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 223/357 (62%), Positives = 269/357 (75%), Gaps = 9/357 (3%)
 Frame = +2

Query  158   QVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPL  337
             Q YG +  +RSA DIAFHVALFIA KNGSY+NYYMYHGGTNFGRTAA+++ITSYYDQAPL
Sbjct  259   QRYGQEVFLRSATDIAFHVALFIA-KNGSYVNYYMYHGGTNFGRTAAAYIITSYYDQAPL  317

Query  338   DEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLI  517
             DEYGL+R+P W HLKELHAAI++C++ LLS    T+S  + Q AYVF+G SSG CAAFL+
Sbjct  318   DEYGLIRQPLWGHLKELHAAIRLCTKPLLSGAYETYSSGKLQDAYVFKGKSSGDCAAFLV  377

Query  518   NNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTee  697
             N+D   +A+V+FQN S++LPP SISILPDCK VAFNTAKV+TQ NTR+M    KFDST  
Sbjct  378   NSDNTTNARVRFQNVSFELPPMSISILPDCKNVAFNTAKVSTQYNTRSMTVRHKFDSTGR  437

Query  698   weefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGHV  877
             WEE++E +  F  T +RA  LLDH++TTKD SD+LWYTLS Q + SD ++ +SV S  HV
Sbjct  438   WEEYKEPIPTFSKTKLRAKNLLDHMSTTKDTSDHLWYTLSFQLD-SDAQAVLSVTSDAHV  496

Query  878   LHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLGP  1057
             LH FVNG   G A+G  +N  F L +TV LN G NNISLLS  VG P+SGAYLEHKT G 
Sbjct  497   LHSFVNGAYTGYAYGGKKN--FELNNTVHLNNGTNNISLLSVMVGFPDSGAYLEHKTAGI  554

Query  1058  RKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-SQPLIWYK  1225
             + VTI+    +EDL+N  WGYQVGL GE+ +I+TE GSN VQW  F      L WYK
Sbjct  555   QSVTIQ----NEDLNNYQWGYQVGLSGESSRIFTEHGSNKVQWNRFHGIHHRLTWYK  607


 Score =   140 bits (353),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P GNDPLALNLGSMGKGE WVNGQSIGRYWVS HT    PSQTWYN+PR FLKP
Sbjct  607   KTLFDAPGGNDPLALNLGSMGKGEVWVNGQSIGRYWVSLHTPELRPSQTWYNIPRPFLKP  666

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEEYG+P  ITL  +SI+
Sbjct  667   TGNLLVLLEEEYGDPLRITLGSISIS  692



>ref|XP_006473025.1| PREDICTED: beta-galactosidase 16-like [Citrus sinensis]
Length=822

 Score =   429 bits (1103),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 209/359 (58%), Positives = 271/359 (75%), Gaps = 4/359 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +A +RSAEDIA+HVALFI +  GSY+NYYMYHGGTNFGRTA+++++T YYDQAP
Sbjct  263   YQVYGDEARIRSAEDIAYHVALFIVKMKGSYVNYYMYHGGTNFGRTASAYVLTGYYDQAP  322

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELH+A+K+C + +LS    + + ++ Q+A++F+G S   CAAFL
Sbjct  323   LDEYGLLRQPKWGHLKELHSAVKLCLKPMLSGVLVSMNFSKLQEAFIFQGSSE--CAAFL  380

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D +++A V F N  Y+LPP SISILPDCKTVAFNTAKV+TQ  TR+M+   K DS E
Sbjct  381   VNKDKRNNATVYFSNLMYELPPLSISILPDCKTVAFNTAKVSTQYGTRSMEQRQKLDSVE  440

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEE++E +  +D+T++RA+ LL+ +NTTKD SDYLWY    + + S+ +S + V SLGH
Sbjct  441   QWEEYKEAIPTYDETSLRANFLLEQMNTTKDASDYLWYNFRFKHDPSNSESVLKVSSLGH  500

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VL  F+NGE  GSAHG   + SFTLE  V L  G NN+SLLS  VGLP+SGAYLE +  G
Sbjct  501   VLLAFINGEFVGSAHGKHSDKSFTLEKMVHLINGTNNVSLLSVMVGLPDSGAYLERRVAG  560

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
              R V+I+ ++  +D S+ SWGYQVGLLGE LQI+T+ GS  V W  + SS  QPL WYK
Sbjct  561   LRNVSIQGAKELKDFSSFSWGYQVGLLGEKLQIFTDYGSRIVPWSRYGSSTHQPLTWYK  619


 Score =   137 bits (344),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +TVFD P G+DP+A+NL SMGKGEAWVNGQSIGRYWVS+ T  GTPSQ+WY++PRSFLKP
Sbjct  619   KTVFDAPTGSDPVAINLISMGKGEAWVNGQSIGRYWVSFLTPQGTPSQSWYHIPRSFLKP  678

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE G P GI++D VS+T
Sbjct  679   TGNLLVLLEEENGYPPGISIDTVSVT  704



>ref|XP_009376872.1| PREDICTED: beta-galactosidase 16 [Pyrus x bretschneideri]
Length=757

 Score =   427 bits (1097),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 223/359 (62%), Positives = 272/359 (76%), Gaps = 9/359 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG   L+RSAEDIA+ VALFIA+  GSY+NYYMYHGGTNFGR+A++F+ITSYYD+AP
Sbjct  204   YQVYGDKPLLRSAEDIAYQVALFIAKFRGSYVNYYMYHGGTNFGRSASAFVITSYYDEAP  263

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYG +R+PKW HLKELHAA+K+ S  LLS   +  SL + Q AYVF+   SG CAAFL
Sbjct  264   LDEYGSVRQPKWGHLKELHAAVKLASNSLLSGDQTNVSLGELQDAYVFQ-VKSGECAAFL  322

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N  G   A V FQNS YQLP KSISILPDCKTVAFNTAKV  Q +TR+ Q   KFDSTE
Sbjct  323   VNK-GPKDASVVFQNSPYQLPRKSISILPDCKTVAFNTAKVNAQQSTRSWQVTQKFDSTE  381

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEE++E +  FD+T  RA+TL + + TTKD SDYLWYT+SL+Q+S++ +S + V+S GH
Sbjct  382   RWEEYKEAIPNFDNTVSRANTLPEQLFTTKDESDYLWYTISLKQDSNN-ESKLVVQSRGH  440

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH  VNG   GSAHG  RN SF+LE TV+LNKG+N++S LSA VGLP+SGAYLE +  G
Sbjct  441   VLHALVNGVFVGSAHGRHRNESFSLEQTVTLNKGVNSLSFLSAMVGLPDSGAYLERRVGG  500

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
              RKV I+      DLS +SWGYQVGL GE L+IYT+ GS+ VQW +  S+  Q L W+K
Sbjct  501   LRKVLIQ----ERDLSKNSWGYQVGLSGEKLEIYTDAGSSKVQWNKLGSTANQRLKWFK  555


 Score =   136 bits (343),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P GNDP+ALNLGSMGKGEA+VNGQSIGRYWVS+ T  G PSQTWY+VPR+FLKP
Sbjct  555   KTHFDAPAGNDPIALNLGSMGKGEAFVNGQSIGRYWVSFQTPEGKPSQTWYHVPRAFLKP  614

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             T NLLVL EEE G+P  ++LDK+S+ 
Sbjct  615   TSNLLVLLEEENGDPLKVSLDKISVA  640



>ref|XP_009355859.1| PREDICTED: beta-galactosidase 6 isoform X2 [Pyrus x bretschneideri]
Length=692

 Score =   425 bits (1092),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 207/360 (58%), Positives = 268/360 (74%), Gaps = 4/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHVALFIAR NGSYINYYMYHGGTNFGRT ++++IT YYDQAP
Sbjct  233   YQVYGGEPYIRSAEDIAFHVALFIAR-NGSYINYYMYHGGTNFGRTGSAYVITGYYDQAP  291

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAAIK CS  LL+ T + FSL Q Q+AYVF  +S+G C AFL
Sbjct  292   LDEYGLLRQPKWGHLKELHAAIKSCSTTLLNGTRTNFSLGQLQEAYVFSEESAGRCVAFL  351

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND K +A VQF+N+S++L PKS++IL DC+   FNTA+V T+ N R ++    FD+ +
Sbjct  352   INNDEKSNATVQFRNASHELMPKSVAILSDCEKEIFNTARVNTKQNKRIIRSTKIFDTMD  411

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W++F +++  F++T++++DTLL+H+N TKDVSDYLWYTLS Q   S  +  + VESLGH
Sbjct  412   KWQKFTDIIPNFENTSLQSDTLLEHMNVTKDVSDYLWYTLSFQHNISCAEPVLVVESLGH  471

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H F+N    G+ HG+     F +E  + LN G NNISLLS  VGLP+SGA+LE +  G
Sbjct  472   VTHAFINNMYIGNGHGSHDTKQFVMEKPIGLNNGTNNISLLSVMVGLPDSGAFLERRFAG  531

Query  1055  PRKVTIESSEGS-EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              R+V I+ S+    + +N  WGYQVGLLGE +QIY E+  + V+W +   SS+QPL WYK
Sbjct  532   LRRVEIQCSKKELYNFTNYDWGYQVGLLGEKMQIYKEENIDNVEWSDVGGSSNQPLTWYK  591


 Score =   117 bits (293),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             + VF+ P GNDP+ LNLGSMGKGEAWVN QSIGRYWVS+ T  G PSQT Y++PRSFLK 
Sbjct  591   KIVFEPPVGNDPVILNLGSMGKGEAWVNDQSIGRYWVSFLTSKGKPSQTMYHIPRSFLKN  650

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLLVL EE  GNP   +L+ +S++
Sbjct  651   SGNLLVLLEEYGGNPLHTSLNTISLS  676



>gb|KDP32835.1| hypothetical protein JCGZ_12127 [Jatropha curcas]
Length=778

 Score =   427 bits (1098),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 216/359 (60%), Positives = 270/359 (75%), Gaps = 8/359 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG +  MRSAEDIAFH ALFIA+K GSYINYYMYHGGTNFGRTA++FMITSYYDQ+P
Sbjct  247   YQTYGGETYMRSAEDIAFHAALFIAKK-GSYINYYMYHGGTNFGRTASAFMITSYYDQSP  305

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYG + +PKW HLK+LHA IK CS  LL     T  L + QQAYVF+ ++SGAC AFL
Sbjct  306   LDEYGQISQPKWGHLKKLHATIKSCSDTLLHGANYTVHLGKLQQAYVFK-ENSGACVAFL  364

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NN  +  A+V FQN SYQ+P KSISILP+CKTV FNTAKV TQ NTR+M  + +F+ TE
Sbjct  365   VNNSSRRDAQVLFQNISYQIPRKSISILPNCKTVTFNTAKVNTQYNTRSMIKSRRFNPTE  424

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEE+EE +  FD T++R  +LLDH++ TKD SDYLWYT   + +  + ++ I   S GH
Sbjct  425   TWEEYEETIPAFDKTSLRETSLLDHMSITKDQSDYLWYTFRFKNDFPNAQAVIQAFSHGH  484

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH ++NG  AGSAHG   N  FTLE+++ L +G N+++LLSATVGLPN+GAYLE K  G
Sbjct  485   VLHAYINGVYAGSAHGNHSNPIFTLENSIYLKEGENDVALLSATVGLPNAGAYLERKIAG  544

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              R+V+++    ++D +   WGYQVGL+GE LQIYTEKGS+ VQW +F  SS +PL WYK
Sbjct  545   LRRVSLQ----NKDFTRYEWGYQVGLVGEELQIYTEKGSSNVQWNKFKGSSQRPLTWYK  599


 Score =   143 bits (361),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P GNDP+ALNL SMGKGEAWVNGQSIGRYWVS+HT  G PSQTWY++PRSFLKP
Sbjct  599   KTLFDAPAGNDPVALNLHSMGKGEAWVNGQSIGRYWVSFHTYKGRPSQTWYHIPRSFLKP  658

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE G P  IT+D +SIT
Sbjct  659   TGNLLVLLEEEQGYPPDITVDTISIT  684



>gb|AAG51670.1|AC010704_14 putative beta-galactosidase, 3' partial; 3669-1 [Arabidopsis 
thaliana]
Length=636

 Score =   422 bits (1085),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 214/359 (60%), Positives = 258/359 (72%), Gaps = 6/359 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG + L+RSAEDIAFHVALFIA KNGS++NYYMYHGGTNFGR A+ F+ITSYYDQAP
Sbjct  258   YQTYGEEPLIRSAEDIAFHVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAA+K+C + LLS   +T SL + Q A+VF G  +  CAA L
Sbjct  317   LDEYGLLRQPKWGHLKELHAAVKLCEEPLLSGLQTTISLGKLQTAFVF-GKKANLCAAIL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D K  + VQF+NSSY+L PKS+S+LPDCK VAFNTAKV  Q NTRT +      S +
Sbjct  376   VNQD-KCESTVQFRNSSYRLSPKSVSVLPDCKNVAFNTAKVNAQYNTRTRKARQNLSSPQ  434

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEEF E V  F +T+IR+++LL+H+NTT+D SDYLW T   QQ    P S + V  LGH
Sbjct  435   MWEEFTETVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQSEGAP-SVLKVNHLGH  493

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              LH FVNG   GS HGTF+   F LE  +SLN G NN++LLS  VGLPNSGA+LE + +G
Sbjct  494   ALHAFVNGRFIGSMHGTFKAHRFLLEKNMSLNNGTNNLALLSVMVGLPNSGAHLERRVVG  553

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              R V I +       +N SWGYQVGL GE   +YTE GS  VQW+++  S SQPL WYK
Sbjct  554   SRSVKIWNGRYQLYFNNYSWGYQVGLKGEKFHVYTEDGSAKVQWKQYRDSKSQPLTWYK  612



>ref|XP_007137444.1| hypothetical protein PHAVU_009G127500g [Phaseolus vulgaris]
 gb|ESW09438.1| hypothetical protein PHAVU_009G127500g [Phaseolus vulgaris]
Length=735

 Score =   425 bits (1093),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 214/358 (60%), Positives = 272/358 (76%), Gaps = 9/358 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQV+G    +RSAEDIA++VALFIA++ GSY+NYYMYHGGTNF + A++F++T+YYD+AP
Sbjct  299   YQVFGGVPYVRSAEDIAYNVALFIAKR-GSYVNYYMYHGGTNFDKIASAFVMTAYYDEAP  357

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAIK  S+ LL  T ++FSL   Q AYVF+  SS  CAAFL
Sbjct  358   LDEYGLVRQPKWGHLKELHAAIKSSSKSLLYGTQTSFSLGSRQNAYVFK-SSSTECAAFL  416

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN  + S  +QFQN+ YQLPPKSISILPDCK VAFNTAKV TQ N R+M+P L+F+S E
Sbjct  417   ENNADR-SVTIQFQNTPYQLPPKSISILPDCKNVAFNTAKVRTQ-NDRSMKPHLQFNSAE  474

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W+ ++E +  FDDT++RA+ LLD I+T KD SDY+WYT      S + +S ++  S GH
Sbjct  475   KWKVYKEAIPSFDDTSLRANALLDQISTAKDTSDYMWYTFRFNDNSPNAQSILTAHSQGH  534

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH F+NG L GSAHG+ +N+SF +E+ ++L +G+NNIS LSATVGLPNSGAYLEHK  G
Sbjct  535   VLHTFINGNLVGSAHGSHKNASFVMENKLNLIQGVNNISFLSATVGLPNSGAYLEHKVAG  594

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
                V ++      D +N +WGYQVGLLGE LQIYT  GS+ V W  F SS++PL WYK
Sbjct  595   LSGVKVQ----GRDFTNQAWGYQVGLLGEKLQIYTGSGSSKVHWESFQSSTKPLTWYK  648


 Score =   138 bits (348),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEGNDPLALNLGSMGKG AWVNGQ IGRYWVS+HT  GT SQ WY++PRS LK 
Sbjct  648   KTTFDAPEGNDPLALNLGSMGKGYAWVNGQGIGRYWVSFHTPKGTASQKWYHIPRSLLKS  707

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE GNP  ITLD V IT
Sbjct  708   TGNLLVLLEEETGNPLAITLDLVYIT  733



>ref|XP_008219605.1| PREDICTED: beta-galactosidase 16 [Prunus mume]
Length=814

 Score =   427 bits (1099),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 222/359 (62%), Positives = 268/359 (75%), Gaps = 9/359 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAE+IA+ VALFIA+K GSY+NYYMYHGGT+FGRTA+ F++TSYYD+AP
Sbjct  261   YQVYGGEPYIRSAEEIAYQVALFIAKKRGSYVNYYMYHGGTHFGRTASPFVVTSYYDEAP  320

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYG +R+PKW HLKELHAA+K+ S  LLS   ++  L Q Q AYVF+   SG CAAFL
Sbjct  321   LDEYGSIRQPKWGHLKELHAAVKLASSALLSGEQTSIPLGQLQDAYVFK-VLSGECAAFL  379

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N   KH A V FQ SSYQLPPKSISILPDCK VAFNTAKV+ Q  TR+ Q A KFDS E
Sbjct  380   VNKGPKH-ATVLFQESSYQLPPKSISILPDCKKVAFNTAKVSAQHATRSWQVAQKFDSAE  438

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEE++E +  F+ T +RA TL + I+ TKD SDYLWYT S Q + SD +S +SV+S GH
Sbjct  439   NWEEYKEAIPNFEKTTLRASTLPEQISITKDESDYLWYTFSFQYD-SDAQSTLSVKSHGH  497

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG   GSAHG  RN SF+LE TV+L+KG+N ISLLSA VGLP++GAYLE K  G
Sbjct  498   VLHAFVNGVFTGSAHGRHRNESFSLEQTVTLSKGINYISLLSAMVGLPDNGAYLERKVGG  557

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
               +V +E     +D S  SWGYQVGL GE LQI+++ G + VQW +  SS  QPL WYK
Sbjct  558   LHEVRVE----DQDFSKSSWGYQVGLDGEKLQIHSDSGPSKVQWSKLGSSDHQPLTWYK  612


 Score =   143 bits (361),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             + +FD P G+D +ALNLGSMGKGEAWVNGQSIGR+WVS+ T  G PSQTWYNVPRSFLKP
Sbjct  612   KILFDAPAGHDSIALNLGSMGKGEAWVNGQSIGRFWVSFQTPKGKPSQTWYNVPRSFLKP  671

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE G+P GI+LDKVS+T
Sbjct  672   TGNLLVLLEEENGDPLGISLDKVSVT  697



>gb|KDO80551.1| hypothetical protein CISIN_1g004533mg [Citrus sinensis]
Length=746

 Score =   425 bits (1093),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 215/358 (60%), Positives = 267/358 (75%), Gaps = 7/358 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQV+G    +RSA+DIAFHVALFIA KNGSY+NYYMYHGGTNFGRTAA+FMIT YYDQAP
Sbjct  173   YQVWGGKPYIRSAQDIAFHVALFIA-KNGSYVNYYMYHGGTNFGRTAAAFMITGYYDQAP  231

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+REPKW HLKELHAAIK+CS+ LL+ T +  SL Q Q+A+VF  ++SG CAAFL
Sbjct  232   LDEYGLVREPKWGHLKELHAAIKLCSRPLLTGTQNVISLGQLQEAFVFE-ETSGVCAAFL  290

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND + +  V F+N SY+LP KSISILPDCKTVAFNT +V+TQ N R+    LKFDS E
Sbjct  291   VNNDERKAVTVLFRNISYELPRKSISILPDCKTVAFNTERVSTQYNKRSKTSNLKFDSDE  350

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEE+ E ++ FD+T +RA+ LLD I+  KD SDY WYT      SS+ ++ + V+S GH
Sbjct  351   KWEEYREAILNFDNTLLRAEGLLDQISAAKDASDYFWYTFRFHYNSSNAQAPLDVQSHGH  410

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             +LH FVNGE  GSAHG+  N SFTL +TV L +G N+ +LLS TVGLP+SGA+LE K  G
Sbjct  411   ILHAFVNGEYTGSAHGSHDNVSFTLRNTVHLRQGTNDGALLSVTVGLPDSGAFLERKVAG  470

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
               +V ++     +  +N SWGYQVGL+GE LQIY+  G N V W    S ++ L WYK
Sbjct  471   VHRVRVQ----DKSFTNCSWGYQVGLIGEKLQIYSNLGLNKVLWSSIRSPTRQLTWYK  524


 Score =   123 bits (308),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 71/105 (68%), Gaps = 20/105 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTW----------  1620
             +T F  P GNDP+ALNL SMGKGEAWVNGQSIGRYWVS+ T  G PSQT           
Sbjct  524   KTTFRAPAGNDPIALNLQSMGKGEAWVNGQSIGRYWVSFKTSKGNPSQTQYAVNTVTSIH  583

Query  1621  ----------YNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSI  1725
                       Y+VPR+FLKPTGNLLVL EEE GNP GIT+D ++I
Sbjct  584   FCAIIKATNTYHVPRAFLKPTGNLLVLLEEENGNPLGITVDTIAI  628



>ref|XP_009355858.1| PREDICTED: beta-galactosidase 6 isoform X1 [Pyrus x bretschneideri]
Length=724

 Score =   424 bits (1091),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 207/360 (58%), Positives = 268/360 (74%), Gaps = 4/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHVALFIAR NGSYINYYMYHGGTNFGRT ++++IT YYDQAP
Sbjct  265   YQVYGGEPYIRSAEDIAFHVALFIAR-NGSYINYYMYHGGTNFGRTGSAYVITGYYDQAP  323

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAAIK CS  LL+ T + FSL Q Q+AYVF  +S+G C AFL
Sbjct  324   LDEYGLLRQPKWGHLKELHAAIKSCSTTLLNGTRTNFSLGQLQEAYVFSEESAGRCVAFL  383

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND K +A VQF+N+S++L PKS++IL DC+   FNTA+V T+ N R ++    FD+ +
Sbjct  384   INNDEKSNATVQFRNASHELMPKSVAILSDCEKEIFNTARVNTKQNKRIIRSTKIFDTMD  443

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W++F +++  F++T++++DTLL+H+N TKDVSDYLWYTLS Q   S  +  + VESLGH
Sbjct  444   KWQKFTDIIPNFENTSLQSDTLLEHMNVTKDVSDYLWYTLSFQHNISCAEPVLVVESLGH  503

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H F+N    G+ HG+     F +E  + LN G NNISLLS  VGLP+SGA+LE +  G
Sbjct  504   VTHAFINNMYIGNGHGSHDTKQFVMEKPIGLNNGTNNISLLSVMVGLPDSGAFLERRFAG  563

Query  1055  PRKVTIESSEGS-EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              R+V I+ S+    + +N  WGYQVGLLGE +QIY E+  + V+W +   SS+QPL WYK
Sbjct  564   LRRVEIQCSKKELYNFTNYDWGYQVGLLGEKMQIYKEENIDNVEWSDVGGSSNQPLTWYK  623


 Score =   117 bits (292),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             + VF+ P GNDP+ LNLGSMGKGEAWVN QSIGRYWVS+ T  G PSQT Y++PRSFLK 
Sbjct  623   KIVFEPPVGNDPVILNLGSMGKGEAWVNDQSIGRYWVSFLTSKGKPSQTMYHIPRSFLKN  682

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLLVL EE  GNP   +L+ +S++
Sbjct  683   SGNLLVLLEEYGGNPLHTSLNTISLS  708



>ref|XP_007019137.1| Beta-galactosidase isoform 2 [Theobroma cacao]
 gb|EOY16362.1| Beta-galactosidase isoform 2 [Theobroma cacao]
Length=664

 Score =   422 bits (1085),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 214/360 (59%), Positives = 270/360 (75%), Gaps = 5/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG D  +RSAEDIAFHVALFIA+K GSY+NYYMYHGGTNFGR AA++M+T YYDQAP
Sbjct  258   YQVYGDDVDIRSAEDIAFHVALFIAKK-GSYVNYYMYHGGTNFGRNAAAYMLTGYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKW HLKELHAAIK+CS+ L+S   +T +L + QQA+V+RG+S   CAAFL
Sbjct  317   LDEYGLFRQPKWGHLKELHAAIKLCSKPLISGVYTTMALGRSQQAFVYRGNSV-DCAAFL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKV-TTQSNTRTMQPALKFDST  691
             +NND + +  V F NS Y+LPPKSISILPDCKT AFNTAKV +TQ NTR ++   K DS 
Sbjct  376   VNNDTRKNVGVTFLNSFYELPPKSISILPDCKTEAFNTAKVVSTQYNTRAVETRQKLDSI  435

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLG  871
             E+WEEF+E +  F+ T++RA+ LL+H+NTTKD SDYLWYT   Q + SD +  ++V S  
Sbjct  436   EKWEEFKEAIPTFEKTSLRANILLEHMNTTKDTSDYLWYTFRFQNDFSDAQYVLNVTSSA  495

Query  872   HVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             HVLH FVNG   G  HG+++  +  LE  V+L+ G N+ISLLS  VGLP+SGAYLE +  
Sbjct  496   HVLHAFVNGASVGFTHGSYKTKTPNLERKVTLSNGTNHISLLSGMVGLPDSGAYLERRVA  555

Query  1052  GPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
             G  +V I+     +D ++ SWGYQVGLLGE LQ+YT+ GS+ +QW  + SS  + L WYK
Sbjct  556   GVSRVIIKGEHEIKDFTSYSWGYQVGLLGEKLQVYTDFGSSKIQWNTYGSSTHRTLTWYK  615


 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTW  1620
             +T+FD P G DP+ALNL SMGKGEAWVNGQSIGRYWVS+ T  G+PSQTW
Sbjct  615   KTLFDAPVGKDPVALNLESMGKGEAWVNGQSIGRYWVSFLTPKGSPSQTW  664



>ref|XP_002284529.2| PREDICTED: beta-galactosidase 16-like [Vitis vinifera]
 emb|CBI18991.3| unnamed protein product [Vitis vinifera]
Length=821

 Score =   427 bits (1098),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 209/359 (58%), Positives = 261/359 (73%), Gaps = 3/359 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+VYG D   R+AED+AF VALFIA+KNGS+INYYMYHGGTNFGRT++S+++T+YYDQAP
Sbjct  265   YEVYGEDKRGRAAEDLAFQVALFIAKKNGSFINYYMYHGGTNFGRTSSSYVLTAYYDQAP  324

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHA IK+CS  LL      +SL Q Q+AY+F+   SG CAAFL
Sbjct  325   LDEYGLIRQPKWGHLKELHAVIKLCSDTLLHGVQYNYSLGQLQEAYLFK-RPSGQCAAFL  383

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND + +  V FQN++Y+L   SISILPDCK +AFNTAKV+TQ NTR++Q    F ST+
Sbjct  384   VNNDKRRNVTVLFQNTNYELAANSISILPDCKKIAFNTAKVSTQFNTRSVQTRATFGSTK  443

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W E+ E +  F  T ++A  LL+H+ TTKD SDYLWYTL   Q SS+ +  + V+SL H
Sbjct  444   QWSEYREGIPSFGGTPLKASMLLEHMGTTKDASDYLWYTLRFIQNSSNAQPVLRVDSLAH  503

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG+   SAHG+ +N SF+L + V LN G+N ISLLS  VGLP++G YLEHK  G
Sbjct  504   VLHAFVNGKYIASAHGSHQNGSFSLVNKVPLNSGLNRISLLSVMVGLPDAGPYLEHKVAG  563

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--SQPLIWYK  1225
              R+V I+    S+D S   WGYQVGL+GE  QIYT  GS  VQW    S    PL WYK
Sbjct  564   IRRVEIQDGGDSKDFSKHPWGYQVGLMGEKSQIYTSPGSQKVQWHGLGSHGRGPLTWYK  622


 Score =   128 bits (321),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P GNDP+ L  GSMGKGEAWVNGQSIGRYWVSY T +G PSQTWYNVPR+FL P
Sbjct  622   KTLFDAPPGNDPVVLFFGSMGKGEAWVNGQSIGRYWVSYLTPSGEPSQTWYNVPRAFLNP  681

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
              GNLLV+ EEE G+P  I++  VS+T
Sbjct  682   KGNLLVVQEEESGDPLKISIGTVSVT  707



>ref|XP_007019136.1| Beta-galactosidase isoform 1 [Theobroma cacao]
 gb|EOY16361.1| Beta-galactosidase isoform 1 [Theobroma cacao]
Length=817

 Score =   426 bits (1095),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 214/359 (60%), Positives = 270/359 (75%), Gaps = 4/359 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG D  +RSAEDIAFHVALFIA+K GSY+NYYMYHGGTNFGR AA++M+T YYDQAP
Sbjct  258   YQVYGDDVDIRSAEDIAFHVALFIAKK-GSYVNYYMYHGGTNFGRNAAAYMLTGYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKW HLKELHAAIK+CS+ L+S   +T +L + QQA+V+RG+S   CAAFL
Sbjct  317   LDEYGLFRQPKWGHLKELHAAIKLCSKPLISGVYTTMALGRSQQAFVYRGNSV-DCAAFL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND + +  V F NS Y+LPPKSISILPDCKT AFNTAKV+TQ NTR ++   K DS E
Sbjct  376   VNNDTRKNVGVTFLNSFYELPPKSISILPDCKTEAFNTAKVSTQYNTRAVETRQKLDSIE  435

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEEF+E +  F+ T++RA+ LL+H+NTTKD SDYLWYT   Q + SD +  ++V S  H
Sbjct  436   KWEEFKEAIPTFEKTSLRANILLEHMNTTKDTSDYLWYTFRFQNDFSDAQYVLNVTSSAH  495

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG   G  HG+++  +  LE  V+L+ G N+ISLLS  VGLP+SGAYLE +  G
Sbjct  496   VLHAFVNGASVGFTHGSYKTKTPNLERKVTLSNGTNHISLLSGMVGLPDSGAYLERRVAG  555

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
               +V I+     +D ++ SWGYQVGLLGE LQ+YT+ GS+ +QW  + SS  + L WYK
Sbjct  556   VSRVIIKGEHEIKDFTSYSWGYQVGLLGEKLQVYTDFGSSKIQWNTYGSSTHRTLTWYK  614


 Score =   135 bits (339),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P G DP+ALNL SMGKGEAWVNGQSIGRYWVS+ T  G+PSQTWYNVPRSFLKP
Sbjct  614   KTLFDAPVGKDPVALNLESMGKGEAWVNGQSIGRYWVSFLTPKGSPSQTWYNVPRSFLKP  673

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             T NLLV+ EE+ G P GI++D +SIT
Sbjct  674   TNNLLVILEEQNGYPLGISVDTISIT  699



>ref|XP_006441550.1| hypothetical protein CICLE_v10023501mg [Citrus clementina]
 gb|ESR54790.1| hypothetical protein CICLE_v10023501mg [Citrus clementina]
Length=798

 Score =   425 bits (1093),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 213/362 (59%), Positives = 276/362 (76%), Gaps = 7/362 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG D + R+A+DIAFHVAL++AR NGS++NYYMYHGGTNFGR A++F+  SYYD AP
Sbjct  243   YQAYGEDPIGRTADDIAFHVALWVAR-NGSFVNYYMYHGGTNFGREASAFVTASYYDDAP  301

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQ-ILLSATPSTFSLAQFQQAYVFRGDSSGACA-A  508
             LDEYG++ +PKW HLKELHAAIK+CS  +LL    +   L   Q+AY+F  +SS  CA A
Sbjct  302   LDEYGMINQPKWGHLKELHAAIKLCSNTLLLGKAMTPLQLGPKQEAYLFAENSSEECASA  361

Query  509   FLINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDS  688
             FL+N D K +  V FQNSSY+L   SISILPDC+ V FNTA+V TQ+NTRT  P + F+ 
Sbjct  362   FLVNKD-KQNVDVVFQNSSYKLLANSISILPDCRNVIFNTAEVKTQTNTRTRIPIMYFNV  420

Query  689   TeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESL  868
             +++WEEF+E +  F+DT++++DTLL+H +TTKD SDYLWY+ S Q E SD ++ +SV SL
Sbjct  421   SDQWEEFKEPIPNFEDTSLKSDTLLEHTDTTKDTSDYLWYSFSFQHEPSDTRAQLSVHSL  480

Query  869   GHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKT  1048
             GHVLH FVNG   GSAHG+++N+SFTL++  SL+ G+NN+SLLS  VGLP+SGAYLE K 
Sbjct  481   GHVLHAFVNGVPVGSAHGSYKNTSFTLQTDFSLSNGINNVSLLSVMVGLPDSGAYLERKR  540

Query  1049  LGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS---SQPLIW  1219
              GP  V+I++ EGS + +N  WG +VGLLGENLQIYT++GS  +QW + SS   S PL W
Sbjct  541   YGPVAVSIQNKEGSMNFTNYKWGQKVGLLGENLQIYTDEGSKIIQWSKLSSLDISPPLTW  600

Query  1220  YK  1225
             YK
Sbjct  601   YK  602


 Score =   108 bits (270),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD    ++ +ALN+  M KGEAWVNGQS GRYW S  T  G PSQ  YN+PRSFLKP
Sbjct  602   KTAFDATGEDEHVALNVNGMRKGEAWVNGQSFGRYWPSLRTPRGEPSQISYNIPRSFLKP  661

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             TGNLLVL EEE G+P  ITL+KV I
Sbjct  662   TGNLLVLLEEEGGDPLSITLEKVVI  686



>ref|XP_003527942.1| PREDICTED: beta-galactosidase 16-like [Glycine max]
Length=697

 Score =   422 bits (1084),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 216/358 (60%), Positives = 266/358 (74%), Gaps = 9/358 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQV+G    +RSAEDIA++VALFIA++ GSY+NYYMYHGGTNF R A++F+IT+YYD+AP
Sbjct  261   YQVFGEVPYIRSAEDIAYNVALFIAKR-GSYVNYYMYHGGTNFDRIASAFVITAYYDEAP  319

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+REPKW HLKELHAAIK CS  +L  T ++FSL   Q AYVF+  SS  CAAFL
Sbjct  320   LDEYGLVREPKWGHLKELHAAIKSCSNSILHGTQTSFSLGTQQNAYVFK-RSSIECAAFL  378

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N +   S  +QFQN  YQLPP SISILPDCK VAFNTAKV+ Q N R M+  L+F+S E
Sbjct  379   ENTE-DQSVTIQFQNIPYQLPPNSISILPDCKNVAFNTAKVSIQ-NARAMKSQLEFNSAE  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W+ ++E +  F DT++RA+TLLD I+TTKD SDYLWYT  L   S + +S +S  S GH
Sbjct  437   TWKVYKEAIPSFGDTSLRANTLLDQISTTKDTSDYLWYTFRLYDNSPNAQSILSAYSHGH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG L GS HG+ +N SF +E+ ++L  GMNNIS LSATVGLPNSGAYLE +  G
Sbjct  497   VLHAFVNGNLVGSIHGSHKNLSFVMENKLNLINGMNNISFLSATVGLPNSGAYLERRVAG  556

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
              R + ++      D +N +WGYQ+GLLGE LQIYT  GS+ VQW  F SS++PL WYK
Sbjct  557   LRSLKVQ----GRDFTNQAWGYQIGLLGEKLQIYTASGSSKVQWESFQSSTKPLTWYK  610


 Score =   136 bits (342),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P GNDP+ LNLGSMGKG  W+NGQ IGRYWVS+HT  GTPSQ WY++PRS LK 
Sbjct  610   KTTFDAPVGNDPVVLNLGSMGKGYTWINGQGIGRYWVSFHTPQGTPSQKWYHIPRSLLKS  669

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE GNP GITLD V IT
Sbjct  670   TGNLLVLLEEETGNPLGITLDTVYIT  695



>ref|XP_006472815.1| PREDICTED: beta-galactosidase 16-like isoform X1 [Citrus sinensis]
Length=823

 Score =   425 bits (1093),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 215/358 (60%), Positives = 267/358 (75%), Gaps = 7/358 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQV+G    +RSA+DIAFHVALFIA KNGSY+NYYMYHGGTNFGRTAA+FMIT YYDQAP
Sbjct  270   YQVWGGKPYIRSAQDIAFHVALFIA-KNGSYVNYYMYHGGTNFGRTAAAFMITGYYDQAP  328

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+REPKW HLKELHAAIK+CS+ LL+ T +  SL Q Q+A+VF  ++SG CAAFL
Sbjct  329   LDEYGLVREPKWGHLKELHAAIKLCSRPLLTGTQNVISLGQLQEAFVFE-ETSGVCAAFL  387

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND + +  V F+N SY+LP KSISILPDCKTVAFNT +V+TQ N R+    LKFDS E
Sbjct  388   VNNDERKAVTVLFRNISYELPRKSISILPDCKTVAFNTERVSTQYNKRSKTSNLKFDSDE  447

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEE+ E ++ FD+T +RA+ LLD I+  KD SDY WYT      SS+ ++ + V+S GH
Sbjct  448   KWEEYREAILNFDNTLLRAEGLLDQISAAKDASDYFWYTFRFHYNSSNAQAPLDVQSHGH  507

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             +LH FVNGE  GSAHG+  N SFTL +TV L +G N+ +LLS TVGLP+SGA+LE K  G
Sbjct  508   ILHAFVNGEYTGSAHGSHDNVSFTLRNTVHLRQGTNDGALLSVTVGLPDSGAFLERKVAG  567

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
               +V ++     +  +N SWGYQVGL+GE LQIY+  G N V W    S ++ L WYK
Sbjct  568   VHRVRVQ----DKSFTNCSWGYQVGLIGEKLQIYSNLGLNKVLWSSIRSPTRQLTWYK  621


 Score =   134 bits (337),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P GNDP+ALNL SMGKGEAWVNGQSIGRYWVS+ T  G PSQT Y+VPR FLKP
Sbjct  621   KTTFRAPAGNDPIALNLQSMGKGEAWVNGQSIGRYWVSFKTSKGNPSQTRYHVPRGFLKP  680

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             TGNLLVL EEE GNP GIT+D ++I
Sbjct  681   TGNLLVLLEEENGNPLGITVDTIAI  705



>ref|XP_004502496.1| PREDICTED: beta-galactosidase 16-like [Cicer arietinum]
Length=704

 Score =   421 bits (1083),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 215/358 (60%), Positives = 263/358 (73%), Gaps = 9/358 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ +G    +RSA+DIA++VALFIA+K GSY+NYYMYHGGTNF R A++F+ T+YYD+AP
Sbjct  265   YQAFGGVPYLRSAKDIAYNVALFIAKK-GSYVNYYMYHGGTNFDRMASAFITTAYYDEAP  323

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAIK CSQ LL  T +TFSL   QQAYVFR  SS  CAAFL
Sbjct  324   LDEYGLVRQPKWGHLKELHAAIKSCSQALLYGTQTTFSLGSQQQAYVFR--SSTECAAFL  381

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
               N       VQFQN  YQLP KSISILPDCK VAFNTAKV  Q+N R M+  L+F+S E
Sbjct  382   -ENSRNGDVTVQFQNIPYQLPSKSISILPDCKNVAFNTAKVNVQNNARAMKTQLQFNSAE  440

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W+ + E +  FDDT++RA+TLLD I T KD SDY+WYT      S + +S +S+ S GH
Sbjct  441   NWKVYTEAIPNFDDTSLRANTLLDQIGTAKDTSDYMWYTFRFNGNSPNAQSVLSIYSQGH  500

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH F+NG L GSAHG+  N    +E+ V+L  GMNNIS+LSATVGLPNSGAYLE +  G
Sbjct  501   VLHSFINGVLIGSAHGSHNNMYVAMENNVNLINGMNNISILSATVGLPNSGAYLERRVAG  560

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
              R+V ++      D ++ SWGYQVGLLGE +QIYT  GS+ VQW+ F SS++PL WY+
Sbjct  561   LRQVKVQ----GRDFTSYSWGYQVGLLGETMQIYTATGSSKVQWQSFQSSTKPLTWYQ  614


 Score =   141 bits (356),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 79/114 (69%), Gaps = 0/114 (0%)
 Frame = +1

Query  1396  VLTALSAPKLYCHFLLIKLKVETT*QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRY  1575
             + TA  + K+         K  T  QT FDEP GNDP+ LNLGSMGKG  WVNGQ IGRY
Sbjct  589   IYTATGSSKVQWQSFQSSTKPLTWYQTTFDEPAGNDPVVLNLGSMGKGLTWVNGQGIGRY  648

Query  1576  WVSYHTVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSITLDK  1737
             W+S+HT  GTPSQ WY++PRS LK TGNLLV+ EEE GNP GITLD V I  D+
Sbjct  649   WISFHTQKGTPSQQWYHIPRSLLKSTGNLLVILEEETGNPLGITLDTVYIAEDQ  702



>emb|CBI18990.3| unnamed protein product [Vitis vinifera]
Length=817

 Score =   425 bits (1092),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 211/361 (58%), Positives = 269/361 (75%), Gaps = 4/361 (1%)
 Frame = +2

Query  152   SYQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQA  331
             SY ++G DA  R  EDIAFHVALF+A+ NGS+INYYMYHGGTNFGRTA++++ T+YYD+A
Sbjct  260   SYPLFGEDARPRPVEDIAFHVALFVAKMNGSFINYYMYHGGTNFGRTASAYVQTAYYDEA  319

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLA-QFQQAYVFRGDSSGACAA  508
             PLDEYGL+++P W HLKELHAA+K+CS+ LL    S  SL  + Q+AYVFRG  SG CAA
Sbjct  320   PLDEYGLIQQPTWGHLKELHAAVKLCSETLLQGAQSNLSLGTKLQEAYVFRGQ-SGKCAA  378

Query  509   FLINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDS  688
             FL+NND +    V FQN+SY+LP KSISILPDCK  AFNTAK + +    ++Q   KF+S
Sbjct  379   FLVNNDSRTDVTVVFQNTSYELPRKSISILPDCKNEAFNTAKASFRPGLISIQTVTKFNS  438

Query  689   TeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESL  868
             TE+WEE++E ++ FDDT+ RA+TLL+H+NTTKD SDYLWYT     + S+ +S +S  S 
Sbjct  439   TEQWEEYKESILNFDDTSSRANTLLEHMNTTKDASDYLWYTFRYNNDPSNGQSVLSTNSR  498

Query  869   GHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKT  1048
              H LH F+NG   GS HG+  N SF+L++TVS   G+NN+SLLS  VGLP+SGAYLE + 
Sbjct  499   AHALHAFINGRHTGSQHGSSSNLSFSLDNTVSFRAGINNVSLLSVMVGLPDSGAYLERRV  558

Query  1049  LGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQP--LIWY  1222
              G R+V I+S+   +D +N+ WGYQVGLLGE LQIYT+ GS  VQW +F SS    L WY
Sbjct  559   AGLRRVRIQSNGSLKDFTNNPWGYQVGLLGEKLQIYTDVGSQKVQWSKFGSSTSGLLTWY  618

Query  1223  K  1225
             K
Sbjct  619   K  619


 Score =   132 bits (332),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +TVFD P GN+P+ALNL SM KGE WVNGQSIGRYWVS+ T +G PSQ WY++PRSFLKP
Sbjct  619   KTVFDAPAGNEPVALNLVSMRKGEVWVNGQSIGRYWVSFLTPSGKPSQIWYHIPRSFLKP  678

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             TGNLLVL EEE G+P GI++ KVSI
Sbjct  679   TGNLLVLLEEETGHPVGISIGKVSI  703



>ref|XP_008338665.1| PREDICTED: beta-galactosidase 16 isoform X2 [Malus domestica]
Length=757

 Score =   422 bits (1086),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 221/359 (62%), Positives = 267/359 (74%), Gaps = 9/359 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG   L+RSAEDIA+ VALFIA+  GSY+NYYMYHGGTNFGR+A++F+ITSYYD+AP
Sbjct  204   YQVYGDKPLLRSAEDIAYQVALFIAKFRGSYVNYYMYHGGTNFGRSASAFVITSYYDEAP  263

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYG +R+PKW HLKELHAA+K+ S  LLS   +  SL + Q AYVF+   SG CAAFL
Sbjct  264   LDEYGSVRQPKWGHLKELHAAVKLASNPLLSGGHTNVSLGELQDAYVFQ-VKSGECAAFL  322

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N  G   A V FQNS YQLP KSISILPDCKTVAFNTAKV  Q +TR+ Q   KFDSTE
Sbjct  323   VNK-GPKDASVVFQNSPYQLPRKSISILPDCKTVAFNTAKVNAQQSTRSWQVTQKFDSTE  381

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEE++E +  FD+   RA+TL + + TTKD SDYLWYT+SL+Q+S+  +S + V+S GH
Sbjct  382   RWEEYKEAIPNFDNXXSRANTLPEQLFTTKDESDYLWYTISLKQDSNT-QSKLXVQSRGH  440

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG   GSAHG  RN  F+LE TV LNKG+N++S LSA VGLP+SGAYLE +  G
Sbjct  441   VLHAFVNGVFVGSAHGRHRNEXFSLEQTVILNKGVNSLSFLSAMVGLPDSGAYLERRVGG  500

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
              RKV I       DLS +SWGY VGL GE L+IYT+ G + V+W +  SS  QPL W+K
Sbjct  501   LRKVLIX----ERDLSKNSWGYXVGLSGEKLEIYTDAGXSKVEWNKLGSSANQPLKWFK  555


 Score =   135 bits (341),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P GNDP+ALNLGSMGKGEA+VNGQSIGRYWV + T  G PSQTWY+VPR+FLKP
Sbjct  555   KTHFDAPAGNDPIALNLGSMGKGEAFVNGQSIGRYWVLFQTPEGKPSQTWYHVPRAFLKP  614

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE G+P  ++LDK+S+ 
Sbjct  615   TGNLLVLLEEENGDPLKVSLDKISVA  640



>ref|XP_006434247.1| hypothetical protein CICLE_v10003478mg [Citrus clementina]
 gb|ESR47487.1| hypothetical protein CICLE_v10003478mg [Citrus clementina]
Length=802

 Score =   423 bits (1088),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 215/358 (60%), Positives = 266/358 (74%), Gaps = 7/358 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQV+G    +RSA+DIAFHVALFIA KNGSY+NYYMYHGGTNFGRTAA+FMIT YYDQAP
Sbjct  249   YQVWGGKPYIRSAQDIAFHVALFIA-KNGSYVNYYMYHGGTNFGRTAAAFMITGYYDQAP  307

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+REPKW HLKELHAAIK+CS+ LL+ T +   L Q Q+AYVF  ++SG CAAFL
Sbjct  308   LDEYGLVREPKWGHLKELHAAIKLCSRPLLTGTQNVIPLGQLQEAYVFE-ETSGVCAAFL  366

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND + +  V F+N SY+LP KSISILPDCKTVAFNT +V+TQ N R+    LKFDS E
Sbjct  367   VNNDERKAVTVLFRNISYELPRKSISILPDCKTVAFNTERVSTQYNKRSKTSNLKFDSDE  426

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEE+ E +  FD+T +RA+ LLD I+  KD SDYLWYT      SS+ ++ + V+S GH
Sbjct  427   KWEEYREAIPNFDNTLLRAEGLLDQISAAKDASDYLWYTFRFHYNSSNAQAPLDVQSHGH  486

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             +LH FVNGE  GSAHG+  N SFTL +TV L +G ++ +LLS TVGLP+SGA+LE K  G
Sbjct  487   ILHAFVNGEYTGSAHGSHDNVSFTLRNTVHLRQGTSDGALLSVTVGLPDSGAFLERKVAG  546

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
               +V ++     +  +N SWGYQVGL+GE LQIY+  G N V W    S ++ L WYK
Sbjct  547   VHRVRVQ----DKSFTNCSWGYQVGLIGEKLQIYSNLGLNKVLWSSIRSPTRQLTWYK  600


 Score =   136 bits (343),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P GNDP+ALNL SMGKGEAWVNGQSIGRYWVS+ T  G PSQT Y+VPR+FLKP
Sbjct  600   KTTFRAPAGNDPIALNLQSMGKGEAWVNGQSIGRYWVSFKTSKGNPSQTQYHVPRAFLKP  659

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE GNP GIT+D ++IT
Sbjct  660   TGNLLVLLEEENGNPLGITVDTIAIT  685



>ref|XP_002889142.1| hypothetical protein ARALYDRAFT_476906 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65401.1| hypothetical protein ARALYDRAFT_476906 [Arabidopsis lyrata subsp. 
lyrata]
Length=818

 Score =   423 bits (1088),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 214/359 (60%), Positives = 258/359 (72%), Gaps = 6/359 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG + L+RSAEDIAFHVALFIA KNGS++NYYMYHGGTNFGR A+ F+ITSYYDQAP
Sbjct  258   YQTYGEEPLIRSAEDIAFHVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAA+K+C + LLS   +T SL + Q A+VF G  +  CAA L
Sbjct  317   LDEYGLLRQPKWGHLKELHAAVKLCEEPLLSGLQTTISLGKLQTAFVF-GKKANLCAALL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D K    VQF+NSSY+L PKSIS+LPDCK VAFNTAKV  Q NTRT +P     S  
Sbjct  376   VNQD-KCDCTVQFRNSSYRLSPKSISVLPDCKNVAFNTAKVNAQYNTRTRKPRQNLSSPH  434

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WE+F E V  F +T+IR+++LL+H+NTT+D SDYLW T   +Q    P S + V  LGH
Sbjct  435   MWEKFTETVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFEQSEGAP-SVLKVNHLGH  493

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVN    GS HGTF+  SF LE  +SLN G NN++LLS  VGLPNSGA+LE + +G
Sbjct  494   VLHAFVNERFIGSMHGTFKAHSFLLEKNMSLNNGTNNMALLSVMVGLPNSGAHLERRVVG  553

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              R V I +       +N SWGYQVGL GE   +YTE G+  VQW+++  S SQPL WYK
Sbjct  554   SRSVNIWNGSYQLFFNNYSWGYQVGLKGEKYHVYTEDGAKKVQWKQYRDSKSQPLTWYK  612


 Score =   132 bits (332),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD PEG DP+ALNLGSMGKGEAWVNGQSIGRYWVS++T  G PSQ WY++PRSFLKP  N
Sbjct  615   FDTPEGEDPVALNLGSMGKGEAWVNGQSIGRYWVSFYTSKGNPSQIWYHIPRSFLKPNSN  674

Query  1660  LLVLFEEEY-GNPYGITLDKVSIT  1728
             LLV+ EEE  G P GIT+D VS+T
Sbjct  675   LLVILEEEREGYPLGITIDTVSVT  698



>ref|XP_010063413.1| PREDICTED: beta-galactosidase 16-like [Eucalyptus grandis]
Length=700

 Score =   419 bits (1078),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 212/359 (59%), Positives = 268/359 (75%), Gaps = 9/359 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y V+G D   RS +DIAF VALFIA+K GSY+NYYMYHGGTNFGRTA++F+ TSYYDQAP
Sbjct  261   YLVFGEDQRTRSVKDIAFQVALFIAKK-GSYVNYYMYHGGTNFGRTASAFVTTSYYDQAP  319

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+P+W HL ELH  IK CS+ LL  TP   SL   QQA VFRG S G CAAFL
Sbjct  320   LDEYGLMRQPQWGHLTELHGTIKSCSKALLYGTPVDTSLGPLQQAIVFRG-SQGICAAFL  378

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND + S ++ FQN  + LPPKSISILPDCKT  FNTA+ +T+ +TRTM    K DS++
Sbjct  379   INNDTR-STRILFQNIPFVLPPKSISILPDCKTAFFNTAETSTKVSTRTMTINQKLDSSD  437

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W+E++E ++ FD T+ RA+TLLDH+N TKD SDY+WYT  +QQ+S + ++ + V S GH
Sbjct  438   KWQEYQEEIISFDMTSFRANTLLDHMNITKDASDYVWYTFRVQQDSPNAEAELDVFSQGH  497

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              LH+F+NGE AGSAHG+  NS+F+L+ +V  NKG+N ISLLS TVG PNSGA+LE +  G
Sbjct  498   ALHVFLNGEYAGSAHGSHDNSTFSLQQSVFFNKGINYISLLSVTVGFPNSGAHLERRIAG  557

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--SQPLIWYK  1225
             PR++ I       D +N +WGYQVGL GEN  IYT+ GS+ V+W ++ S  S  LIWYK
Sbjct  558   PRRLKINRV----DFTNYAWGYQVGLSGENKGIYTDFGSSKVRWNKYGSSISNRLIWYK  612


 Score =   136 bits (342),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P GNDP+ALNL SMGKGE +VNGQSIGRYWVS+HT +G PSQ WY++PRSFLKP
Sbjct  612   KTTFDAPVGNDPVALNLSSMGKGEVYVNGQSIGRYWVSFHTDSGVPSQIWYHIPRSFLKP  671

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
              GNLLV+ EEE GNP GIT+D V  T
Sbjct  672   KGNLLVILEEESGNPLGITIDTVQAT  697



>ref|XP_008338663.1| PREDICTED: beta-galactosidase 16 isoform X1 [Malus domestica]
Length=813

 Score =   422 bits (1086),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 221/359 (62%), Positives = 267/359 (74%), Gaps = 9/359 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG   L+RSAEDIA+ VALFIA+  GSY+NYYMYHGGTNFGR+A++F+ITSYYD+AP
Sbjct  260   YQVYGDKPLLRSAEDIAYQVALFIAKFRGSYVNYYMYHGGTNFGRSASAFVITSYYDEAP  319

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYG +R+PKW HLKELHAA+K+ S  LLS   +  SL + Q AYVF+   SG CAAFL
Sbjct  320   LDEYGSVRQPKWGHLKELHAAVKLASNPLLSGGHTNVSLGELQDAYVFQ-VKSGECAAFL  378

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N  G   A V FQNS YQLP KSISILPDCKTVAFNTAKV  Q +TR+ Q   KFDSTE
Sbjct  379   VNK-GPKDASVVFQNSPYQLPRKSISILPDCKTVAFNTAKVNAQQSTRSWQVTQKFDSTE  437

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEE++E +  FD+   RA+TL + + TTKD SDYLWYT+SL+Q+ S+ +S + V+S GH
Sbjct  438   RWEEYKEAIPNFDNXXSRANTLPEQLFTTKDESDYLWYTISLKQD-SNTQSKLXVQSRGH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG   GSAHG  RN  F+LE TV LNKG+N++S LSA VGLP+SGAYLE +  G
Sbjct  497   VLHAFVNGVFVGSAHGRHRNEXFSLEQTVILNKGVNSLSFLSAMVGLPDSGAYLERRVGG  556

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
              RKV I       DLS +SWGY VGL GE L+IYT+ G + V+W +  SS  QPL W+K
Sbjct  557   LRKVLIX----ERDLSKNSWGYXVGLSGEKLEIYTDAGXSKVEWNKLGSSANQPLKWFK  611


 Score =   136 bits (342),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P GNDP+ALNLGSMGKGEA+VNGQSIGRYWV + T  G PSQTWY+VPR+FLKP
Sbjct  611   KTHFDAPAGNDPIALNLGSMGKGEAFVNGQSIGRYWVLFQTPEGKPSQTWYHVPRAFLKP  670

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE G+P  ++LDK+S+ 
Sbjct  671   TGNLLVLLEEENGDPLKVSLDKISVA  696



>ref|NP_177866.2| beta-galactosidase 16 [Arabidopsis thaliana]
 sp|Q8GX69.2|BGA16_ARATH RecName: Full=Beta-galactosidase 16; Short=Lactase 16; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE35975.1| beta-galactosidase 16 [Arabidopsis thaliana]
Length=815

 Score =   422 bits (1085),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 214/359 (60%), Positives = 258/359 (72%), Gaps = 6/359 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG + L+RSAEDIAFHVALFIA KNGS++NYYMYHGGTNFGR A+ F+ITSYYDQAP
Sbjct  258   YQTYGEEPLIRSAEDIAFHVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAA+K+C + LLS   +T SL + Q A+VF G  +  CAA L
Sbjct  317   LDEYGLLRQPKWGHLKELHAAVKLCEEPLLSGLQTTISLGKLQTAFVF-GKKANLCAAIL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D K  + VQF+NSSY+L PKS+S+LPDCK VAFNTAKV  Q NTRT +      S +
Sbjct  376   VNQD-KCESTVQFRNSSYRLSPKSVSVLPDCKNVAFNTAKVNAQYNTRTRKARQNLSSPQ  434

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEEF E V  F +T+IR+++LL+H+NTT+D SDYLW T   QQ    P S + V  LGH
Sbjct  435   MWEEFTETVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQSEGAP-SVLKVNHLGH  493

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              LH FVNG   GS HGTF+   F LE  +SLN G NN++LLS  VGLPNSGA+LE + +G
Sbjct  494   ALHAFVNGRFIGSMHGTFKAHRFLLEKNMSLNNGTNNLALLSVMVGLPNSGAHLERRVVG  553

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              R V I +       +N SWGYQVGL GE   +YTE GS  VQW+++  S SQPL WYK
Sbjct  554   SRSVKIWNGRYQLYFNNYSWGYQVGLKGEKFHVYTEDGSAKVQWKQYRDSKSQPLTWYK  612


 Score =   138 bits (347),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD PEG DP+ALNLGSMGKGEAWVNGQSIGRYWVS+HT  G PSQ WY++PRSFLKP  N
Sbjct  615   FDTPEGEDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTYKGNPSQIWYHIPRSFLKPNSN  674

Query  1660  LLVLFEEEY-GNPYGITLDKVSIT  1728
             LLV+ EEE  GNP GIT+D VS+T
Sbjct  675   LLVILEEEREGNPLGITIDTVSVT  698



>ref|XP_008466741.1| PREDICTED: beta-galactosidase 16 isoform X1 [Cucumis melo]
Length=850

 Score =   423 bits (1088),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 217/375 (58%), Positives = 269/375 (72%), Gaps = 7/375 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG +  +RSAE+IAFHVALFIA KNG+Y+NYYMYHGGTNFGR+A++FMIT YYDQ P
Sbjct  268   YQTYGEEPYIRSAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMITGYYDQGP  327

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLKELHAA+K+CS  LL+ T   FSL Q  +A VF+ +S   CAAFL
Sbjct  328   LDEYGLTREPKWGHLKELHAAVKLCSTPLLTGTKFNFSLGQSLEAIVFKTESD-ECAAFL  386

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N  G     V FQN +Y+LP  SISILPDCK VAFNT +V+ Q NTR+M    KFDS+E
Sbjct  387   VNR-GAIDTDVLFQNVTYELPLGSISILPDCKNVAFNTRRVSVQRNTRSMMTVQKFDSSE  445

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             EWEEF+E +  F+DT +RA+ LL+H+ TTKD SDYLWYT  +QQ+S D +    V+S  H
Sbjct  446   EWEEFKEPIPNFEDTELRANKLLEHMGTTKDRSDYLWYTFRVQQDSPDSQQTFEVDSRAH  505

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              LH FVNG+ AGSAHGT++   F+L + ++L  G+NNISLLS  VGLP+SGA+LE +  G
Sbjct  506   ALHAFVNGDYAGSAHGTYKEKGFSLVNNITLRNGINNISLLSVMVGLPDSGAFLETRVAG  565

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REFSSSQPLIWYKEW  1231
              R+V I+     ED S   WGY+VGL GE  QI+ + GS+ VQW R  +SSQPL WYK  
Sbjct  566   LRRVGIQ----GEDFSEQPWGYKVGLSGEQSQIFLDTGSSNVQWSRLGNSSQPLTWYKVL  621

Query  1232  RTIKKVYLPARAVKT  1276
               I   YL  +  +T
Sbjct  622   PIINSNYLEFKCSRT  636


 Score =   137 bits (344),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 74/102 (73%), Gaps = 7/102 (7%)
 Frame = +1

Query  1423  LYCHFLLIKLKVETT*QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAG  1602
              YCH LLI        QT FD P G+DP+ALNLGSMGKG AWVNG+ IGRYWVS+ T  G
Sbjct  639   CYCHSLLIG-------QTRFDAPPGDDPIALNLGSMGKGAAWVNGRGIGRYWVSFLTPKG  691

Query  1603  TPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
              PSQ WYNVPRSFLKPT N LV+ EEE GNP  I+LD V IT
Sbjct  692   EPSQKWYNVPRSFLKPTDNQLVILEEETGNPVEISLDSVLIT  733



>gb|KEH35318.1| beta-like galactosidase [Medicago truncatula]
Length=639

 Score =   417 bits (1071),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 213/357 (60%), Positives = 262/357 (73%), Gaps = 9/357 (3%)
 Frame = +2

Query  158   QVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPL  337
             Q +G    MRSA DIA++VALFIA+K GSY+NYYMYHGGTNF R A++F+IT+YYD+APL
Sbjct  205   QAFGGAPYMRSASDIAYNVALFIAKK-GSYVNYYMYHGGTNFDRLASAFIITAYYDEAPL  263

Query  338   DEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLI  517
             DEYGL+R+PKW HLKELHA+IK CSQ LL  T +TFSL   QQAYVFR  SS  CAAFL 
Sbjct  264   DEYGLVRQPKWGHLKELHASIKSCSQPLLDGTQTTFSLGSEQQAYVFR--SSTECAAFL-  320

Query  518   NNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTee  697
              N G     +QFQN SY+LP KSISILP CK V FNT KV+ Q+N R M+P L+F+S E 
Sbjct  321   ENSGPRDVTIQFQNISYELPGKSISILPGCKNVVFNTGKVSIQNNVRAMKPRLQFNSAEN  380

Query  698   weefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGHV  877
             W+ + E +  F  T+ RADTLLD I+T KD SDY+WYT     +S + KS +S+ S G V
Sbjct  381   WKVYTEAIPNFAHTSKRADTLLDQISTAKDTSDYMWYTFRFNNKSPNAKSVLSIYSQGDV  440

Query  878   LHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLGP  1057
             LH F+NG L GSAHG+  N+  T++  V+L  GMNNIS+LSATVGLPNSGA+LE +  G 
Sbjct  441   LHSFINGVLTGSAHGSRNNTQVTMKKNVNLINGMNNISILSATVGLPNSGAFLESRVAGL  500

Query  1058  RKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
             RKV ++      D S+ SWGYQVGLLGE LQI+T  GS+ VQW+ F SS++PL WY+
Sbjct  501   RKVEVQ----GRDFSSYSWGYQVGLLGEKLQIFTVSGSSKVQWKSFQSSTKPLTWYQ  553


 Score =   133 bits (334),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             QT F  P GNDP+ +NLGSMGKG AWVNGQ IGRYWVS+H   GTPSQ WY++PRSFLK 
Sbjct  553   QTTFHAPAGNDPVVVNLGSMGKGLAWVNGQGIGRYWVSFHKPDGTPSQQWYHIPRSFLKS  612

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             TGNLLV+ EEE GNP GITLD V I
Sbjct  613   TGNLLVILEEETGNPLGITLDTVYI  637



>ref|XP_010471934.1| PREDICTED: beta-galactosidase 16-like [Camelina sativa]
Length=820

 Score =   422 bits (1085),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 216/359 (60%), Positives = 261/359 (73%), Gaps = 6/359 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG + L+RSAEDIAF VALFIA KNGS++NYYMYHGGTNFGR A+ F+ITSYYDQAP
Sbjct  260   YQTYGDEPLIRSAEDIAFQVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAP  318

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAA+K+C + LLS   +T SL + Q A+VF G  +  CAA L
Sbjct  319   LDEYGLLRQPKWGHLKELHAAVKLCEKPLLSGLQTTISLGKLQTAFVF-GKKANLCAALL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D +  A VQF+NSSY L PKSIS+LPDCK VAFNTAKV  Q +TRT +P  K  S  
Sbjct  378   VNQD-ECEATVQFRNSSYLLSPKSISVLPDCKNVAFNTAKVNAQYSTRTREPRQKLSSPH  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEEF E V  F +T+IR+++LL+H+NTT+D SDYLW T   QQ     +S + V  LGH
Sbjct  437   MWEEFTETVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQPEGA-QSVLKVNHLGH  495

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG+  GS HGT++   F LE  VSLN G NNI+LLS  VGLPNSGA+LE + +G
Sbjct  496   VLHGFVNGKFIGSMHGTYKAHRFLLEKNVSLNNGTNNIALLSVMVGLPNSGAHLERRVVG  555

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              R V I + + S   +N SWGYQVGL GE   +YTE G+  VQW+++  S SQPL WYK
Sbjct  556   SRSVKIWNGKHSLYFNNYSWGYQVGLQGEKFHVYTENGAAKVQWKKYRDSKSQPLTWYK  614


 Score =   135 bits (340),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P+G DP+ALNLGSMGKGEAWVNGQSIGRYWVS+HT  G PSQ WY++PRSFLKP+ N
Sbjct  617   FDTPDGTDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTFKGNPSQIWYHIPRSFLKPSSN  676

Query  1660  LLVLFEEEY-GNPYGITLDKVSIT  1728
             LLV+ EEE  G P G+T+D VS+T
Sbjct  677   LLVILEEEREGKPLGVTIDTVSVT  700



>emb|CDP10946.1| unnamed protein product [Coffea canephora]
Length=705

 Score =   419 bits (1076),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 214/360 (59%), Positives = 271/360 (75%), Gaps = 6/360 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG    +RSAED+A++VALFIARKNGS++NYYMYHGGTNFGRT ++F+ITSYYD+AP
Sbjct  261   YQVYGDKTPLRSAEDLAYNVALFIARKNGSFVNYYMYHGGTNFGRTGSAFVITSYYDEAP  320

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             +DEYGL+R+PKW HLK+LH+ IK CSQ LL    S   L Q Q+AYVFR D SG CAAFL
Sbjct  321   IDEYGLIRQPKWGHLKQLHSVIKSCSQTLLHGVISVSPLGQQQEAYVFRRD-SGECAAFL  379

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAK--VTTQSNTRTMQPALKFDS  688
             +N D +    V FQN  Y+LP  SISILPDC T AFNTAK  VTTQS  R+  P +KF+S
Sbjct  380   VNYDRRTEVVVLFQNIHYKLPATSISILPDCATEAFNTAKARVTTQSYKRSTLPTVKFNS  439

Query  689   TeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESL  868
              + W EF E +  F +T+I +++LL+H+NTTKD SDYLWY  S+   SS  +S ++V+S 
Sbjct  440   VDRWSEFREAIPVFGETSISSNSLLEHMNTTKDKSDYLWYMTSVN--SSKAQSLLTVDSR  497

Query  869   GHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKT  1048
             GH LH FVNGE AGSAHG  +N +F LE T++L+   NNISLLS TVGLPNSGAYLE ++
Sbjct  498   GHALHAFVNGEHAGSAHGDHKNPAFALERTINLHHRRNNISLLSLTVGLPNSGAYLERRS  557

Query  1049  LGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS-QPLIWYK  1225
             LG     +++S+ + DL+N +WGYQVGLLGE L+++TEKGS+A  W + S+S + L WYK
Sbjct  558   LGLDGARLKNSQATNDLTNSAWGYQVGLLGERLRLHTEKGSSAALWSKLSASPKQLTWYK  617


 Score =   127 bits (320),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG+DPLA+NLGSMGKGEAW+NG SIGRYWVS+    G+PSQTWY++P+SFLKP
Sbjct  617   KTYFDAPEGDDPLAINLGSMGKGEAWINGHSIGRYWVSFLKADGSPSQTWYHIPKSFLKP  676

Query  1651  TGNLLVLFEEEYGNPYGITLDKV  1719
              GN LVLFEEE  +P  I++D +
Sbjct  677   KGNRLVLFEEESKDPLNISIDVI  699



>ref|XP_003522573.1| PREDICTED: beta-galactosidase 16-like [Glycine max]
Length=696

 Score =   418 bits (1075),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 215/358 (60%), Positives = 265/358 (74%), Gaps = 9/358 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQV+G    +RSAEDIA++VALFIA++ GSY+NYYMYHGGTNF R A++F++T+YYD+AP
Sbjct  260   YQVFGEVPYIRSAEDIAYNVALFIAKR-GSYVNYYMYHGGTNFDRIASAFVVTAYYDEAP  318

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+REPKW HLKELH AIK CS  LL  T ++FSL   Q AYVFR  SS  CAAFL
Sbjct  319   LDEYGLVREPKWGHLKELHEAIKSCSNSLLYGTQTSFSLGTQQNAYVFR-RSSIECAAFL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N + + S  +QFQN  YQLPP SISILPDCK VAFNTAKV  Q N R M+  L+F+S E
Sbjct  378   ENTEDR-SVTIQFQNIPYQLPPNSISILPDCKNVAFNTAKVRAQ-NARAMKSQLQFNSAE  435

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W+ + E +  F DT++RA+TLLD I+T KD SDYLWYT  L   S++ +S +S  S GH
Sbjct  436   KWKVYREAIPSFADTSLRANTLLDQISTAKDTSDYLWYTFRLYDNSANAQSILSAYSHGH  495

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG L GS HG+ +N SF +E+ ++L  GMNNIS LSATVGLPNSGAYLE +  G
Sbjct  496   VLHAFVNGNLVGSKHGSHKNVSFVMENKLNLISGMNNISFLSATVGLPNSGAYLEGRVAG  555

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
              R + ++      D +N +WGYQVGLLGE LQIYT  GS+ V+W  F SS++PL WYK
Sbjct  556   LRSLKVQ----GRDFTNQAWGYQVGLLGEKLQIYTASGSSKVKWESFLSSTKPLTWYK  609


 Score =   138 bits (347),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +1

Query  1396  VLTALSAPKLYCHFLLIKLKVETT*QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRY  1575
             + TA  + K+     L   K  T  +T FD P GNDP+ LNLGSMGKG  WVNGQ IGRY
Sbjct  584   IYTASGSSKVKWESFLSSTKPLTWYKTTFDAPVGNDPVVLNLGSMGKGYTWVNGQGIGRY  643

Query  1576  WVSYHTVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
             WVS+HT  GTPSQ WY++PRS LK TGNLLVL EEE GNP GITLD V IT
Sbjct  644   WVSFHTPQGTPSQKWYHIPRSLLKSTGNLLVLLEEETGNPLGITLDTVYIT  694



>dbj|BAC43014.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64909.1| At1g77410 [Arabidopsis thaliana]
Length=820

 Score =   422 bits (1084),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 214/359 (60%), Positives = 258/359 (72%), Gaps = 6/359 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG + L+RSAEDIAFHVALFIA KNGS++NYYMYHGGTNFGR A+ F+ITSYYDQAP
Sbjct  258   YQTYGEEPLIRSAEDIAFHVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAA+K+C + LLS   +T SL + Q A+VF G  +  CAA L
Sbjct  317   LDEYGLLRQPKWGHLKELHAAVKLCEEPLLSGLQTTISLGKLQTAFVF-GKKANLCAAIL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D K  + VQF+NSSY+L PKS+S+LPDCK VAFNTAKV  Q NTRT +      S +
Sbjct  376   VNQD-KCESTVQFRNSSYRLSPKSVSVLPDCKNVAFNTAKVNAQYNTRTRKARQNLSSPQ  434

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEEF E V  F +T+IR+++LL+H+NTT+D SDYLW T   QQ    P S + V  LGH
Sbjct  435   MWEEFTETVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQSEGAP-SVLKVNHLGH  493

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              LH FVNG   GS HGTF+   F LE  +SLN G NN++LLS  VGLPNSGA+LE + +G
Sbjct  494   ALHAFVNGRFIGSMHGTFKAHRFLLEKNMSLNNGTNNLALLSVMVGLPNSGAHLERRVVG  553

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              R V I +       +N SWGYQVGL GE   +YTE GS  VQW+++  S SQPL WYK
Sbjct  554   SRSVKIWNGRYQLYFNNYSWGYQVGLKGEKFHVYTEDGSAKVQWKQYRDSKSQPLTWYK  612


 Score =   138 bits (347),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 1/84 (1%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD PEG DP+ALNLGSMGKGEAWVNGQSIGRYWVS+HT  G PSQ WY++PRSFLKP  N
Sbjct  615   FDTPEGEDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTYKGNPSQIWYHIPRSFLKPNSN  674

Query  1660  LLVLFEEEY-GNPYGITLDKVSIT  1728
             LLV+ EEE  GNP GIT+D VS+T
Sbjct  675   LLVILEEEREGNPLGITIDTVSVT  698



>ref|XP_007212740.1| hypothetical protein PRUPE_ppa019429mg, partial [Prunus persica]
 gb|EMJ13939.1| hypothetical protein PRUPE_ppa019429mg, partial [Prunus persica]
Length=457

 Score =   410 bits (1053),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 201/360 (56%), Positives = 259/360 (72%), Gaps = 4/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHVALFIAR NGSY+NYYMYHGGTNFGRT+++++ITSYYDQAP
Sbjct  1     YQVYGGEPYIRSAEDIAFHVALFIAR-NGSYVNYYMYHGGTNFGRTSSAYVITSYYDQAP  59

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLK LHAAIK CS  LL   P+ FSL Q Q+AYVFR ++ G C AFL
Sbjct  60    LDEYGLLRQPKWGHLKALHAAIKSCSTTLLQGMPTNFSLGQLQEAYVFREETEGRCVAFL  119

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND +++A VQFQN+S++L PKSISILPDC+ V FNTA V T    R ++    FDS +
Sbjct  120   INNDERNNATVQFQNASHELMPKSISILPDCEKVIFNTATVNTNYTKRIIRTTEIFDSMD  179

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W+ + +++  +++T++ +DTLL+H N TKDVSDYLWYTL  Q   S  +  +  ES GH
Sbjct  180   RWQGYTDVIPNYENTSLHSDTLLEHTNVTKDVSDYLWYTLRFQHNISCAEPILVAESKGH  239

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
               H F N    G+AHG+     F ++S V L+  +NNISLL   VGLP+SGA+LE +  G
Sbjct  240   ATHAFANNIYIGNAHGSHDTKQFIMQSPVVLSNEINNISLLGVMVGLPDSGAFLERRFSG  299

Query  1055  PRKVTIESSEGS-EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
               +V I+ S+    + +N +WGYQVGL GE LQIY E+  + V+W + ++S  QPL WYK
Sbjct  300   LTRVEIQCSKNEFYNFTNYAWGYQVGLFGEKLQIYREENIHMVEWSKANTSLNQPLTWYK  359


 Score =   120 bits (300),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P GNDP+ALNL SMGKGEAW+NGQSIGRYWVS+ T    PSQ  Y+VPRSF K 
Sbjct  359   KTFFDAPNGNDPVALNLSSMGKGEAWINGQSIGRYWVSFLTSKREPSQIMYHVPRSFFKT  418

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI-TLDKDI  1743
             + NLLVL EE  GNP  I+L+ +S+ TL K I
Sbjct  419   SENLLVLLEEAGGNPLHISLNTISLSTLPKHI  450



>ref|XP_010312841.1| PREDICTED: beta-galactosidase 16 [Solanum lycopersicum]
Length=814

 Score =   421 bits (1081),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 222/362 (61%), Positives = 274/362 (76%), Gaps = 7/362 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +A+ RSAE++A+ VALFIARKNG+YINYYMYHGGTNFGR+AA FMITSYYD AP
Sbjct  263   YQVYGENAVKRSAEEMAYQVALFIARKNGTYINYYMYHGGTNFGRSAAEFMITSYYDLAP  322

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+ +PK+ H KELHAAIK+CS+ +LS  P+  SL   Q+ YV+  DS   C+A L
Sbjct  323   LDEYGLISQPKYGHFKELHAAIKLCSENILSTFPTMHSLGPLQEVYVYGEDSGTKCSALL  382

Query  515   INNDGKHSAK---VQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFD  685
             +N D  HS K   V+F++ +YQLPPKSISILPDCKTV FNTAKV+TQ NTR+     KFD
Sbjct  383   VNTD--HSNKNITVKFRDLTYQLPPKSISILPDCKTVVFNTAKVSTQFNTRSPTTVFKFD  440

Query  686   STeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVES  865
               E+WE+F E++  FD T +R++TLL+  NTTKDVSDYLWYT SL+QES + +  +SV+S
Sbjct  441   RAEKWEQFHEIIPQFDATTVRSETLLEQTNTTKDVSDYLWYTASLEQESEEEQVKLSVKS  500

Query  866   LGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHK  1045
             LGHVLH+FVNG L G  HG FR +SF +ESTVSL KG N IS LSATVGLPNSGA+LE +
Sbjct  501   LGHVLHVFVNGHLVGYGHGQFRKASFLVESTVSLKKGKNQISFLSATVGLPNSGAFLERR  560

Query  1046  TLGPRKVTIE-SSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REFSSSQPLIW  1219
             +LG   V I+  +   ++ ++ SWGYQVGLLGE LQIY+   + +  W R  SS Q L W
Sbjct  561   SLGVHSVMIQLDNRVLKNFTDFSWGYQVGLLGEKLQIYSSGRTKSGNWSRLGSSKQQLTW  620

Query  1220  YK  1225
             YK
Sbjct  621   YK  622


 Score =   144 bits (362),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +++FD P+G+DP+ LNLGSMGKGE WVNGQSIGR+W+S+HT  G PSQTWYNVPRSFLKP
Sbjct  622   KSIFDAPKGDDPVTLNLGSMGKGEVWVNGQSIGRFWLSFHTPQGVPSQTWYNVPRSFLKP  681

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               N+LVLFEEE GNP GIT+D +SIT
Sbjct  682   KDNVLVLFEEEIGNPLGITIDTISIT  707



>ref|XP_010419240.1| PREDICTED: beta-galactosidase 16 [Camelina sativa]
Length=801

 Score =   420 bits (1080),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 217/359 (60%), Positives = 260/359 (72%), Gaps = 6/359 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG + L+RSAEDIAF VALFIA KNGS++NYYMYHGGTNFGR A+ F+ITSYYDQAP
Sbjct  241   YQTYGEEPLIRSAEDIAFQVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAP  299

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAA+K+C + LLS   +T SL + Q A+VF G  +  CAA L
Sbjct  300   LDEYGLLRQPKWGHLKELHAAVKLCEKPLLSGLQTTISLGKLQTAFVF-GKKANLCAALL  358

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D +  A VQF+NSSY L PKSIS+LPDCK VAFNTAKV  Q +TRT +P  K  S+ 
Sbjct  359   VNQD-ECEATVQFRNSSYLLSPKSISVLPDCKNVAFNTAKVNAQYSTRTREPRQKLSSSH  417

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEEF E V  F +T I +++LL+H+NTT+D SDYLW T   QQ     +S + V  LGH
Sbjct  418   MWEEFTENVPSFSETLILSESLLEHMNTTQDTSDYLWQTTRFQQPEG-AQSVLKVNHLGH  476

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG+  GS HGTF+   F LE  VSLN G NNI+LLS  VGLPNSGA+LE + +G
Sbjct  477   VLHGFVNGKFIGSTHGTFKAHRFLLEKNVSLNNGTNNIALLSVMVGLPNSGAHLERRAVG  536

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              R V I + + S   +N SWGYQVGL GE   +YTE G+  VQWR++  S SQPL WYK
Sbjct  537   SRSVKIWNGKHSLYFNNYSWGYQVGLQGEKFHVYTENGAAKVQWRKYRDSKSQPLTWYK  595


 Score =   139 bits (350),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +  FD PEG DP+ALNLGSMGKGEAWVNGQSIGRYWVS+HT  G PSQ WY++PRSFLKP
Sbjct  595   KAAFDTPEGTDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSKGNPSQIWYHIPRSFLKP  654

Query  1651  TGNLLVLFEEEY-GNPYGITLDKVSIT  1728
             + NLLV+ EEE  GNP G+T+D VS+T
Sbjct  655   SSNLLVILEEEREGNPLGVTIDTVSVT  681



>ref|XP_003602061.1| Beta-galactosidase [Medicago truncatula]
 gb|AES72312.1| beta-like galactosidase [Medicago truncatula]
Length=694

 Score =   416 bits (1070),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 213/357 (60%), Positives = 262/357 (73%), Gaps = 9/357 (3%)
 Frame = +2

Query  158   QVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPL  337
             Q +G    MRSA DIA++VALFIA+K GSY+NYYMYHGGTNF R A++F+IT+YYD+APL
Sbjct  260   QAFGGAPYMRSASDIAYNVALFIAKK-GSYVNYYMYHGGTNFDRLASAFIITAYYDEAPL  318

Query  338   DEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLI  517
             DEYGL+R+PKW HLKELHA+IK CSQ LL  T +TFSL   QQAYVFR  SS  CAAFL 
Sbjct  319   DEYGLVRQPKWGHLKELHASIKSCSQPLLDGTQTTFSLGSEQQAYVFR--SSTECAAFL-  375

Query  518   NNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTee  697
              N G     +QFQN SY+LP KSISILP CK V FNT KV+ Q+N R M+P L+F+S E 
Sbjct  376   ENSGPRDVTIQFQNISYELPGKSISILPGCKNVVFNTGKVSIQNNVRAMKPRLQFNSAEN  435

Query  698   weefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGHV  877
             W+ + E +  F  T+ RADTLLD I+T KD SDY+WYT     +S + KS +S+ S G V
Sbjct  436   WKVYTEAIPNFAHTSKRADTLLDQISTAKDTSDYMWYTFRFNNKSPNAKSVLSIYSQGDV  495

Query  878   LHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLGP  1057
             LH F+NG L GSAHG+  N+  T++  V+L  GMNNIS+LSATVGLPNSGA+LE +  G 
Sbjct  496   LHSFINGVLTGSAHGSRNNTQVTMKKNVNLINGMNNISILSATVGLPNSGAFLESRVAGL  555

Query  1058  RKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
             RKV ++      D S+ SWGYQVGLLGE LQI+T  GS+ VQW+ F SS++PL WY+
Sbjct  556   RKVEVQ----GRDFSSYSWGYQVGLLGEKLQIFTVSGSSKVQWKSFQSSTKPLTWYQ  608


 Score =   133 bits (334),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             QT F  P GNDP+ +NLGSMGKG AWVNGQ IGRYWVS+H   GTPSQ WY++PRSFLK 
Sbjct  608   QTTFHAPAGNDPVVVNLGSMGKGLAWVNGQGIGRYWVSFHKPDGTPSQQWYHIPRSFLKS  667

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             TGNLLV+ EEE GNP GITLD V I
Sbjct  668   TGNLLVILEEETGNPLGITLDTVYI  692



>ref|XP_010086721.1| Beta-galactosidase 6 [Morus notabilis]
 gb|EXB23137.1| Beta-galactosidase 6 [Morus notabilis]
Length=717

 Score =   417 bits (1072),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 206/362 (57%), Positives = 259/362 (72%), Gaps = 8/362 (2%)
 Frame = +2

Query  158   QVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPL  337
             +VYG    +RSAEDIAFH ALFIAR NGSY+NYYMYHGGTNFGRT+++++ITSYYDQAP+
Sbjct  260   EVYGGQPYIRSAEDIAFHAALFIAR-NGSYVNYYMYHGGTNFGRTSSAYVITSYYDQAPI  318

Query  338   DEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLI  517
             DEYG LR+PKW HLKELHAAI+ CS  LL A P+  SL Q Q+AY+FR ++ G C AFLI
Sbjct  319   DEYGQLRQPKWGHLKELHAAIRNCSGTLLKAVPTNISLGQSQEAYIFREEAEG-CVAFLI  377

Query  518   NNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTee  697
             N D K +A VQFQN SY L PKSISILPDCKTV FNTAKV T++NTR  +P L FDS + 
Sbjct  378   NRDNKTTAAVQFQNQSYLLLPKSISILPDCKTVIFNTAKVNTKANTRIRKPTLTFDSADR  437

Query  698   weefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGHV  877
             W +F +++  F+DT IRADTLL+H+N TKD SDY+WYT+      S  ++ + VESLGHV
Sbjct  438   WRKFTDVIPNFEDTTIRADTLLEHMNMTKDESDYVWYTMRFDNNVSCTEAVLHVESLGHV  497

Query  878   LHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLGP  1057
              H F+N    G+ HG   +    +E+ + LN G+NNISLLS  VGLP+SG +LE +  G 
Sbjct  498   THAFLNNIYFGNTHGNKSSKGLVMENPIKLNDGINNISLLSVMVGLPDSGPFLERRVAGL  557

Query  1058  RKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS----SSQPLIW  1219
              +V I+ +  +E  + +N  WGYQVGL GE L +Y E+    V+W EF     S+Q L W
Sbjct  558   TRVEIQCTNENEFYNFTNYEWGYQVGLFGEKLHLYREQNLGDVEWDEFEVVSDSNQTLTW  617

Query  1220  YK  1225
             YK
Sbjct  618   YK  619


 Score =   117 bits (294),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             + VFD P+GN  LALNL  MGKGEAW+NG SIGRYWV++ T  G PSQ+ Y+VPRSFLK 
Sbjct  619   KIVFDAPKGNGSLALNLSVMGKGEAWINGHSIGRYWVTFLTSKGRPSQSLYHVPRSFLKD  678

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKD  1740
             T N+LVL EE  GNP  +TLD +SI L+++
Sbjct  679   TENVLVLLEELGGNPLHVTLDAISINLNEN  708



>emb|CAN64508.1| hypothetical protein VITISV_004610 [Vitis vinifera]
Length=766

 Score =   419 bits (1076),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 206/356 (58%), Positives = 257/356 (72%), Gaps = 3/356 (1%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPLDE  343
             YG D   R+AED+AF VALFIA+KNGS+INYYMYHGGTNFGRT++S+++T+YYDQAPLDE
Sbjct  213   YGEDKRGRAAEDLAFQVALFIAKKNGSFINYYMYHGGTNFGRTSSSYVLTAYYDQAPLDE  272

Query  344   YGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINN  523
             YGL+R+PKW HLKELHA IK+CS  LL      +SL Q Q+AY+F+   SG CAAFL+NN
Sbjct  273   YGLIRQPKWGHLKELHAVIKLCSDTLLXGVQYNYSLGQLQEAYLFK-RPSGQCAAFLVNN  331

Query  524   DGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeewe  703
             D + +  V FQN++Y+L   SISILPDCK +AFNTAKV+TQ NTR++Q    F ST++W 
Sbjct  332   DKRRNVTVLFQNTNYELAANSISILPDCKKIAFNTAKVSTQFNTRSVQTRATFGSTKQWS  391

Query  704   efeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGHVLH  883
             E+ E +  F  T ++A  LL+H+ TTKD SDYLWYTL     SS+ +  + V+SL HVL 
Sbjct  392   EYREGIPSFGGTPLKASMLLEHMGTTKDASDYLWYTLRFIHNSSNAQPVLRVDSLAHVLL  451

Query  884   IFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLGPRK  1063
              FVNG+   SAHG+ +N SF+L + V LN G+N ISLLS  VGLP++G YLEHK  G R+
Sbjct  452   AFVNGKYIASAHGSHQNGSFSLVNKVPLNSGLNRISLLSVMVGLPDAGPYLEHKVAGIRR  511

Query  1064  VTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--SQPLIWYK  1225
             V I+    S+D S   WGYQVGL+GE LQIYT  GS  VQW    S    PL WYK
Sbjct  512   VEIQDGGXSKDFSKHPWGYQVGLMGEKLQIYTSPGSQKVQWYGLGSHGRGPLTWYK  567


 Score =   129 bits (323),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P GNDP+ L  GSMGKGEAWVNGQSIGRYWVSY T +G PSQTWYNVPR+FL P
Sbjct  567   KTLFDAPRGNDPVVLFFGSMGKGEAWVNGQSIGRYWVSYLTPSGEPSQTWYNVPRAFLNP  626

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
              GNLLV+ EEE G+P  I++  VS+T
Sbjct  627   KGNLLVVQEEESGDPLKISIGTVSVT  652



>ref|XP_008466742.1| PREDICTED: beta-galactosidase 16 isoform X2 [Cucumis melo]
Length=821

 Score =   419 bits (1078),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 213/358 (59%), Positives = 263/358 (73%), Gaps = 7/358 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG +  +RSAE+IAFHVALFIA KNG+Y+NYYMYHGGTNFGR+A++FMIT YYDQ P
Sbjct  268   YQTYGEEPYIRSAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMITGYYDQGP  327

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLKELHAA+K+CS  LL+ T   FSL Q  +A VF+ +S   CAAFL
Sbjct  328   LDEYGLTREPKWGHLKELHAAVKLCSTPLLTGTKFNFSLGQSLEAIVFKTESD-ECAAFL  386

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N  G     V FQN +Y+LP  SISILPDCK VAFNT +V+ Q NTR+M    KFDS+E
Sbjct  387   VNR-GAIDTDVLFQNVTYELPLGSISILPDCKNVAFNTRRVSVQRNTRSMMTVQKFDSSE  445

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             EWEEF+E +  F+DT +RA+ LL+H+ TTKD SDYLWYT  +QQ+S D +    V+S  H
Sbjct  446   EWEEFKEPIPNFEDTELRANKLLEHMGTTKDRSDYLWYTFRVQQDSPDSQQTFEVDSRAH  505

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              LH FVNG+ AGSAHGT++   F+L + ++L  G+NNISLLS  VGLP+SGA+LE +  G
Sbjct  506   ALHAFVNGDYAGSAHGTYKEKGFSLVNNITLRNGINNISLLSVMVGLPDSGAFLETRVAG  565

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REFSSSQPLIWYK  1225
              R+V I+     ED S   WGY+VGL GE  QI+ + GS+ VQW R  +SSQPL WYK
Sbjct  566   LRRVGIQ----GEDFSEQPWGYKVGLSGEQSQIFLDTGSSNVQWSRLGNSSQPLTWYK  619


 Score =   128 bits (322),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G+DP+ALNLGSMGKG AWVNG+ IGRYWVS+ T  G PSQ WYNVPRSFLKP
Sbjct  619   KTRFDAPPGDDPIALNLGSMGKGAAWVNGRGIGRYWVSFLTPKGEPSQKWYNVPRSFLKP  678

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             T N LV+ EEE GNP  I+LD V IT
Sbjct  679   TDNQLVILEEETGNPVEISLDSVLIT  704



>ref|XP_006432094.1| hypothetical protein CICLE_v10000420mg [Citrus clementina]
 ref|XP_006464973.1| PREDICTED: beta-galactosidase 6-like [Citrus sinensis]
 gb|ESR45334.1| hypothetical protein CICLE_v10000420mg [Citrus clementina]
Length=724

 Score =   416 bits (1069),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 218/367 (59%), Positives = 262/367 (71%), Gaps = 11/367 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHV LFIA KNGSYINYYMYHGGTNFGRTA++++ITSYYDQAP
Sbjct  259   YQVYGGEPYIRSAEDIAFHVTLFIA-KNGSYINYYMYHGGTNFGRTASAYIITSYYDQAP  317

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKW HLKELH AI  CS+ LL   PS FSL Q Q+AYVF  ++ G C AFL
Sbjct  318   LDEYGLTRQPKWGHLKELHGAINSCSETLLQGNPSNFSLGQLQEAYVFEEEAGGGCVAFL  377

Query  515   INNDGKH-SAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             INNDG+  +A VQF+N S+QLPPKSI+ILPDC  V FNTAKV    N R    +  F+  
Sbjct  378   INNDGRDDNATVQFRNMSFQLPPKSITILPDCINVIFNTAKVNVVYNERRTNVSEVFNEA  437

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLG  871
             E W++F++L+  F DT ++ADTLL+H+NTTKD SDYLWYT S Q  SS  +  + VESL 
Sbjct  438   ERWQQFKDLIPNFLDTPLKADTLLEHMNTTKDKSDYLWYTFSFQTNSSCTEPVLHVESLA  497

Query  872   HVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             HV H FVN   AG+AHG      FT++  V LN GMNNIS+LS  VGLP+SGA+LE +  
Sbjct  498   HVAHAFVNNVYAGTAHGNHDVKKFTMDIPVDLNDGMNNISILSVMVGLPDSGAFLEKRFA  557

Query  1052  GPRKVTIESS--EGSEDLSND-SWGYQVGLLGENLQIY-TEKG-SNAVQWRE----FSSS  1204
             G   V I     E S + +N+ +WGY+VGLLGE LQIY TE+   NA +W +     SS 
Sbjct  558   GLATVEIHCGDMENSYNFTNNYTWGYEVGLLGEKLQIYNTEQNLENAPEWTKIDQYLSSK  617

Query  1205  QPLIWYK  1225
             QPL WYK
Sbjct  618   QPLTWYK  624


 Score =   114 bits (284),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G+DP+ALNL SMGKGEAWVNG S+GRYWVS++T  G  SQT Y+VPRSFLK 
Sbjct  624   KTAFDAPVGDDPVALNLSSMGKGEAWVNGLSVGRYWVSFYTSEGNSSQTLYHVPRSFLKS  683

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             T N+LVL EE  G+P  I+++ +S+T
Sbjct  684   TENVLVLMEEFGGDPLHISVETISLT  709



>ref|XP_011027489.1| PREDICTED: beta-galactosidase 16 [Populus euphratica]
Length=816

 Score =   418 bits (1074),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 212/358 (59%), Positives = 260/358 (73%), Gaps = 3/358 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG +   RSAEDIAFH ALFIA K GS++NYYMYHGGTNFGRTAA ++ TSYYDQAP
Sbjct  259   YQTYGKETRSRSAEDIAFHAALFIA-KGGSFVNYYMYHGGTNFGRTAAEYVPTSYYDQAP  317

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK  HLKELHAAIK+C + LLS     FSL Q Q+A+ F  +S   CAAFL
Sbjct  318   LDEYGLLRQPKHGHLKELHAAIKLCRKPLLSRKWINFSLGQLQEAFAFERNSDN-CAAFL  376

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N+DG+ +A V F+ SSY+LPPKSISILPDCKTVAFNTA+V+TQ  TR      KFDS E
Sbjct  377   VNHDGRSNATVHFKGSSYELPPKSISILPDCKTVAFNTAQVSTQYGTRLATRRHKFDSIE  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W+E++E +  FD +++RAD LL+H+NTTKD SDYLWYT    Q SSD  S ++V SLGH
Sbjct  437   QWKEYKEYIPSFDKSSLRADMLLEHMNTTKDSSDYLWYTFRFHQNSSDAHSVLTVNSLGH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              LH FVNGE  GSAHG+  N SF L+  + L +G N +SLLS   GLP++GAYLE +  G
Sbjct  497   NLHAFVNGEFIGSAHGSHDNKSFILQRILPLKRGTNYVSLLSVMTGLPDAGAYLERRVAG  556

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
              R+VTI+      D ++  WGY+VGL GEN+Q++    S    W  + SSSQPL WYK
Sbjct  557   LRRVTIQRQHELHDFTSYLWGYKVGLSGENIQLHRNNASVKAYWSRYASSSQPLSWYK  614


 Score =   129 bits (325),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +++FD P GNDP+ALNL SMGKGEAWVNG+SIGRYWVS+    G P QTW ++PRSFLKP
Sbjct  614   KSIFDAPVGNDPVALNLASMGKGEAWVNGRSIGRYWVSFLDSDGNPYQTWNHIPRSFLKP  673

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLLV+ EEE GNP GI+L  +SIT
Sbjct  674   SGNLLVILEEERGNPLGISLGTMSIT  699



>ref|XP_010269108.1| PREDICTED: beta-galactosidase 16-like [Nelumbo nucifera]
Length=771

 Score =   416 bits (1068),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 209/359 (58%), Positives = 271/359 (75%), Gaps = 4/359 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QV+G    +RSAEDIAFHVALFIA K GSYINYYMYHGGTNFGRT ++++ TSYYDQAP
Sbjct  219   FQVFGGKPYIRSAEDIAFHVALFIAAKKGSYINYYMYHGGTNFGRTGSAYVTTSYYDQAP  278

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELH+AIK+C++ LL  T + FSL   Q+A++F+G+S G C+AFL
Sbjct  279   LDEYGLVRQPKWGHLKELHSAIKLCTEPLLWGTHTNFSLGNLQEAHIFQGES-GECSAFL  337

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND    AKV FQN SY+LP +SIS LPDCK V FNT KV+TQ + R+ + + KFDS++
Sbjct  338   VNNDAV-IAKVNFQNLSYELPQQSISTLPDCKNVVFNTRKVSTQYSARSTELSQKFDSSD  396

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W+EF E++  F++T+I AD LLDH++ TKDVSDYLWYT S Q  SSD +S + V+SLGH
Sbjct  397   QWKEFREVIPKFEETSITADMLLDHMDATKDVSDYLWYTFSFQNNSSDDQSLLQVDSLGH  456

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H F+N    GSAHG+++N   +L  ++SL+ GM ++SLLS  VGLPNSGAYLEH+  G
Sbjct  457   VVHAFLNKTYIGSAHGSYKNPGSSLNISISLSNGMTDVSLLSVMVGLPNSGAYLEHRVAG  516

Query  1055  PRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ-PLIWYK  1225
              R V I+    GS+D S   WGYQVGL+GE  + Y E+ S+ VQW    + + PL WYK
Sbjct  517   LRGVKIQGIGNGSQDFSKYQWGYQVGLVGEKFRAYNEESSSEVQWNNLGTYKPPLTWYK  575


 Score =   124 bits (311),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G+DP+ LNL +M KGE WVNGQSIGRYWVS+HT  G PSQ  Y+VPRSF+KP
Sbjct  575   KTTFDAPAGDDPVVLNLSTMSKGEVWVNGQSIGRYWVSFHTDGGVPSQALYHVPRSFIKP  634

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLLVL EE  G+P  ITLD V+I+
Sbjct  635   SGNLLVLLEEFGGDPLHITLDTVTIS  660



>ref|XP_010428819.1| PREDICTED: beta-galactosidase 16-like [Camelina sativa]
Length=819

 Score =   417 bits (1071),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 215/359 (60%), Positives = 258/359 (72%), Gaps = 6/359 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG + L+RSAEDIAF VALFIA KNGS++NYY YHGGTNFGR A+ F+ITSYYDQAP
Sbjct  259   YQTYGDEPLIRSAEDIAFQVALFIA-KNGSFVNYYTYHGGTNFGRNASQFVITSYYDQAP  317

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAA+K+C + LLS   +T SL + Q A+VF G  +  CAA L
Sbjct  318   LDEYGLLRQPKWGHLKELHAAVKLCEKPLLSGLQTTISLGKLQTAFVF-GKKANLCAALL  376

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D    A VQF+NSSY L PKSIS+L DCK VAFNTAKV  Q +TRT +P  K  S  
Sbjct  377   VNQD-DCEATVQFRNSSYLLSPKSISVLQDCKNVAFNTAKVNAQYSTRTREPRQKLSSPH  435

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEEF E V  F +T+IR+++LL+H+NTT+D SDYLW T   QQ     +S + V  LGH
Sbjct  436   MWEEFTETVPSFSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQPEG-AQSVLKVNHLGH  494

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG+  GS HGTF+   F LE  VSLN G NNI+LLS  VGLPNSGA+LE + +G
Sbjct  495   VLHGFVNGKFIGSTHGTFKAHRFLLEKNVSLNNGTNNIALLSVMVGLPNSGAHLERRVVG  554

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              R V I + + S   +N SWGYQVGL GE   +YTE G+  VQW+++  S SQPL WYK
Sbjct  555   SRSVKIWNGKHSLYFNNYSWGYQVGLQGEKFHVYTENGAAKVQWKKYRDSKSQPLTWYK  613


 Score =   137 bits (345),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P+G DP+ALNLGSMGKGEAWVNGQSIGRYWVS+HT  G PSQ WY++PRSFLKP+ N
Sbjct  616   FDTPDGTDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSKGNPSQIWYHIPRSFLKPSSN  675

Query  1660  LLVLFEEEY-GNPYGITLDKVSIT  1728
             LLV+ EEE  GNP G+T+D VS+T
Sbjct  676   LLVILEEEREGNPLGVTIDTVSVT  699



>gb|KGN47702.1| hypothetical protein Csa_6G382900 [Cucumis sativus]
Length=804

 Score =   416 bits (1069),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 214/368 (58%), Positives = 265/368 (72%), Gaps = 8/368 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG +  +RSAE+IAFHVALFIA KNG+Y+NYYMYHGGTNFGR+A++FMIT YYDQ+P
Sbjct  223   YQTYGEEPYIRSAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMITGYYDQSP  282

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLKELHAA+K+CS  LL+ T S FSL Q  +A VF+ +S+  CAAFL
Sbjct  283   LDEYGLTREPKWGHLKELHAAVKLCSTPLLTGTKSNFSLGQSVEAIVFKTESN-ECAAFL  341

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N  G   + V FQN +Y+LP  SISILPDCK VAFNT +V+ Q NTR+M    KFD   
Sbjct  342   VNR-GAIDSNVLFQNVTYELPLGSISILPDCKNVAFNTRRVSVQHNTRSMMAVQKFD-LL  399

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             EWEEF+E +   DDT +RA+ LL+H+ TTKD SDYLWYT  +QQ+S D +  + V+S  H
Sbjct  400   EWEEFKEPIPNIDDTELRANELLEHMGTTKDRSDYLWYTFRVQQDSPDSQQTLEVDSRAH  459

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              LH FVNG+ AGSAHG ++   F+L   ++L  G+NNISLLS  VGLP+SGA+LE +  G
Sbjct  460   ALHAFVNGDYAGSAHGIYKEKGFSLAKNITLRNGINNISLLSVMVGLPDSGAFLETRVAG  519

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REFSSSQPLIWYKEW  1231
              R+V I+     ED S   WGY+VGL GE  QI+ + GS+ VQW R  +SSQPL WYK  
Sbjct  520   LRRVGIQ----GEDFSEQHWGYKVGLSGEQSQIFLDTGSSNVQWSRLGNSSQPLTWYKVL  575

Query  1232  RTIKKVYL  1255
               I   YL
Sbjct  576   PIINSNYL  583


 Score =   133 bits (335),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 73/101 (72%), Gaps = 7/101 (7%)
 Frame = +1

Query  1426  YCHFLLIKLKVETT*QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGT  1605
             +CH LLI        QT FD P G+DP+ALNLGSMGKG  WVNG+ IGRYWVS+ T  G 
Sbjct  594   HCHSLLIG-------QTQFDAPPGDDPIALNLGSMGKGAVWVNGRGIGRYWVSFLTPKGE  646

Query  1606  PSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
             PSQ WYNVPRSFLKPT N LV+ EEE GNP  I+LD V IT
Sbjct  647   PSQKWYNVPRSFLKPTDNQLVILEEETGNPVEISLDSVLIT  687



>ref|XP_004171523.1| PREDICTED: beta-galactosidase 16-like [Cucumis sativus]
Length=756

 Score =   414 bits (1065),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 211/358 (59%), Positives = 262/358 (73%), Gaps = 8/358 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG +  +RSAE+IAFHVALFIA KNG+Y+NYYMYHGGTNFGR+A++FMIT YYDQ+P
Sbjct  204   YQTYGEEPYIRSAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMITGYYDQSP  263

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLKELHAA+K+CS  LL+ T S FSL Q  +A VF+ +S+  CAAFL
Sbjct  264   LDEYGLTREPKWGHLKELHAAVKLCSTPLLTGTKSNFSLGQSVEAIVFKTESN-ECAAFL  322

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N  G   + V FQN +Y+LP  SISILPDCK VAFNT +V+ Q NTR+M    KFD   
Sbjct  323   VNR-GAIDSNVLFQNVTYELPLGSISILPDCKNVAFNTRRVSVQHNTRSMMAVQKFD-LL  380

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             EWEEF+E +   DDT +RA+ LL+H+ TTKD SDYLWYT  +QQ+S D +  + V+S  H
Sbjct  381   EWEEFKEPIPNIDDTELRANELLEHMGTTKDRSDYLWYTFRVQQDSPDSQQTLEVDSRAH  440

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              LH FVNG+ AGSAHG ++   F+L   ++L  G+NNISLLS  VGLP+SGA+LE +  G
Sbjct  441   ALHAFVNGDYAGSAHGIYKEKGFSLAKNITLRNGINNISLLSVMVGLPDSGAFLETRVAG  500

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REFSSSQPLIWYK  1225
              R+V I+     ED S   WGY+VGL GE  QI+ + GS+ VQW R  +SSQPL WYK
Sbjct  501   LRRVGIQ----GEDFSEQHWGYKVGLSGEQSQIFLDTGSSNVQWSRLGNSSQPLTWYK  554


 Score =   127 bits (318),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G+DP+ALNLGSMGKG  WVNG+ IGRYWVS+ T  G PSQ WYNVPRSFLKP
Sbjct  554   KTQFDAPPGDDPIALNLGSMGKGAVWVNGRGIGRYWVSFLTPKGEPSQKWYNVPRSFLKP  613

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             T N LV+ EEE GNP  I+LD V IT
Sbjct  614   TDNQLVILEEETGNPVEISLDSVLIT  639



>ref|XP_004289501.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 6-like, partial 
[Fragaria vesca subsp. vesca]
Length=717

 Score =   413 bits (1061),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 206/362 (57%), Positives = 261/362 (72%), Gaps = 5/362 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHVALFIAR NGSY+NYYMYHGGTNFGRT+++++IT YYDQAP
Sbjct  254   YQVYGGEPYIRSAEDIAFHVALFIARMNGSYVNYYMYHGGTNFGRTSSAYVITGYYDQAP  313

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLK+LHAA++ CS  LL    +  SL Q Q+AYVF+ +S+G C AFL
Sbjct  314   LDEYGLLRQPKWGHLKQLHAAVRNCSTTLLQGVRTNISLGQLQEAYVFQEESAGRCVAFL  373

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND K +A VQF+N SY L PKSISILPDC  V FNTAKV T  N R  +    FDS +
Sbjct  374   INNDEKVNATVQFRNISYYLRPKSISILPDCGKVIFNTAKVNTSYNKRITRTVQIFDSVD  433

Query  695   eweefeeLVVGFDDT-NIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLG  871
              WE  ++++  F+ T ++++DTLL+H+N TKD SDYLWYT+  Q   S  +  + VESLG
Sbjct  434   RWEGSKDIIQNFEPTISLQSDTLLEHMNVTKDKSDYLWYTMRFQHNISCTEPILHVESLG  493

Query  872   HVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             HV H FVNG   G+AHG+     F +E+ + LN G NNISLLS  VGLP+SGA+LE K  
Sbjct  494   HVTHAFVNGIYTGNAHGSHDTKQFIMENPIVLNNGSNNISLLSVMVGLPDSGAFLESKFA  553

Query  1052  GPRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR--EFSSSQPLIW  1219
             G R+V I  +E  +  + ++ +WGYQVGLLG+ LQIY E+  +  +W   E S ++PL W
Sbjct  554   GLRRVEIHCNETDQFYNFTSYAWGYQVGLLGQKLQIYREENLDDFEWSNIEGSFNKPLTW  613

Query  1220  YK  1225
             YK
Sbjct  614   YK  615


 Score =   120 bits (302),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P GNDP+  NL SM KGEAW+NGQSIGRYWVS+ T  G PSQT Y+VPRSFLK 
Sbjct  615   KTYFDAPMGNDPVTFNLSSMAKGEAWINGQSIGRYWVSFLTSKGKPSQTMYHVPRSFLKD  674

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             + NLLVLFEE  GNP  ITL+ VS++
Sbjct  675   SENLLVLFEEVGGNPLHITLNTVSLS  700



>gb|KDO80552.1| hypothetical protein CISIN_1g003612mg [Citrus sinensis]
Length=807

 Score =   415 bits (1066),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 205/359 (57%), Positives = 264/359 (74%), Gaps = 19/359 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +A +RSAEDIA+HVALFIA+  GSY+NYYMYHGGTNFGRTA+++++T YYDQAP
Sbjct  263   YQVYGDEARIRSAEDIAYHVALFIAKMKGSYVNYYMYHGGTNFGRTASAYVLTGYYDQAP  322

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELH+A+K+C + +LS    + + ++ Q+A++F+G S   CAAFL
Sbjct  323   LDEYGLLRQPKWGHLKELHSAVKLCLKPMLSGVLVSMNFSKLQEAFIFQGSSE--CAAFL  380

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D +++A V F N  Y+LPP SISILPDCKTVAFNTAK+               DS E
Sbjct  381   VNKDKRNNATVYFSNLMYELPPLSISILPDCKTVAFNTAKL---------------DSVE  425

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEE++E +  +D+T++RA+ LL+ +NTTKD SDYLWY    + + SD +S + V SLGH
Sbjct  426   QWEEYKEAIPTYDETSLRANFLLEQMNTTKDASDYLWYNFRFKHDPSDSESVLKVSSLGH  485

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH F+NGE  GSAHG   + SFTLE  V L  G NN+SLLS  VGLP+SGAYLE +  G
Sbjct  486   VLHAFINGEFVGSAHGKHSDKSFTLEKMVHLINGTNNVSLLSVMVGLPDSGAYLERRVAG  545

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
              R V+I+ ++  +D S+ SWGYQVGLLGE LQI+T+ GS  V W  + SS  QPL WYK
Sbjct  546   LRNVSIQGAKELKDFSSFSWGYQVGLLGEKLQIFTDYGSRIVPWSRYGSSTHQPLTWYK  604


 Score =   137 bits (344),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +TVFD P G+DP+A+NL SMGKGEAWVNGQSIGRYWVS+ T  GTPSQ+WY++PRSFLKP
Sbjct  604   KTVFDAPTGSDPVAINLISMGKGEAWVNGQSIGRYWVSFLTPQGTPSQSWYHIPRSFLKP  663

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE G P GI++D VS+T
Sbjct  664   TGNLLVLLEEENGYPPGISIDTVSVT  689



>ref|XP_002302225.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE81498.2| beta-galactosidase family protein [Populus trichocarpa]
Length=816

 Score =   415 bits (1066),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 210/358 (59%), Positives = 261/358 (73%), Gaps = 3/358 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG +   RSAEDIAFH ALFIA K GS++NYYMYHGGTNFGRTAA ++ TSYYDQAP
Sbjct  259   YQTYGKETRSRSAEDIAFHAALFIA-KGGSFVNYYMYHGGTNFGRTAAEYVPTSYYDQAP  317

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK  HLKELHAAIK+C + LLS     FSL Q Q+A+ F  +S   CAAFL
Sbjct  318   LDEYGLLRQPKHGHLKELHAAIKLCRKPLLSRKWINFSLGQLQEAFAFERNSD-ECAAFL  376

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N+DG+ +A V F+ SSY+LPPKSISILP CKTVAFNTA+V+TQ  TR      KFDS E
Sbjct  377   VNHDGRSNATVHFKGSSYKLPPKSISILPHCKTVAFNTAQVSTQYGTRLATRRHKFDSIE  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W+E++E +  FD +++RA+TLL+H+NTTKD SDYLWYT    Q SS+  S ++V SLGH
Sbjct  437   QWKEYKEYIPSFDKSSLRANTLLEHMNTTKDSSDYLWYTFRFHQNSSNAHSVLTVNSLGH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              LH FVNGE  GSAHG+  N SFTL+ ++ L +G N +SLLS   GLP++GAYLE +  G
Sbjct  497   NLHAFVNGEFIGSAHGSHDNKSFTLQRSLPLKRGTNYVSLLSVMTGLPDAGAYLERRVAG  556

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
              R+VTI+      D +   WGY+VGL GEN+Q++    S    W  + SSS+PL WYK
Sbjct  557   LRRVTIQRQHELHDFTTYLWGYKVGLSGENIQLHRNNASVKAYWSRYASSSRPLTWYK  614


 Score =   130 bits (327),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +++FD P GNDP+ALNL SMGKGEAWVNG+SIGRYWVS+    G P QTW ++PRSFLKP
Sbjct  614   KSIFDAPAGNDPVALNLASMGKGEAWVNGRSIGRYWVSFLDSDGNPYQTWNHIPRSFLKP  673

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLLV+ EEE GNP GI+L  +SIT
Sbjct  674   SGNLLVILEEERGNPLGISLGTMSIT  699



>ref|XP_004149808.1| PREDICTED: beta-galactosidase 16-like [Cucumis sativus]
Length=801

 Score =   414 bits (1065),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 211/358 (59%), Positives = 262/358 (73%), Gaps = 8/358 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG +  +RSAE+IAFHVALFIA KNG+Y+NYYMYHGGTNFGR+A++FMIT YYDQ+P
Sbjct  249   YQTYGEEPYIRSAEEIAFHVALFIAAKNGTYVNYYMYHGGTNFGRSASAFMITGYYDQSP  308

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLKELHAA+K+CS  LL+ T S FSL Q  +A VF+ +S+  CAAFL
Sbjct  309   LDEYGLTREPKWGHLKELHAAVKLCSTPLLTGTKSNFSLGQSVEAIVFKTESN-ECAAFL  367

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N  G   + V FQN +Y+LP  SISILPDCK VAFNT +V+ Q NTR+M    KFD   
Sbjct  368   VNR-GAIDSNVLFQNVTYELPLGSISILPDCKNVAFNTRRVSVQHNTRSMMAVQKFD-LL  425

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             EWEEF+E +   DDT +RA+ LL+H+ TTKD SDYLWYT  +QQ+S D +  + V+S  H
Sbjct  426   EWEEFKEPIPNIDDTELRANELLEHMGTTKDRSDYLWYTFRVQQDSPDSQQTLEVDSRAH  485

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              LH FVNG+ AGSAHG ++   F+L   ++L  G+NNISLLS  VGLP+SGA+LE +  G
Sbjct  486   ALHAFVNGDYAGSAHGIYKEKGFSLAKNITLRNGINNISLLSVMVGLPDSGAFLETRVAG  545

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REFSSSQPLIWYK  1225
              R+V I+     ED S   WGY+VGL GE  QI+ + GS+ VQW R  +SSQPL WYK
Sbjct  546   LRRVGIQ----GEDFSEQHWGYKVGLSGEQSQIFLDTGSSNVQWSRLGNSSQPLTWYK  599


 Score =   127 bits (318),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G+DP+ALNLGSMGKG  WVNG+ IGRYWVS+ T  G PSQ WYNVPRSFLKP
Sbjct  599   KTQFDAPPGDDPIALNLGSMGKGAVWVNGRGIGRYWVSFLTPKGEPSQKWYNVPRSFLKP  658

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             T N LV+ EEE GNP  I+LD V IT
Sbjct  659   TDNQLVILEEETGNPVEISLDSVLIT  684



>gb|KCW62455.1| hypothetical protein EUGRSUZ_H05090 [Eucalyptus grandis]
Length=705

 Score =   411 bits (1056),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 205/359 (57%), Positives = 264/359 (74%), Gaps = 3/359 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFH  LFIA+ NG YINYYMYHGGTNFGRTAA++ IT YYDQAP
Sbjct  250   YQVYGGEPYLRSAEDIAFHATLFIAKLNGCYINYYMYHGGTNFGRTAAAYFITGYYDQAP  309

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELH AIK  S  LL    S FSL Q+Q+AYVF+ + +G C AFL
Sbjct  310   LDEYGLLRQPKWGHLKELHGAIKNSSSTLLEGVKSNFSLGQYQEAYVFQ-EETGGCVAFL  368

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND K SA VQF N S++L PKSISIL DC+ + FNTAKVT++S+TR    +  F+  +
Sbjct  369   VNNDAKSSATVQFGNKSFELLPKSISILQDCENMIFNTAKVTSESSTRVTTSSQTFEGAD  428

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEEF +++  + DT++RADTLL+H+NTTKD SDYLWY  S Q +S+  +  + ++SLGH
Sbjct  429   KWEEFLDVIPSYLDTSLRADTLLEHMNTTKDESDYLWYAFSFQPDSTCAEPVLHLKSLGH  488

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H FVN E  GSAHG+    +FT+E+ + L+  MNNISLLS  VGLP+SGA+LE +  G
Sbjct  489   VTHAFVNNEYMGSAHGSHDVKNFTMETKIVLDNQMNNISLLSVMVGLPDSGAFLEKRYAG  548

Query  1055  PRKVTIESSEG-SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-SQPLIWYK  1225
               +V I  ++  S + ++ SWGYQVGLLG+ L+IY E+    V+W   ++ +QPL WYK
Sbjct  549   LAEVEIRCTQDESYNFTHYSWGYQVGLLGQELEIYNEQNLGNVEWSNVTTVNQPLTWYK  607


 Score =   116 bits (290),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG++PLA NL +M KGEAWVNGQSIGRYWVS+ T  G PSQT Y+VPRSFL+ 
Sbjct  607   KTYFDAPEGSEPLAFNLTTMSKGEAWVNGQSIGRYWVSFLTANGNPSQTLYHVPRSFLQA  666

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKD  1740
             +GNLLVL EE  G+P  ++L  +S++   D
Sbjct  667   SGNLLVLLEEVGGDPLHVSLCTLSVSTLND  696



>ref|XP_004292712.1| PREDICTED: beta-galactosidase 16-like [Fragaria vesca subsp. 
vesca]
Length=813

 Score =   414 bits (1064),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 208/358 (58%), Positives = 266/358 (74%), Gaps = 9/358 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +R AEDIA+HVALFIA+  GSY+NYYMYHGGTNFGRTA+ F+ TSYYD+AP
Sbjct  260   YQVYGDEPYLRRAEDIAYHVALFIAKNKGSYVNYYMYHGGTNFGRTASEFVTTSYYDEAP  319

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYG+  EPK+SHLKELHAA+K+    LL+   +  +L Q Q AYV++   SG CAAFL
Sbjct  320   LDEYGMPNEPKYSHLKELHAAVKLSISPLLAGEQTVVNLGQSQTAYVYK-VKSGECAAFL  378

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NN G   A VQFQNS YQL PKSISILPDCK+VAFNT KV+ Q  TR+  P  KFDS +
Sbjct  379   VNN-GSKDAIVQFQNSPYQLYPKSISILPDCKSVAFNTGKVSAQHATRSWTPTQKFDSHQ  437

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W+E+ E +  +D+T++R + ++D + TT D+SDYLWYT S Q +S +P+S ++V++ GH
Sbjct  438   NWQEYNEPIPTYDNTSLRQNIIVDQMRTTNDLSDYLWYTFSFQHDSPNPESTLNVQTHGH  497

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG L GS HG  RN+ F LES V+LNKG+N++SLLSA VGLP++GAYLE +  G
Sbjct  498   VLHSFVNGVLVGSGHGVHRNAGFALESKVNLNKGINHVSLLSAMVGLPDNGAYLERRDYG  557

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ-PLIWYK  1225
                V I+     +D S  +WGYQVGL GENLQIYT+  ++ VQW   SS++ P+ WYK
Sbjct  558   LHSVKID----GKDFSTYAWGYQVGLSGENLQIYTD--TSKVQWHRLSSTKHPMTWYK  609


 Score =   141 bits (356),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P GNDP+ALNLGSMGKGE W+NGQSIGRYWVS+HT  GTPSQTWY+VPRSFLKP
Sbjct  609   KTLFDAPAGNDPVALNLGSMGKGEVWINGQSIGRYWVSFHTPKGTPSQTWYHVPRSFLKP  668

Query  1651  TGNLLVLFEEEYG-NPYGITLDKVSIT  1728
             TGNLLVL EEE G +P  I+LD++S+ 
Sbjct  669   TGNLLVLIEEETGVDPVKISLDRISVA  695



>ref|XP_010243519.1| PREDICTED: beta-galactosidase 16 [Nelumbo nucifera]
Length=813

 Score =   414 bits (1064),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 210/360 (58%), Positives = 267/360 (74%), Gaps = 4/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQV+G +  +RSAEDIAFHVALF+A K GSY+NYYMYHGGTNFGR ++++  TSYYDQAP
Sbjct  258   YQVFGGEPYIRSAEDIAFHVALFVAAKKGSYVNYYMYHGGTNFGRVSSAYATTSYYDQAP  317

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKW HLKELHAAIK+CS+ LL+ T + FSL Q Q+A+VF+G S G CAAFL
Sbjct  318   LDEYGLTRQPKWGHLKELHAAIKLCSEQLLTGTYNNFSLGQLQEAHVFQGKS-GGCAAFL  376

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND ++++ V FQNSS+ LP KSISILPDCK V FNTAKV++Q + R+     K +S+E
Sbjct  377   VNNDIRNTSTVYFQNSSFVLPQKSISILPDCKNVIFNTAKVSSQYSARSTWLNQKLESSE  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W+EF E++  F DT+ +  TLL+H+ TTKD SDYLWYT S QQ SS   + + V SLGH
Sbjct  437   QWKEFSEVIPNFSDTSEKETTLLEHMGTTKDASDYLWYTFSFQQNSSAKGNMLQVYSLGH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H FVN   AGSAHG+  N   +L  ++SLN G+NNISLLS  VGLP+SGAYLE +  G
Sbjct  497   VIHAFVNRIYAGSAHGSHENPGSSLNISISLNYGVNNISLLSVMVGLPDSGAYLERRVAG  556

Query  1055  PRKVTIE-SSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
              R+V I+ + +  +D S   WGYQVGL GE L+ Y ++G   +QW   + S  QPL WYK
Sbjct  557   LRRVRIQGTGKWLQDFSKYQWGYQVGLSGEKLKTYGDQGLAKIQWNNLTISHQQPLTWYK  616


 Score =   121 bits (303),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P GNDP+ LNL SMGKGEAWVNGQSIGRYWVS++     PSQT Y+VPRSF+K 
Sbjct  616   KTTFDAPIGNDPVVLNLSSMGKGEAWVNGQSIGRYWVSFYPDKADPSQTLYHVPRSFIKN  675

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLLVLFEE  GNP  +TL+ ++I+
Sbjct  676   SGNLLVLFEEFGGNPLKVTLETITIS  701



>ref|XP_010025737.1| PREDICTED: beta-galactosidase 6 isoform X1 [Eucalyptus grandis]
Length=716

 Score =   411 bits (1056),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 205/359 (57%), Positives = 264/359 (74%), Gaps = 3/359 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFH  LFIA+ NG YINYYMYHGGTNFGRTAA++ IT YYDQAP
Sbjct  261   YQVYGGEPYLRSAEDIAFHATLFIAKLNGCYINYYMYHGGTNFGRTAAAYFITGYYDQAP  320

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELH AIK  S  LL    S FSL Q+Q+AYVF+ + +G C AFL
Sbjct  321   LDEYGLLRQPKWGHLKELHGAIKNSSSTLLEGVKSNFSLGQYQEAYVFQ-EETGGCVAFL  379

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND K SA VQF N S++L PKSISIL DC+ + FNTAKVT++S+TR    +  F+  +
Sbjct  380   VNNDAKSSATVQFGNKSFELLPKSISILQDCENMIFNTAKVTSESSTRVTTSSQTFEGAD  439

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEEF +++  + DT++RADTLL+H+NTTKD SDYLWY  S Q +S+  +  + ++SLGH
Sbjct  440   KWEEFLDVIPSYLDTSLRADTLLEHMNTTKDESDYLWYAFSFQPDSTCAEPVLHLKSLGH  499

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H FVN E  GSAHG+    +FT+E+ + L+  MNNISLLS  VGLP+SGA+LE +  G
Sbjct  500   VTHAFVNNEYMGSAHGSHDVKNFTMETKIVLDNQMNNISLLSVMVGLPDSGAFLEKRYAG  559

Query  1055  PRKVTIESSEG-SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-SQPLIWYK  1225
               +V I  ++  S + ++ SWGYQVGLLG+ L+IY E+    V+W   ++ +QPL WYK
Sbjct  560   LAEVEIRCTQDESYNFTHYSWGYQVGLLGQELEIYNEQNLGNVEWSNVTTVNQPLTWYK  618


 Score =   116 bits (290),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG++PLA NL +M KGEAWVNGQSIGRYWVS+ T  G PSQT Y+VPRSFL+ 
Sbjct  618   KTYFDAPEGSEPLAFNLTTMSKGEAWVNGQSIGRYWVSFLTANGNPSQTLYHVPRSFLQA  677

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKD  1740
             +GNLLVL EE  G+P  ++L  +S++   D
Sbjct  678   SGNLLVLLEEVGGDPLHVSLCTLSVSTLND  707



>ref|XP_008227610.1| PREDICTED: beta-galactosidase 6 [Prunus mume]
Length=723

 Score =   410 bits (1055),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 203/360 (56%), Positives = 261/360 (73%), Gaps = 4/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHVALFIAR NGSY+NYYMYHGGTNFGRT+++++ITSYYDQAP
Sbjct  267   YQVYGGEPYIRSAEDIAFHVALFIAR-NGSYVNYYMYHGGTNFGRTSSAYVITSYYDQAP  325

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLK LHAAIK CS  LL   P+ FSL Q Q+AYVFR ++ G C AFL
Sbjct  326   LDEYGLLRQPKWGHLKSLHAAIKSCSTTLLQGMPTNFSLGQLQEAYVFREETEGRCVAFL  385

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND +++A VQFQN+S++L PKSISILPDC+ V FNTA V T    R ++    FDS E
Sbjct  386   INNDERNNATVQFQNASHELMPKSISILPDCEKVIFNTATVNTNYTKRIIRTTEIFDSME  445

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W+ + +++  +++T++ +DTLL+H+N TKDVSDYLWYTL  Q   S  +  +  ES GH
Sbjct  446   RWQGYTDVIPNYENTSLHSDTLLEHMNVTKDVSDYLWYTLRFQPNISCAEPILVAESKGH  505

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
               H FVN    G+AHG+     F ++S V L+  +NNISLL   VGLP+SGA+LE +  G
Sbjct  506   ATHAFVNNIYIGNAHGSHDTKQFIMQSPVVLSNEINNISLLGVMVGLPDSGAFLERRFSG  565

Query  1055  PRKVTIESSEGS-EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWYK  1225
               +V I+ S+    + +N +WGYQVGL GE LQIY E+  + V+W + ++S  QPL WYK
Sbjct  566   LTRVEIQCSKNEFYNFTNYAWGYQVGLFGEKLQIYREENIHMVEWSKANTSLNQPLTWYK  625


 Score =   117 bits (292),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 69/92 (75%), Gaps = 1/92 (1%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P GNDP+ALNL SMGKGEAW+NGQSIGRYWVS+ T    PSQ  Y+VPRSF K 
Sbjct  625   KTFFDAPIGNDPVALNLSSMGKGEAWINGQSIGRYWVSFLTSKREPSQIMYHVPRSFFKT  684

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI-TLDKDI  1743
             + NLLVL EE  GNP  I+L+ +S+ TL K I
Sbjct  685   SENLLVLLEEAGGNPLHISLNIISLSTLPKHI  716



>ref|XP_006584660.1| PREDICTED: beta-galactosidase 6-like isoform X2 [Glycine max]
 ref|XP_006584661.1| PREDICTED: beta-galactosidase 6-like isoform X3 [Glycine max]
Length=625

 Score =   407 bits (1046),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 202/359 (56%), Positives = 255/359 (71%), Gaps = 4/359 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHV LFIARKNGSY+NYYMYHGGTN GRT++S++ITSYYDQAP
Sbjct  181   YQVYGGEPYIRSAEDIAFHVTLFIARKNGSYVNYYMYHGGTNLGRTSSSYVITSYYDQAP  240

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAAIK CS  LL    S FSL Q Q+ YVF  +  G C AFL
Sbjct  241   LDEYGLLRQPKWGHLKELHAAIKSCSTTLLEGKQSNFSLGQLQEGYVF--EEEGKCVAFL  298

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND      VQF+N SY+LP KSISILPDC+ V FNTA V T+SN R       F S +
Sbjct  299   VNNDHVKMFTVQFRNRSYELPSKSISILPDCQNVTFNTATVNTKSNRRMTSTIQTFSSAD  358

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE+F++++  FD T + +++LL+ +N TKD SDYLWYTL  +   S  +S ++ +S  H
Sbjct  359   KWEQFQDVIPNFDQTTLISNSLLEQMNVTKDKSDYLWYTLRFEHNLSCSESKLTAQSAAH  418

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H F +G   G AHG+    SFT +  + LN+G NNIS+LS  VGLP++GA+LE +  G
Sbjct  419   VTHAFADGTYLGGAHGSHDVKSFTTQVPLKLNEGTNNISILSVMVGLPDAGAFLERRFAG  478

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
                V I+ SE S DL+N +WGYQVGLLGE L+IY EK ++++QW     + +Q L WYK
Sbjct  479   LTAVEIQCSEESYDLTNSTWGYQVGLLGEQLEIYEEKSNSSIQWSPLGNTCNQTLTWYK  537


 Score =   126 bits (316),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P+G++P+ALNL SMGKG+AWVNG+SIGRYW+S+H   G PSQT Y+VPRSFLK 
Sbjct  537   KTAFDSPKGDEPVALNLESMGKGQAWVNGESIGRYWISFHDSKGQPSQTLYHVPRSFLKD  596

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
              GN LVLFEEE GNP  I+LD +S T
Sbjct  597   IGNSLVLFEEEGGNPLHISLDTISST  622



>ref|XP_007048527.1| Glycosyl hydrolase family 35 protein isoform 1 [Theobroma cacao]
 gb|EOX92684.1| Glycosyl hydrolase family 35 protein isoform 1 [Theobroma cacao]
Length=754

 Score =   410 bits (1055),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 205/361 (57%), Positives = 267/361 (74%), Gaps = 6/361 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSA+DIAFHVALFIA+K GSYINYYMYHGGTNFGRTA++++ITSYYDQAP
Sbjct  298   YQVYGGEPNIRSAQDIAFHVALFIAKK-GSYINYYMYHGGTNFGRTASAYVITSYYDQAP  356

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHA IK CS  LL    + FS+ QFQQAYVF   S+G C AFL
Sbjct  357   LDEYGLLRQPKWGHLKELHAVIKNCSSPLLEGVQTNFSIGQFQQAYVFEEGSAG-CVAFL  415

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND  ++A +QF+N+S++L PKSISILPDC+ + FNTAKV TQ N R    +  FD+ +
Sbjct  416   VNNDSTNNATLQFRNNSFELLPKSISILPDCQNIIFNTAKVKTQPNKRITTSSKMFDAVD  475

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEEF +++  F DT+++A++LL+H+NTTKD SDYLWYTLS Q  SS  +  + +ESLGH
Sbjct  476   SWEEFRDVIPNFLDTSLQANSLLEHMNTTKDGSDYLWYTLSFQPNSSCTEPVLHIESLGH  535

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H ++N +   + HG+     FT++  + L  GMNN+S+LS  VGLP+SG +LE +  G
Sbjct  536   VVHSYINNKFVEAGHGSHNIKGFTMDIPIDLIDGMNNVSILSVMVGLPDSGPFLESRFAG  595

Query  1055  PRKVTIESSEGS-EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR---EFSSSQPLIWY  1222
               KV I+ SE    D +N +WGYQVGLLGE LQ+Y E+  + V+W    + S++Q L WY
Sbjct  596   LTKVEIQCSETELYDFTNYTWGYQVGLLGEKLQVYKEENLDEVEWSSEIDHSANQSLTWY  655

Query  1223  K  1225
             K
Sbjct  656   K  656


 Score =   123 bits (308),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +TVFD P G+DP+ALNL SMGKGE WVNGQSIGRYWVS+ T  G PSQT Y+VPR+FLKP
Sbjct  656   KTVFDAPTGDDPIALNLSSMGKGEVWVNGQSIGRYWVSFLTSKGVPSQTLYHVPRAFLKP  715

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLL++ EE  G+P  I+L  +S+ 
Sbjct  716   SGNLLIVLEELNGDPLHISLHTISVA  741



>ref|XP_006584659.1| PREDICTED: beta-galactosidase 6-like isoform X1 [Glycine max]
 gb|KHN16937.1| Beta-galactosidase 6 [Glycine soja]
Length=704

 Score =   407 bits (1045),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 202/359 (56%), Positives = 255/359 (71%), Gaps = 4/359 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHV LFIARKNGSY+NYYMYHGGTN GRT++S++ITSYYDQAP
Sbjct  260   YQVYGGEPYIRSAEDIAFHVTLFIARKNGSYVNYYMYHGGTNLGRTSSSYVITSYYDQAP  319

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAAIK CS  LL    S FSL Q Q+ YVF  +  G C AFL
Sbjct  320   LDEYGLLRQPKWGHLKELHAAIKSCSTTLLEGKQSNFSLGQLQEGYVF--EEEGKCVAFL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND      VQF+N SY+LP KSISILPDC+ V FNTA V T+SN R       F S +
Sbjct  378   VNNDHVKMFTVQFRNRSYELPSKSISILPDCQNVTFNTATVNTKSNRRMTSTIQTFSSAD  437

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE+F++++  FD T + +++LL+ +N TKD SDYLWYTL  +   S  +S ++ +S  H
Sbjct  438   KWEQFQDVIPNFDQTTLISNSLLEQMNVTKDKSDYLWYTLRFEHNLSCSESKLTAQSAAH  497

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H F +G   G AHG+    SFT +  + LN+G NNIS+LS  VGLP++GA+LE +  G
Sbjct  498   VTHAFADGTYLGGAHGSHDVKSFTTQVPLKLNEGTNNISILSVMVGLPDAGAFLERRFAG  557

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
                V I+ SE S DL+N +WGYQVGLLGE L+IY EK ++++QW     + +Q L WYK
Sbjct  558   LTAVEIQCSEESYDLTNSTWGYQVGLLGEQLEIYEEKSNSSIQWSPLGNTCNQTLTWYK  616


 Score =   125 bits (314),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P+G++P+ALNL SMGKG+AWVNG+SIGRYW+S+H   G PSQT Y+VPRSFLK 
Sbjct  616   KTAFDSPKGDEPVALNLESMGKGQAWVNGESIGRYWISFHDSKGQPSQTLYHVPRSFLKD  675

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
              GN LVLFEEE GNP  I+LD +S T
Sbjct  676   IGNSLVLFEEEGGNPLHISLDTISST  701



>ref|XP_006301847.1| hypothetical protein CARUB_v10022317mg [Capsella rubella]
 gb|EOA34745.1| hypothetical protein CARUB_v10022317mg [Capsella rubella]
Length=821

 Score =   410 bits (1054),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 209/359 (58%), Positives = 251/359 (70%), Gaps = 6/359 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG + LMRSAEDIAF VALFIAR NGS++NYYMYHGGTNFGR A+ F+ITSYYDQAP
Sbjct  260   YQTYGEEPLMRSAEDIAFQVALFIAR-NGSFVNYYMYHGGTNFGRNASQFVITSYYDQAP  318

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAA+K+C + LLS   +T  L +   A+VF G  +  C+A L
Sbjct  319   LDEYGLLRQPKWGHLKELHAAVKLCEEPLLSGLQTTIPLGKLLTAFVF-GKKANLCSALL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D K  + VQF NSSY L PKSIS+LPDCK VAFNTAKV  Q NTRT +P     S  
Sbjct  378   VNQD-KCDSTVQFHNSSYILSPKSISVLPDCKNVAFNTAKVNAQYNTRTREPRQNLSSPH  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEEF E +  F +T++R++  L+H+NTT+D SDYLW T    Q   +  S + V  LGH
Sbjct  437   MWEEFTETIPSFSETSVRSEFFLEHMNTTQDTSDYLWQTTRFHQ-PEEALSVLKVNHLGH  495

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG   GS HGTF+   F LE  VSLN G NNI+LLS  VGLPNSGA+LE + +G
Sbjct  496   VLHAFVNGRFIGSMHGTFKAHRFLLEKNVSLNNGTNNIALLSVMVGLPNSGAHLERRVVG  555

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
              R   I + + +   +N SWGYQVGL GE    YTE G+  VQW+++  S SQPL WYK
Sbjct  556   TRGAKIWNGKHTLYFNNYSWGYQVGLQGEKFHAYTENGAAKVQWKQYRDSKSQPLTWYK  614


 Score =   128 bits (322),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 70/85 (82%), Gaps = 2/85 (2%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP-TG  1656
             FD PEG D +ALNLGSMGKGEAWVNGQSIGRYWVS+HT  G PSQ WY++PRSFLK  + 
Sbjct  617   FDTPEGTDSVALNLGSMGKGEAWVNGQSIGRYWVSFHTYKGNPSQIWYHIPRSFLKRNSS  676

Query  1657  NLLVLFEEEY-GNPYGITLDKVSIT  1728
             NLLV+ EEE  GNP GIT+D VS+T
Sbjct  677   NLLVILEEEREGNPLGITIDTVSVT  701



>ref|XP_007137753.1| hypothetical protein PHAVU_009G153000g [Phaseolus vulgaris]
 gb|ESW09747.1| hypothetical protein PHAVU_009G153000g [Phaseolus vulgaris]
Length=716

 Score =   406 bits (1044),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 203/360 (56%), Positives = 257/360 (71%), Gaps = 5/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG+   +RSAEDIAFHV LF+AR NGSYINYYMYHGGTNFGRT A+++IT YYDQAP
Sbjct  259   YQVYGALPYIRSAEDIAFHVTLFVAR-NGSYINYYMYHGGTNFGRTGAAYVITGYYDQAP  317

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLK+LH  IK CS  LL    S FSL Q Q+ YVF+ +  G C AFL
Sbjct  318   LDEYGLLRQPKWGHLKQLHTVIKSCSTTLLQGVQSNFSLGQVQEGYVFQ-EEKGGCVAFL  376

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND  +   VQF+N SY+L PKSISILPDC+ V FNTA V T SNTR + P  KF S +
Sbjct  377   INNDRANKVTVQFRNRSYELLPKSISILPDCQNVTFNTANVNTPSNTRIISPKQKFSSVD  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W++F++ +  FDDT++++++ L+ +NTTKD SDYLWYT   +   S  K  +SV+S  H
Sbjct  437   VWKQFQDFIPSFDDTSLKSNSFLEQMNTTKDESDYLWYTHRFENNLSCSKPTLSVQSAAH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H FVN    G AHG     SFTLE  V+L++G NN+S+LS  VGLP+SGA+LE +  G
Sbjct  497   VAHAFVNNTYIGGAHGNHDVKSFTLEFPVTLHEGTNNLSILSVMVGLPDSGAFLERRFAG  556

Query  1055  PRKVTIESSEG-SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--SQPLIWYK  1225
                + ++ S+G S +L+N  WGY+VGLLGE LQ+Y  + S+ ++WRE  +   Q LIWYK
Sbjct  557   LISMQLQCSKGESLNLTNSLWGYKVGLLGEQLQVYKGQNSSGIEWRELGNIKEQTLIWYK  616


 Score =   119 bits (299),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F+ P+G DP+ L+L SMGKGEAWVNGQSIGRYW+ +H   G PSQ+ Y+VPRSFL+ 
Sbjct  616   KTTFETPKGEDPVVLDLSSMGKGEAWVNGQSIGRYWILFHDSKGNPSQSLYHVPRSFLQD  675

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GN+LVL +E  GNP GI+LD VS+T
Sbjct  676   SGNVLVLVDECGGNPLGISLDTVSVT  701



>gb|KDP31634.1| hypothetical protein JCGZ_14859 [Jatropha curcas]
Length=815

 Score =   408 bits (1049),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 209/359 (58%), Positives = 264/359 (74%), Gaps = 10/359 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y + G D   RS EDIA+ VALF+  KNGS++NYYMYHGGTNFGRTA++F+  SYYDQAP
Sbjct  257   YVINGEDIRTRSVEDIAYQVALFLVAKNGSFVNYYMYHGGTNFGRTASAFIPPSYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+REPK+ HLKELHAAIK+CS  LLS      SL Q QQAYVF G  SG CAAFL
Sbjct  317   LDEYGLVREPKFGHLKELHAAIKLCSTPLLSGVQVYISLGQQQQAYVFNGQ-SGECAAFL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N+D ++ A VQFQN SY LPP SISILPDCK        V +Q  TR+M  +   D  E
Sbjct  376   VNSDTENEASVQFQNGSYDLPPISISILPDCKN-------VNSQYGTRSMVRSKLLDGGE  428

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEEF E +  FDDT+I+++T+L+ ++TTKD SDYLWYT   Q+ESSD ++ ++V+SLGH
Sbjct  429   TWEEFHEPIPKFDDTSIKSETILEQMSTTKDASDYLWYTFRFQKESSDSQAVLNVKSLGH  488

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG+ AGSA G+ +   F L+STV L  G+NN+SLLS  VGLP+SGA++E ++ G
Sbjct  489   VLHAFVNGQAAGSAQGSHKTPRFNLQSTVHLVGGINNVSLLSVMVGLPDSGAHMERRSAG  548

Query  1055  PRKVTIESSEG-SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS-QPLIWYK  1225
               +V I+  +G ++D +N SWGYQ+GLLGE LQIYT+KGS  VQW++FS+      WYK
Sbjct  549   LSRVIIQDKQGNNKDFTNHSWGYQIGLLGEKLQIYTDKGSTQVQWQKFSNPWNSPTWYK  607


 Score =   118 bits (295),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 1/86 (1%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             + +FD P G  P+ALNLGSMGKGEAWVNG+SIGRYW SY +  G+ SQ WYNVPRSFLKP
Sbjct  607   KALFDAPAGEVPVALNLGSMGKGEAWVNGESIGRYWPSYRSPDGS-SQIWYNVPRSFLKP  665

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLV+ EE  GNP  I++D  +I+
Sbjct  666   TGNLLVVMEEMGGNPLQISVDTATIS  691



>gb|AAG29193.1|AC078898_3 beta-galactosidase, putative [Arabidopsis thaliana]
Length=780

 Score =   407 bits (1046),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 208/348 (60%), Positives = 250/348 (72%), Gaps = 6/348 (2%)
 Frame = +2

Query  188   SAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPLDEYGLLREPK  367
             SAEDIAFHVALFIA KNGS++NYYMYHGGTNFGR A+ F+ITSYYDQAPLDEYGLLR+PK
Sbjct  245   SAEDIAFHVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVITSYYDQAPLDEYGLLRQPK  303

Query  368   WSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINNDGKHSAKV  547
             W HLKELHAA+K+C + LLS   +T SL + Q A+VF G  +  CAA L+N D K  + V
Sbjct  304   WGHLKELHAAVKLCEEPLLSGLQTTISLGKLQTAFVF-GKKANLCAAILVNQD-KCESTV  361

Query  548   QFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeeweefeeLVVG  727
             QF+NSSY+L PKS+S+LPDCK VAFNTAKV  Q NTRT +      S + WEEF E V  
Sbjct  362   QFRNSSYRLSPKSVSVLPDCKNVAFNTAKVNAQYNTRTRKARQNLSSPQMWEEFTETVPS  421

Query  728   FDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGHVLHIFVNGELA  907
             F +T+IR+++LL+H+NTT+D SDYLW T   QQ    P S + V  LGH LH FVNG   
Sbjct  422   FSETSIRSESLLEHMNTTQDTSDYLWQTTRFQQSEGAP-SVLKVNHLGHALHAFVNGRFI  480

Query  908   GSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLGPRKVTIESSEG  1087
             GS HGTF+   F LE  +SLN G NN++LLS  VGLPNSGA+LE + +G R V I +   
Sbjct  481   GSMHGTFKAHRFLLEKNMSLNNGTNNLALLSVMVGLPNSGAHLERRVVGSRSVKIWNGRY  540

Query  1088  SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF--SSSQPLIWYK  1225
                 +N SWGYQVGL GE   +YTE GS  VQW+++  S SQPL WYK
Sbjct  541   QLYFNNYSWGYQVGLKGEKFHVYTEDGSAKVQWKQYRDSKSQPLTWYK  588


 Score = 99.4 bits (246),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 59/84 (70%), Gaps = 12/84 (14%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD PEG DP+ALNLGSMGKGEAWVNGQSI  +           S   Y++PRSFLKP  N
Sbjct  591   FDTPEGEDPVALNLGSMGKGEAWVNGQSIAMF-----------SYFRYHIPRSFLKPNSN  639

Query  1660  LLVLFEEEY-GNPYGITLDKVSIT  1728
             LLV+ EEE  GNP GIT+D VS+T
Sbjct  640   LLVILEEEREGNPLGITIDTVSVT  663



>ref|XP_006376211.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|ERP54008.1| beta-galactosidase family protein [Populus trichocarpa]
Length=788

 Score =   407 bits (1046),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 204/348 (59%), Positives = 252/348 (72%), Gaps = 9/348 (3%)
 Frame = +2

Query  185   RSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPLDEYGLLREP  364
             +SAEDIAFHV LFIA K GS++NYYMYHGGTNFGRTA++F+ TSYYDQAPLDEYGL  +P
Sbjct  258   QSAEDIAFHVTLFIAAKKGSFVNYYMYHGGTNFGRTASAFVTTSYYDQAPLDEYGLTTQP  317

Query  365   KWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINNDGKHSAK  544
             KW HLKELHAAIK+CS  LLS       L   QQAY+F    SG CAAFLINND  ++A 
Sbjct  318   KWGHLKELHAAIKLCSTPLLSGVQVNLYLGPQQQAYIFNA-VSGECAAFLINNDSSNAAS  376

Query  545   VQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeeweefeeLVV  724
             V F+N+SY LPP SISILPDCK V       +TQ  TRTM      D+ + W+EF E + 
Sbjct  377   VPFRNASYDLPPMSISILPDCKNV-------STQYTTRTMGRGEVLDAADAWQEFTEAIP  429

Query  725   GFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGHVLHIFVNGEL  904
              FD T+ R+ TLL+ +NTTKD SDYLWYT   Q ESSD ++ + V SLGH LH FVNG+ 
Sbjct  430   NFDSTSKRSKTLLEQMNTTKDSSDYLWYTFRFQHESSDTQAILDVSSLGHALHAFVNGQS  489

Query  905   AGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLGPRKVTIESSE  1084
              GS  G+ +N  F  E++VSL+KG+NN+SLLS  VG+P+SGA+LE++  G R V I   +
Sbjct  490   VGSVQGSRKNPRFKFETSVSLSKGINNVSLLSVMVGMPDSGAFLENRAAGLRTVMIRDKQ  549

Query  1085  GSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS-QPLIWYK  1225
              + D +N SWGYQ+GL GE LQIYTE+GS+ VQW++FS++  PL WYK
Sbjct  550   DNNDFTNYSWGYQIGLQGETLQIYTEQGSSQVQWKKFSNAGNPLTWYK  597


 Score =   107 bits (266),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 62/86 (72%), Gaps = 12/86 (14%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T  D P G+ P+ALNL SMGKGEAWVNGQSIGRYW SYH            VPRSFLKP
Sbjct  597   KTQVDAPPGDVPVALNLASMGKGEAWVNGQSIGRYWPSYH------------VPRSFLKP  644

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNL+VL EEE GNP  ++LD VSI+
Sbjct  645   TGNLVVLQEEEGGNPLQVSLDTVSIS  670



>ref|XP_006578771.1| PREDICTED: beta-galactosidase 6-like isoform X3 [Glycine max]
Length=604

 Score =   397 bits (1021),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 200/360 (56%), Positives = 256/360 (71%), Gaps = 5/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG    +RSAEDIAFHV LFIAR NGSY+NYYMYHGGTNFGRTA++++IT YYDQAP
Sbjct  147   YQVYGGLPYIRSAEDIAFHVTLFIAR-NGSYVNYYMYHGGTNFGRTASAYVITGYYDQAP  205

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLK+LH  IK CS  LL      FSL Q Q+ YVF  +  G C AFL
Sbjct  206   LDEYGLLRQPKWGHLKQLHEVIKSCSTTLLQGVQRNFSLGQLQEGYVFE-EEKGECVAFL  264

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NND  +   VQF+N SY+L P+SISILPDC+ VAFNTA V T SN R + P   F S +
Sbjct  265   KNNDRDNKVTVQFRNRSYELLPRSISILPDCQNVAFNTANVNTTSNRRIISPKQNFSSLD  324

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W++F++++  FD+T++R+D+LL+ +NTTKD SDYLWYTL  +   S  K  +SV+S  H
Sbjct  325   DWKQFQDVIPYFDNTSLRSDSLLEQMNTTKDKSDYLWYTLRFEYNLSCRKPTLSVQSAAH  384

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H F+N    G  HG     SFTLE  V++N+G NN+S+LSA VGLP+SGA+LE +  G
Sbjct  385   VAHAFINNTYIGGEHGNHDVKSFTLELPVTVNQGTNNLSILSAMVGLPDSGAFLERRFAG  444

Query  1055  PRKVTIESSEG-SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--SQPLIWYK  1225
                V ++ SE  S +L+N +WGYQVGLLGE LQ+Y ++ ++ + W +  +   Q LIWYK
Sbjct  445   LISVELQCSEQESLNLTNSTWGYQVGLLGEQLQVYKKQNNSDIGWSQLGNIMEQLLIWYK  504


 Score =   122 bits (307),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG+DP+ L+L SMGKGEAWVN QSIGRYW+ +H   G PSQ+ Y+VPRSFLK 
Sbjct  504   KTTFDTPEGDDPVVLDLSSMGKGEAWVNEQSIGRYWILFHDSKGNPSQSLYHVPRSFLKD  563

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             TGN+LVL EE  GNP GI+LD VS+
Sbjct  564   TGNVLVLVEEGGGNPLGISLDTVSV  588



>ref|XP_010652936.1| PREDICTED: beta-galactosidase 6 isoform X2 [Vitis vinifera]
Length=600

 Score =   397 bits (1020),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 257/360 (71%), Gaps = 5/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G +  +RSAEDIAFHVALFIAR NGSY+NYYMYHGGTNFGR +++++ TSYYDQAP
Sbjct  137   YEVFGGETYLRSAEDIAFHVALFIAR-NGSYVNYYMYHGGTNFGRASSAYIKTSYYDQAP  195

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAI +CS  LL+   S  SL Q Q+AYVF+ +  G C AFL
Sbjct  196   LDEYGLIRQPKWGHLKELHAAITLCSTPLLNGVQSNISLGQLQEAYVFQ-EEMGGCVAFL  254

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND  +++ V FQN S +L PKSISILPDCK V FNTAK+ T  N R    +  FD+ +
Sbjct  255   VNNDEGNNSTVLFQNVSIELLPKSISILPDCKNVIFNTAKINTGYNERIATSSQSFDAVD  314

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEE+++ +  F DT+++++ +L+H+N TKD SDYLWYT   Q  SS  +  + +ESL H
Sbjct  315   RWEEYKDAIPNFLDTSLKSNMILEHMNMTKDESDYLWYTFRFQPNSSCTEPLLHIESLAH  374

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              +H FVN    G+ HG+     FT +S +SLN  MNNIS+LS  VG P+SGAYLE +  G
Sbjct  375   AVHAFVNNIYVGATHGSHDMKGFTFKSPISLNNEMNNISILSVMVGFPDSGAYLESRFAG  434

Query  1055  PRKVTIESSE-GSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR--EFSSSQPLIWYK  1225
               +V I+ +E G  D +N +WGYQVGL GE L IY E+  + V+WR  E S++QPL WYK
Sbjct  435   LTRVEIQCTEKGIYDFANYTWGYQVGLSGEKLHIYKEENLSNVEWRKTEISTNQPLTWYK  494


 Score =   120 bits (301),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             + VF+ P G+DP+ALNL +MGKGEAWVNGQSIGRYWVS+H   G PSQT Y+VPR+FLK 
Sbjct  494   KIVFNTPSGDDPVALNLSTMGKGEAWVNGQSIGRYWVSFHNSKGDPSQTLYHVPRAFLKT  553

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT-LDKDILLRRLA*GKGSVPS  1785
             + NLLVL EE  G+P  I+L+ +S T L   +L   L   K  V S
Sbjct  554   SENLLVLLEEANGDPLHISLETISRTDLPDHVLYHHLPQEKQRVQS  599



>gb|KEH35626.1| beta-galactosidase-like protein [Medicago truncatula]
Length=569

 Score =   395 bits (1016),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 200/362 (55%), Positives = 256/362 (71%), Gaps = 7/362 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG    +RSAEDIAFHV LF+AR NGS++NYYMYHGGTNFGRT++++MIT YYDQAP
Sbjct  110   YQVYGGVPYIRSAEDIAFHVTLFVAR-NGSFVNYYMYHGGTNFGRTSSAYMITGYYDQAP  168

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKW HLKELHAAIK CS  LL      FSL + Q+ YVF  + +G CAAFL
Sbjct  169   LDEYGLFRQPKWGHLKELHAAIKSCSTTLLQGVQRNFSLGELQEGYVFE-EENGKCAAFL  227

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND  ++  VQF NSSY+L PKSISILPDC+ VAFNTA + T SN R +     F S +
Sbjct  228   INNDKGNTVTVQFNNSSYKLLPKSISILPDCQNVAFNTAHLNTTSNRRIITSRQNFSSVD  287

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W++F++++  FDDT++R+D+LL+ +NTTKD SDYLWYTL L+   S     + V+S  H
Sbjct  288   DWKQFQDVIPNFDDTSLRSDSLLEQMNTTKDKSDYLWYTLRLENNLSCNDPILHVQSSAH  347

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V + FVN    G  HG     SFTLE  ++LN+  NNIS+LS  VGLP+SGA+LE +  G
Sbjct  348   VAYAFVNNTYIGGEHGNHDVKSFTLELPITLNERTNNISILSGMVGLPDSGAFLEKRFAG  407

Query  1055  PRKVTIESSEG-SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS----SQPLIW  1219
                V ++ SE  S +L+N +WGYQVGLLGE L++YTE+ S  ++W +  +       L W
Sbjct  408   LNNVELQCSEQESLNLNNSTWGYQVGLLGEQLKVYTEQNSTDIKWTQLGNITIDEVTLTW  467

Query  1220  YK  1225
             YK
Sbjct  468   YK  469


 Score =   112 bits (280),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P+G+DP+AL+L SM KGEAWVNGQSIGRYW+ +    G PSQ+ Y+VPRSFLK 
Sbjct  469   KTTFDTPKGDDPIALDLSSMAKGEAWVNGQSIGRYWILFLDSKGNPSQSLYHVPRSFLKD  528

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKD  1740
             + N LVL +E  GNP  I+L+ VS+T  +D
Sbjct  529   SENSLVLLDEGGGNPLDISLNTVSVTDLQD  558



>ref|XP_006578770.1| PREDICTED: beta-galactosidase 6-like isoform X2 [Glycine max]
Length=692

 Score =   397 bits (1021),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 200/360 (56%), Positives = 256/360 (71%), Gaps = 5/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG    +RSAEDIAFHV LFIAR NGSY+NYYMYHGGTNFGRTA++++IT YYDQAP
Sbjct  235   YQVYGGLPYIRSAEDIAFHVTLFIAR-NGSYVNYYMYHGGTNFGRTASAYVITGYYDQAP  293

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLK+LH  IK CS  LL      FSL Q Q+ YVF  +  G C AFL
Sbjct  294   LDEYGLLRQPKWGHLKQLHEVIKSCSTTLLQGVQRNFSLGQLQEGYVFE-EEKGECVAFL  352

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NND  +   VQF+N SY+L P+SISILPDC+ VAFNTA V T SN R + P   F S +
Sbjct  353   KNNDRDNKVTVQFRNRSYELLPRSISILPDCQNVAFNTANVNTTSNRRIISPKQNFSSLD  412

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W++F++++  FD+T++R+D+LL+ +NTTKD SDYLWYTL  +   S  K  +SV+S  H
Sbjct  413   DWKQFQDVIPYFDNTSLRSDSLLEQMNTTKDKSDYLWYTLRFEYNLSCRKPTLSVQSAAH  472

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H F+N    G  HG     SFTLE  V++N+G NN+S+LSA VGLP+SGA+LE +  G
Sbjct  473   VAHAFINNTYIGGEHGNHDVKSFTLELPVTVNQGTNNLSILSAMVGLPDSGAFLERRFAG  532

Query  1055  PRKVTIESSEG-SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--SQPLIWYK  1225
                V ++ SE  S +L+N +WGYQVGLLGE LQ+Y ++ ++ + W +  +   Q LIWYK
Sbjct  533   LISVELQCSEQESLNLTNSTWGYQVGLLGEQLQVYKKQNNSDIGWSQLGNIMEQLLIWYK  592


 Score =   122 bits (307),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG+DP+ L+L SMGKGEAWVN QSIGRYW+ +H   G PSQ+ Y+VPRSFLK 
Sbjct  592   KTTFDTPEGDDPVVLDLSSMGKGEAWVNEQSIGRYWILFHDSKGNPSQSLYHVPRSFLKD  651

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             TGN+LVL EE  GNP GI+LD VS+
Sbjct  652   TGNVLVLVEEGGGNPLGISLDTVSV  676



>ref|XP_003522474.1| PREDICTED: beta-galactosidase 6-like isoform X1 [Glycine max]
Length=717

 Score =   397 bits (1021),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 200/360 (56%), Positives = 256/360 (71%), Gaps = 5/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG    +RSAEDIAFHV LFIAR NGSY+NYYMYHGGTNFGRTA++++IT YYDQAP
Sbjct  260   YQVYGGLPYIRSAEDIAFHVTLFIAR-NGSYVNYYMYHGGTNFGRTASAYVITGYYDQAP  318

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLK+LH  IK CS  LL      FSL Q Q+ YVF  +  G C AFL
Sbjct  319   LDEYGLLRQPKWGHLKQLHEVIKSCSTTLLQGVQRNFSLGQLQEGYVFE-EEKGECVAFL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NND  +   VQF+N SY+L P+SISILPDC+ VAFNTA V T SN R + P   F S +
Sbjct  378   KNNDRDNKVTVQFRNRSYELLPRSISILPDCQNVAFNTANVNTTSNRRIISPKQNFSSLD  437

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W++F++++  FD+T++R+D+LL+ +NTTKD SDYLWYTL  +   S  K  +SV+S  H
Sbjct  438   DWKQFQDVIPYFDNTSLRSDSLLEQMNTTKDKSDYLWYTLRFEYNLSCRKPTLSVQSAAH  497

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H F+N    G  HG     SFTLE  V++N+G NN+S+LSA VGLP+SGA+LE +  G
Sbjct  498   VAHAFINNTYIGGEHGNHDVKSFTLELPVTVNQGTNNLSILSAMVGLPDSGAFLERRFAG  557

Query  1055  PRKVTIESSEG-SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--SQPLIWYK  1225
                V ++ SE  S +L+N +WGYQVGLLGE LQ+Y ++ ++ + W +  +   Q LIWYK
Sbjct  558   LISVELQCSEQESLNLTNSTWGYQVGLLGEQLQVYKKQNNSDIGWSQLGNIMEQLLIWYK  617


 Score =   122 bits (306),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG+DP+ L+L SMGKGEAWVN QSIGRYW+ +H   G PSQ+ Y+VPRSFLK 
Sbjct  617   KTTFDTPEGDDPVVLDLSSMGKGEAWVNEQSIGRYWILFHDSKGNPSQSLYHVPRSFLKD  676

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             TGN+LVL EE  GNP GI+LD VS+
Sbjct  677   TGNVLVLVEEGGGNPLGISLDTVSV  701



>ref|XP_010652935.1| PREDICTED: beta-galactosidase 6 isoform X1 [Vitis vinifera]
Length=722

 Score =   397 bits (1019),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 257/360 (71%), Gaps = 5/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G +  +RSAEDIAFHVALFIAR NGSY+NYYMYHGGTNFGR +++++ TSYYDQAP
Sbjct  259   YEVFGGETYLRSAEDIAFHVALFIAR-NGSYVNYYMYHGGTNFGRASSAYIKTSYYDQAP  317

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAI +CS  LL+   S  SL Q Q+AYVF+ +  G C AFL
Sbjct  318   LDEYGLIRQPKWGHLKELHAAITLCSTPLLNGVQSNISLGQLQEAYVFQ-EEMGGCVAFL  376

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND  +++ V FQN S +L PKSISILPDCK V FNTAK+ T  N R    +  FD+ +
Sbjct  377   VNNDEGNNSTVLFQNVSIELLPKSISILPDCKNVIFNTAKINTGYNERIATSSQSFDAVD  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEE+++ +  F DT+++++ +L+H+N TKD SDYLWYT   Q  SS  +  + +ESL H
Sbjct  437   RWEEYKDAIPNFLDTSLKSNMILEHMNMTKDESDYLWYTFRFQPNSSCTEPLLHIESLAH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              +H FVN    G+ HG+     FT +S +SLN  MNNIS+LS  VG P+SGAYLE +  G
Sbjct  497   AVHAFVNNIYVGATHGSHDMKGFTFKSPISLNNEMNNISILSVMVGFPDSGAYLESRFAG  556

Query  1055  PRKVTIESSE-GSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR--EFSSSQPLIWYK  1225
               +V I+ +E G  D +N +WGYQVGL GE L IY E+  + V+WR  E S++QPL WYK
Sbjct  557   LTRVEIQCTEKGIYDFANYTWGYQVGLSGEKLHIYKEENLSNVEWRKTEISTNQPLTWYK  616


 Score =   120 bits (300),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             + VF+ P G+DP+ALNL +MGKGEAWVNGQSIGRYWVS+H   G PSQT Y+VPR+FLK 
Sbjct  616   KIVFNTPSGDDPVALNLSTMGKGEAWVNGQSIGRYWVSFHNSKGDPSQTLYHVPRAFLKT  675

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT-LDKDILLRRLA*GKGSVPS  1785
             + NLLVL EE  G+P  I+L+ +S T L   +L   L   K  V S
Sbjct  676   SENLLVLLEEANGDPLHISLETISRTDLPDHVLYHHLPQEKQRVQS  721



>ref|XP_004502987.1| PREDICTED: beta-galactosidase 6-like isoform X2 [Cicer arietinum]
Length=645

 Score =   392 bits (1008),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 197/362 (54%), Positives = 259/362 (72%), Gaps = 7/362 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG    +RSAEDIAFHV LFIAR NGS++NYYMYHGGTNFGRT+++++IT+YYDQAP
Sbjct  186   YQVYGGVPYIRSAEDIAFHVTLFIAR-NGSFVNYYMYHGGTNFGRTSSAYIITAYYDQAP  244

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKW HLKELHAAIK CS  LL      FSL + Q+AYVF  + +G C AFL
Sbjct  245   LDEYGLFRQPKWGHLKELHAAIKSCSTTLLQGVQRNFSLGEMQEAYVFE-EENGECVAFL  303

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND +++  VQF NSS++L PKSISILPDC+ V FNTA V T SN R +     F S +
Sbjct  304   INNDRRNNVTVQFHNSSHELLPKSISILPDCQNVVFNTANVNTTSNIRIITSRQNFSSVD  363

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W+++++++  FDDT++R+++LL+ +NTTKD+SDYLWYTL L+   S  +  + + S  H
Sbjct  364   DWKQYQDVISKFDDTSLRSNSLLEQMNTTKDISDYLWYTLRLENNLSCGEPTLRLHSAAH  423

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V + FVN    G AHG     SFTLE  V+LN+G NNIS+LS  VGLP+SGA+LE +  G
Sbjct  424   VAYAFVNDTYIGGAHGNHDVKSFTLELPVTLNEGKNNISILSVMVGLPDSGAFLERRFAG  483

Query  1055  PRKVTIESS-EGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS----SSQPLIW  1219
                V ++ S + S +L+N +WGYQVGLLGE L++Y E+ S+ ++W +          L W
Sbjct  484   LINVELQCSKQESLNLNNYTWGYQVGLLGEQLEVYKEQTSSDIEWTQLEHIMIDQITLTW  543

Query  1220  YK  1225
             YK
Sbjct  544   YK  545


 Score =   116 bits (291),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P+G+DP+ L+L SMGKGEAWVNGQSIGRYW+ +H   G PSQ+ Y+VPRSFLK 
Sbjct  545   KTTFDTPKGDDPVVLDLSSMGKGEAWVNGQSIGRYWILFHDSKGNPSQSLYHVPRSFLKE  604

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             + N LVL EE  GNP  I+L+ VS+T
Sbjct  605   SENSLVLLEEGGGNPLDISLNTVSVT  630



>ref|XP_003602682.1| Beta-galactosidase [Medicago truncatula]
 gb|AES72933.1| beta-galactosidase-like protein [Medicago truncatula]
Length=719

 Score =   394 bits (1013),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 200/362 (55%), Positives = 256/362 (71%), Gaps = 7/362 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG    +RSAEDIAFHV LF+AR NGS++NYYMYHGGTNFGRT++++MIT YYDQAP
Sbjct  260   YQVYGGVPYIRSAEDIAFHVTLFVAR-NGSFVNYYMYHGGTNFGRTSSAYMITGYYDQAP  318

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKW HLKELHAAIK CS  LL      FSL + Q+ YVF  + +G CAAFL
Sbjct  319   LDEYGLFRQPKWGHLKELHAAIKSCSTTLLQGVQRNFSLGELQEGYVFE-EENGKCAAFL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND  ++  VQF NSSY+L PKSISILPDC+ VAFNTA + T SN R +     F S +
Sbjct  378   INNDKGNTVTVQFNNSSYKLLPKSISILPDCQNVAFNTAHLNTTSNRRIITSRQNFSSVD  437

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W++F++++  FDDT++R+D+LL+ +NTTKD SDYLWYTL L+   S     + V+S  H
Sbjct  438   DWKQFQDVIPNFDDTSLRSDSLLEQMNTTKDKSDYLWYTLRLENNLSCNDPILHVQSSAH  497

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V + FVN    G  HG     SFTLE  ++LN+  NNIS+LS  VGLP+SGA+LE +  G
Sbjct  498   VAYAFVNNTYIGGEHGNHDVKSFTLELPITLNERTNNISILSGMVGLPDSGAFLEKRFAG  557

Query  1055  PRKVTIESSEG-SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS----SQPLIW  1219
                V ++ SE  S +L+N +WGYQVGLLGE L++YTE+ S  ++W +  +       L W
Sbjct  558   LNNVELQCSEQESLNLNNSTWGYQVGLLGEQLKVYTEQNSTDIKWTQLGNITIDEVTLTW  617

Query  1220  YK  1225
             YK
Sbjct  618   YK  619


 Score =   111 bits (278),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P+G+DP+AL+L SM KGEAWVNGQSIGRYW+ +    G PSQ+ Y+VPRSFLK 
Sbjct  619   KTTFDTPKGDDPIALDLSSMAKGEAWVNGQSIGRYWILFLDSKGNPSQSLYHVPRSFLKD  678

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKD  1740
             + N LVL +E  GNP  I+L+ VS+T  +D
Sbjct  679   SENSLVLLDEGGGNPLDISLNTVSVTDLQD  708



>ref|XP_011031111.1| PREDICTED: beta-galactosidase 6 isoform X2 [Populus euphratica]
Length=592

 Score =   390 bits (1002),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 199/362 (55%), Positives = 256/362 (71%), Gaps = 7/362 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHV LFIA+K GSYINYYM+HGGTNFGRTA++++ITSYYDQAP
Sbjct  135   YQVYGGEPYIRSAEDIAFHVTLFIAKK-GSYINYYMFHGGTNFGRTASAYVITSYYDQAP  193

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAIK CS  +L    S FSL Q QQAY+F  + +G CAAFL
Sbjct  194   LDEYGLIRQPKWGHLKELHAAIKSCSTTILEGAQSNFSLGQLQQAYIFEEEGAG-CAAFL  252

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND K++A V+F+N +++L PKSISILPDC+ + FNTAKV  + N  T   +  FD  +
Sbjct  253   VNNDQKNNATVEFRNITFELLPKSISILPDCENIVFNTAKVNAKGNEITRTSSQLFDDAD  312

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WE + +++  F DTN+++DTLL+H+NTTKD SDYLWYT S Q  SS  +  + VESL H
Sbjct  313   RWEAYTDVIPNFADTNLKSDTLLEHMNTTKDKSDYLWYTFSFQPNSSCTEPVLHVESLAH  372

Query  875   VLHIFVNGELAGSAHGT-FRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             V   FVN + AGSAHG+      FT+E+ + LN  MNNIS+LS  VGL +SGA+LE +  
Sbjct  373   VASAFVNNKYAGSAHGSKAAKGPFTMEAPIVLNDQMNNISILSTMVGLQDSGAFLERRYA  432

Query  1052  GPRKVTIESSEGS--EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIW  1219
             G  +V I  ++       +N  WGYQ GL GE+L IY  +    ++W    S+  QPL W
Sbjct  433   GLTRVEIRCAQQEIYNFTNNYEWGYQAGLSGESLSIYMREHLGNIEWSGVVSATDQPLSW  492

Query  1220  YK  1225
             +K
Sbjct  493   FK  494


 Score =   115 bits (289),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P GNDP+ LNL +MGKGEAWVNGQSIGRYW+S+ T  G PSQ  Y++PR+FL  +GN
Sbjct  497   FDAPTGNDPVVLNLSTMGKGEAWVNGQSIGRYWLSFLTSKGQPSQRLYHIPRAFLNSSGN  556

Query  1660  LLVLFEEEYGNPYGITLDKVSIT  1728
             LLVL EE  G+P  I+LD VS T
Sbjct  557   LLVLLEESGGDPLHISLDTVSRT  579



>ref|XP_004502986.1| PREDICTED: beta-galactosidase 6-like isoform X1 [Cicer arietinum]
Length=718

 Score =   392 bits (1008),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 197/362 (54%), Positives = 259/362 (72%), Gaps = 7/362 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG    +RSAEDIAFHV LFIAR NGS++NYYMYHGGTNFGRT+++++IT+YYDQAP
Sbjct  259   YQVYGGVPYIRSAEDIAFHVTLFIAR-NGSFVNYYMYHGGTNFGRTSSAYIITAYYDQAP  317

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKW HLKELHAAIK CS  LL      FSL + Q+AYVF  + +G C AFL
Sbjct  318   LDEYGLFRQPKWGHLKELHAAIKSCSTTLLQGVQRNFSLGEMQEAYVFE-EENGECVAFL  376

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND +++  VQF NSS++L PKSISILPDC+ V FNTA V T SN R +     F S +
Sbjct  377   INNDRRNNVTVQFHNSSHELLPKSISILPDCQNVVFNTANVNTTSNIRIITSRQNFSSVD  436

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W+++++++  FDDT++R+++LL+ +NTTKD+SDYLWYTL L+   S  +  + + S  H
Sbjct  437   DWKQYQDVISKFDDTSLRSNSLLEQMNTTKDISDYLWYTLRLENNLSCGEPTLRLHSAAH  496

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V + FVN    G AHG     SFTLE  V+LN+G NNIS+LS  VGLP+SGA+LE +  G
Sbjct  497   VAYAFVNDTYIGGAHGNHDVKSFTLELPVTLNEGKNNISILSVMVGLPDSGAFLERRFAG  556

Query  1055  PRKVTIESS-EGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS----SSQPLIW  1219
                V ++ S + S +L+N +WGYQVGLLGE L++Y E+ S+ ++W +          L W
Sbjct  557   LINVELQCSKQESLNLNNYTWGYQVGLLGEQLEVYKEQTSSDIEWTQLEHIMIDQITLTW  616

Query  1220  YK  1225
             YK
Sbjct  617   YK  618


 Score =   116 bits (291),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P+G+DP+ L+L SMGKGEAWVNGQSIGRYW+ +H   G PSQ+ Y+VPRSFLK 
Sbjct  618   KTTFDTPKGDDPVVLDLSSMGKGEAWVNGQSIGRYWILFHDSKGNPSQSLYHVPRSFLKE  677

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             + N LVL EE  GNP  I+L+ VS+T
Sbjct  678   SENSLVLLEEGGGNPLDISLNTVSVT  703



>ref|XP_003528064.1| PREDICTED: beta-galactosidase 6-like [Glycine max]
Length=717

 Score =   392 bits (1008),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 197/360 (55%), Positives = 253/360 (70%), Gaps = 5/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG    +RSAEDIAFHV LFIAR NGSY+NYYMYHGGTNFGRT ++++IT YYDQAP
Sbjct  260   YQVYGGLPYIRSAEDIAFHVTLFIAR-NGSYVNYYMYHGGTNFGRTGSAYVITGYYDQAP  318

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLK+LH  IK CS  LL      F+L Q  + YVF  +  G C AFL
Sbjct  319   LDEYGLLRQPKWGHLKQLHEVIKSCSTTLLQGVQRNFTLGQLLEVYVFE-EEKGECVAFL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND  + A VQF+NSSY+L PKSISILPDC+ V F+TA V T SN R + P   F S +
Sbjct  378   INNDRDNKATVQFRNSSYELLPKSISILPDCQNVTFSTANVNTTSNRRIISPKQNFSSVD  437

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W++F++++  FD+T++++D+LL+ +NTTKD SDYLWYTL  +   S  K  +SV+S  H
Sbjct  438   DWQQFQDVISNFDNTSLKSDSLLEQMNTTKDKSDYLWYTLRFEYNLSCSKPTLSVQSAAH  497

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H FVN    G  HG     SFTLE  V++N+G NN+S+LS  VGLP+SGA+LE +  G
Sbjct  498   VAHAFVNNTYIGGEHGNHDVKSFTLELPVTVNQGTNNLSILSVMVGLPDSGAFLERRFAG  557

Query  1055  PRKVTIESSEG-SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--SQPLIWYK  1225
                V ++ SE  S +L+N +WGYQVGL+GE LQ+Y E+ ++   W +  +   Q L WYK
Sbjct  558   LISVELQCSEQESLNLTNSTWGYQVGLMGEQLQVYKEQNNSDTGWSQLGNVMEQTLFWYK  617


 Score =   125 bits (313),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG+DP+ L+L SMGKGEAWVNG+SIGRYW+ +H   G PSQ+ Y+VPRSFLK 
Sbjct  617   KTTFDTPEGDDPVVLDLSSMGKGEAWVNGESIGRYWILFHDSKGNPSQSLYHVPRSFLKD  676

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GN+LVL EE  GNP GI+LD VS+T
Sbjct  677   SGNVLVLLEEGGGNPLGISLDTVSVT  702



>ref|XP_010674350.1| PREDICTED: beta-galactosidase 6 isoform X2 [Beta vulgaris subsp. 
vulgaris]
Length=653

 Score =   390 bits (1002),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 194/362 (54%), Positives = 250/362 (69%), Gaps = 7/362 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QV+G    +R A++IAFHV+LFIA  NG Y+NYYMYHGGTNFGRT  S++ TSYYD AP
Sbjct  183   FQVFGGKPYIRHADEIAFHVSLFIANNNGCYVNYYMYHGGTNFGRTGTSYVTTSYYDLAP  242

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELH  IK CS+ LL    S   L + Q AYVF+  S G C AFL
Sbjct  243   LDEYGLIRQPKWGHLKELHMVIKACSKTLLEGKKSIVPLGELQTAYVFQEPSEG-CVAFL  301

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND +HSA ++F+N+SYQLPPKSISILPDC    FNTAK+ T+S  R  +P L   S  
Sbjct  302   INNDTQHSANIEFRNNSYQLPPKSISILPDCLNATFNTAKILTESGERNARPELVLSSAT  361

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WE F EL+  F DT+++AD LL+H+N TKD SDYLWY+L  + +SS  +  + V SL H
Sbjct  362   RWEVFNELIPNFSDTSLKADALLEHMNVTKDESDYLWYSLRFETDSSCSEPVLHVRSLAH  421

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             + + FVNG  AG AHG+    +FTL++ + ++ GMN IS+LS   GLP+SG YLE K  G
Sbjct  422   IAYAFVNGTYAGGAHGSRDVKNFTLDTPIKIDTGMNEISILSVMAGLPDSGPYLERKFAG  481

Query  1055  PRKVTIESSEGSE--DLS-NDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQP--LIW  1219
              R+V++  + G++  DL+ N +WGY+VG LGE+LQIY ++    V W  F  S P    W
Sbjct  482   LREVSVRCN-GNDIYDLTANHTWGYKVGFLGEDLQIYKQENLGKVVWGGFELSAPKAFTW  540

Query  1220  YK  1225
             YK
Sbjct  541   YK  542


 Score =   117 bits (292),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 75/110 (68%), Gaps = 11/110 (10%)
 Frame = +1

Query  1408  LSAPKLYCHFLLIKLKVETT*QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY  1587
             LSAPK +  +           +  FD P G+DP+AL+L +MGKGEAW+NGQSIGRYWVS 
Sbjct  532   LSAPKAFTWY-----------KATFDAPSGDDPVALDLSAMGKGEAWINGQSIGRYWVSL  580

Query  1588  HTVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSITLDK  1737
              T  G PSQT Y++PRSFLK + NLLVLFEE  GNP  I+++ +S T  K
Sbjct  581   LTPQGKPSQTLYHIPRSFLKASENLLVLFEEIGGNPRQISVNTISWTTSK  630



>ref|XP_003630451.1| Beta-galactosidase [Medicago truncatula]
Length=706

 Score =   390 bits (1003),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 203/368 (55%), Positives = 256/368 (70%), Gaps = 19/368 (5%)
 Frame = +2

Query  158   QVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPL  337
             Q +G    MRSA DIA++VALFIA+K GSY+NYYMYHGGTNF R A++F+IT+YYD+APL
Sbjct  260   QAFGGAPYMRSASDIAYNVALFIAKK-GSYVNYYMYHGGTNFDRLASAFIITAYYDEAPL  318

Query  338   DEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLI  517
             DEYGL+R+PKW HLKELHA+IK CSQ LL  T +TFSL   QQ  V + +SS      + 
Sbjct  319   DEYGLVRQPKWGHLKELHASIKSCSQPLLDGTQTTFSLGSEQQ--VIKNESSWTYFPLMF  376

Query  518   NN-----------DGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTM  664
             +             G     +QFQN SY+LP KSISILP CK V FNT KV+ Q+N R M
Sbjct  377   SEVPQNVLLSWKISGPRDVTIQFQNISYELPGKSISILPGCKNVVFNTGKVSIQNNVRAM  436

Query  665   QPALKFDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPK  844
             +P L+F+S E W+ + E +  F  T+ RADTLLD I+T KD SDY+WYT     +S + K
Sbjct  437   KPRLQFNSAENWKVYTEAIPNFAHTSKRADTLLDQISTAKDTSDYMWYTFRFNNKSPNAK  496

Query  845   SAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNS  1024
             S +S+ S G VLH F+NG L GSAHG+  N+  T++  V+L  GMNNIS+LSATVGLPNS
Sbjct  497   SVLSIYSQGDVLHSFINGVLTGSAHGSRNNTQVTMKKNVNLINGMNNISILSATVGLPNS  556

Query  1025  GAYLEHKTLGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SS  1201
             GA+LE +  G RKV ++      D S+ SWGYQVGLLGE LQI+T  GS+ VQW+ F SS
Sbjct  557   GAFLESRVAGLRKVEVQ----GRDFSSYSWGYQVGLLGEKLQIFTVSGSSKVQWKSFQSS  612

Query  1202  SQPLIWYK  1225
             ++PL WY+
Sbjct  613   TKPLTWYQ  620


 Score =   132 bits (333),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             QT F  P GNDP+ +NLGSMGKG AWVNGQ IGRYWVS+H   GTPSQ WY++PRSFLK 
Sbjct  620   QTTFHAPAGNDPVVVNLGSMGKGLAWVNGQGIGRYWVSFHKPDGTPSQQWYHIPRSFLKS  679

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             TGNLLV+ EEE GNP GITLD V I
Sbjct  680   TGNLLVILEEETGNPLGITLDTVYI  704



>ref|XP_010674349.1| PREDICTED: beta-galactosidase 6 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=730

 Score =   390 bits (1002),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 194/362 (54%), Positives = 250/362 (69%), Gaps = 7/362 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QV+G    +R A++IAFHV+LFIA  NG Y+NYYMYHGGTNFGRT  S++ TSYYD AP
Sbjct  260   FQVFGGKPYIRHADEIAFHVSLFIANNNGCYVNYYMYHGGTNFGRTGTSYVTTSYYDLAP  319

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELH  IK CS+ LL    S   L + Q AYVF+  S G C AFL
Sbjct  320   LDEYGLIRQPKWGHLKELHMVIKACSKTLLEGKKSIVPLGELQTAYVFQEPSEG-CVAFL  378

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND +HSA ++F+N+SYQLPPKSISILPDC    FNTAK+ T+S  R  +P L   S  
Sbjct  379   INNDTQHSANIEFRNNSYQLPPKSISILPDCLNATFNTAKILTESGERNARPELVLSSAT  438

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WE F EL+  F DT+++AD LL+H+N TKD SDYLWY+L  + +SS  +  + V SL H
Sbjct  439   RWEVFNELIPNFSDTSLKADALLEHMNVTKDESDYLWYSLRFETDSSCSEPVLHVRSLAH  498

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             + + FVNG  AG AHG+    +FTL++ + ++ GMN IS+LS   GLP+SG YLE K  G
Sbjct  499   IAYAFVNGTYAGGAHGSRDVKNFTLDTPIKIDTGMNEISILSVMAGLPDSGPYLERKFAG  558

Query  1055  PRKVTIESSEGSE--DLS-NDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQP--LIW  1219
              R+V++  + G++  DL+ N +WGY+VG LGE+LQIY ++    V W  F  S P    W
Sbjct  559   LREVSVRCN-GNDIYDLTANHTWGYKVGFLGEDLQIYKQENLGKVVWGGFELSAPKAFTW  617

Query  1220  YK  1225
             YK
Sbjct  618   YK  619


 Score =   117 bits (292),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 75/110 (68%), Gaps = 11/110 (10%)
 Frame = +1

Query  1408  LSAPKLYCHFLLIKLKVETT*QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY  1587
             LSAPK +  +           +  FD P G+DP+AL+L +MGKGEAW+NGQSIGRYWVS 
Sbjct  609   LSAPKAFTWY-----------KATFDAPSGDDPVALDLSAMGKGEAWINGQSIGRYWVSL  657

Query  1588  HTVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSITLDK  1737
              T  G PSQT Y++PRSFLK + NLLVLFEE  GNP  I+++ +S T  K
Sbjct  658   LTPQGKPSQTLYHIPRSFLKASENLLVLFEEIGGNPRQISVNTISWTTSK  707



>ref|XP_011031110.1| PREDICTED: beta-galactosidase 6 isoform X1 [Populus euphratica]
Length=715

 Score =   389 bits (1000),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 199/362 (55%), Positives = 256/362 (71%), Gaps = 7/362 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHV LFIA+K GSYINYYM+HGGTNFGRTA++++ITSYYDQAP
Sbjct  258   YQVYGGEPYIRSAEDIAFHVTLFIAKK-GSYINYYMFHGGTNFGRTASAYVITSYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAIK CS  +L    S FSL Q QQAY+F  + +G CAAFL
Sbjct  317   LDEYGLIRQPKWGHLKELHAAIKSCSTTILEGAQSNFSLGQLQQAYIFEEEGAG-CAAFL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND K++A V+F+N +++L PKSISILPDC+ + FNTAKV  + N  T   +  FD  +
Sbjct  376   VNNDQKNNATVEFRNITFELLPKSISILPDCENIVFNTAKVNAKGNEITRTSSQLFDDAD  435

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WE + +++  F DTN+++DTLL+H+NTTKD SDYLWYT S Q  SS  +  + VESL H
Sbjct  436   RWEAYTDVIPNFADTNLKSDTLLEHMNTTKDKSDYLWYTFSFQPNSSCTEPVLHVESLAH  495

Query  875   VLHIFVNGELAGSAHGT-FRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             V   FVN + AGSAHG+      FT+E+ + LN  MNNIS+LS  VGL +SGA+LE +  
Sbjct  496   VASAFVNNKYAGSAHGSKAAKGPFTMEAPIVLNDQMNNISILSTMVGLQDSGAFLERRYA  555

Query  1052  GPRKVTIESSEGS--EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIW  1219
             G  +V I  ++       +N  WGYQ GL GE+L IY  +    ++W    S+  QPL W
Sbjct  556   GLTRVEIRCAQQEIYNFTNNYEWGYQAGLSGESLSIYMREHLGNIEWSGVVSATDQPLSW  615

Query  1220  YK  1225
             +K
Sbjct  616   FK  617


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P GNDP+ LNL +MGKGEAWVNGQSIGRYW+S+ T  G PSQ  Y++PR+FL  +GN
Sbjct  620   FDAPTGNDPVVLNLSTMGKGEAWVNGQSIGRYWLSFLTSKGQPSQRLYHIPRAFLNSSGN  679

Query  1660  LLVLFEEEYGNPYGITLDKVSIT  1728
             LLVL EE  G+P  I+LD VS T
Sbjct  680   LLVLLEESGGDPLHISLDTVSRT  702



>ref|XP_006390092.1| hypothetical protein EUTSA_v10018129mg [Eutrema salsugineum]
 gb|ESQ27378.1| hypothetical protein EUTSA_v10018129mg [Eutrema salsugineum]
Length=818

 Score =   392 bits (1007),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 200/360 (56%), Positives = 255/360 (71%), Gaps = 8/360 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG + L+RSAEDIAF VALFIA KNGS++NYYMYHGGTNFGR A+ F+ +SYYDQAP
Sbjct  258   YQTYGEEPLIRSAEDIAFQVALFIA-KNGSFVNYYMYHGGTNFGRNASQFVTSSYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELHAAIK+C + LLS   +   + + Q A+VF G ++  CAA L
Sbjct  317   LDEYGLLRQPKWGHLKELHAAIKLCERPLLSGLRTAIPIGKLQTAFVF-GKNADLCAALL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D K+ + VQF +SSY L P SIS+LPDCK VAFNTAKV  Q NTR  +P     S+ 
Sbjct  376   VNQD-KNDSTVQFLDSSYLLSPNSISVLPDCKNVAFNTAKVNAQYNTRRREPRQNLSSSH  434

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAI-SVESLG  871
              WE F E V  + +T+IR+++LL+H+NTT+D SDYLW     QQ  S+P ++I  V  +G
Sbjct  435   MWEVFTETVPSYSETSIRSESLLEHLNTTQDTSDYLWQIFRFQQ--SEPAASILKVNHIG  492

Query  872   HVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             HVLH FVNG L GS HG F+   F LE  VSL  G N+I+LLS  VGLPNSGA+LE +  
Sbjct  493   HVLHAFVNGRLIGSMHGAFKAQKFLLEKNVSLINGTNSIALLSVMVGLPNSGAHLERRVG  552

Query  1052  GPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS--SSQPLIWYK  1225
             G R V I + + +   +  +WGYQVGL GE + +YT+ G+  V+W+++   +SQPL WYK
Sbjct  553   GSRSVKIWNGKYALYFNKYAWGYQVGLHGEQVHVYTDNGAAKVKWKQYRDYNSQPLTWYK  612


 Score =   138 bits (348),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD PEG DP+ALNLGSMGKGEAWVNGQSIGRYWVS+HT  G+PSQ WY++PRSFLKP  N
Sbjct  615   FDTPEGKDPVALNLGSMGKGEAWVNGQSIGRYWVSFHTSKGSPSQIWYHIPRSFLKPKSN  674

Query  1660  LLVLFEEEY-GNPYGITLDKVSIT  1728
              LV+FEEE  GNP GIT+D VS+T
Sbjct  675   SLVIFEEEREGNPLGITIDTVSVT  698



>ref|XP_002307056.1| hypothetical protein POPTR_0005s07020g [Populus trichocarpa]
 gb|EEE94052.1| hypothetical protein POPTR_0005s07020g [Populus trichocarpa]
Length=715

 Score =   387 bits (995),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 198/362 (55%), Positives = 256/362 (71%), Gaps = 7/362 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHV LFIA KNGSYINYYM+HGGTNFGRTA++++ITSYYDQAP
Sbjct  258   YQVYGGEPYIRSAEDIAFHVTLFIA-KNGSYINYYMFHGGTNFGRTASAYVITSYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAIK CS  +L    S FSL Q QQAY+F  + +G CAAFL
Sbjct  317   LDEYGLIRQPKWGHLKELHAAIKSCSSTILEGVQSNFSLGQLQQAYIFEEEGAG-CAAFL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND K++A V+F+N +++L PKSIS+LPDC+ + FNTAKV  + N  T   +  FD  +
Sbjct  376   VNNDQKNNATVEFRNITFELLPKSISVLPDCENIIFNTAKVNAKGNEITRTSSQLFDDAD  435

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WE + +++  F DTN+++DTLL+H+NTTKD SDYLWYT S    SS  +  + VESL H
Sbjct  436   RWEAYTDVIPNFADTNLKSDTLLEHMNTTKDKSDYLWYTFSFLPNSSCTEPILHVESLAH  495

Query  875   VLHIFVNGELAGSAHGTF-RNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             V   FVN + AGSAHG+      FT+E+ + LN  MN IS+LS  VGL +SGA+LE +  
Sbjct  496   VASAFVNNKYAGSAHGSKDAKGPFTMEAPIVLNDQMNTISILSTMVGLQDSGAFLERRYA  555

Query  1052  GPRKVTIESSEGS--EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIW  1219
             G  +V I  ++       +N  WGYQ GL GE+L IY  +  + ++W E  S+  QPL W
Sbjct  556   GLTRVEIRCAQQEIYNFTNNYEWGYQAGLSGESLNIYMREHLDNIEWSEVVSATDQPLSW  615

Query  1220  YK  1225
             +K
Sbjct  616   FK  617


 Score =   117 bits (292),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P GNDP+ LNL +MGKGEAWVNGQSIGRYW+S+ T  G PSQT Y++PR+FL  +GN
Sbjct  620   FDAPTGNDPVVLNLSTMGKGEAWVNGQSIGRYWLSFLTSKGQPSQTLYHIPRAFLNSSGN  679

Query  1660  LLVLFEEEYGNPYGITLDKVSIT  1728
             LLVL EE  G+P  I+LD VS T
Sbjct  680   LLVLLEESGGDPLHISLDTVSRT  702



>emb|CBI21611.3| unnamed protein product [Vitis vinifera]
Length=729

 Score =   387 bits (993),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 200/371 (54%), Positives = 258/371 (70%), Gaps = 20/371 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G +  +RSAEDIAFHVALFIAR NGSY+NYYMYHGGTNFGR +++++ TSYYDQAP
Sbjct  259   YEVFGGETYLRSAEDIAFHVALFIAR-NGSYVNYYMYHGGTNFGRASSAYIKTSYYDQAP  317

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAI +CS  LL+   S  SL Q Q+AYVF+ +  G C AFL
Sbjct  318   LDEYGLIRQPKWGHLKELHAAITLCSTPLLNGVQSNISLGQLQEAYVFQ-EEMGGCVAFL  376

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALK-----  679
             +NND  +++ V FQN S +L PKSISILPDCK V FNTAKV + S     Q A K     
Sbjct  377   VNNDEGNNSTVLFQNVSIELLPKSISILPDCKNVIFNTAKVCSSSR----QSAYKIQELS  432

Query  680   ------FDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP  841
                   FD+ + WEE+++ +  F DT+++++ +L+H+N TKD SDYLWYT   Q  SS  
Sbjct  433   RSCIQSFDAVDRWEEYKDAIPNFLDTSLKSNMILEHMNMTKDESDYLWYTFRFQPNSSCT  492

Query  842   KSAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPN  1021
             +  + +ESL H +H FVN    G+ HG+     FT +S +SLN  MNNIS+LS  VG P+
Sbjct  493   EPLLHIESLAHAVHAFVNNIYVGATHGSHDMKGFTFKSPISLNNEMNNISILSVMVGFPD  552

Query  1022  SGAYLEHKTLGPRKVTIESSE-GSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR--E  1192
             SGAYLE +  G  +V I+ +E G  D +N +WGYQVGL GE L IY E+  + V+WR  E
Sbjct  553   SGAYLESRFAGLTRVEIQCTEKGIYDFANYTWGYQVGLSGEKLHIYKEENLSNVEWRKTE  612

Query  1193  FSSSQPLIWYK  1225
              S++QPL WYK
Sbjct  613   ISTNQPLTWYK  623


 Score =   120 bits (301),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 75/106 (71%), Gaps = 1/106 (1%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             + VF+ P G+DP+ALNL +MGKGEAWVNGQSIGRYWVS+H   G PSQT Y+VPR+FLK 
Sbjct  623   KIVFNTPSGDDPVALNLSTMGKGEAWVNGQSIGRYWVSFHNSKGDPSQTLYHVPRAFLKT  682

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT-LDKDILLRRLA*GKGSVPS  1785
             + NLLVL EE  G+P  I+L+ +S T L   +L   L   K  V S
Sbjct  683   SENLLVLLEEANGDPLHISLETISRTDLPDHVLYHHLPQEKQRVQS  728



>gb|KDO45824.1| hypothetical protein CISIN_1g0419572mg, partial [Citrus sinensis]
Length=600

 Score =   381 bits (979),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 194/362 (54%), Positives = 249/362 (69%), Gaps = 36/362 (10%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG D + R+A+DIAFHVAL++AR NGS++NYYMYHGGTNFGR A++F+  SYYD AP
Sbjct  95    YQAYGEDPIGRTADDIAFHVALWVAR-NGSFVNYYMYHGGTNFGREASAFVTASYYDDAP  153

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQ-ILLSATPSTFSLAQFQQAYVFRGDSSGACA-A  508
             LDEYG++ +PKW HLKELHAAIK+CS  +LL    +   L   Q+AY+F  +SS  CA A
Sbjct  154   LDEYGMINQPKWGHLKELHAAIKLCSNTLLLGKAMTPLQLGPKQEAYLFAENSSEECASA  213

Query  509   FLINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDS  688
             FL+N D K +  V FQNSSY+L   SISILPD +   F                      
Sbjct  214   FLVNKD-KQNVDVVFQNSSYKLLANSISILPDYQWEEFKEP-------------------  253

Query  689   TeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESL  868
                       +  F+DT++++DTLL+H +TTKD SDYLWY+ S Q E SD ++ +SV SL
Sbjct  254   ----------IPNFEDTSLKSDTLLEHTDTTKDTSDYLWYSFSFQPEPSDTRAQLSVHSL  303

Query  869   GHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKT  1048
             GHVLH FVNG   GSAHG+++N+SFTL++  SL+ G+NN+SLLS  VGLP+SGAYLE K 
Sbjct  304   GHVLHAFVNGVPVGSAHGSYKNTSFTLQTDFSLSNGINNVSLLSVMVGLPDSGAYLERKR  363

Query  1049  LGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ---PLIW  1219
              GP  V+I++ EGS + +N  WG +VGLLGENLQIYT++GS  +QW + SSS    PL W
Sbjct  364   YGPVAVSIQNKEGSMNFTNYKWGQKVGLLGENLQIYTDEGSKIIQWSKLSSSDISPPLTW  423

Query  1220  YK  1225
             YK
Sbjct  424   YK  425


 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 62/83 (75%), Gaps = 0/83 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +TVFD    ++ +ALNL  M KGEA VNG+SIGRYW S  T  G PSQ  YN+PRSFLKP
Sbjct  425   KTVFDATGEDEYVALNLNGMRKGEARVNGRSIGRYWPSLITPRGEPSQISYNIPRSFLKP  484

Query  1651  TGNLLVLFEEEYGNPYGITLDKV  1719
             TGNLLVL EEE G+P  ITL+K+
Sbjct  485   TGNLLVLLEEEGGDPLSITLEKL  507



>gb|KDP24928.1| hypothetical protein JCGZ_24426 [Jatropha curcas]
Length=741

 Score =   380 bits (976),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 205/367 (56%), Positives = 262/367 (71%), Gaps = 13/367 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG    +RSA+DIAFHVALFIA KNGSY+NYYMYHGGTNFGR+A++++ T+YYDQAP
Sbjct  275   YQVYGGQVYVRSAQDIAFHVALFIA-KNGSYVNYYMYHGGTNFGRSASAYVTTAYYDQAP  333

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAIK CS  LL    +T SL + QQAYVF     G CAAFL
Sbjct  334   LDEYGLIRQPKWGHLKELHAAIKNCSSALLEGAQTTLSLGELQQAYVFEAQGVG-CAAFL  392

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKT--VAFNTAKVTTQSNTRTMQPALKFDS  688
             +NND  + A VQF+++S++L PKSISILPDC T  VAFNTAKVT +SN R    + K + 
Sbjct  393   VNNDSSN-ATVQFRSNSFELLPKSISILPDCDTQNVAFNTAKVTVESNGRITTSSEKLNG  451

Query  689   TeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESL  868
              + WE++ E++  + DT IR++TLL+H+N TKD SDYLWYTLS Q  SS  +  + VESL
Sbjct  452   VDRWEKYVEVIPNYADTIIRSNTLLEHMNITKDQSDYLWYTLSFQPNSSCTEPLLHVESL  511

Query  869   GHVLHIFVNGELAGSAHGTFRNSS-FTLESTVSLNK-GMNNISLLSATVGLPNSGAYLEH  1042
              HV + FVN + AGS HG+  +   FT++  ++LN  G NNIS+LS  VGLP+SGA+LE 
Sbjct  512   AHVAYAFVNDKYAGSEHGSKTDKGPFTMKLPIALNDSGSNNISILSVMVGLPDSGAFLEK  571

Query  1043  KTLGPRKVTIESSEGSEDLS---NDSWGYQVGLLGENLQIYTEKGSNAVQWREF---SSS  1204
             +  G   V I+ ++  +  +   N  WGYQVGL  ENLQIY E+  + V W +    S++
Sbjct  572   RYAGLTSVEIQCTKEKDFYNFTDNYQWGYQVGLFVENLQIYKEELLDRVNWTKANMSSTT  631

Query  1205  QPLIWYK  1225
             QPL WYK
Sbjct  632   QPLTWYK  638


 Score =   107 bits (267),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 62/82 (76%), Gaps = 1/82 (1%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFL-KPTG  1656
             FD PEGNDP+ LNL  MGKG AW+NGQ+IGRYWVS+ T  G PSQ  Y++PR+FL   +G
Sbjct  641   FDTPEGNDPVILNLSKMGKGMAWINGQNIGRYWVSFLTFKGHPSQASYHIPRAFLNSASG  700

Query  1657  NLLVLFEEEYGNPYGITLDKVS  1722
             NLLV+ EE  G+P  I+LD +S
Sbjct  701   NLLVILEESDGDPLDISLDTIS  722



>ref|XP_010521259.1| PREDICTED: beta-galactosidase 6 [Tarenaya hassleriana]
Length=711

 Score =   376 bits (966),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 192/366 (52%), Positives = 245/366 (67%), Gaps = 9/366 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QV+G +  +RSAEDIAFHVALF+A KNGSYINYYMYHGGTNFGR+A+S+ IT YYDQAP
Sbjct  263   FQVFGGEPYIRSAEDIAFHVALFVA-KNGSYINYYMYHGGTNFGRSASSYFITGYYDQAP  321

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PK+ HLKELHAAIK C + LL    +  SL   QQAYVF GD++  C AFL
Sbjct  322   LDEYGLVRQPKYGHLKELHAAIKSCMKPLLMGKHTLLSLGPLQQAYVF-GDATSGCVAFL  380

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NN+  + A V F+N +Y+L PKSI+IL +C+TV F TAK     NTR      +FD+ E
Sbjct  381   VNNNAANVATVTFRNKAYRLRPKSIAILQNCRTVIFETAKANVPKNTRVTTMVKRFDAAE  440

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W    E V GF DT+ RA++LL+H N TKD +DYLWYT+    +S   K  + +ESLGH
Sbjct  441   TWTTVTETVPGFSDTSFRANSLLEHTNLTKDTTDYLWYTIGFNPKSPCVKPVLHIESLGH  500

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H FVN    GS HG+       ++  + L +G NNIS+LSA VGLP+SGA+LE +T G
Sbjct  501   VVHAFVNNARKGSGHGSRDIKVVKMDVPIQLTRGQNNISILSAMVGLPDSGAFLEKRTFG  560

Query  1055  PRKV-TIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS------SSQPL  1213
              RKV  I S     D S   WGYQVGL+GE + IY       V+  ++S       ++PL
Sbjct  561   LRKVQMICSGVIKYDFSGSKWGYQVGLVGEKVGIYDRTNVMNVKPLKWSPKGVVLKNRPL  620

Query  1214  IWYKEW  1231
              WY+ W
Sbjct  621   TWYQRW  626


 Score =   124 bits (311),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             Q  F+ P+G+DPL LN+G+MGKGE WVNGQSIGRYWVS+ T AG PSQ+ Y++PR FLK 
Sbjct  624   QRWFETPKGDDPLVLNVGTMGKGEVWVNGQSIGRYWVSFLTRAGRPSQSMYHIPRGFLKD  683

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             +GNLLV+FEEE G+P GI+L +VS+
Sbjct  684   SGNLLVVFEEEGGDPLGISLSRVSV  708



>gb|KHN09646.1| Beta-galactosidase 3 [Glycine soja]
Length=1489

 Score =   392 bits (1006),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 197/360 (55%), Positives = 253/360 (70%), Gaps = 5/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG    +RSAEDIAFHV LFIAR NGSY+NYYMYHGGTNFGRT ++++IT YYDQAP
Sbjct  260   YQVYGGLPYIRSAEDIAFHVTLFIAR-NGSYVNYYMYHGGTNFGRTGSAYVITGYYDQAP  318

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLK+LH  IK CS  LL      F+L Q  + YVF  +  G C AFL
Sbjct  319   LDEYGLLRQPKWGHLKQLHEVIKSCSTTLLQGVQRNFTLGQLLEVYVFE-EEKGECVAFL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             INND  + A VQF+NSSY+L PKSISILPDC+ V F+TA V T SN R + P   F S +
Sbjct  378   INNDRDNKATVQFRNSSYELLPKSISILPDCQNVTFSTANVNTTSNRRIISPKQNFSSVD  437

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W++F++++  FD+T++++D+LL+ +NTTKD SDYLWYTL  +   S  K  +SV+S  H
Sbjct  438   DWQQFQDVISNFDNTSLKSDSLLEQMNTTKDKSDYLWYTLRFEYNLSCSKPTLSVQSAAH  497

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V H FVN    G  HG     SFTLE  V++N+G NN+S+LS  VGLP+SGA+LE +  G
Sbjct  498   VAHAFVNNTYIGGEHGNHDVKSFTLELPVTVNQGTNNLSILSVMVGLPDSGAFLERRFAG  557

Query  1055  PRKVTIESSEG-SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--SQPLIWYK  1225
                V ++ SE  S +L+N +WGYQVGL+GE LQ+Y E+ ++   W +  +   Q L WYK
Sbjct  558   LISVELQCSEQESLNLTNSTWGYQVGLMGEQLQVYKEQNNSDTGWSQLGNVMEQTLFWYK  617


 Score =   285 bits (729),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 164/373 (44%), Positives = 220/373 (59%), Gaps = 18/373 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QA  331
             ++ +G     R AED+AF VA F  +K GS  NYYMYHGGTNFGRTA    IT+ YD  A
Sbjct  899   FKTFGGRDPHRPAEDVAFSVARFF-QKGGSVHNYYMYHGGTNFGRTAGGPFITTSYDYDA  957

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             P+DEYGL R PKW HLKELH AIK+C  +LL+      SL    +A V+  DSSGACAAF
Sbjct  958   PVDEYGLPRLPKWGHLKELHRAIKLCEHVLLNGKSVNISLGPSVEADVYT-DSSGACAAF  1016

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             + N D K+   V+F+N+S+ LP  S+SILPDCK V FNTAKVT+Q++   M P     S 
Sbjct  1017  ISNVDDKNDKTVEFRNASFHLPAWSVSILPDCKNVVFNTAKVTSQTSVVAMVPESLQQSD  1076

Query  692   eeweefeeLVVG-----FDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP-----  841
             +    F+  +V      +   +   +  +D INTTKD +DYLW+T S+    ++      
Sbjct  1077  KVVNSFKWDIVKEKPGIWGKADFVKNGFVDLINTTKDTTDYLWHTTSIFVSENEEFLKKG  1136

Query  842   -KSAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLP  1018
              K  + +ES GH LH FVN E  G+  G   ++ FT ++ +SL  G N I+LL  TVGL 
Sbjct  1137  NKPVLLIESTGHALHAFVNQEYEGTGSGNGTHAPFTFKNPISLRAGKNEIALLCLTVGLQ  1196

Query  1019  NSGAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW---  1186
              +G + +    G   V I+  + G+ DLS+ +W Y++G+ GE L++Y   G N V W   
Sbjct  1197  TAGPFYDFVGAGLTSVKIKGLNNGTIDLSSYAWTYKIGVQGEYLRLYQGNGLNNVNWTST  1256

Query  1187  REFSSSQPLIWYK  1225
              E    QPL WYK
Sbjct  1257  SEPPKMQPLTWYK  1269


 Score =   111 bits (278),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 68/93 (73%), Gaps = 5/93 (5%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG+DP+ L+L SMGKGEAWVNG+SIGRYW+ +H   G PSQ+ Y+VPRSFLK 
Sbjct  617   KTTFDTPEGDDPVVLDLSSMGKGEAWVNGESIGRYWILFHDSKGNPSQSLYHVPRSFLKD  676

Query  1651  TGNLLVLFEEEYGNPY-----GITLDKVSITLD  1734
             +GN+LVL EE  GNP       ++ D  S+ +D
Sbjct  677   SGNVLVLLEEGGGNPLVASSANVSYDGRSLIID  709


 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 61/109 (56%), Gaps = 23/109 (21%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYW--------------VSYH------  1590
             + + D P G++P+ L++  MGKG AW+NG+ IGRYW                Y       
Sbjct  1269  KAIVDAPPGDEPVGLDMLHMGKGLAWLNGEEIGRYWPRKSEFKSEDCVKECDYRGKFNPD  1328

Query  1591  ---TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
                T  G P+Q WY+VPRS+ KP+GN+LVLFEE+ G+P  I   +  ++
Sbjct  1329  KCDTGCGEPTQRWYHVPRSWFKPSGNILVLFEEKGGDPEKIKFVRRKVS  1377



>ref|XP_008783343.1| PREDICTED: beta-galactosidase 7-like [Phoenix dactylifera]
Length=751

 Score =   375 bits (963),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 193/361 (53%), Positives = 251/361 (70%), Gaps = 5/361 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y VYG +  MR  ED+AF VALFIARKNGS++NYYMYHGGTNFG++ +S++ TSYYD+AP
Sbjct  204   YPVYGKEPSMRRVEDLAFSVALFIARKNGSFVNYYMYHGGTNFGKSPSSYVTTSYYDRAP  263

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+  P W HL+ELHA IK+ S+ LL  T +  SL Q Q+A+VF+ + SG CAAFL
Sbjct  264   LDEYGLIWLPTWGHLRELHAVIKLSSEPLLWGTYTNVSLGQLQEAHVFQTN-SGKCAAFL  322

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D   +A V F N++Y+LP KSISILPDCK+VAFNTAKV+ Q   R+ +    FD+ +
Sbjct  323   VNFDEHLNATVCFHNATYELPSKSISILPDCKSVAFNTAKVSAQYGNRSARAVQSFDNAK  382

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W  F + V    D +     LL+ ++TTKDV+DYLWYT S   +SSD + A+ V+S  H
Sbjct  383   KWMAFLDGVPNVHDASFITKELLEQMSTTKDVTDYLWYTFSYNYKSSDGQQALHVDSRAH  442

Query  875   VLHIFVNGELAGSAHGTFRNSS-FTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             VLH FVN E  GS HG+       T E  +SL +G NN+SLLS  VGLP+SGAYLE +  
Sbjct  443   VLHAFVNDEFVGSVHGSSDGPRIMTFEKDISLREGQNNLSLLSVMVGLPDSGAYLEKRFA  502

Query  1052  GPRKVTIESS-EGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPLIWY  1222
             G R+V+I  +    ++L+N  WGYQ+GLLGE L+IYT+KG   V W+   SS  +PL WY
Sbjct  503   GLRRVSIHCNGSRPQNLTNWLWGYQIGLLGEKLEIYTQKGLPKVDWKTVGSSICKPLTWY  562

Query  1223  K  1225
             K
Sbjct  563   K  563


 Score =   117 bits (293),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P G +P+AL+L SMGKGE W+NG+SIGRYWVS+ +  G PSQT Y+VPRSFLKP
Sbjct  563   KTTFHVPLGTNPVALDLSSMGKGEVWINGESIGRYWVSFTSPNGQPSQTLYHVPRSFLKP  622

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
              GNLLVLFEE  G+P GIT++ +S+T
Sbjct  623   FGNLLVLFEELGGDPLGITVNTISVT  648



>emb|CDY43756.1| BnaA06g22920D [Brassica napus]
Length=510

 Score =   367 bits (942),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 189/363 (52%), Positives = 250/363 (69%), Gaps = 9/363 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG+   +RSAEDIA+H ALF+A KNGS+INYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  56    FQVYGAPPYIRSAEDIAYHAALFVA-KNGSFINYYMYHGGTNFGRTSSSYFITGYYDQAP  114

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  D+   C AFL
Sbjct  115   LDEYGLLRQPKYGHLKELHAAIKSTANPLLHGKQTILSLGPMQQAYVFE-DARSGCVAFL  173

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NNDG+   ++QF+N++Y L PKSI IL +CKT+ + TAKV    N R   P   F+  +
Sbjct  174   VNNDGRKVIQIQFRNNAYSLRPKSIGILQNCKTLIYETAKVNVPKNMRVTTPVHTFNVPD  233

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F  T++RA+TLL+H   TKD +DYLWYTL  +++S+  K ++ +ES GH
Sbjct  234   KWEVFRETIPTFSGTSLRANTLLEHTKLTKDKTDYLWYTLRFKRDSTCTKPSLFIESSGH  293

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+    +  L+  VSL  G NNIS+LS  VGLP+SGAY+E K+ G
Sbjct  294   VVHVFVNNALAGSGHGSRDIRAVKLQVPVSLINGQNNISILSGMVGLPDSGAYMESKSYG  353

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS----SQPLI  1216
               K  I S +G++  DLS   WGY VGLLGE ++++  +    V+W   ++    + PL 
Sbjct  354   LTKAQI-SCDGTKTIDLSRSQWGYSVGLLGEKVRLHQWRNLKRVKWSNNNAGLIKNHPLA  412

Query  1217  WYK  1225
             WYK
Sbjct  413   WYK  415


 Score =   118 bits (295),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P G+ P+ LN+ SMGKGE WVNG+SIGRYWVS+ T +G PSQ+ Y++PR+FLKP
Sbjct  415   KTMFDAPSGDGPVGLNMESMGKGEMWVNGESIGRYWVSFLTPSGHPSQSIYHIPRAFLKP  474

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             +GNLLV+ EEE G+P GI+L+ +S+
Sbjct  475   SGNLLVVLEEEGGDPLGISLNTISV  499



>gb|KDO57551.1| hypothetical protein CISIN_1g0063012mg, partial [Citrus sinensis]
Length=391

 Score =   361 bits (927),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 188/331 (57%), Positives = 232/331 (70%), Gaps = 10/331 (3%)
 Frame = +2

Query  263   YHGGTNFGRTAASFMITSYYDQAPLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPST  442
             YHGGTNFGRTA++++ITSYYDQAPLDEYGL R+PKW HLKELH AI  CS+ LL   PS 
Sbjct  1     YHGGTNFGRTASAYIITSYYDQAPLDEYGLTRQPKWGHLKELHGAINSCSETLLQGNPSN  60

Query  443   FSLAQFQQAYVFRGDSSGACAAFLINNDGKH-SAKVQFQNSSYQLPPKSISILPDCKTVA  619
             FSL Q Q+AYVF  ++ G C AFLINNDG+  +A VQF+N S+QLPPKSISILPDC  V 
Sbjct  61    FSLGQLQEAYVFEEEAGGGCVAFLINNDGRDDNATVQFRNMSFQLPPKSISILPDCINVI  120

Query  620   FNTAKVTTQSNTRTMQPALKFDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDY  799
             FNTAKV  + N R    +  F+  E W++F++L+  F DT ++ADTLL+H+NTTKD SDY
Sbjct  121   FNTAKVNVEYNERRTNVSEVFNEAERWQQFKDLIPNFLDTPLKADTLLEHMNTTKDKSDY  180

Query  800   LWYTLSLQQESSDPKSAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGM  979
             LWYT S Q  SS  +  + VESL HV H FVN   AG+AHG      FT++  + LN GM
Sbjct  181   LWYTFSFQTNSSCTEPVLHVESLAHVAHAFVNNIYAGAAHGNHDVKKFTMDIPIGLNDGM  240

Query  980   NNISLLSATVGLPNSGAYLEHKTLGPRKVTIESS--EGSEDLSND-SWGYQVGLLGENLQ  1150
             NNIS+LS   GLP+SGA+LE +  G   V I     E S + +N+ +WGY+VGLLGE LQ
Sbjct  241   NNISILSVMAGLPDSGAFLEKRFAGLATVEIHCGDMENSYNFTNNYTWGYEVGLLGEKLQ  300

Query  1151  IY-TEKG-SNAVQW----REFSSSQPLIWYK  1225
             IY TE+   NA +W    ++ SS QPL WYK
Sbjct  301   IYNTEQNLENAPEWTKIDQDLSSKQPLTWYK  331


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWY  1623
             +T FD P G+DP+ALNL SMGKGEAWVNG S+GRYWVS++T  G  SQT Y
Sbjct  331   KTAFDAPVGDDPVALNLSSMGKGEAWVNGLSVGRYWVSFYTSEGNSSQTLY  381



>emb|CDX84445.1| BnaC03g50550D [Brassica napus]
Length=720

 Score =   370 bits (949),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 192/363 (53%), Positives = 248/363 (68%), Gaps = 9/363 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG+   +RSAEDIAFH ALF+A KNGSYINYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  266   FQVYGAPPYIRSAEDIAFHAALFVA-KNGSYINYYMYHGGTNFGRTSSSYFITGYYDQAP  324

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  D+   C AFL
Sbjct  325   LDEYGLLRQPKYGHLKELHAAIKSTANPLLHGKQTILSLGPMQQAYVFE-DARSGCVAFL  383

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NNDG+   ++QF+N++Y L PKSI IL +CKT+ + TAKV    N R   P   F+  +
Sbjct  384   VNNDGRKVIQIQFRNNAYSLRPKSIGILQNCKTLIYETAKVNVPKNMRVTTPVHTFNVPD  443

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F  T++RA+TLL+H   TKD +DYLWYTL  +++S+  K ++ +ES GH
Sbjct  444   KWEVFRETIPTFLGTSLRANTLLEHTKLTKDKTDYLWYTLRFKRDSTCTKPSLFIESSGH  503

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+    +  L+  VSL  G NNIS+LS  VGLP+SGAY+E K+ G
Sbjct  504   VVHVFVNNALAGSGHGSRDIRAVKLQVPVSLINGQNNISILSGMVGLPDSGAYMESKSYG  563

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE----FSSSQPLI  1216
               K  I S +G++  DLS   WGY VGLLGE ++I+  +    V+W         + PL 
Sbjct  564   LTKAQI-SCDGTKSIDLSRSQWGYSVGLLGEKVRIHQWRNLKRVKWSNNNAGLIKNHPLA  622

Query  1217  WYK  1225
             WYK
Sbjct  623   WYK  625


 Score =   118 bits (295),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P G+ P+ LN+ SMGKGE WVNG+SIGRYWVS+ T +G PSQ+ Y++PR+FLKP
Sbjct  625   KTMFDAPSGDGPVGLNMESMGKGEMWVNGESIGRYWVSFLTPSGHPSQSIYHIPRAFLKP  684

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLLV+ EEE G+P GI+L+ +S+ 
Sbjct  685   SGNLLVVLEEEGGDPLGISLNTISVV  710



>gb|KDO57552.1| hypothetical protein CISIN_1g0063012mg, partial [Citrus sinensis]
Length=392

 Score =   357 bits (915),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 188/332 (57%), Positives = 232/332 (70%), Gaps = 11/332 (3%)
 Frame = +2

Query  263   YHGGTNFGRTAASFMITSYYDQAPLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPST  442
             YHGGTNFGRTA++++ITSYYDQAPLDEYGL R+PKW HLKELH AI  CS+ LL   PS 
Sbjct  1     YHGGTNFGRTASAYIITSYYDQAPLDEYGLTRQPKWGHLKELHGAINSCSETLLQGNPSN  60

Query  443   FSLAQFQQAYVFRGDSSGACAAFLINNDGK-HSAKVQFQNSSYQLPPKSISILPDCKTVA  619
             FSL Q Q+AYVF  ++ G C AFLINNDG+  +A VQF+N S+QLPPKSISILPDC  V 
Sbjct  61    FSLGQLQEAYVFEEEAGGGCVAFLINNDGRDDNATVQFRNMSFQLPPKSISILPDCINVI  120

Query  620   FNTAKVTTQSNTRTMQPALKFDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDY  799
             FNTAKV  + N R    +  F+  E W++F++L+  F DT ++ADTLL+H+NTTKD SDY
Sbjct  121   FNTAKVNVEYNERRTNVSEVFNEAERWQQFKDLIPNFLDTPLKADTLLEHMNTTKDKSDY  180

Query  800   LWYTL-SLQQESSDPKSAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKG  976
             LWYT  S Q  SS  +  + VESL HV H FVN   AG+AHG      FT++  + LN G
Sbjct  181   LWYTFSSFQTNSSCTEPVLHVESLAHVAHAFVNNIYAGAAHGNHDVKKFTMDIPIGLNDG  240

Query  977   MNNISLLSATVGLPNSGAYLEHKTLGPRKVTIESS--EGSEDLSND-SWGYQVGLLGENL  1147
             MNNIS+LS   GLP+SGA+LE +  G   V I     E S + +N+ +WGY+VGLLGE L
Sbjct  241   MNNISILSVMAGLPDSGAFLEKRFAGLATVEIHCGDMENSYNFTNNYTWGYEVGLLGEKL  300

Query  1148  QIY-TEKG-SNAVQW----REFSSSQPLIWYK  1225
             QIY TE+   NA +W    ++ SS QPL WYK
Sbjct  301   QIYNTEQNLENAPEWTKIDQDLSSKQPLTWYK  332


 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWY  1623
             +T FD P G+DP+ALNL SMGKGEAWVNG S+GRYWVS++T  G  SQT Y
Sbjct  332   KTAFDAPVGDDPVALNLSSMGKGEAWVNGLSVGRYWVSFYTSEGNSSQTLY  382



>ref|XP_006282368.1| hypothetical protein CARUB_v10028665mg [Capsella rubella]
 gb|EOA15266.1| hypothetical protein CARUB_v10028665mg [Capsella rubella]
Length=719

 Score =   365 bits (938),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 193/363 (53%), Positives = 244/363 (67%), Gaps = 9/363 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG +  +RSAEDIAFH ALFIA KNGSYINYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  265   FQVYGGEPYIRSAEDIAFHAALFIA-KNGSYINYYMYHGGTNFGRTSSSYFITGYYDQAP  323

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  D+S  C AFL
Sbjct  324   LDEYGLLRQPKYGHLKELHAAIKASANPLLQGKQTILSLGPLQQAYVFE-DASSGCVAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND     ++QF+N++Y L PKSI IL +CK + + TAKV    NTR   P   F+  +
Sbjct  383   VNNDAAKVIQIQFRNNAYSLSPKSIGILQNCKNLIYQTAKVNVAKNTRVTTPVQVFNVPD  442

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F  T+++ ++LL+H N TKD +DYLWYT S + +S     +I +ES GH
Sbjct  443   KWEVFRETIPAFSGTSLKTNSLLEHTNLTKDKTDYLWYTSSFKPDSPCTNPSIYIESSGH  502

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVNG LAGS HG+       L+  VSL  G N+IS+LS  VGLP+SGAY+E K+ G
Sbjct  503   VVHVFVNGALAGSGHGSRDIRVVKLQVPVSLINGQNSISILSGMVGLPDSGAYMERKSYG  562

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE----FSSSQPLI  1216
               KV I S  GS+  DLS   WGY VGLLGE +++   K    V+W        ++ PL 
Sbjct  563   LTKVQI-SCGGSKTIDLSGSQWGYSVGLLGEKVRLQQWKNLKRVKWSTNDAGLINNHPLA  621

Query  1217  WYK  1225
             WYK
Sbjct  622   WYK  624


 Score =   114 bits (284),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P G+ P+ LN+ SMGKGE WVNG SIGRYWVS+ T +G PSQ+ Y++PR+FLK 
Sbjct  624   KTMFDGPNGDSPVGLNMSSMGKGEIWVNGVSIGRYWVSFLTPSGHPSQSIYHIPRAFLKA  683

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             +GNLLV+ EEE G+P GI+L+ +S+
Sbjct  684   SGNLLVVLEEEGGDPLGISLNTISV  708



>dbj|BAF01618.1| beta-galactosidase like protein [Arabidopsis thaliana]
Length=718

 Score =   365 bits (936),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 192/363 (53%), Positives = 245/363 (67%), Gaps = 10/363 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG +  +RSAEDIAFH ALF+A KNGSYINYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  265   FQVYGKEPYIRSAEDIAFHAALFVA-KNGSYINYYMYHGGTNFGRTSSSYFITGYYDQAP  323

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  D++  C AFL
Sbjct  324   LDEYGLLRQPKYGHLKELHAAIKSSANPLLQGKQTILSLGPMQQAYVFE-DANNGCVAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND K S ++QF+N++Y L PKSI IL +CK + + TAKV  + NTR   P   F+  +
Sbjct  383   VNNDAKAS-QIQFRNNAYSLSPKSIGILQNCKNLIYETAKVNVKMNTRVTTPVQVFNVPD  441

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W  F E +  F  T+++ + LL+H N TKD +DYLWYT S + +S     +I  ES GH
Sbjct  442   NWNLFRETIPAFPGTSLKTNALLEHTNLTKDKTDYLWYTSSFKLDSPCTNPSIYTESSGH  501

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+       L++ VSL  G NNIS+LS  VGLP+SGAY+E ++ G
Sbjct  502   VVHVFVNNALAGSGHGSRDIRVVKLQAPVSLINGQNNISILSGMVGLPDSGAYMERRSYG  561

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR----EFSSSQPLI  1216
               KV I S  G++  DLS   WGY VGLLGE +++Y  K  N V+W         ++PL 
Sbjct  562   LTKVQI-SCGGTKPIDLSRSQWGYSVGLLGEKVRLYQWKNLNRVKWSMNKAGLIKNRPLA  620

Query  1217  WYK  1225
             WYK
Sbjct  621   WYK  623


 Score =   120 bits (301),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G+ P+ L++ SMGKGE WVNG+SIGRYWVS+ T AG PSQ+ Y++PR+FLKP
Sbjct  623   KTTFDGPNGDGPVGLHMSSMGKGEIWVNGESIGRYWVSFLTPAGQPSQSIYHIPRAFLKP  682

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLLV+FEEE G+P GI+L+ +S+ 
Sbjct  683   SGNLLVVFEEEGGDPLGISLNTISVV  708



>ref|NP_568978.2| beta-galactosidase 6 [Arabidopsis thaliana]
 sp|Q9FFN4.1|BGAL6_ARATH RecName: Full=Beta-galactosidase 6; Short=Lactase 6; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB10473.1| beta-galactosidase [Arabidopsis thaliana]
 gb|AED97799.1| beta-galactosidase 6 [Arabidopsis thaliana]
Length=718

 Score =   364 bits (935),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 192/363 (53%), Positives = 245/363 (67%), Gaps = 10/363 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG +  +RSAEDIAFH ALF+A KNGSYINYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  265   FQVYGKEPYIRSAEDIAFHAALFVA-KNGSYINYYMYHGGTNFGRTSSSYFITGYYDQAP  323

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  D++  C AFL
Sbjct  324   LDEYGLLRQPKYGHLKELHAAIKSSANPLLQGKQTILSLGPMQQAYVFE-DANNGCVAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND K S ++QF+N++Y L PKSI IL +CK + + TAKV  + NTR   P   F+  +
Sbjct  383   VNNDAKAS-QIQFRNNAYSLSPKSIGILQNCKNLIYETAKVNVKMNTRVTTPVQVFNVPD  441

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W  F E +  F  T+++ + LL+H N TKD +DYLWYT S + +S     +I  ES GH
Sbjct  442   NWNLFRETIPAFPGTSLKTNALLEHTNLTKDKTDYLWYTSSFKLDSPCTNPSIYTESSGH  501

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+       L++ VSL  G NNIS+LS  VGLP+SGAY+E ++ G
Sbjct  502   VVHVFVNNALAGSGHGSRDIRVVKLQAPVSLINGQNNISILSGMVGLPDSGAYMERRSYG  561

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR----EFSSSQPLI  1216
               KV I S  G++  DLS   WGY VGLLGE +++Y  K  N V+W         ++PL 
Sbjct  562   LTKVQI-SCGGTKPIDLSRSQWGYSVGLLGEKVRLYQWKNLNRVKWSMNKAGLIKNRPLA  620

Query  1217  WYK  1225
             WYK
Sbjct  621   WYK  623


 Score =   120 bits (301),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G+ P+ L++ SMGKGE WVNG+SIGRYWVS+ T AG PSQ+ Y++PR+FLKP
Sbjct  623   KTTFDGPNGDGPVGLHMSSMGKGEIWVNGESIGRYWVSFLTPAGQPSQSIYHIPRAFLKP  682

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLLV+FEEE G+P GI+L+ +S+ 
Sbjct  683   SGNLLVVFEEEGGDPLGISLNTISVV  708



>ref|XP_009150443.1| PREDICTED: beta-galactosidase 6 [Brassica rapa]
Length=749

 Score =   365 bits (937),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 188/363 (52%), Positives = 247/363 (68%), Gaps = 9/363 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG+   +RSAEDIA+H ALF+A KNGS+INYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  295   FQVYGAPPYIRSAEDIAYHAALFVA-KNGSFINYYMYHGGTNFGRTSSSYFITGYYDQAP  353

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  D+   C AFL
Sbjct  354   LDEYGLLRQPKYGHLKELHAAIKSTANPLLHGKQTILSLGPMQQAYVFE-DARSGCVAFL  412

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NNDG+   ++QF+N++Y L PKSI IL +CKT+ + TAKV    N R   P   F+  +
Sbjct  413   VNNDGRKVIQIQFRNNAYSLRPKSIGILQNCKTLIYETAKVNVPKNMRVTTPVHTFNVPD  472

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F  T++RA+TLL+H   TKD +DYLWYTL  +++S+  K ++ +ES GH
Sbjct  473   KWEVFRETIPTFSGTSLRANTLLEHTKLTKDKTDYLWYTLRFKRDSTCMKPSLFIESSGH  532

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+    +  L+  V L  G NNIS+LS  VGLP+SGAY+E K+ G
Sbjct  533   VVHVFVNNALAGSGHGSRDIRAVKLQVPVGLINGQNNISILSGMVGLPDSGAYMESKSYG  592

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE----FSSSQPLI  1216
               K  I S +G++  DLS   WGY VGLLGE ++++  +    V+W         + PL 
Sbjct  593   LTKAQI-SCDGTKTIDLSRSQWGYSVGLLGEKVRLHQWRNLKRVKWSNNNAGLIKNHPLA  651

Query  1217  WYK  1225
             WYK
Sbjct  652   WYK  654


 Score =   116 bits (291),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P G+ P+ LN+ SMGKGE WVNG+SIGRYWVS+ T +G PSQ+ Y++PR+FLKP
Sbjct  654   KTMFDAPSGDGPVGLNMESMGKGEMWVNGESIGRYWVSFLTPSGHPSQSIYHIPRAFLKP  713

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GN LV+ EEE G+P GI+L+ +S+ 
Sbjct  714   SGNFLVVLEEEGGDPLGISLNTISVV  739



>ref|XP_002864867.1| beta-galactosidase 6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41126.1| beta-galactosidase 6 [Arabidopsis lyrata subsp. lyrata]
Length=716

 Score =   363 bits (932),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 194/363 (53%), Positives = 245/363 (67%), Gaps = 10/363 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG++  +RSAEDIAFH  LFIA KNGSYINYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  263   FQVYGTEPYIRSAEDIAFHAVLFIA-KNGSYINYYMYHGGTNFGRTSSSYFITGYYDQAP  321

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  D+S  C AFL
Sbjct  322   LDEYGLLRQPKYGHLKELHAAIKSSANPLLQGKQTILSLGPMQQAYVFE-DASSGCVAFL  380

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND K S ++QF+ SSY L PKSI IL +CK + + TAKV  + N R   P   F+  E
Sbjct  381   VNNDAKVS-QIQFRKSSYSLSPKSIGILQNCKNLIYETAKVNVEKNKRVTTPVQVFNVPE  439

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F  T+++A+ LL+H N TKD +DYLWYT S + +S     +I +ES GH
Sbjct  440   KWEGFRETIPAFSGTSLKANALLEHTNLTKDKTDYLWYTSSFKPDSPCTNPSIYIESSGH  499

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+       L+   SL  G N+IS+LS  VGLP+SGAY+E K+ G
Sbjct  500   VVHVFVNNALAGSGHGSRDIKVVKLQVPASLTNGQNSISILSGMVGLPDSGAYMERKSYG  559

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR----EFSSSQPLI  1216
               KV I S  G++  DLS   WGY VGLLGE +++   +  N V+W         ++PLI
Sbjct  560   LTKVQI-SCGGTKPIDLSGSQWGYSVGLLGEKVRLQQWRNLNRVKWSMNNAGLIKNRPLI  618

Query  1217  WYK  1225
             WYK
Sbjct  619   WYK  621


 Score =   120 bits (300),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P G+ P+ LN+ SMGKGE WVNG+SIGRYWVS+ T +G PSQ+ Y++PR FLKP
Sbjct  621   KTIFDGPNGDGPVGLNMSSMGKGEIWVNGESIGRYWVSFLTPSGHPSQSIYHIPREFLKP  680

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             +GNLLV+FEEE G+P GI+L+ +S+
Sbjct  681   SGNLLVVFEEEGGDPLGISLNTISV  705



>ref|XP_010444300.1| PREDICTED: beta-galactosidase 6 [Camelina sativa]
Length=743

 Score =   362 bits (930),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 189/363 (52%), Positives = 243/363 (67%), Gaps = 9/363 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG++  +RSAEDIAFH ALFIA KNGSY+NYYMYHGGTNFGRT++S+ +T YYDQAP
Sbjct  289   FQVYGAEPYIRSAEDIAFHAALFIA-KNGSYVNYYMYHGGTNFGRTSSSYFVTGYYDQAP  347

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  D+   C AFL
Sbjct  348   LDEYGLLRQPKYGHLKELHAAIKASANPLLQGKQTILSLGPLQQAYVFE-DARSGCVAFL  406

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND    ++VQF+N++Y L PKSI IL +CK + + TAKV    N R   P   F+  +
Sbjct  407   VNNDAAKVSQVQFRNNAYSLSPKSIGILQNCKNLIYQTAKVNVPKNVRFTTPVQLFNVPD  466

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F  T ++ + LL+H N TKD +DYLWYT S + +S     +I +ES GH
Sbjct  467   KWEVFRETIPAFPGTALKTNALLEHTNLTKDKTDYLWYTTSFKPDSPCTNPSIYIESSGH  526

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+       ++  VSL  G N+IS+LS  VGLP+SGAY+E K+ G
Sbjct  527   VVHVFVNSALAGSGHGSRDIRVVKVQVPVSLTNGQNSISILSGMVGLPDSGAYMERKSYG  586

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR----EFSSSQPLI  1216
               KV I S  G++  DLS   WGY VGLLGE +++Y  K  N V+W        ++ PL 
Sbjct  587   LTKVQI-SCGGTKTIDLSRSQWGYSVGLLGEKVRLYQWKNLNRVKWSMNNAGLINNHPLA  645

Query  1217  WYK  1225
             WYK
Sbjct  646   WYK  648


 Score =   118 bits (295),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P G+ P+ LN+ SMGKGE WVNG SIGRYWVS+ T AG PSQ+ Y++PR FLKP
Sbjct  648   KTMFDGPSGDGPVGLNMSSMGKGEMWVNGVSIGRYWVSFLTPAGRPSQSIYHIPREFLKP  707

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLL++ EEE G+P GI+L+ +S+T
Sbjct  708   SGNLLMVLEEEGGDPLGISLNTISVT  733



>gb|KHN35500.1| Beta-galactosidase 16 [Glycine soja]
Length=563

 Score =   356 bits (913),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 196/359 (55%), Positives = 251/359 (70%), Gaps = 25/359 (7%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQV+G    +RSAEDIA++VALFIA++ GSY+NYYMYHGGTNF R A++F++T+YYD+AP
Sbjct  141   YQVFGEVPYIRSAEDIAYNVALFIAKR-GSYVNYYMYHGGTNFDRIASAFVVTAYYDEAP  199

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYG+      S L+         S+I+     S   +  + +AYVFR  SS  CAAFL
Sbjct  200   LDEYGMFL----SFLR--------VSKIV---EISNHYVIDYAKAYVFR-RSSIECAAFL  243

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N + + S  +QFQN  YQLPP SISILPDCK VAFNTAKV  Q N R M+  L+F+S E
Sbjct  244   ENTEDR-SVTIQFQNIPYQLPPNSISILPDCKNVAFNTAKVRAQ-NARAMKSQLQFNSAE  301

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W+ + E +  F DT++RA+TLLD I+T KD SDYLWYT  L   S++ +S +S  S GH
Sbjct  302   KWKVYREAIPSFADTSLRANTLLDQISTAKDTSDYLWYTFRLYDNSANAQSILSAYSHGH  361

Query  875   VLHIFVNGELAGSA-HGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTL  1051
             VLH FVNG L GS+ HG+ +N SF +E+ ++L  GMNNIS LSATVGLPNSGAYLE +  
Sbjct  362   VLHAFVNGNLVGSSKHGSHKNVSFVMENKLNLISGMNNISFLSATVGLPNSGAYLEGRVA  421

Query  1052  GPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
             G R + ++      D +N +WGYQVGLLGE LQIYT  GS+ V+W  F SS++PL WYK
Sbjct  422   GLRSLKVQ----GRDFTNQAWGYQVGLLGEKLQIYTASGSSKVKWESFLSSTKPLTWYK  476


 Score =   138 bits (348),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +1

Query  1396  VLTALSAPKLYCHFLLIKLKVETT*QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRY  1575
             + TA  + K+     L   K  T  +T FD P GNDP+ LNLGSMGKG  WVNGQ IGRY
Sbjct  451   IYTASGSSKVKWESFLSSTKPLTWYKTTFDAPVGNDPVVLNLGSMGKGYTWVNGQGIGRY  510

Query  1576  WVSYHTVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
             WVS+HT  GTPSQ WY++PRS LK TGNLLVL EEE GNP GITLD V IT
Sbjct  511   WVSFHTPQGTPSQKWYHIPRSLLKSTGNLLVLLEEETGNPLGITLDTVYIT  561



>ref|XP_009130274.1| PREDICTED: beta-galactosidase 6 [Brassica rapa]
Length=720

 Score =   360 bits (925),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 190/370 (51%), Positives = 242/370 (65%), Gaps = 23/370 (6%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG +  +RSAEDIAFH ALFIA KNGSYINYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  266   YQFYGGEPYIRSAEDIAFHAALFIA-KNGSYINYYMYHGGTNFGRTSSSYFITGYYDQAP  324

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  ++SG C AFL
Sbjct  325   LDEYGLLRQPKYGHLKELHAAIKSSANPLLHGKQTVLSLGPMQQAYVFEDENSG-CVAFL  383

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND + + ++QF+N++Y L PKSI IL DCKT+ + TAKV    N R   P   F+  +
Sbjct  384   VNNDARKAIQMQFRNNAYSLLPKSIGILQDCKTLIYETAKVNVAKNMRVTTPVQVFNVPD  443

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F DT ++ ++LL+H N TKD +DYLWYTL  +  S     ++ +ESLGH
Sbjct  444   KWEVFRESIPAFSDTPLKTNSLLEHTNLTKDKTDYLWYTLRFESSSPCANPSLYIESLGH  503

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+   +   L+  VSL  G NNIS+LS  VGLP+SGAY+E K+ G
Sbjct  504   VVHVFVNNALAGSGHGSRNITVVKLQVPVSLINGQNNISILSGMVGLPDSGAYMERKSYG  563

Query  1055  PRKVTIESSEGSE-DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ--------  1207
               K  I   E +  DLS   WG+ VGLLG+ ++++        QW    S +        
Sbjct  564   LTKAQISCGETNAIDLSGSQWGHLVGLLGDKVRLH--------QWANLKSVKRSTNDAGL  615

Query  1208  ----PLIWYK  1225
                 PL WYK
Sbjct  616   IKNCPLAWYK  625


 Score =   125 bits (314),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FDEP G+ P+ LN+GSMGKGE WVNGQ IGRYWVS+ T +G PSQ+ Y++PR+FLKP
Sbjct  625   KTMFDEPSGDGPVGLNMGSMGKGEVWVNGQRIGRYWVSFLTPSGHPSQSIYHIPRAFLKP  684

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             +GNLLV+FEEE G+P GI+L+ +S+
Sbjct  685   SGNLLVVFEEEGGDPLGISLNTISV  709



>ref|XP_010095419.1| Beta-galactosidase 16 [Morus notabilis]
 gb|EXB60111.1| Beta-galactosidase 16 [Morus notabilis]
Length=783

 Score =   362 bits (930),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 197/360 (55%), Positives = 235/360 (65%), Gaps = 48/360 (13%)
 Frame = +2

Query  158   QVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPL  337
             + YG +  +RS E+IAFHVALFIA+K GSY+NYYMYHGGTNFGR+A++F+ TSYYDQAPL
Sbjct  263   ETYGEEPYIRSPEEIAFHVALFIAKK-GSYVNYYMYHGGTNFGRSASAFVKTSYYDQAPL  321

Query  338   DEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLI  517
             DEYGL R+PKW HLKELHAA+K+CS+ L S   +T  L Q QQAYV+    SG CAAFL+
Sbjct  322   DEYGLTRQPKWGHLKELHAAMKLCSKPLTSGQQTTLPLGQLQQAYVYGDYKSGDCAAFLV  381

Query  518   NNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTee  697
             NN G   A+V F N  YQLP KSISILPDCK VAFNTAKV+TQ +TRTM P  KF S E 
Sbjct  382   NN-GSKDAEVLFYNVLYQLPRKSISILPDCKAVAFNTAKVSTQYDTRTMVPCEKFGSKER  440

Query  698   weefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGHV  877
             WE+F E +  FD T++RA  LL+ +NTTKD SDYLWYTL  Q +S + ++ ++V+S GHV
Sbjct  441   WEDFREAMPDFDKTSLRATVLLEQMNTTKDESDYLWYTLRFQHDSPNAQATLNVQSCGHV  500

Query  878   LHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLGP  1057
             L  FVNG                                        NSGAYLE K  G 
Sbjct  501   LRAFVNGHF--------------------------------------NSGAYLERKVAGL  522

Query  1058  RKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS----QPLIWYK  1225
             R V IE     +D S   WGYQVGL GE LQIY++ GS  V+W +F SS    QPL WYK
Sbjct  523   RSVRIE----GKDFSRYLWGYQVGLSGEQLQIYSDLGSRKVEWNKFGSSDNQPQPLTWYK  578


 Score =   143 bits (361),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P G++PLALNLGSMGKG+AW+NGQ+IGRYWVS+HT  G PSQTWYNVPRSFLKP+GN
Sbjct  581   FDAPAGSEPLALNLGSMGKGQAWINGQNIGRYWVSFHTYKGQPSQTWYNVPRSFLKPSGN  640

Query  1660  LLVLFEEEYGNPYGITLDKVSIT  1728
             LL+L EEE GNP GI+LD+VS T
Sbjct  641   LLILLEEENGNPLGISLDRVSTT  663



>emb|CDY31349.1| BnaA02g33920D [Brassica napus]
Length=741

 Score =   361 bits (926),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 190/370 (51%), Positives = 243/370 (66%), Gaps = 23/370 (6%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG +  +RSAEDIAFH ALFIA KNGSYINYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  287   YQFYGGEPYIRSAEDIAFHAALFIA-KNGSYINYYMYHGGTNFGRTSSSYFITGYYDQAP  345

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL+   +  SL   QQAYVF  ++SG C AFL
Sbjct  346   LDEYGLLRQPKYGHLKELHAAIKSSANPLLNGKQTVLSLGPMQQAYVFEDENSG-CVAFL  404

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND + + ++QF+N++Y L PKSI IL DCKT+ + TAKV    N R   P   F+  +
Sbjct  405   VNNDARKAIQMQFRNNAYSLLPKSIGILQDCKTLIYETAKVNVAKNMRVTTPVQVFNVPD  464

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F DT ++ + LL+H N TKD +DYLWYTL  +  S     ++ +ESLGH
Sbjct  465   KWEVFRESIPTFSDTPLKTNALLEHTNLTKDRTDYLWYTLRFESSSPCANPSLYIESLGH  524

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+   ++  L+  VSL  G NNIS+LS  VGLP+SGAY+E K+ G
Sbjct  525   VVHVFVNNALAGSGHGSRNITAVKLQVPVSLINGQNNISILSGMVGLPDSGAYMERKSYG  584

Query  1055  PRKVTIESSEGSE-DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ--------  1207
               K  I   E +  DLS   WG+ VGLLG+ ++++        QW    S +        
Sbjct  585   LTKAQISCGETNAIDLSGSQWGHLVGLLGDKVRLH--------QWANLKSVKRSTNDAGL  636

Query  1208  ----PLIWYK  1225
                 PL WYK
Sbjct  637   IKNCPLAWYK  646


 Score =   127 bits (318),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FDEP G+ P+ LN+GSMGKGE WVNGQSIGRYWVS+ T +G PSQ+ Y++PR+FLKP
Sbjct  646   KTMFDEPSGDGPVGLNMGSMGKGEVWVNGQSIGRYWVSFLTPSGHPSQSIYHIPRAFLKP  705

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             +GNLLV+FEEE G+P GI+L+ +S+
Sbjct  706   SGNLLVVFEEEGGDPLGISLNTISV  730



>ref|XP_010484136.1| PREDICTED: beta-galactosidase 6-like isoform X1 [Camelina sativa]
Length=699

 Score =   360 bits (923),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 188/363 (52%), Positives = 243/363 (67%), Gaps = 9/363 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG++  +RSAEDIAFH ALFIA KNGSY+NYYMYHGGTNFGRT++S+ +T YYDQAP
Sbjct  288   FQVYGAEPYIRSAEDIAFHAALFIA-KNGSYVNYYMYHGGTNFGRTSSSYFVTGYYDQAP  346

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  D+   C AFL
Sbjct  347   LDEYGLLRQPKYGHLKELHAAIKASANPLLQGKQTILSLGPLQQAYVFE-DARSGCVAFL  405

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND    ++VQF+N++Y L PKSI IL +CK + + TAKV    N R   P   F+  +
Sbjct  406   VNNDAAKVSQVQFRNNAYSLSPKSIGILQNCKNLIYQTAKVNVPKNVRFTTPVQVFNVPD  465

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F  T ++ + LL+H N TKD +DYLWYT S + +S     +I +ES GH
Sbjct  466   KWEVFRETIPAFTGTALKTNALLEHTNLTKDKTDYLWYTSSFKPDSPCSNPSIYIESSGH  525

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H++VN  LAGS HG+       L+  VSL  G N+IS+LS  VGLP+SGAY+E K+ G
Sbjct  526   VVHVYVNSALAGSGHGSRDIRVVKLQVPVSLTNGQNSISILSGMVGLPDSGAYMERKSYG  585

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR----EFSSSQPLI  1216
               KV I S  G++  DLS   WGY VGLLGE ++++  K  N V+W        ++ PL 
Sbjct  586   LTKVQI-SCGGTKTIDLSRSQWGYSVGLLGEKVRLHQWKNLNRVKWSMSNAGLINNHPLA  644

Query  1217  WYK  1225
             WYK
Sbjct  645   WYK  647


 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQT  1617
             +T+FD P G+ P+ LN+ SMGKGE WVNG SIGRYWVS+ T AG PSQ+
Sbjct  647   KTMFDGPSGDGPVGLNMSSMGKGEIWVNGVSIGRYWVSFLTPAGRPSQS  695



>ref|XP_010461014.1| PREDICTED: beta-galactosidase 6-like [Camelina sativa]
 ref|XP_010461022.1| PREDICTED: beta-galactosidase 6-like [Camelina sativa]
Length=745

 Score =   360 bits (925),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 188/363 (52%), Positives = 242/363 (67%), Gaps = 9/363 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG++  +RSAEDIAFH ALFIA KNGSY+NYYMYHGGTNFGRT++S+ +T YYDQAP
Sbjct  291   FQVYGAEPYIRSAEDIAFHAALFIA-KNGSYVNYYMYHGGTNFGRTSSSYFVTGYYDQAP  349

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  D+   C AFL
Sbjct  350   LDEYGLLRQPKYGHLKELHAAIKASANPLLQGKQTMLSLGPLQQAYVFE-DARSGCVAFL  408

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND    ++VQF+N++Y L PKSI IL +CK + + TAKV    N R   P   F+  +
Sbjct  409   VNNDAAKVSQVQFRNNAYSLSPKSIGILQNCKNLVYQTAKVNVPKNVRFATPVQVFNVPD  468

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F  T ++ + LL+H N TKD +DYLWYT S + +S     +I +ES GH
Sbjct  469   KWEVFRETIPAFSGTALKTNALLEHTNLTKDKTDYLWYTTSFKPDSPCTNPSIYIESSGH  528

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+        +  VSL  G N+IS+LS  VGLP+SGAY+E K+ G
Sbjct  529   VVHVFVNSALAGSGHGSRDIRVVKRQVQVSLTNGQNSISILSGMVGLPDSGAYMERKSYG  588

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE----FSSSQPLI  1216
               KV I S  G++  DLS   WGY VGLLGE ++++  K  N V+W        ++ PL 
Sbjct  589   LTKVQI-SCGGTKTIDLSRSQWGYSVGLLGEKVRLHQWKNLNRVKWSMNNAGLINNHPLA  647

Query  1217  WYK  1225
             WYK
Sbjct  648   WYK  650


 Score =   124 bits (312),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FDEP G++P+ LN+ SMGKGE WVNG SIGRYWVS+ T AG PSQ+ Y++PR FLKP
Sbjct  650   KTMFDEPSGDEPVGLNMSSMGKGEMWVNGVSIGRYWVSFLTPAGRPSQSMYHIPREFLKP  709

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLL++ EEE GNP GI+L+ +S+T
Sbjct  710   SGNLLMVLEEEGGNPLGISLNTISVT  735



>ref|XP_010484137.1| PREDICTED: beta-galactosidase 6-like isoform X2 [Camelina sativa]
Length=742

 Score =   360 bits (925),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 188/363 (52%), Positives = 243/363 (67%), Gaps = 9/363 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG++  +RSAEDIAFH ALFIA KNGSY+NYYMYHGGTNFGRT++S+ +T YYDQAP
Sbjct  288   FQVYGAEPYIRSAEDIAFHAALFIA-KNGSYVNYYMYHGGTNFGRTSSSYFVTGYYDQAP  346

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  D+   C AFL
Sbjct  347   LDEYGLLRQPKYGHLKELHAAIKASANPLLQGKQTILSLGPLQQAYVFE-DARSGCVAFL  405

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND    ++VQF+N++Y L PKSI IL +CK + + TAKV    N R   P   F+  +
Sbjct  406   VNNDAAKVSQVQFRNNAYSLSPKSIGILQNCKNLIYQTAKVNVPKNVRFTTPVQVFNVPD  465

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F  T ++ + LL+H N TKD +DYLWYT S + +S     +I +ES GH
Sbjct  466   KWEVFRETIPAFTGTALKTNALLEHTNLTKDKTDYLWYTSSFKPDSPCSNPSIYIESSGH  525

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H++VN  LAGS HG+       L+  VSL  G N+IS+LS  VGLP+SGAY+E K+ G
Sbjct  526   VVHVYVNSALAGSGHGSRDIRVVKLQVPVSLTNGQNSISILSGMVGLPDSGAYMERKSYG  585

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR----EFSSSQPLI  1216
               KV I S  G++  DLS   WGY VGLLGE ++++  K  N V+W        ++ PL 
Sbjct  586   LTKVQI-SCGGTKTIDLSRSQWGYSVGLLGEKVRLHQWKNLNRVKWSMSNAGLINNHPLA  644

Query  1217  WYK  1225
             WYK
Sbjct  645   WYK  647


 Score =   119 bits (299),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FD P G+ P+ LN+ SMGKGE WVNG SIGRYWVS+ T AG PSQ+ Y++PRSFLKP
Sbjct  647   KTMFDGPSGDGPVGLNMSSMGKGEIWVNGVSIGRYWVSFLTPAGRPSQSIYHIPRSFLKP  706

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLL++ EEE G+P GI+L+ +S+T
Sbjct  707   SGNLLMVLEEEGGDPLGISLNTISVT  732



>gb|KHN47001.1| Beta-galactosidase 16 [Glycine soja]
Length=602

 Score =   356 bits (914),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 193/358 (54%), Positives = 236/358 (66%), Gaps = 47/358 (13%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQV+G    +RSAEDIA++VALFIA++ GSY+NYYMYHGGTNF R A++F+IT+YYD+AP
Sbjct  204   YQVFGEVPYIRSAEDIAYNVALFIAKR-GSYVNYYMYHGGTNFDRIASAFVITAYYDEAP  262

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+REPKW HLKELHAAIK CS  +L  T ++FSL   Q AYVF+  SS  CAAFL
Sbjct  263   LDEYGLVREPKWGHLKELHAAIKSCSNSILHGTQTSFSLGTQQNAYVFK-RSSIECAAFL  321

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N +   S  +QFQN  YQLPP SISILPDCK VAFNTAKV  Q N R M+  L+F+S E
Sbjct  322   ENTE-DQSVTIQFQNIPYQLPPNSISILPDCKNVAFNTAKVRIQ-NARAMKSQLQFNSAE  379

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W+ ++E +  F DT++RA+TLLD I+TTKD SDYLWYT  L   S + +S +S  S GH
Sbjct  380   TWKVYKEAIPSFGDTSLRANTLLDQISTTKDTSDYLWYTFRLYDNSPNAQSILSAYSHGH  439

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH FVNG L                                      NSGAYLE +  G
Sbjct  440   VLHAFVNGNL--------------------------------------NSGAYLERRVAG  461

Query  1055  PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQPLIWYK  1225
              R + ++      D +N +WGYQ+GLLGE LQIYT  GS+ VQW  F SS++PL WYK
Sbjct  462   LRSLKVQ----GRDFTNQAWGYQIGLLGEKLQIYTASGSSKVQWESFQSSTKPLTWYK  515


 Score =   136 bits (342),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P GNDP+ LNLGSMGKG  W+NGQ IGRYWVS+HT  GTPSQ WY++PRS LK 
Sbjct  515   KTTFDAPVGNDPVVLNLGSMGKGYTWINGQGIGRYWVSFHTPQGTPSQKWYHIPRSLLKS  574

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             TGNLLVL EEE GNP GITLD V IT
Sbjct  575   TGNLLVLLEEETGNPLGITLDTVYIT  600



>ref|XP_010025738.1| PREDICTED: beta-galactosidase 6 isoform X2 [Eucalyptus grandis]
Length=550

 Score =   354 bits (908),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 174/288 (60%), Positives = 217/288 (75%), Gaps = 1/288 (0%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFH  LFIA+ NG YINYYMYHGGTNFGRTAA++ IT YYDQAP
Sbjct  261   YQVYGGEPYLRSAEDIAFHATLFIAKLNGCYINYYMYHGGTNFGRTAAAYFITGYYDQAP  320

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PKW HLKELH AIK  S  LL    S FSL Q+Q+AYVF+ + +G C AFL
Sbjct  321   LDEYGLLRQPKWGHLKELHGAIKNSSSTLLEGVKSNFSLGQYQEAYVFQ-EETGGCVAFL  379

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND K SA VQF N S++L PKSISIL DC+ + FNTAKVT++S+TR    +  F+  +
Sbjct  380   VNNDAKSSATVQFGNKSFELLPKSISILQDCENMIFNTAKVTSESSTRVTTSSQTFEGAD  439

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WEEF +++  + DT++RADTLL+H+NTTKD SDYLWY  S Q +S+  +  + ++SLGH
Sbjct  440   KWEEFLDVIPSYLDTSLRADTLLEHMNTTKDESDYLWYAFSFQPDSTCAEPVLHLKSLGH  499

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLP  1018
             V H FVN E  GSAHG+    +FT+E+ + L+  MNNISLLS  VGLP
Sbjct  500   VTHAFVNNEYMGSAHGSHDVKNFTMETKIVLDNQMNNISLLSVMVGLP  547



>ref|XP_006394241.1| hypothetical protein EUTSA_v10005464mg [Eutrema salsugineum]
 gb|ESQ31527.1| hypothetical protein EUTSA_v10005464mg [Eutrema salsugineum]
Length=701

 Score =   357 bits (917),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 238/362 (66%), Gaps = 7/362 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG++  +RSAEDIAFH ALF+A KNGSYINYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  247   FQVYGAEPYIRSAEDIAFHAALFVA-KNGSYINYYMYHGGTNFGRTSSSYFITGYYDQAP  305

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF   SSG C AFL
Sbjct  306   LDEYGLLRQPKYGHLKELHAAIKSSANPLLQGKQTILSLGPMQQAYVFEDPSSG-CVAFL  364

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND     ++QF+N++Y L PKSI IL +CK + + TAKV    N R   P   F+  +
Sbjct  365   VNNDATKVIQIQFRNNAYSLRPKSIGILQNCKNLIYETAKVNVAKNMRVTTPVQVFNVPD  424

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F  T+++ + LL+H   TKD SDYLWYT   + +S     ++ +ES GH
Sbjct  425   KWEVFRETIPTFSGTSLKTNALLEHTKLTKDKSDYLWYTSRFKPDSPCANPSLYIESSGH  484

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+       L+  VSL  G NNIS+LS  VGLP+SGAY+E K+ G
Sbjct  485   VVHVFVNNALAGSGHGSRDIRVVKLQVPVSLINGQNNISILSGMVGLPDSGAYMERKSYG  544

Query  1055  PRKVTIESSE-GSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE----FSSSQPLIW  1219
               KV I   E  + DL    WGY VGLLGE ++++  +    V+W         ++PL W
Sbjct  545   LTKVQISCGERKTIDLGGSKWGYSVGLLGEKVRLHQWRNLRRVKWSTNNAGLIKNRPLAW  604

Query  1220  YK  1225
             YK
Sbjct  605   YK  606


 Score =   115 bits (287),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             + +FD P GN P+ LN+ SMGKGE WVNG+SIGRYWVS+ T +G PSQ+ Y++PR+FLK 
Sbjct  606   KIMFDGPNGNGPVGLNMESMGKGEMWVNGESIGRYWVSFLTPSGHPSQSIYHIPRAFLKA  665

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLLV+ EEE G+P GI+L+ +S+ 
Sbjct  666   SGNLLVVLEEEGGDPLGISLNTISVV  691



>emb|CAB64742.1| putative beta-galactosidase [Arabidopsis thaliana]
Length=718

 Score =   357 bits (915),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 190/363 (52%), Positives = 242/363 (67%), Gaps = 10/363 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG +  +RSAEDIAFH ALF+A KNGSYINYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  265   FQVYGKEPYIRSAEDIAFHAALFVA-KNGSYINYYMYHGGTNFGRTSSSYFITGYYDQAP  323

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  D++  C AFL
Sbjct  324   LDEYGLLRQPKYGHLKELHAAIKSSANPLLQGKQTILSLGPMQQAYVFE-DANNGCVAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND K S ++QF+N++Y L PKSI IL +CK + + TAKV  + NTR   P   F+  +
Sbjct  383   VNNDAKAS-QIQFRNNAYSLSPKSIGILQNCKNLIYETAKVNVKMNTRVTTPVQVFNVPD  441

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              W  F E +       ++ + LL+H N TKD +DYLWYT S + +S     +I  ES GH
Sbjct  442   NWNLFRETIPASQAHLLKTNALLEHTNLTKDKTDYLWYTSSFKLDSPCTNPSIYTESSGH  501

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+       L++ VSL  G NNIS+LS  VGLP+SGAY+E ++ G
Sbjct  502   VVHVFVNNALAGSGHGSRDIRVVKLQAPVSLINGQNNISILSGMVGLPDSGAYMERRSYG  561

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR----EFSSSQPLI  1216
               KV I S  G++  DLS   WGY VGLLGE +++Y  K  N V+W         ++PL 
Sbjct  562   LTKVQI-SCGGTKPIDLSRSQWGYSVGLLGEKVRLYQWKNLNRVKWSMNKAGLIKNRPLA  620

Query  1217  WYK  1225
             WYK
Sbjct  621   WYK  623


 Score =   120 bits (301),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G+ P+ L++ SMGKGE WVNG+SIGRYWVS+ T AG PSQ+ Y++PR+FLKP
Sbjct  623   KTTFDGPNGDGPVGLHMSSMGKGEIWVNGESIGRYWVSFLTPAGQPSQSIYHIPRAFLKP  682

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLLV+FEEE G+P GI+L+ +S+ 
Sbjct  683   SGNLLVVFEEEGGDPLGISLNTISVV  708



>ref|XP_009385110.1| PREDICTED: beta-galactosidase 7 [Musa acuminata subsp. malaccensis]
Length=808

 Score =   357 bits (916),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 184/360 (51%), Positives = 241/360 (67%), Gaps = 4/360 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG D   RSAEDIAF VALFIA+KNGS++NYYMYHGGTNFG++A+S++ TSYYDQAP
Sbjct  262   YQVYGEDPRPRSAEDIAFAVALFIAKKNGSFVNYYMYHGGTNFGKSASSYVTTSYYDQAP  321

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+  P W HL+ELHA IK+C + LL    + +SLA+ Q+A++FR  +SG CAAFL
Sbjct  322   LDEYGLIWLPTWGHLRELHAVIKLCQEALLWGRYTYYSLAKLQEAHLFR-TNSGKCAAFL  380

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D    A + F ++ Y+LP KSISILPDCK   FNTAKV+ +   RT +P    + ++
Sbjct  381   VNYDKSLVANLHFLDAIYELPAKSISILPDCKKTVFNTAKVSARYGERTAEPVQYLNRSQ  440

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE   E        ++ A  LL+ ++TTKDV+DYLWYT S      D +  + V+SL H
Sbjct  441   QWEASAEESNIAGKASLVAKGLLEQMSTTKDVTDYLWYTTSYNHSQQDGQITLHVDSLAH  500

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             VLH+FVN EL G+ HG         +  + +  G NNISLLS  VGLP+SGAYLE +  G
Sbjct  501   VLHVFVNDELLGTVHGKNHGELPVFDKPIPVKGGQNNISLLSVMVGLPDSGAYLEKRFAG  560

Query  1055  PRKVTIESSEG-SEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--SQPLIWYK  1225
              +   I+ +   S DL+++ W YQVGL GE + IYTE+GS    W    S  ++PLIWYK
Sbjct  561   IQHARIQGTGNLSRDLTHELWRYQVGLRGEKVLIYTEEGSKQAVWNPVVSFANKPLIWYK  620


 Score =   117 bits (294),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G DP+ALNL +MGKGE W+NG+SIGRYW S+   +G PSQ+ Y+VPRSFL P
Sbjct  620   KTRFDAPRGTDPVALNLANMGKGEVWINGESIGRYWASFKAPSGKPSQSLYHVPRSFLNP  679

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             + NLLVLFEE  G+P  IT+D +S+ 
Sbjct  680   SNNLLVLFEEMGGDPRSITVDTISVA  705



>emb|CDY39845.1| BnaC02g42730D [Brassica napus]
Length=720

 Score =   353 bits (907),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 190/371 (51%), Positives = 239/371 (64%), Gaps = 25/371 (7%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQ YG    +RSAEDIAFH ALFIA KNGSYINYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  266   YQFYGGTPYIRSAEDIAFHAALFIA-KNGSYINYYMYHGGTNFGRTSSSYFITGYYDQAP  324

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +  SL   QQAYVF  ++SG C AFL
Sbjct  325   LDEYGLLRQPKYGHLKELHAAIKSSANPLLQGKQTILSLGPMQQAYVFEDENSG-CVAFL  383

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND + + ++QF+N++Y L PKSI IL +CK + + TAKV    N R   P   F+  +
Sbjct  384   VNNDARKAIQIQFRNNAYSLLPKSIGILQNCKNLIYETAKVNVAKNMRVTTPVQVFNVPD  443

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F DT ++   LL+H N TKD SDYLWYTL  +  S     ++ +ESLGH
Sbjct  444   KWEVFRESIPTFSDTPLKTKALLEHTNLTKDKSDYLWYTLRFESSSPCANPSLYIESLGH  503

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN  LAGS HG+   +   L+  VSL  G NNIS+LS  VGLP+SGAY+E K+ G
Sbjct  504   VVHVFVNHALAGSGHGSRNITVVKLQVPVSLINGQNNISILSGMVGLPDSGAYMERKSYG  563

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ-------  1207
               K  I S  G+   DLS   WGY VGL+G+ ++++        QW    S +       
Sbjct  564   LTKAQI-SCGGTNAIDLSGSQWGYLVGLVGDKVKLH--------QWANLKSVKRSTNDAG  614

Query  1208  -----PLIWYK  1225
                  PL WYK
Sbjct  615   LIKNCPLAWYK  625


 Score =   126 bits (317),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FDEP G+ P+ LN+GSMGKGE WVNG+SIGRYWVS+ T AG PSQ+ Y++PR+FLKP
Sbjct  625   KTMFDEPNGDGPVGLNMGSMGKGEVWVNGESIGRYWVSFLTPAGHPSQSIYHIPRAFLKP  684

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             +GNLLV+FEEE G+P GI+L+ +S+
Sbjct  685   SGNLLVVFEEEGGDPLGISLNTISV  709



>gb|KFK28074.1| hypothetical protein AALP_AA8G468900 [Arabis alpina]
Length=716

 Score =   353 bits (906),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 184/363 (51%), Positives = 241/363 (66%), Gaps = 9/363 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QVYG++  +RSAEDIA+H ALFIA KNGSYINYYMYHGGTNFGRT++S+ IT YYDQAP
Sbjct  262   FQVYGAEPYIRSAEDIAYHAALFIA-KNGSYINYYMYHGGTNFGRTSSSYFITGYYDQAP  320

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELHAAIK  +  LL    +T SL   QQAYVF  D+S  C AFL
Sbjct  321   LDEYGLLRQPKYGHLKELHAAIKTSANPLLQGKQTTLSLGPLQQAYVFE-DASSGCVAFL  379

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND     ++QF++++Y L PKSI IL +CK + + TAKV    N+R   P   F+  +
Sbjct  380   VNNDATKVVQIQFRDNAYSLRPKSIGILQNCKNLIYETAKVNVAKNSRITTPVQVFNVPD  439

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +WE F E +  F    ++A+ LL+H   T+D +DYLWYTL  + +SS    ++ +ES GH
Sbjct  440   KWEVFRETIPTFSGAAMKANALLEHTKVTQDKTDYLWYTLRFKADSSCTNPSLFIESSGH  499

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H+FVN   AGS HG+       L+  V L  G NNIS+LS  VGLP+SGAY+E K+ G
Sbjct  500   VVHVFVNNARAGSGHGSRDIRVVKLQVPVRLINGDNNISILSGMVGLPDSGAYMERKSYG  559

Query  1055  PRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR----EFSSSQPLI  1216
              +KV I +  G++  DLS   WGY  GLLGE +++      N V+W         ++PL 
Sbjct  560   LKKVQI-TCGGTKTIDLSRSQWGYTAGLLGEKVRLQNSMNLNKVKWSMNKAGLIKNRPLA  618

Query  1217  WYK  1225
             WYK
Sbjct  619   WYK  621


 Score =   126 bits (316),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T+FDEP GN P+ LN+ SMGKGE WVNG+SIGRYWVS+ T AG PSQ+ Y++PR+FLKP
Sbjct  621   KTMFDEPSGNGPVGLNMASMGKGEIWVNGESIGRYWVSFLTPAGRPSQSIYHIPRAFLKP  680

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +GNLL++ EEE G+P GI+L+ +S+T
Sbjct  681   SGNLLLVLEEEGGDPLGISLNTISVT  706



>ref|XP_010547679.1| PREDICTED: beta-galactosidase 6-like isoform X1 [Tarenaya hassleriana]
Length=724

 Score =   350 bits (897),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 180/365 (49%), Positives = 240/365 (66%), Gaps = 10/365 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QV+G +  +RSAEDIAFHVALF+A KNGSY+NYYMYHGGTNFGRT +S+ IT YYDQ+P
Sbjct  265   FQVFGGEPYIRSAEDIAFHVALFVA-KNGSYVNYYMYHGGTNFGRTTSSYFITGYYDQSP  323

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELH AIK  ++ LL    +  SL   Q+ YVF  D++  C AFL
Sbjct  324   LDEYGLLRQPKYGHLKELHLAIKSVAEPLLQGKQTFLSLGSLQEGYVFE-DATSGCVAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NN+ K +A V F+N++YQL PKSI IL +C T+ F TA+V    N R       FD+ +
Sbjct  383   VNNNAK-AATVTFRNNAYQLRPKSIGILQNCATMIFETARVNVAKNIRATTRVQLFDAED  441

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W    E V  F DT+ RA+ LL+H N TKD +DYLWYT     +S+     + +ESLGH
Sbjct  442   KWTTVTESVPRFSDTSFRANALLEHTNMTKDTTDYLWYTTRFDSKSACMNPVLHIESLGH  501

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H FVN   AGS HG+       ++  + L  G N IS+LSA VGLP+SG +LE K+ G
Sbjct  502   VVHAFVNNVRAGSGHGSRDIKVVKMDVPIQLTSGPNYISILSAMVGLPDSGPFLEKKSFG  561

Query  1055  PRKVTIESSEGSE-DLSNDSWGYQVGLLGENLQIYTEKGSN---AVQWRE---FSSSQPL  1213
             P KV ++ S   + DL+   WGYQVGL+GE  ++  +   N   +++W +      +QPL
Sbjct  562   PTKVQVDCSGTMKYDLTRSKWGYQVGLVGEKARMQDKNKVNKAKSLKWNKNGVVLKNQPL  621

Query  1214  IWYKE  1228
              WYK+
Sbjct  622   TWYKQ  626


 Score =   119 bits (298),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             QT F  P+G+DP+ LNL +MGKGE WVNGQSIGRYWVS+ T +G PSQ  Y++PR+FLK 
Sbjct  626   QTTFGTPKGDDPVVLNLTTMGKGEVWVNGQSIGRYWVSFLTPSGHPSQALYHIPRAFLKE  685

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
              GNLLV+FEEE G+P GI+L+ VS+
Sbjct  686   GGNLLVMFEEEGGDPLGISLNTVSV  710



>ref|XP_010547680.1| PREDICTED: beta-galactosidase 6-like isoform X2 [Tarenaya hassleriana]
Length=723

 Score =   349 bits (895),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 180/364 (49%), Positives = 239/364 (66%), Gaps = 10/364 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +QV+G +  +RSAEDIAFHVALF+A KNGSY+NYYMYHGGTNFGRT +S+ IT YYDQ+P
Sbjct  265   FQVFGGEPYIRSAEDIAFHVALFVA-KNGSYVNYYMYHGGTNFGRTTSSYFITGYYDQSP  323

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLLR+PK+ HLKELH AIK  ++ LL    +  SL   Q+ YVF  D++  C AFL
Sbjct  324   LDEYGLLRQPKYGHLKELHLAIKSVAEPLLQGKQTFLSLGSLQEGYVFE-DATSGCVAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NN+ K +A V F+N++YQL PKSI IL +C T+ F TA+V    N R       FD+ +
Sbjct  383   VNNNAK-AATVTFRNNAYQLRPKSIGILQNCATMIFETARVNVAKNIRATTRVQLFDAED  441

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             +W    E V  F DT+ RA+ LL+H N TKD +DYLWYT     +S+     + +ESLGH
Sbjct  442   KWTTVTESVPRFSDTSFRANALLEHTNMTKDTTDYLWYTTRFDSKSACMNPVLHIESLGH  501

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
             V+H FVN   AGS HG+       ++  + L  G N IS+LSA VGLP+SG +LE K+ G
Sbjct  502   VVHAFVNNVRAGSGHGSRDIKVVKMDVPIQLTSGPNYISILSAMVGLPDSGPFLEKKSFG  561

Query  1055  PRKVTIESSEGSE-DLSNDSWGYQVGLLGENLQIYTEKGSN---AVQWRE---FSSSQPL  1213
             P KV ++ S   + DL+   WGYQVGL+GE  ++  +   N   +++W +      +QPL
Sbjct  562   PTKVQVDCSGTMKYDLTRSKWGYQVGLVGEKARMQDKNKVNKAKSLKWNKNGVVLKNQPL  621

Query  1214  IWYK  1225
              WYK
Sbjct  622   TWYK  625


 Score =   119 bits (297),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P+G+DP+ LNL +MGKGE WVNGQSIGRYWVS+ T +G PSQ  Y++PR+FLK 
Sbjct  625   KTTFGTPKGDDPVVLNLTTMGKGEVWVNGQSIGRYWVSFLTPSGHPSQALYHIPRAFLKE  684

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
              GNLLV+FEEE G+P GI+L+ VS+
Sbjct  685   GGNLLVMFEEEGGDPLGISLNTVSV  709



>ref|XP_006382885.1| hypothetical protein POPTR_0005s07020g [Populus trichocarpa]
 gb|ERP60682.1| hypothetical protein POPTR_0005s07020g [Populus trichocarpa]
Length=557

 Score =   342 bits (877),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 170/288 (59%), Positives = 214/288 (74%), Gaps = 3/288 (1%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSAEDIAFHV LFIA KNGSYINYYM+HGGTNFGRTA++++ITSYYDQAP
Sbjct  258   YQVYGGEPYIRSAEDIAFHVTLFIA-KNGSYINYYMFHGGTNFGRTASAYVITSYYDQAP  316

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHAAIK CS  +L    S FSL Q QQAY+F  + +G CAAFL
Sbjct  317   LDEYGLIRQPKWGHLKELHAAIKSCSSTILEGVQSNFSLGQLQQAYIFEEEGAG-CAAFL  375

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND K++A V+F+N +++L PKSIS+LPDC+ + FNTAKV  + N  T   +  FD  +
Sbjct  376   VNNDQKNNATVEFRNITFELLPKSISVLPDCENIIFNTAKVNAKGNEITRTSSQLFDDAD  435

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WE + +++  F DTN+++DTLL+H+NTTKD SDYLWYT S    SS  +  + VESL H
Sbjct  436   RWEAYTDVIPNFADTNLKSDTLLEHMNTTKDKSDYLWYTFSFLPNSSCTEPILHVESLAH  495

Query  875   VLHIFVNGELAGSAHGTF-RNSSFTLESTVSLNKGMNNISLLSATVGL  1015
             V   FVN + AGSAHG+      FT+E+ + LN  MN IS+LS  VGL
Sbjct  496   VASAFVNNKYAGSAHGSKDAKGPFTMEAPIVLNDQMNTISILSTMVGL  543



>ref|XP_009386767.1| PREDICTED: beta-galactosidase 11-like [Musa acuminata subsp. 
malaccensis]
Length=769

 Score =   342 bits (876),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 172/366 (47%), Positives = 234/366 (64%), Gaps = 8/366 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIA+ VA F + KNG+  NYYMYHGGTNFGRT A+FM+T YYD+AP
Sbjct  203   YRVFGDPPSQRSAEDIAYSVARFFS-KNGTLTNYYMYHGGTNFGRTGAAFMMTRYYDEAP  261

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYG+ +EPKW HL++LH A+K+C + LL  TPS  +  +  +A ++    S  C AFL
Sbjct  262   LDEYGMEKEPKWGHLRDLHHALKLCRKGLLWGTPSVQAFDKGFEARLYEIPESHVCVAFL  321

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N + K    V F+   Y LP +SISILPDCKTV FN+ +V  Q N RT   A +     
Sbjct  322   TNTNRKEDGTVSFRGEEYYLPRRSISILPDCKTVVFNSQRVNAQHNARTFDVAKESSMKN  381

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KSAIS  856
             +W+   +L+      ++ +   L+ +N TKD +DYLWYT S + ++ D P     +  + 
Sbjct  382   QWQMTSDLIPTLRHASVISKGPLELMNLTKDTTDYLWYTTSFKLDADDLPRRQDIRPVLQ  441

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V +LGH +H FVNG+  GS HGT    SF  +  + LN G N+I++L  TVGLP+SGAYL
Sbjct  442   VSNLGHAMHAFVNGKYIGSGHGTKIEKSFVFQKPMDLNAGTNHIAILGLTVGLPDSGAYL  501

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPL  1213
             EH+  G   V I+  + G+ DLS+  WG+QVGL GE L I++EKG NAV+W E  S  P+
Sbjct  502   EHRLAGVHTVVIQGLNAGTLDLSHSVWGHQVGLTGETLGIFSEKGVNAVKWEEAKSDTPV  561

Query  1214  IWYKEW  1231
             +WYK +
Sbjct  562   MWYKRY  567


 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 62/90 (69%), Gaps = 4/90 (4%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P G+DP+AL + SMGKG  W+NG+SIGRYW+SY    G  SQ+ Y+VPRSFLKP  N
Sbjct  568   FDAPSGHDPVALEMNSMGKGLVWINGESIGRYWISYLNPLGKASQSVYHVPRSFLKPKDN  627

Query  1660  LLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             L+V+FEE  G P  I +    +T+ +D + 
Sbjct  628   LMVVFEEHGGKPEDIQI----MTVKRDDIC  653



>ref|XP_009396587.1| PREDICTED: beta-galactosidase 11-like [Musa acuminata subsp. 
malaccensis]
Length=739

 Score =   340 bits (872),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 174/368 (47%), Positives = 238/368 (65%), Gaps = 11/368 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAED+A+ VA F + KNG+ +NYYMYHGGTNFGR+ +SF +T YYD+AP
Sbjct  204   YRVFGDPPSQRSAEDLAYSVARFFS-KNGTLVNYYMYHGGTNFGRSGSSFAMTRYYDEAP  262

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPS--TFSLAQFQQAYVFRGDSSGACAA  508
             LDE+GL +EPK+ HL +LH A+++CS+ LL    S  TF +  F +A V+      ACAA
Sbjct  263   LDEFGLHKEPKYGHLSDLHHALRLCSKALLWGVSSVQTFDIDGF-EATVYENPGMKACAA  321

Query  509   FLINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDS  688
             FL N++ K    V F+ + Y LP +SISILPDCKTVAFNT KV +Q N RT   A +   
Sbjct  322   FLSNSNRKIEGTVNFKGTDYYLPRRSISILPDCKTVAFNTQKVISQHNARTFHVAKESSM  381

Query  689   TeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KSA  850
               +W+  ++ +  F DT +R+ + L+  N TKD SDYLWYT S + E  D P     +  
Sbjct  382   NNQWQMHKDHIPRFRDTRVRSRSTLELFNMTKDTSDYLWYTTSFRLEDDDLPRRHDIRPV  441

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             + V +LGH +H FVNG  AGS HGT    SF     ++L  G+N++++L  T+GLPNSG+
Sbjct  442   LLVSNLGHAMHAFVNGRHAGSGHGTNIEKSFVFHQPIALGAGINHVTILCMTIGLPNSGS  501

Query  1031  YLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ  1207
             YLEH+  G   V I+  + G+ DLS + WG+QVGL+GE L I+ EKG N V W +  +  
Sbjct  502   YLEHRIAGVHTVVIQGLNTGTLDLSQNGWGHQVGLVGEKLGIFNEKGVNNVNWTQAQNDM  561

Query  1208  PLIWYKEW  1231
             P+ WYK +
Sbjct  562   PITWYKRY  569


 Score =   103 bits (258),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 61/87 (70%), Gaps = 4/87 (5%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P GNDP+AL+L SM KG  W+NG+SIGRYWVSY      PSQ+ Y+VPRS LKP  N
Sbjct  570   FDAPSGNDPVALDLTSMSKGMVWINGESIGRYWVSYLNPLQKPSQSVYHVPRSLLKPKDN  629

Query  1660  LLVLFEEEYGNPYGITLDKVSITLDKD  1740
             L+V+FEE  G P GI    V +T+ +D
Sbjct  630   LMVVFEEHRGKPEGI----VMMTVKRD  652



>ref|XP_006826593.1| hypothetical protein AMTR_s00138p00054750 [Amborella trichopoda]
 gb|ERM93830.1| hypothetical protein AMTR_s00138p00054750 [Amborella trichopoda]
Length=850

 Score =   343 bits (879),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 176/367 (48%), Positives = 233/367 (63%), Gaps = 10/367 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V G     R AED+AF VA + + K+G+ +NYYMYHGGTNFGRT +SF+ T YYD+AP
Sbjct  277   YRVLGDPPSQRPAEDLAFAVARWFS-KHGTLVNYYMYHGGTNFGRTTSSFVTTRYYDEAP  335

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+REPKW HL++LH A+K+  + LL  T S +SL    +A V++      C+AFL
Sbjct  336   LDEYGLVREPKWGHLRDLHRALKLSRKALLWGTHSNYSLGHQLEARVYQNSEKNVCSAFL  395

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN+ + +A + FQN  Y LPP+SISILPDCKTV FNT KV  Q N RT      F    
Sbjct  396   ANNNTREAATIYFQNVPYYLPPRSISILPDCKTVVFNTKKVNAQHNARTFHHVKDFSKGM  455

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KSAIS  856
              W+ F++ +   +DT ++   LL+H N TKD +D+LWYT ++   S+D P     K  + 
Sbjct  456   RWKMFKDSIPNTEDTPVQNSLLLEHYNATKDTTDFLWYTTNIDVGSNDLPLLNSIKPILQ  515

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V S GH +H FVN    GS+HG    S F+L   ++L  G N ISLLS T G PNSG Y+
Sbjct  516   VASWGHAVHGFVNDLYVGSSHGDHVQSPFSLNKPITLKPGKNKISLLSMTTGFPNSGGYM  575

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--SQ  1207
             EHK  G  KV I+    G++DL N+ WG+QVGLLGE L++Y  + S  V+W +      +
Sbjct  576   EHKIAGVSKVLIQGLMTGTQDLINNIWGHQVGLLGEKLEVYNPRSSKKVKWVDAKGHDHE  635

Query  1208  PLIWYKE  1228
             PLIWYK 
Sbjct  636   PLIWYKR  642


 Score =   114 bits (285),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 4/90 (4%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P G+DP+AL++ SMGKGE WVNGQSIGRYWVSY T  G PSQ+ Y++PRSFLKP  N
Sbjct  644   FDAPAGSDPVALDMSSMGKGEIWVNGQSIGRYWVSYLTPLGLPSQSVYHIPRSFLKPKRN  703

Query  1660  LLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             LLV+ EE  GNP  ITL+ V     +DI+ 
Sbjct  704   LLVILEETGGNPRRITLENVR----RDIIC  729



>ref|XP_004961993.1| PREDICTED: beta-galactosidase 7-like isoform X2 [Setaria italica]
Length=822

 Score =   339 bits (869),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 181/364 (50%), Positives = 234/364 (64%), Gaps = 9/364 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+D  +RS EDIAF VALFIARKNGSY++YYMYHGGTNFGR ++S++ T+YYD AP
Sbjct  273   YLIYGNDTKLRSPEDIAFAVALFIARKNGSYMSYYMYHGGTNFGRFSSSYVTTNYYDGAP  332

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+ +P W HL+ELH A+K  S+ LL  T S FSL Q Q+A++F  +S   C AFL
Sbjct  333   LDEYGLIWQPTWGHLRELHTAVKQSSEPLLFGTYSNFSLGQEQEAHIFETESQ--CVAFL  390

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKF-DST  691
             +N D    ++V F+N S QL PKSISIL DCK V F TAKV  Q  +RT +    F D  
Sbjct  391   VNFDQHQISEVVFRNISLQLAPKSISILSDCKRVVFETAKVNAQHGSRTAEEVQSFSDIN  450

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKS--AISVES  865
                   E +           + L DH++TTKD +DYLWY +  +   SD      I+VES
Sbjct  451   TWKAFKEPIPQDVSKAMYTGNQLFDHLSTTKDETDYLWYIVGYEYTPSDDGQLVLINVES  510

Query  866   LGHVLHIFVNGELAGSAHGTFRN-SSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEH  1042
               H+LH FVN    G  HG+    +S  L + +SLN+G NNISLLSA VG P+SGA++E 
Sbjct  511   RAHILHAFVNNAYVGRIHGSHDGPASIILSTNISLNEGPNNISLLSAMVGSPDSGAHMER  570

Query  1043  KTLGPRKVTIESSEGSED-LSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS--SSQPL  1213
             +  G RKV+I+  +  E  L N+ WG QVGL GE   IYT++GS +V+W   +  +  PL
Sbjct  571   RVFGIRKVSIQQGQEPEHLLDNELWGNQVGLFGERNHIYTQEGSKSVEWTTINNLAYSPL  630

Query  1214  IWYK  1225
             IWYK
Sbjct  631   IWYK  634


 Score =   112 bits (279),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P GND +ALNL SMGKGE W+NG+SIGRYWVS+   +G PSQ+ Y++PR FL P
Sbjct  634   KTTFPTPAGNDAIALNLTSMGKGEVWINGESIGRYWVSFKAPSGNPSQSLYHIPRQFLNP  693

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               N+LVLFEE  G+P  IT++ VS+T
Sbjct  694   QDNILVLFEEMGGDPQQITVNTVSVT  719



>ref|XP_002522930.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF39473.1| beta-galactosidase, putative [Ricinus communis]
Length=450

 Score =   327 bits (839),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 181/362 (50%), Positives = 230/362 (64%), Gaps = 46/362 (13%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             YQVYG +  +RSA+DIAFHVALFIA KNGSY+NYYMYHGGTNFGRTAA+++IT YYDQAP
Sbjct  81    YQVYGGEPYIRSAQDIAFHVALFIA-KNGSYVNYYMYHGGTNFGRTAAAYVITGYYDQAP  139

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+R+PKW HLKELHA IK CS  LL    +  S+ Q QQAY+F     G C AFL
Sbjct  140   LDEYGLIRQPKWGHLKELHAVIKSCSTTLLEGVQTNLSVGQLQQAYMFEAQ-GGGCVAFL  198

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND  + A V F+N S++L PKSISILPDC  + FNTAKV   SN R    + K ++  
Sbjct  199   VNNDSVN-ATVGFRNKSFELLPKSISILPDCDNIIFNTAKVNAGSNRRITTSSKKLNT--  255

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WE++ +++  + D+ I++DTLL+H+NTTKD SDYLWYT S Q   S  K  + VESL H
Sbjct  256   -WEKYIDVIPNYSDSTIKSDTLLEHMNTTKDKSDYLWYTFSFQPNLSCTKPLLHVESLAH  314

Query  875   VLHIFVNGELAGSAHGTFRNS-SFTLESTVSL-NKGM-NNISLLSATVGLPNSGAYLEHK  1045
             V + FVN + +GSAHG+      F +E  + L + G+ NNIS+LS  VGL          
Sbjct  315   VAYAFVNNKYSGSAHGSKNGKVPFIMEVPIVLDDDGLSNNISILSVLVGL----------  364

Query  1046  TLGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR--EFSSSQPLIW  1219
                                       VGLLGE LQ+Y ++    V+W   + S +QPL W
Sbjct  365   -------------------------SVGLLGETLQLYGKEHLEMVKWSKADISIAQPLTW  399

Query  1220  YK  1225
             +K
Sbjct  400   FK  401


 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQT  1617
             FD P+GNDP+ LNL +M KGEAWVNGQSIGRYW+S+ T  G PSQT
Sbjct  404   FDTPKGNDPVVLNLATMSKGEAWVNGQSIGRYWISFLTSKGHPSQT  449



>emb|CAN82672.1| hypothetical protein VITISV_014349 [Vitis vinifera]
Length=710

 Score =   330 bits (846),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 176/360 (49%), Positives = 230/360 (64%), Gaps = 32/360 (9%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G +  +RSAEDIAFHVALFIAR NGSY+NYYM                        
Sbjct  259   YEVFGGETYLRSAEDIAFHVALFIAR-NGSYVNYYMV-----------------------  294

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
                  L+R+PKW HLKELHAAI +CS  LL+   S  SL Q Q+AYVF+ +  G C AFL
Sbjct  295   ----SLIRQPKWGHLKELHAAITLCSTPLLNGVQSNISLGQLQEAYVFQ-EEMGGCVAFL  349

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +NND  +++ V FQN S +L PKSISILPDCK V FNTAK+ T  N R    +  FD+ +
Sbjct  350   VNNDEGNNSTVLFQNVSIELLPKSISILPDCKNVIFNTAKINTGYNERITTSSQSFDAVD  409

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
              WEE+++ +  F DT+++++ +L+H+N TKD SDYLWYT   Q  SS  +  + +ESL H
Sbjct  410   RWEEYKDAIPNFLDTSLKSNMILEHMNMTKDESDYLWYTFRFQPNSSCTEPLLHIESLAH  469

Query  875   VLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLG  1054
              +H FVN    G+ HG+     FT +S +SLN  MNNIS+LS  VG P+SGAYLE +  G
Sbjct  470   AVHAFVNNIYVGATHGSHDMKGFTFKSPISLNNEMNNISILSVMVGFPDSGAYLESRFAG  529

Query  1055  PRKVTIESSE-GSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR--EFSSSQPLIWYK  1225
               +V I+ +E G  D +N +WGYQVGL GE L IY E+  + V+WR  E S++QPL WYK
Sbjct  530   LTRVEIQCTEKGIYDFANYTWGYQVGLSGEKLHIYKEENLSNVEWRKTEISTNQPLTWYK  589


 Score =   119 bits (298),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/97 (59%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             + VF+ P G+DP+ALNL +MGKGEAWVNGQSIGRYWVS+H   G PSQT Y+VPR+FLK 
Sbjct  589   KIVFNTPSGDDPVALNLSTMGKGEAWVNGQSIGRYWVSFHNSKGDPSQTLYHVPRAFLKT  648

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITL--DKDILLRR  1755
             + NLLVL EE  G+P  I+L+ +S T   D +I+  +
Sbjct  649   SENLLVLLEEANGDPLHISLETISRTDLPDHEIMFSQ  685



>ref|XP_010029662.1| PREDICTED: beta-galactosidase 13-like [Eucalyptus grandis]
Length=784

 Score =   330 bits (847),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 169/365 (46%), Positives = 238/365 (65%), Gaps = 9/365 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAED+A+ VA F + KNG+  NYYMY+GGTNFGRT +SF+ T YYD+AP
Sbjct  204   YRVFGDPPSQRSAEDLAYSVARFFS-KNGTLANYYMYYGGTNFGRTPSSFVTTRYYDEAP  262

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             +DEYGLLREPKW HL++LH+A+++C + LL  TP+  +L +  +A V+    +G CAAFL
Sbjct  263   IDEYGLLREPKWGHLRDLHSALRLCKKALLWGTPTVQNLGEGLEAQVYEKPGTGICAAFL  322

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN  +   +V F+   Y LP +SISIL DCKTV +NT  V +Q ++R    +   +   
Sbjct  323   SNNSTRLPRQVMFKGIEYYLPQRSISILVDCKTVVYNTGTVVSQHSSRKYHQSEIANKNL  382

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPK------SAIS  856
              WE + + +    D  I++ + L+ ++TTKD +DYLWY  S++   +D          + 
Sbjct  383   RWEMWRDNIPTTSDAPIKSKSPLELMSTTKDTTDYLWYATSIKLYPTDLPFRKDIIPVLQ  442

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V +LGH++H FVNGE  GS HG+    SF L+  + L  G+NNISLLSATVGLP+SGAY+
Sbjct  443   VANLGHLMHAFVNGEYIGSGHGSNIEKSFVLQKPIELKPGLNNISLLSATVGLPDSGAYM  502

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REFSSSQP  1210
             EH+  G  KVT++  + G+ DLS + W ++VGL GE L +Y + GS+ VQW +     QP
Sbjct  503   EHRFAGVHKVTLKGLNTGTLDLSLNGWAHKVGLDGEKLHVYRQGGSHRVQWTKAKKHGQP  562

Query  1211  LIWYK  1225
             L WYK
Sbjct  563   LTWYK  567


 Score =   106 bits (265),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 66/93 (71%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +  FD PEGNDP+ + LG+M KG AWVNG+SIGRYW SY +    PSQ  Y+VPR+FLKP
Sbjct  567   KAYFDAPEGNDPVVMQLGTMSKGMAWVNGKSIGRYWSSYLSPLERPSQDVYHVPRAFLKP  626

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             T NLLVL EE  GNP G+ +    +T+ +D++ 
Sbjct  627   TDNLLVLLEEIGGNPEGVKI----LTVSRDVVC  655



>ref|XP_008811847.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 11-like [Phoenix 
dactylifera]
Length=905

 Score =   333 bits (854),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 163/366 (45%), Positives = 229/366 (63%), Gaps = 7/366 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     R+AED+A+ V  F + KNG+ +NYYMYHGGTNFGR  ++F++T YYD+AP
Sbjct  329   YRVFGDPPSQRAAEDLAYAVTRFFSAKNGTLVNYYMYHGGTNFGREGSAFVMTRYYDEAP  388

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL +EPK+ HL+++H A+++C + L    PST +L +  +  ++       CAAFL
Sbjct  389   LDEYGLYKEPKFGHLRDVHHALRLCRKALFYGNPSTQNLGKGYEVVIYEKPERKVCAAFL  448

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N + +    V F+   Y LP +SISILPDCKTV FN+ +   Q N RT   A +     
Sbjct  449   TNTNPRIDGTVNFRGVEYSLPRRSISILPDCKTVVFNSQRTMAQHNARTFHTAKETTEKN  508

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KSAIS  856
             +W  ++E +  F DT + +   L+ +N TKD +DYLWYT S + +S D P     +  + 
Sbjct  509   KWWMYQEYIPKFRDTKVTSRQPLELMNMTKDTTDYLWYTTSFKLDSEDLPMRHDIRPVLQ  568

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V SLGH +H FVNG   G+ HG+    SF     + LN+G N+I++L  T+GLPNSGAYL
Sbjct  569   VSSLGHAIHAFVNGFYIGTGHGSHVEKSFVFTKPMDLNRGYNHITILGLTIGLPNSGAYL  628

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPL  1213
             EH+  G   V I+  + G+ DLSN+ WG++VGL GE L I+TE+G   VQW E  S  P 
Sbjct  629   EHRLAGVHTVGIQGLNAGTLDLSNNRWGHRVGLDGERLGIFTEEGLKNVQWTEAKSDTPA  688

Query  1214  IWYKEW  1231
              WYK +
Sbjct  689   TWYKRY  694


 Score =   106 bits (265),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P GNDP++LN+ SMGKG AWVNG+ IGRYWVSY    G PSQ+ Y+VPRS+LKP  N
Sbjct  695   FDAPRGNDPVSLNMTSMGKGRAWVNGECIGRYWVSYLDPYGKPSQSTYHVPRSWLKPKDN  754

Query  1660  LLVLFEEEYGNPYGITL  1710
             LLVLFEE+ G P  I +
Sbjct  755   LLVLFEEQGGKPEDIII  771



>gb|EMS61058.1| Beta-galactosidase 7 [Triticum urartu]
Length=839

 Score =   331 bits (849),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 179/369 (49%), Positives = 244/369 (66%), Gaps = 19/369 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+D  +RS EDIAF VALFIARK GS+++YYMYHGGTNFGR A+S++ TSYYD AP
Sbjct  290   YPIYGNDTKLRSTEDIAFAVALFIARKKGSFVSYYMYHGGTNFGRFASSYVTTSYYDGAP  349

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+  P W HLKELHAA+ + S+ LL  T S+FSL Q Q+A++F  ++   C AFL
Sbjct  350   LDEYGLIWRPTWGHLKELHAAVNLSSEPLLFGTYSSFSLGQEQEAHIF--ETELKCVAFL  407

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D   S  V F+N S+QL PKSISIL +C+TV F TAKVT Q  +RT   A   +ST 
Sbjct  408   VNFDKHQSPTVVFRNMSFQLAPKSISILSECRTVVFETAKVTAQYGSRT---AKAVESTN  464

Query  695   eweefeeLVVGFDDTNIRA----DTLLDHINTTKDVSDYLWYTLSLQQESSDPKS--AIS  856
             +   ++       +   +A    + L +H++ TKD +DYLWY +S +   SD      ++
Sbjct  465   DIHRWKAFKEPIPEDISKAAYTGNQLFEHLSMTKDETDYLWYIVSYEYRPSDDGQLMLLN  524

Query  857   VESLGHVLHIFVNGELAGSAHGTFRN-SSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             VES  HVLH FVN E  GS HG+     +  L + +SL +G N ISLLS  VG P+SGA+
Sbjct  525   VESRAHVLHAFVNTEYVGSVHGSHDGPGNIILNTNISLKEGQNTISLLSVMVGSPDSGAH  584

Query  1034  LEHKTLGPRKVTIESSEGSED---LSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS--  1198
             +E ++ G RKV+I+  +G +    L+N+ WGYQVGL GE  +IYT++ +++V+W E +  
Sbjct  585   MERRSFGIRKVSIQ--QGQQPLYLLNNELWGYQVGLYGEGKRIYTQEEASSVEWTEINNL  642

Query  1199  SSQPLIWYK  1225
             +  PL WYK
Sbjct  643   TYHPLTWYK  651


 Score =   112 bits (280),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P GND +ALNL SMGKGE WVNG+SIGRYWVS+   +G PSQ+ Y++P+ FLKP
Sbjct  651   KTTFAAPVGNDVVALNLTSMGKGEVWVNGESIGRYWVSFKAPSGQPSQSLYHIPQHFLKP  710

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               NLLVL EE  GNP  ITL+ VSIT
Sbjct  711   IDNLLVLVEEIGGNPLEITLNTVSIT  736



>ref|XP_009419064.1| PREDICTED: beta-galactosidase 11-like [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   329 bits (844),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 163/366 (45%), Positives = 225/366 (61%), Gaps = 8/366 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIA+ VA F + KNG+ +NYYMYHGGTNFGRT A+F++T YYD+AP
Sbjct  203   YRVFGDPPSQRSAEDIAYSVARFFS-KNGTLVNYYMYHGGTNFGRTGAAFVMTRYYDEAP  261

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL +EPKW HL++LH A+K+CS+ LL  +PS  S     +A ++       C AFL
Sbjct  262   LDEYGLPKEPKWGHLRDLHYALKLCSKALLKGSPSVQSFGSGFEARLYEIPEDNVCVAFL  321

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N + +    V+F+ + Y LP +SISILPDCKTV +N   V +Q N RT  PA +     
Sbjct  322   TNTNARRDGTVKFRGTEYFLPRRSISILPDCKTVVYNNQMVNSQHNARTFNPAKEDSKNN  381

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESS------DPKSAIS  856
             +W+ + E      DT+I+A    + +N TKD +DYLWY  S   E        D +  + 
Sbjct  382   KWQMYVEQPPSVRDTSIKAKGPQELVNMTKDTTDYLWYATSFNLEKDDLSMRHDIRPVLQ  441

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V  LGH +H FVNG+  GS HGT    SF  +  + L  G N++++L  TVGLP+SGAYL
Sbjct  442   VSHLGHAMHAFVNGKYIGSGHGTKIEKSFVFQKPMDLQAGTNDVAILGMTVGLPDSGAYL  501

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPL  1213
             EH+  G   V ++  + GS DLS + WG++V + GE   IY EK  ++ +W +  S  P+
Sbjct  502   EHRLSGVHTVVVQGLNAGSLDLSQNVWGHKVAMEGERKAIYDEKKVDSFKWEDPKSDSPI  561

Query  1214  IWYKEW  1231
              WYK +
Sbjct  562   TWYKRY  567


 Score =   103 bits (257),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%), Gaps = 4/87 (5%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P G DP+A++L SMGKG+ WVNG+SIGRYWVSY +  G PSQ+ Y+VPRSFLK   N
Sbjct  568   FDAPNGKDPVAVDLKSMGKGQVWVNGESIGRYWVSYLSPLGKPSQSIYHVPRSFLKSKDN  627

Query  1660  LLVLFEEEYGNPYGITLDKVSITLDKD  1740
             L+V+FEE  G P  I +    +T+ +D
Sbjct  628   LMVVFEERGGKPEDILI----MTVKRD  650



>gb|KCW56611.1| hypothetical protein EUGRSUZ_I02332, partial [Eucalyptus grandis]
Length=823

 Score =   330 bits (847),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 169/367 (46%), Positives = 239/367 (65%), Gaps = 9/367 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAED+A+ VA F + KNG+  NYYMY+GGTNFGRT +SF+ T YYD+AP
Sbjct  262   YRVFGDPPSQRSAEDLAYSVARFFS-KNGTLANYYMYYGGTNFGRTPSSFVTTRYYDEAP  320

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             +DEYGLLREPKW HL++LH+A+++C + LL  TP+  +L +  +A V+    +G CAAFL
Sbjct  321   IDEYGLLREPKWGHLRDLHSALRLCKKALLWGTPTVQNLGEGLEAQVYEKPGTGICAAFL  380

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN  +   +V F+   Y LP +SISIL DCKTV +NT  V +Q ++R    +   +   
Sbjct  381   SNNSTRLPRQVMFKGIEYYLPQRSISILVDCKTVVYNTGTVVSQHSSRKYHQSEIANKNL  440

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPK------SAIS  856
              WE + + +    D  I++ + L+ ++TTKD +DYLWY  S++   +D          + 
Sbjct  441   RWEMWRDNIPTTSDAPIKSKSPLELMSTTKDTTDYLWYATSIKLYPTDLPFRKDIIPVLQ  500

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V +LGH++H FVNGE  GS HG+    SF L+  + L  G+NNISLLSATVGLP+SGAY+
Sbjct  501   VANLGHLMHAFVNGEYIGSGHGSNIEKSFVLQKPIELKPGLNNISLLSATVGLPDSGAYM  560

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REFSSSQP  1210
             EH+  G  KVT++  + G+ DLS + W ++VGL GE L +Y + GS+ VQW +     QP
Sbjct  561   EHRFAGVHKVTLKGLNTGTLDLSLNGWAHKVGLDGEKLHVYRQGGSHRVQWTKAKKHGQP  620

Query  1211  LIWYKEW  1231
             L WYK +
Sbjct  621   LTWYKAY  627


 Score =   106 bits (265),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 66/93 (71%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +  FD PEGNDP+ + LG+M KG AWVNG+SIGRYW SY +    PSQ  Y+VPR+FLKP
Sbjct  625   KAYFDAPEGNDPVVMQLGTMSKGMAWVNGKSIGRYWSSYLSPLERPSQDVYHVPRAFLKP  684

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             T NLLVL EE  GNP G+ +    +T+ +D++ 
Sbjct  685   TDNLLVLLEEIGGNPEGVKI----LTVSRDVVC  713



>ref|XP_007041848.1| Beta-galactosidase 14 isoform 2 [Theobroma cacao]
 gb|EOX97679.1| Beta-galactosidase 14 isoform 2 [Theobroma cacao]
Length=666

 Score =   326 bits (836),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 226/366 (62%), Gaps = 14/366 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAED+A+ VA F + KNGS +NYYMYHGGTN+GRT+A+F  T YYD+AP
Sbjct  278   YRVFGDPPSQRSAEDLAYSVARFFS-KNGSLVNYYMYHGGTNYGRTSAAFTTTRYYDEAP  336

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKW HLK+LH A+ +C + LL  +P+   L   Q+   ++   +  CAAFL
Sbjct  337   LDEYGLQRDPKWGHLKDLHKALNLCKKALLWGSPTVQKLGPDQEVRTYKQPGTSLCAAFL  396

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NND +++    F+   Y+LP +SISILPDCKTV +NT  +T Q NTR    +    +T 
Sbjct  397   ANNDTQNAQTFHFRGKQYRLPARSISILPDCKTVVYNTQMITAQHNTRNFVRS----ATA  452

Query  695   eweefeeLVVGFDDTNIRADTL--LDHINTTKDVSDYLWYTLSLQQESSDPK------SA  850
                   ++   +  T + + T   ++    TKD +DY WYT S++    D          
Sbjct  453   NKNFNWQMYKEYVPTQLGSMTKEPMELYELTKDTTDYAWYTTSIELGPRDLPMKKEIFPV  512

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             + V SLGH L  FVNGE  G AHG+    SF  +  V L  G+N I+LL   VGLP+SGA
Sbjct  513   LRVASLGHGLLAFVNGEYIGFAHGSKVEKSFVFQKPVKLKAGVNQITLLGTLVGLPDSGA  572

Query  1031  YLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ  1207
             Y+EH+  GPR +TI   + G+ DLS + WG+QVGL GE  +IYTEKGS  V+WR+ S S 
Sbjct  573   YMEHRFAGPRSITILGLNTGTLDLSVNGWGHQVGLNGEKKKIYTEKGSTKVEWRKLSESP  632

Query  1208  PLIWYK  1225
              L WYK
Sbjct  633   ALTWYK  638



>ref|XP_007041849.1| Beta-galactosidase 14 isoform 3 [Theobroma cacao]
 gb|EOX97680.1| Beta-galactosidase 14 isoform 3 [Theobroma cacao]
Length=692

 Score =   326 bits (836),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 226/366 (62%), Gaps = 14/366 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAED+A+ VA F + KNGS +NYYMYHGGTN+GRT+A+F  T YYD+AP
Sbjct  278   YRVFGDPPSQRSAEDLAYSVARFFS-KNGSLVNYYMYHGGTNYGRTSAAFTTTRYYDEAP  336

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKW HLK+LH A+ +C + LL  +P+   L   Q+   ++   +  CAAFL
Sbjct  337   LDEYGLQRDPKWGHLKDLHKALNLCKKALLWGSPTVQKLGPDQEVRTYKQPGTSLCAAFL  396

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NND +++    F+   Y+LP +SISILPDCKTV +NT  +T Q NTR    +    +T 
Sbjct  397   ANNDTQNAQTFHFRGKQYRLPARSISILPDCKTVVYNTQMITAQHNTRNFVRS----ATA  452

Query  695   eweefeeLVVGFDDTNIRADTL--LDHINTTKDVSDYLWYTLSLQQESSDPK------SA  850
                   ++   +  T + + T   ++    TKD +DY WYT S++    D          
Sbjct  453   NKNFNWQMYKEYVPTQLGSMTKEPMELYELTKDTTDYAWYTTSIELGPRDLPMKKEIFPV  512

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             + V SLGH L  FVNGE  G AHG+    SF  +  V L  G+N I+LL   VGLP+SGA
Sbjct  513   LRVASLGHGLLAFVNGEYIGFAHGSKVEKSFVFQKPVKLKAGVNQITLLGTLVGLPDSGA  572

Query  1031  YLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ  1207
             Y+EH+  GPR +TI   + G+ DLS + WG+QVGL GE  +IYTEKGS  V+WR+ S S 
Sbjct  573   YMEHRFAGPRSITILGLNTGTLDLSVNGWGHQVGLNGEKKKIYTEKGSTKVEWRKLSESP  632

Query  1208  PLIWYK  1225
              L WYK
Sbjct  633   ALTWYK  638



>ref|XP_009406477.1| PREDICTED: beta-galactosidase 11-like [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   328 bits (841),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 170/366 (46%), Positives = 227/366 (62%), Gaps = 8/366 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAED+A+ VA F + KNG+  NYYMYHGGTNFGRT A+F++T YYD+AP
Sbjct  203   YRVFGDPPSQRSAEDLAYSVARFFS-KNGTLTNYYMYHGGTNFGRTGAAFVMTRYYDEAP  261

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL +EPKW HLK+LH A+K+C + LL  TPS        +A ++    S  C AFL
Sbjct  262   LDEYGLQKEPKWGHLKDLHNALKLCRKGLLWGTPSVQKFDAGFEARLYEIPESKVCVAFL  321

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N + K    + F+   Y LP  SISILPDCKTV FN+ +V +Q N RT   A       
Sbjct  322   TNTNAKKDGVMNFRGVEYYLPRHSISILPDCKTVVFNSQQVNSQHNARTFDVAKAAKENN  381

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KSAIS  856
             +W+ + E +    D N+ A   L+ +N TKD +DYLWYT S + +  D P     +  + 
Sbjct  382   QWQMYTEQIPTSRDANVSAKGPLELLNMTKDTTDYLWYTTSFKLDDDDLPMRHDIRPVLQ  441

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V +LGH +H FVNG+  GS HGT    SF  +  + L  G+N I++L  TVGLP+SGAYL
Sbjct  442   VSNLGHAMHAFVNGKYIGSGHGTKIEKSFVFQKPMDLKAGVNQIAILGLTVGLPDSGAYL  501

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPL  1213
             EH+  G   V I+  + G+ DLS + W +QVGL GENL I+ E+ +NAV+W E  S   +
Sbjct  502   EHRLSGVHTVVIQGLNAGTLDLSQNLWRHQVGLAGENLGIFDEQRANAVKWEEAQSDTAV  561

Query  1214  IWYKEW  1231
              WYK +
Sbjct  562   TWYKRY  567


 Score =   104 bits (259),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 64/87 (74%), Gaps = 4/87 (5%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P GNDP+A+++ SMGKG+ W+NG+SIGR+WVSY +  G  SQ+ Y+VPRSFLKP  N
Sbjct  568   FDAPSGNDPVAVDMNSMGKGQVWINGESIGRFWVSYLSPLGKASQSIYHVPRSFLKPKNN  627

Query  1660  LLVLFEEEYGNPYGITLDKVSITLDKD  1740
             L+V+FEE  G P  I +    +T+ +D
Sbjct  628   LMVVFEEHGGKPKDIVI----LTVKRD  650



>ref|XP_008447961.1| PREDICTED: beta-galactosidase 13-like [Cucumis melo]
Length=828

 Score =   329 bits (844),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 164/365 (45%), Positives = 227/365 (62%), Gaps = 10/365 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     R+AEDIAF VA F + KNGS +NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  266   YRVFGDPPSQRAAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSAVFTTTRYYDEAP  324

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDE+GL REPKW HL+++H A+ +C + LL  TP T  + +  +A  +    +  CAAFL
Sbjct  325   LDEFGLQREPKWGHLRDVHKALNLCKKPLLWGTPGTQVMGKGLEARFYEKPGTNICAAFL  384

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NND K++  + F+   Y LPP+SISILPDCKTV FNT  + +Q N R   P+ K  +  
Sbjct  385   ANNDTKNAQTINFRGREYLLPPRSISILPDCKTVVFNTETIVSQHNARNFVPS-KVANNL  443

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKS------AIS  856
             +W+   E +       +     L+  +  KD +DY WYT S++ E  D          + 
Sbjct  444   KWKMSPETIPTVQQVPVNNKIPLELYSLLKDTTDYGWYTTSIELEKEDVSKRPDILPVLR  503

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             + SLGH + +FVNGE  G+AHG+    +F  + +V    G+N+I+LL   VGLP+SGAY+
Sbjct  504   IASLGHAILVFVNGEYIGTAHGSHEEKNFVFQGSVPFKAGVNDIALLGVLVGLPDSGAYM  563

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ-P  1210
             EH+  GPR VTI   + G+ D+S + WG+QVGL GE +++YT+ GS+ V W E    +  
Sbjct  564   EHRFAGPRSVTILGLNTGTLDISKNGWGHQVGLQGEKVRVYTQGGSHRVDWSEIKEEKSA  623

Query  1211  LIWYK  1225
             L WYK
Sbjct  624   LTWYK  628


 Score = 99.4 bits (246),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 66/93 (71%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEGNDP+A+ +  MGKG+ WVNG+SIGRYW+SY +    P+Q+ Y++PRSF+KP
Sbjct  628   KTYFDAPEGNDPVAVRMNGMGKGQIWVNGKSIGRYWMSYLSPLKLPTQSEYHIPRSFIKP  687

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             + NLLV+ EEE   P  + +    + +++D + 
Sbjct  688   SENLLVILEEENFTPEKVEI----LVVNRDTIC  716



>ref|XP_010935389.1| PREDICTED: beta-galactosidase 11-like [Elaeis guineensis]
Length=843

 Score =   328 bits (841),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 171/385 (44%), Positives = 233/385 (61%), Gaps = 8/385 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIA+ VA F + KNG+ +NYYMYHGGTNFGR  AS+++T YYD+AP
Sbjct  272   YRVFGDPPSQRSAEDIAYSVARFFS-KNGTLVNYYMYHGGTNFGREGASYVMTRYYDEAP  330

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGLL+EPK+ HL++LH A+K+  + LL   PS   L ++ +A ++    S  C AFL
Sbjct  331   LDEYGLLKEPKYGHLRDLHQALKLSRKGLLWGVPSVQPLGEWYEARLYESPESNVCVAFL  390

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N + +    V F+ + Y LP +SISILPDCKTV FNT  V  Q N RT +        +
Sbjct  391   TNTNPRVDGTVNFRGTDYFLPHRSISILPDCKTVVFNTQMVNAQHNARTFRTEDVTRKND  450

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPKSAIS  856
             +W+ F+E +  F    I A   LD  N TKD++DY+WYT   + E        D +  + 
Sbjct  451   KWQMFQERIPKFLKKGIVASRPLDLYNMTKDITDYMWYTTRFRLEDVDLPMRPDIRPVLL  510

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V SLGH +H FVNG   GS HG     SF  +  + L +G+N+IS+L  TVG P++GAYL
Sbjct  511   VSSLGHAMHAFVNGIYIGSGHGAKLEKSFVFQKPMDLKQGVNHISILGMTVGFPDNGAYL  570

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPL  1213
             EH+  G     I+  + G+ DLS + WG++VG+ GE L IYTE+GS  V+W E  S QP+
Sbjct  571   EHRLAGVHTAAIQGLNTGTLDLSPNKWGHEVGMKGEKLGIYTEEGSKKVKWTEAKSGQPV  630

Query  1214  IWYKEWRTIKKVYLPARAVKTGFAR  1288
              WYK +  +     P     TG  +
Sbjct  631   TWYKRYFDMPSGNDPVALDMTGMGK  655


 Score =   103 bits (256),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 63/87 (72%), Gaps = 4/87 (5%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P GNDP+AL++  MGKG AWVNG  IGRYWVSY +  G PSQ+ Y+VPR +LKP  N
Sbjct  637   FDMPSGNDPVALDMTGMGKGLAWVNGNCIGRYWVSYLSPLGKPSQSVYHVPRGWLKPKDN  696

Query  1660  LLVLFEEEYGNPYGITLDKVSITLDKD  1740
             LLV+FEE  GNP G+ +    +T+ +D
Sbjct  697   LLVIFEESGGNPEGLLV----VTVKRD  719



>gb|ACC64531.1| beta-galactosidase 6 [Oryza sativa Indica Group]
Length=811

 Score =   327 bits (839),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 173/364 (48%), Positives = 231/364 (63%), Gaps = 9/364 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+D  +R  EDIAF VAL+IARK GS+++YYMYHGGTNFGR AAS++ TSYYD AP
Sbjct  262   YPIYGNDTKLRDPEDIAFAVALYIARKKGSFVSYYMYHGGTNFGRFAASYVTTSYYDGAP  321

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+ +P W HL+ELH A+K  S+ LL  + S FSL Q Q+A+VF  D    C AFL
Sbjct  322   LDEYGLIWQPTWGHLRELHCAVKQSSEPLLFGSYSNFSLGQQQEAHVFETDFK--CVAFL  379

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKF-DST  691
             +N D  ++ KV+F+N S +L PKSIS+L DC+ V F TAKV  Q  +RT        D  
Sbjct  380   VNFDQHNTPKVEFRNISLELAPKSISVLSDCRNVVFETAKVNAQHGSRTANAVQSLNDIN  439

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPK--SAISVES  865
                   E +      +    + L + + TTKD +DYLWY +S +  +SD    + + V+S
Sbjct  440   NWKAFIEPVPQDLSKSTYTGNQLFEQLPTTKDETDYLWYIVSYKNRASDGNQIARLYVKS  499

Query  866   LGHVLHIFVNGELAGSAHGTFRNS-SFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEH  1042
             L H+LH FVN E  GS HG+     +  L + +SL +G N ISLLS  VG P+SGAY+E 
Sbjct  500   LAHILHAFVNNEYVGSVHGSHDGPRNIVLNTHMSLKEGDNTISLLSVMVGSPDSGAYMER  559

Query  1043  KTLGPRKVTIESSEGSED-LSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--SQPL  1213
             +T G + V I+  +     L+ND WGYQVGL GE   IYT++G N+V+W + ++    PL
Sbjct  560   RTFGIQTVGIQQGQQPMHLLNNDLWGYQVGLFGEKDSIYTQEGPNSVRWMDINNLIYHPL  619

Query  1214  IWYK  1225
              WYK
Sbjct  620   TWYK  623


 Score =   107 bits (266),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P GND + LNL SMGKGE WVNG+SIGRYWVS+   +G PSQ+ Y++PR FL P
Sbjct  623   KTTFSTPPGNDAVTLNLTSMGKGEVWVNGESIGRYWVSFKAPSGQPSQSLYHIPRGFLTP  682

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               NLLVL EE  G+P  IT++ +S+T
Sbjct  683   KDNLLVLVEEMGGDPLQITVNTMSVT  708



>ref|XP_010233215.1| PREDICTED: beta-galactosidase 7 [Brachypodium distachyon]
Length=824

 Score =   327 bits (839),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 173/364 (48%), Positives = 233/364 (64%), Gaps = 9/364 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+D  +RS  DI F VALFIARK GS+++YYMYHGGTNFGR A+S++ TSYYD AP
Sbjct  275   YPIYGNDTKLRSTGDITFAVALFIARKGGSFVSYYMYHGGTNFGRFASSYVTTSYYDGAP  334

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+ +P W HLKELHAA+K+ S+ LL  T S FSL + Q+A+VF  ++   C AFL
Sbjct  335   LDEYGLIWQPTWGHLKELHAAVKLSSEPLLYGTYSNFSLGEDQEAHVF--ETKLKCVAFL  392

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D      V F+N S QL PKSISIL DC+TV F T KV  Q  +RT +     + T 
Sbjct  393   VNFDKHQRPTVIFRNISLQLAPKSISILSDCRTVVFETGKVNAQHGSRTAEVVQSLNDTH  452

Query  695   e-weefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAI--SVES  865
                   E +             L +H++TTKD +DYLWY  S +   SD    +  +VES
Sbjct  453   TWKAFKESIPQDISKAAYTGKQLFEHLSTTKDETDYLWYIASYEYRPSDDSHLVLLNVES  512

Query  866   LGHVLHIFVNGELAGSAHGTFRNSSF-TLESTVSLNKGMNNISLLSATVGLPNSGAYLEH  1042
               H+LH FVNGE  GS HG+     +  L  T+SL +G N ISLL+  VG P+SGA++E 
Sbjct  513   QAHILHAFVNGEFVGSVHGSHGARGYIILNMTISLKEGQNTISLLNVMVGSPDSGAHMER  572

Query  1043  KTLGPRKVTIESSEGS-EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS--SSQPL  1213
             ++ G  KV+I+  + +   L+N+ WGYQVGL GE  +IYT++GS++V+W + +  +  PL
Sbjct  573   RSFGIHKVSIQQGQHALHLLNNELWGYQVGLFGEGNRIYTQEGSHSVEWTDVNNLTYLPL  632

Query  1214  IWYK  1225
              WY+
Sbjct  633   TWYQ  636


 Score =   111 bits (278),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             QT F  P GND + LNL SMGKGE W+NG+SIGRYWVS+ T +G PSQ+ Y++P+ FLK 
Sbjct  636   QTTFATPMGNDAVTLNLTSMGKGEVWINGESIGRYWVSFKTPSGQPSQSLYHIPQHFLKN  695

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             T NLLVL EE  GNP  IT++ VSIT
Sbjct  696   TDNLLVLVEEMGGNPLQITVNTVSIT  721



>gb|AAS76480.1| beta-galactosidase [Gossypium hirsutum]
Length=843

 Score =   328 bits (840),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 176/388 (45%), Positives = 240/388 (62%), Gaps = 16/388 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAED+A+ VA F + KNGS +NYYM++GGTNFGRT+ASF  T YYD+ P
Sbjct  282   YRVFGDPPSQRSAEDLAYSVARFFS-KNGSMVNYYMHYGGTNFGRTSASFTTTRYYDEGP  340

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDE+GL REPKW HLK++H A+ +C + L    P+T  L   QQA V++   + ACAAFL
Sbjct  341   LDEFGLQREPKWGHLKDVHRALSLCKRALFWGFPTTLKLGPDQQAIVWQQPGTSACAAFL  400

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTM---QPALKFD  685
              NN+ + +  V F+    +LP +SIS+LPDCKTV FNT  VTTQ N+R     + A K  
Sbjct  401   ANNNTRLAQHVNFRGQDIRLPARSISVLPDCKTVVFNTQLVTTQHNSRNFVRSEIANKNF  460

Query  686   STeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD------PKS  847
             + E   E   + +GF     + D   +  + TKD +DY WYT SL     D       + 
Sbjct  461   NWEMCREVPPVGLGF-----KFDVPRELFHLTKDTTDYAWYTTSLLLGRRDLPMKKNVRP  515

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              + V SLGH +H +VNGE AGSAHG+    SF L+  VSL +G N+I+LL   VGLP+SG
Sbjct  516   VLRVASLGHGIHAYVNGEYAGSAHGSKVEKSFVLQRAVSLKEGENHIALLGYLVGLPDSG  575

Query  1028  AYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS  1204
             AY+E +  GPR +TI   + G+ D+S + WG+QVG+ GE  +++TE+GS +VQW +    
Sbjct  576   AYMEKRFAGPRSITILGLNTGTLDISQNGWGHQVGIDGEKKKLFTEEGSKSVQWTKPDQG  635

Query  1205  QPLIWYKEWRTIKKVYLPARAVKTGFAR  1288
              PL WYK +    +   P   V TG  +
Sbjct  636   GPLTWYKGYFDAPEGDNPVAIVMTGMGK  663


 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 64/90 (71%), Gaps = 5/90 (6%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD PEG++P+A+ +  MGKG  WVNG+SIGRYW +Y +    P+Q+ Y++PR++LKP  N
Sbjct  645   FDAPEGDNPVAIVMTGMGKGMVWVNGRSIGRYWNNYLSPLKKPTQSEYHIPRAYLKPK-N  703

Query  1660  LLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             L+VL EEE GNP  + +    +T+++D + 
Sbjct  704   LIVLLEEEGGNPKDVHI----VTVNRDTIC  729



>dbj|BAC10578.2| beta-galactosidase [Capsicum annuum]
Length=724

 Score =   325 bits (832),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 182/371 (49%), Positives = 233/371 (63%), Gaps = 26/371 (7%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QAPLD  340
             +G     R AEDIAF VA F+ + NGSY NYYMYHGGTNFGRT++   I + YD  AP+D
Sbjct  259   FGGPIPQRPAEDIAFSVARFV-QNNGSYFNYYMYHGGTNFGRTSSGLFIATSYDYDAPID  317

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             EYGLL EPK+ HL+ELH AIK C   L+S+ P+  SL   Q+A+V+R   SGACAAFL N
Sbjct  318   EYGLLNEPKYGHLRELHKAIKQCEPALVSSYPTVTSLGSNQEAHVYR-SKSGACAAFLSN  376

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPA---LKFDST  691
              D K+S +V FQN  Y LPP SISILPDCKTV +NTAKV++Q ++  M PA   L + S 
Sbjct  377   YDAKYSVRVSFQNLPYDLPPWSISILPDCKTVVYNTAKVSSQGSSIKMTPAGGGLSWQSY  436

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPKSAI  853
              E     +     D   +RA+ L +  N T+D SDYLWY   +   S      S     +
Sbjct  437   NEDTPTAD-----DSDTLRANGLWEQRNVTRDSSDYLWYMTDINIASNEGFLKSGKDPYL  491

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             +V S GHVLH+FVNG+LAG+ +G   N   T    V LN G+N ISLLS +VGLPN G +
Sbjct  492   TVMSAGHVLHVFVNGKLAGTVYGALDNPKLTYSGNVKLNAGINKISLLSVSVGLPNVGVH  551

Query  1034  LE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS-  1198
              +      LGP  VT+   +EGS DL+   W Y+VGL GE+L ++T  GS++V+W + S 
Sbjct  552   YDTWNAGVLGP--VTLSGLNEGSRDLAKQKWSYKVGLKGESLSLHTLSGSSSVEWVQGSL  609

Query  1199  --SSQPLIWYK  1225
                +QPL WYK
Sbjct  610   VARTQPLTWYK  620


 Score = 92.0 bits (227),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 20/104 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +  F  P GN+PLAL++ SMGKG+ W+NG+ +GR+W  Y                     
Sbjct  620   KATFSAPGGNEPLALDMASMGKGQIWINGEGVGRHWPGYAAQGDCSKCSYAGTFNEKKCQ  679

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVS  1722
             T  G PSQ WY+VPRS+LK +GNLLV+FEE  G+P GI+L + S
Sbjct  680   TNCGQPSQRWYHVPRSWLKTSGNLLVVFEEWGGDPTGISLVRRS  723



>gb|AAK40304.1| beta-galactosidase [Capsicum annuum]
Length=724

 Score =   325 bits (832),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 182/371 (49%), Positives = 233/371 (63%), Gaps = 26/371 (7%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QAPLD  340
             +G     R AEDIAF VA F+ + NGSY NYYMYHGGTNFGRT++   I + YD  AP+D
Sbjct  259   FGGPIPQRPAEDIAFSVARFV-QNNGSYFNYYMYHGGTNFGRTSSGLFIATSYDYDAPID  317

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             EYGLL EPK+ HL+ELH AIK C   L+S+ P+  SL   Q+A+V+R   SGACAAFL N
Sbjct  318   EYGLLNEPKYGHLRELHKAIKQCEPALVSSYPTVTSLGSNQEAHVYR-SKSGACAAFLSN  376

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPA---LKFDST  691
              D K+S +V FQN  Y LPP SISILPDCKTV +NTAKV++Q ++  M PA   L + S 
Sbjct  377   YDAKYSVRVSFQNLPYDLPPWSISILPDCKTVVYNTAKVSSQGSSIKMTPAGGGLSWQSY  436

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPKSAI  853
              E     +     D   +RA+ L +  N T+D SDYLWY   +   S      S     +
Sbjct  437   NEDTPTAD-----DSDTLRANGLWEQRNVTRDSSDYLWYMTDVNIASNEGFLKSGKDPYL  491

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             +V S GHVLH+FVNG+LAG+ +G   N   T    V LN G+N ISLLS +VGLPN G +
Sbjct  492   TVMSAGHVLHVFVNGKLAGTVYGALDNPKLTYSGNVKLNAGINKISLLSVSVGLPNVGVH  551

Query  1034  LE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS-  1198
              +      LGP  VT+   +EGS DL+   W Y+VGL GE+L ++T  GS++V+W + S 
Sbjct  552   YDTWNAGVLGP--VTLSGLNEGSRDLAKQKWSYKVGLKGESLSLHTLSGSSSVEWVQGSL  609

Query  1199  --SSQPLIWYK  1225
                +QPL WYK
Sbjct  610   VARTQPLTWYK  620


 Score = 92.0 bits (227),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 63/104 (61%), Gaps = 20/104 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +  F  P GN+PLAL++ SMGKG+ W+NG+ +GR+W  Y                     
Sbjct  620   KATFSAPGGNEPLALDMASMGKGQIWINGEGVGRHWPGYAAQGDCSKCSYAGTFNEKKCQ  679

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVS  1722
             T  G PSQ WY+VPRS+LK +GNLLV+FEE  G+P GI+L + S
Sbjct  680   TNCGQPSQRWYHVPRSWLKTSGNLLVVFEEWGGDPTGISLVRRS  723



>ref|XP_007048528.1| Glycosyl hydrolase family 35 protein isoform 2 [Theobroma cacao]
 gb|EOX92685.1| Glycosyl hydrolase family 35 protein isoform 2 [Theobroma cacao]
Length=551

 Score =   319 bits (818),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 156/251 (62%), Positives = 199/251 (79%), Gaps = 2/251 (1%)
 Frame = +2

Query  155  YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
            YQVYG +  +RSA+DIAFHVALFIA+K GSYINYYMYHGGTNFGRTA++++ITSYYDQAP
Sbjct  298  YQVYGGEPNIRSAQDIAFHVALFIAKK-GSYINYYMYHGGTNFGRTASAYVITSYYDQAP  356

Query  335  LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
            LDEYGLLR+PKW HLKELHA IK CS  LL    + FS+ QFQQAYVF   S+G C AFL
Sbjct  357  LDEYGLLRQPKWGHLKELHAVIKNCSSPLLEGVQTNFSIGQFQQAYVFEEGSAG-CVAFL  415

Query  515  INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
            +NND  ++A +QF+N+S++L PKSISILPDC+ + FNTAKV TQ N R    +  FD+ +
Sbjct  416  VNNDSTNNATLQFRNNSFELLPKSISILPDCQNIIFNTAKVKTQPNKRITTSSKMFDAVD  475

Query  695  eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAISVESLGH  874
             WEEF +++  F DT+++A++LL+H+NTTKD SDYLWYTLS Q  SS  +  + +ESLGH
Sbjct  476  SWEEFRDVIPNFLDTSLQANSLLEHMNTTKDGSDYLWYTLSFQPNSSCTEPVLHIESLGH  535

Query  875  VLHIFVNGELA  907
            V+H ++N +L+
Sbjct  536  VVHSYINNKLS  546



>ref|XP_008656263.1| PREDICTED: beta-galactosidase 7-like isoform X3 [Zea mays]
Length=689

 Score =   322 bits (826),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 174/364 (48%), Positives = 231/364 (63%), Gaps = 10/364 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+D  +RS +DI F VALFIARKNGSY++YYMYHGGTNFGR A+S++ TSYYD AP
Sbjct  141   YLIYGNDTKLRSPQDITFAVALFIARKNGSYVSYYMYHGGTNFGRFASSYVTTSYYDGAP  200

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+ +P W HL+ELHAA+K  S+ LL  T S  S+ Q Q+A++F  ++   C AFL
Sbjct  201   LDEYGLIWQPTWGHLRELHAAVKQSSEPLLFGTYSNLSIGQEQEAHIFETETQ--CVAFL  258

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKF-DST  691
             +N D  H ++V F+N S +L PKSISIL DCK V F TAKV  Q  +RT +    F D +
Sbjct  259   VNFDQHHISEVVFRNISLELAPKSISILLDCKQVVFETAKVNAQHGSRTAEEVQSFSDIS  318

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKS--AISVES  865
                   E +      +    + L +H++TTKD +DYLWY +  +   SD      I+VES
Sbjct  319   TWKAFKEPIPQDVSKSAYSGNRLFEHLSTTKDATDYLWYIVGYEYTPSDDGQLVLINVES  378

Query  866   LGHVLHIFVNGELAGSAHGTFRNSSFTLEST-VSLNKGMNNISLLSATVGLPNSGAYLEH  1042
               H+LH FVN    G  HG+    +  + ST +SL +G N ISLLSA VG P+SGA++E 
Sbjct  379   RAHILHAFVNNAYVGRIHGSHGGPANIIFSTNISLQEGPNTISLLSAMVGSPDSGAHMER  438

Query  1043  KTLGPRKVTIESSEGSED-LSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS--SSQPL  1213
             +  G RKV+I+  +  E+ L+N+ WGYQVGL GE   IYT+  S   +W      +  PL
Sbjct  439   RVFGIRKVSIQQGQEPENLLNNELWGYQVGLFGERNNIYTQD-SKITEWTTIDNLTYSPL  497

Query  1214  IWYK  1225
              WYK
Sbjct  498   TWYK  501


 Score =   105 bits (263),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P GND + LNL  MGKGE WVNG+SIGRYWVS+   +G PSQ+ Y++PR FL P
Sbjct  501   KTTFSTPVGNDAVTLNLTGMGKGEVWVNGESIGRYWVSFKAPSGNPSQSLYHIPREFLNP  560

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               N LVLFEE  GNP  IT++ +S++
Sbjct  561   QDNTLVLFEEMGGNPQLITVNTMSVS  586



>ref|XP_007041847.1| Glycosyl hydrolase family 35 protein isoform 1 [Theobroma cacao]
 gb|EOX97678.1| Glycosyl hydrolase family 35 protein isoform 1 [Theobroma cacao]
Length=843

 Score =   326 bits (835),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 169/366 (46%), Positives = 226/366 (62%), Gaps = 14/366 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAED+A+ VA F + KNGS +NYYMYHGGTN+GRT+A+F  T YYD+AP
Sbjct  278   YRVFGDPPSQRSAEDLAYSVARFFS-KNGSLVNYYMYHGGTNYGRTSAAFTTTRYYDEAP  336

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKW HLK+LH A+ +C + LL  +P+   L   Q+   ++   +  CAAFL
Sbjct  337   LDEYGLQRDPKWGHLKDLHKALNLCKKALLWGSPTVQKLGPDQEVRTYKQPGTSLCAAFL  396

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NND +++    F+   Y+LP +SISILPDCKTV +NT  +T Q NTR    +    +T 
Sbjct  397   ANNDTQNAQTFHFRGKQYRLPARSISILPDCKTVVYNTQMITAQHNTRNFVRS----ATA  452

Query  695   eweefeeLVVGFDDTNIRADTL--LDHINTTKDVSDYLWYTLSLQQESSDPK------SA  850
                   ++   +  T + + T   ++    TKD +DY WYT S++    D          
Sbjct  453   NKNFNWQMYKEYVPTQLGSMTKEPMELYELTKDTTDYAWYTTSIELGPRDLPMKKEIFPV  512

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             + V SLGH L  FVNGE  G AHG+    SF  +  V L  G+N I+LL   VGLP+SGA
Sbjct  513   LRVASLGHGLLAFVNGEYIGFAHGSKVEKSFVFQKPVKLKAGVNQITLLGTLVGLPDSGA  572

Query  1031  YLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ  1207
             Y+EH+  GPR +TI   + G+ DLS + WG+QVGL GE  +IYTEKGS  V+WR+ S S 
Sbjct  573   YMEHRFAGPRSITILGLNTGTLDLSVNGWGHQVGLNGEKKKIYTEKGSTKVEWRKLSESP  632

Query  1208  PLIWYK  1225
              L WYK
Sbjct  633   ALTWYK  638


 Score =   100 bits (250),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD PEGN+P+A+ +  MGKG  W+NGQ+IGRYW+SY +    PSQ+ Y +PRSFLKPT N
Sbjct  641   FDTPEGNNPVAIRMTGMGKGMVWINGQNIGRYWMSYLSPLKQPSQSEYQIPRSFLKPTQN  700

Query  1660  LLVLFEEEYGNPYGITL  1710
             L+V+ EE+ GNP  + +
Sbjct  701   LIVILEEQEGNPKDVEI  717



>ref|XP_010266335.1| PREDICTED: beta-galactosidase 13-like [Nelumbo nucifera]
Length=831

 Score =   324 bits (831),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 165/365 (45%), Positives = 228/365 (62%), Gaps = 9/365 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     R+AED+AF VA F ++K G+  NYYMYHGGTN+GRT+A F+ T YYD+AP
Sbjct  260   YRVFGDPPSQRAAEDLAFAVARFFSKK-GTLNNYYMYHGGTNYGRTSADFVTTRYYDEAP  318

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL ++PKW HL++LHAA+++C + LL  TPS   L    +A +F    S  CAAFL
Sbjct  319   LDEYGLQKDPKWGHLRDLHAALRLCKKALLWGTPSVQKLENGVEARIFENSESKVCAAFL  378

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN+ +  A  +F+   Y  PP+SISILPDCKTV FNT  V +Q N+R+ + + + +   
Sbjct  379   CNNNTREPATAKFRGKEYYFPPRSISILPDCKTVVFNTQNVVSQHNSRSYKISKRANKNL  438

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KSAIS  856
             EWE + E +   D++ ++    L+ +N TKD SDYLWYT  +Q    D P        + 
Sbjct  439   EWEMYHEKIPIIDESPVKYKNPLELMNQTKDRSDYLWYTTKIQLTRDDLPFRRDIHPVLQ  498

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V + GHV+H F NGE  GS HG+    SFT +  V L  G N+I LL  TVG P+SGAYL
Sbjct  499   VSNFGHVMHTFANGEYVGSGHGSHIEKSFTFQKPVPLKPGTNHIQLLGMTVGFPDSGAYL  558

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQP  1210
               +  G  +V ++  + G+ DLS + WG+QVG+ GE  +I+T +G+  V W+E       
Sbjct  559   NIRLAGVHRVAVQGLNTGTLDLSANGWGHQVGVDGEKNEIFTPEGTEKVSWKEAKGGGHA  618

Query  1211  LIWYK  1225
             L WYK
Sbjct  619   LTWYK  623


 Score =   109 bits (272),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 69/93 (74%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG++P+ALNL SMGKG  WVNG+SIGRYWV Y +  G P+Q+ Y+VPR FLKP
Sbjct  623   KTYFDAPEGDNPVALNLTSMGKGMVWVNGKSIGRYWVDYKSPLGKPTQSEYHVPRVFLKP  682

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             +GNLLV+ EE  GNP  I +    +T+++D + 
Sbjct  683   SGNLLVVLEEMGGNPEEIKI----LTVNRDTIC  711



>ref|XP_006592069.1| PREDICTED: beta-galactosidase 13-like [Glycine max]
Length=843

 Score =   324 bits (831),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/368 (46%), Positives = 232/368 (63%), Gaps = 12/368 (3%)
 Frame = +2

Query  149   LSYQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQ  328
             + Y+V+G     RSAEDIAF VA F + KNGS +NYYMYHGGTNFGRT+++F  T YYD+
Sbjct  276   VQYRVFGDPPSRRSAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSSAFTTTQYYDE  334

Query  329   APLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAA  508
             APLDEYG+ REPKWSHL+++H A+ +C + L +   +   L+Q  +  VF    S  CAA
Sbjct  335   APLDEYGMQREPKWSHLRDVHKALSLCKKALFNGESTVTKLSQHHETIVFEKPGSDLCAA  394

Query  509   FLINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDS  688
             FL NN     A ++F+ + Y +PP+SISILPDCKTV FNT  + +Q N+R  + ++  ++
Sbjct  395   FLTNNHTLTPATIKFRGTDYYMPPRSISILPDCKTVVFNTQFIASQHNSRNFKRSMAANN  454

Query  689   TeeweefeeLVVGFD-DTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-PKS-----  847
              +     E +       TN +  T L   +  KD SDY WYT S++    D PK      
Sbjct  455   HKWEVYSENIPTTKQIPTNEKIPTEL--YSLLKDTSDYAWYTTSVELGPEDLPKKNDISP  512

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              + + SLGH L  FVNGE  GS HG+    SF  +  V+L  G+N I++L+ TVGLP+SG
Sbjct  513   VLRIMSLGHSLVAFVNGEFIGSNHGSHEEKSFEFQKPVTLKVGVNQIAILACTVGLPDSG  572

Query  1028  AYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS  1204
             AY+EH+  GP+ + I   + G  DL+++ WG++VG+ GE L I+TE+GS  VQW+E   S
Sbjct  573   AYMEHRFAGPKSIFILGLNSGKIDLASNGWGHKVGIKGEELGIFTEEGSKKVQWKEAKGS  632

Query  1205  QP-LIWYK  1225
              P L WYK
Sbjct  633   GPALSWYK  640


 Score = 99.4 bits (246),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 65/93 (70%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F+ PEG DP+A+ +  MGKG  W+NG+SIGR+W+SY +  G P+Q+ Y++PR+F  P
Sbjct  640   KTNFETPEGTDPVAIRMTGMGKGMIWINGKSIGRHWMSYLSPLGMPTQSEYHIPRAFFNP  699

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
               NL+V+FEEE  NP  + +    +T+D+D + 
Sbjct  700   KDNLIVVFEEEIANPEKVEI----LTVDRDTIC  728



>gb|AAL24374.1| beta-galactosidase [Arabidopsis thaliana]
 gb|AAM13351.1| beta-galactosidase [Arabidopsis thaliana]
Length=420

 Score =   312 bits (800),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 166/328 (51%), Positives = 215/328 (66%), Gaps = 9/328 (3%)
 Frame = +2

Query  260   MYHGGTNFGRTAASFMITSYYDQAPLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPS  439
             MYHGGTNFGRT++S+ IT YYDQAPLDEYGLLR+PK+ HLKELHAAIK  +  LL    +
Sbjct  1     MYHGGTNFGRTSSSYFITGYYDQAPLDEYGLLRQPKYGHLKELHAAIKSSANPLLQGKQT  60

Query  440   TFSLAQFQQAYVFRGDSSGACAAFLINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVA  619
               SL   QQAYVF  D++  C AFL+NND K S ++QF+N++Y L PKSI IL +CK + 
Sbjct  61    ILSLGPMQQAYVFE-DANNGCVAFLVNNDAKAS-QIQFRNNAYSLSPKSIGILQNCKNLI  118

Query  620   FNTAKVTTQSNTRTMQPALKFDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDY  799
             + TAKV  + NTR   P   F+  + W  F E +  F  T+++ + LL+H N TKD +DY
Sbjct  119   YETAKVNVKMNTRVTTPVQVFNVPDNWNLFRETIPAFPGTSLKTNALLEHTNLTKDKTDY  178

Query  800   LWYTLSLQQESSDPKSAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGM  979
             LWYT S + +S     +I  ES GHV+H+FVN  LAGS HG+       L++ VSL  G 
Sbjct  179   LWYTSSFKLDSPCTNPSIYTESSGHVVHVFVNNALAGSGHGSRDIRVVKLQAPVSLINGQ  238

Query  980   NNISLLSATVGLPNSGAYLEHKTLGPRKVTIESSEGSE--DLSNDSWGYQVGLLGENLQI  1153
             NNIS+LS  VGLP+SGAY+E ++ G  KV I S  G++  DLS   WGY VGLLGE +++
Sbjct  239   NNISILSGMVGLPDSGAYMERRSYGLTKVQI-SCGGTKPIDLSRSQWGYSVGLLGEKVRL  297

Query  1154  YTEKGSNAVQWR----EFSSSQPLIWYK  1225
             Y  K  N V+W         ++PL WYK
Sbjct  298   YQWKNLNRVKWSMNKAGLIKNRPLAWYK  325


 Score =   120 bits (302),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G+ P+ L++ SMGKGE WVNG+SIGRYWVS+ T AG PSQ+ Y++PR+FLKP
Sbjct  325   KTTFDGPNGDGPVGLHMSSMGKGEIWVNGESIGRYWVSFLTPAGQPSQSIYHIPRAFLKP  384

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
             +GNLLV+FEEE G+P GI+L+ +S+
Sbjct  385   SGNLLVVFEEEGGDPLGISLNTISV  409



>gb|KHN25472.1| Beta-galactosidase 13 [Glycine soja]
Length=854

 Score =   324 bits (831),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 168/368 (46%), Positives = 232/368 (63%), Gaps = 12/368 (3%)
 Frame = +2

Query  149   LSYQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQ  328
             + Y+V+G     RSAEDIAF VA F + KNGS +NYYMYHGGTNFGRT+++F  T YYD+
Sbjct  287   VQYRVFGDPPSRRSAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSSAFTTTQYYDE  345

Query  329   APLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAA  508
             APLDEYG+ REPKWSHL+++H A+ +C + L +   +   L+Q  +  VF    S  CAA
Sbjct  346   APLDEYGMQREPKWSHLRDVHKALSLCKKALFNGESTVTKLSQHHETIVFEKPGSDLCAA  405

Query  509   FLINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDS  688
             FL NN     A ++F+ + Y +PP+SISILPDCKTV FNT  + +Q N+R  + ++  ++
Sbjct  406   FLTNNHTLTPATIKFRGTDYYMPPRSISILPDCKTVVFNTQFIASQHNSRNFKRSMAANN  465

Query  689   TeeweefeeLVVGFD-DTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-PKS-----  847
              +     E +       TN +  T L   +  KD SDY WYT S++    D PK      
Sbjct  466   HKWEVYSENIPTTKQIPTNEKIPTEL--YSLLKDTSDYAWYTTSVELGPEDLPKKNDISP  523

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              + + SLGH L  FVNGE  GS HG+    SF  +  V+L  G+N I++L+ TVGLP+SG
Sbjct  524   VLRIMSLGHSLVAFVNGEFIGSNHGSHEEKSFEFQKPVTLKVGVNQIAILACTVGLPDSG  583

Query  1028  AYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSS  1204
             AY+EH+  GP+ + I   + G  DL+++ WG++VG+ GE L I+TE+GS  VQW+E   S
Sbjct  584   AYMEHRFAGPKSIFILGLNSGKIDLASNGWGHKVGIKGEELGIFTEEGSKKVQWKEAKGS  643

Query  1205  QP-LIWYK  1225
              P L WYK
Sbjct  644   GPALSWYK  651


 Score = 99.4 bits (246),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 65/93 (70%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F+ PEG DP+A+ +  MGKG  W+NG+SIGR+W+SY +  G P+Q+ Y++PR+F  P
Sbjct  651   KTNFETPEGTDPVAIRMTGMGKGMIWINGKSIGRHWMSYLSPLGMPTQSEYHIPRAFFNP  710

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
               NL+V+FEEE  NP  + +    +T+D+D + 
Sbjct  711   KDNLIVVFEEEIANPEKVEI----LTVDRDTIC  739



>ref|XP_004505828.1| PREDICTED: beta-galactosidase 13-like [Cicer arietinum]
Length=851

 Score =   324 bits (831),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 169/365 (46%), Positives = 231/365 (63%), Gaps = 10/365 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + KNGS +NYYMYHGGTNFGRT+++F  T YYD+AP
Sbjct  265   YRVFGDPPSQRSAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSSAFTTTRYYDEAP  323

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDE+GL R+PKWSHLK++H A+ +C + LL+  P+T  ++QF +  V+    S  CAAF+
Sbjct  324   LDEFGLQRDPKWSHLKDVHKALSLCKKPLLNGEPTTQKISQFHEVIVYENKGSNLCAAFI  383

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN  K +  +QF+ S+Y LPP+SISILPDCKTV FNT  + +Q N+R  + + K  +  
Sbjct  384   TNNHTKMAKTIQFRGSNYYLPPRSISILPDCKTVVFNTQNIASQHNSRNFKQS-KNANNH  442

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-PKS-----AIS  856
             +WE F E +    +         +  +  KD +DY WYT S++    D PK       + 
Sbjct  443   KWEVFTEPIPTTKELPPSKKVPAELYSMLKDTTDYGWYTTSVELGPEDLPKKNEISPVLR  502

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             + SLGH L  FVNGE  GS HG+     F  +  VS   G+N I++L + VGLP+SGAY+
Sbjct  503   IMSLGHSLLAFVNGEYIGSNHGSHEEKGFEFQKPVSFKVGVNQIAILGSLVGLPDSGAYM  562

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-SQP  1210
             EH+  GP+ +TI   + G+  L+ + WG+QVGL GE   I+TE+GS  VQW+E      P
Sbjct  563   EHRYAGPKTITILGLNSGTIGLTVNGWGHQVGLYGEKHSIFTEEGSKKVQWKEVKGHGPP  622

Query  1211  LIWYK  1225
             L WYK
Sbjct  623   LSWYK  627


 Score = 85.5 bits (210),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 58/86 (67%), Gaps = 2/86 (2%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFL--  1644
             +T F+ PEG  P+A+ L  MGKG  W+NG+S+GR+W+SY +  G P+Q+ Y++PRSF   
Sbjct  627   KTNFETPEGKGPVAIKLDGMGKGMIWINGESVGRHWLSYLSPLGKPTQSEYHIPRSFFNA  686

Query  1645  KPTGNLLVLFEEEYGNPYGITLDKVS  1722
             K   NLLV+ EEE  +P  + +  V+
Sbjct  687   KSKNNLLVILEEEAASPEKVVIQIVN  712



>ref|XP_010066272.1| PREDICTED: beta-galactosidase 13-like [Eucalyptus grandis]
Length=768

 Score =   322 bits (825),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 169/367 (46%), Positives = 227/367 (62%), Gaps = 14/367 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RS EDIAF VA F A KNGS  NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  204   YRVFGDPPSQRSVEDIAFSVARFFA-KNGSLANYYMYHGGTNFGRTSAVFTTTRYYDEAP  262

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKWSHL+++H A+ +C + LL   PS   L    +A  F    +  CAAFL
Sbjct  263   LDEYGLQREPKWSHLRDVHKALSLCRKPLLWGNPSVQRLGADIEALTFEIPGTKVCAAFL  322

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN  K +   +F+  S+ LPP SISILPDCKT+ +NT  + +Q N R  + +   D+ +
Sbjct  323   TNNHTKIAQVAEFRGESFYLPPHSISILPDCKTLVYNTQTIVSQHNARNFRRSKVTDNLK  382

Query  695   eweefeeLVVGFDDTNIRADTLL--DHINTTKDVSDYLWYTLSLQQESSD-PK-----SA  850
                  E +    D   +  D+ +  +H   TKD +DY W+T S++    D P+       
Sbjct  383   WEMSREAIP---DTAKVPVDSKIPAEHYKLTKDTTDYAWFTTSIKISPRDLPRRTEILPV  439

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             + + SLGH + +FVNGE  G+AHG+    SF  +  V+L  G N ISLL  T+GLP+SGA
Sbjct  440   LRIASLGHAMQVFVNGEYIGTAHGSHIEKSFVFQKAVNLKPGTNYISLLGMTIGLPDSGA  499

Query  1031  YLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ  1207
             Y+EHK  GPR VTI   + G+ DL+ + WG++VGL GE ++ YT+ GS+ VQW++ +   
Sbjct  500   YMEHKFAGPRLVTILGLNTGTLDLTLNGWGHKVGLDGEKVRAYTQAGSHRVQWKKANGVG  559

Query  1208  P-LIWYK  1225
             P L WYK
Sbjct  560   PALTWYK  566


 Score = 95.9 bits (237),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 12/114 (11%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +  F  PEG+ PLA+ L ++GKG  WVNG+SIGR+W SY T    PSQ+ Y++PRSF+KP
Sbjct  566   KAYFHAPEGDGPLAIRLPNLGKGMIWVNGKSIGRFWNSYLTPLLQPSQSEYHIPRSFIKP  625

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILLRRLA*GKGSVPSHNHTKDRKS  1812
             + NL+V+ +EE GNP  I +    +T+D+D +         S  S NH    KS
Sbjct  626   SDNLMVVLDEEGGNPQSIEI----LTVDRDTIC--------SFISENHPPHVKS  667



>ref|XP_008656262.1| PREDICTED: beta-galactosidase 7-like isoform X2 [Zea mays]
Length=820

 Score =   323 bits (827),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 174/364 (48%), Positives = 231/364 (63%), Gaps = 10/364 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+D  +RS +DI F VALFIARKNGSY++YYMYHGGTNFGR A+S++ TSYYD AP
Sbjct  272   YLIYGNDTKLRSPQDITFAVALFIARKNGSYVSYYMYHGGTNFGRFASSYVTTSYYDGAP  331

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+ +P W HL+ELHAA+K  S+ LL  T S  S+ Q Q+A++F  ++   C AFL
Sbjct  332   LDEYGLIWQPTWGHLRELHAAVKQSSEPLLFGTYSNLSIGQEQEAHIFETETQ--CVAFL  389

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKF-DST  691
             +N D  H ++V F+N S +L PKSISIL DCK V F TAKV  Q  +RT +    F D +
Sbjct  390   VNFDQHHISEVVFRNISLELAPKSISILLDCKQVVFETAKVNAQHGSRTAEEVQSFSDIS  449

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKS--AISVES  865
                   E +      +    + L +H++TTKD +DYLWY +  +   SD      I+VES
Sbjct  450   TWKAFKEPIPQDVSKSAYSGNRLFEHLSTTKDATDYLWYIVGYEYTPSDDGQLVLINVES  509

Query  866   LGHVLHIFVNGELAGSAHGTFRNSSFTLEST-VSLNKGMNNISLLSATVGLPNSGAYLEH  1042
               H+LH FVN    G  HG+    +  + ST +SL +G N ISLLSA VG P+SGA++E 
Sbjct  510   RAHILHAFVNNAYVGKIHGSHGGPANIIFSTNISLQEGPNTISLLSAMVGSPDSGAHMER  569

Query  1043  KTLGPRKVTIESSEGSED-LSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS--SSQPL  1213
             +  G RKV+I+  +  E+ L+N+ WGYQVGL GE   IYT+  S   +W      +  PL
Sbjct  570   RVFGIRKVSIQQGQEPENLLNNELWGYQVGLFGERNNIYTQD-SKITEWTTIDNLTYSPL  628

Query  1214  IWYK  1225
              WYK
Sbjct  629   TWYK  632


 Score =   105 bits (262),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P GND + LNL  MGKGE WVNG+SIGRYWVS+   +G PSQ+ Y++PR FL P
Sbjct  632   KTTFSTPVGNDAVTLNLTGMGKGEVWVNGESIGRYWVSFKAPSGNPSQSLYHIPREFLNP  691

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               N LVLFEE  GNP  IT++ +S++
Sbjct  692   QDNTLVLFEEMGGNPQLITVNTMSVS  717



>ref|XP_008656261.1| PREDICTED: beta-galactosidase 7-like isoform X1 [Zea mays]
Length=820

 Score =   323 bits (827),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 174/364 (48%), Positives = 231/364 (63%), Gaps = 10/364 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+D  +RS +DI F VALFIARKNGSY++YYMYHGGTNFGR A+S++ TSYYD AP
Sbjct  272   YLIYGNDTKLRSPQDITFAVALFIARKNGSYVSYYMYHGGTNFGRFASSYVTTSYYDGAP  331

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+ +P W HL+ELHAA+K  S+ LL  T S  S+ Q Q+A++F  ++   C AFL
Sbjct  332   LDEYGLIWQPTWGHLRELHAAVKQSSEPLLFGTYSNLSIGQEQEAHIFETETQ--CVAFL  389

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKF-DST  691
             +N D  H ++V F+N S +L PKSISIL DCK V F TAKV  Q  +RT +    F D +
Sbjct  390   VNFDQHHISEVVFRNISLELAPKSISILLDCKQVVFETAKVNAQHGSRTAEEVQSFSDIS  449

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKS--AISVES  865
                   E +      +    + L +H++TTKD +DYLWY +  +   SD      I+VES
Sbjct  450   TWKAFKEPIPQDVSKSAYSGNRLFEHLSTTKDATDYLWYIVGYEYTPSDDGQLVLINVES  509

Query  866   LGHVLHIFVNGELAGSAHGTFRNSSFTLEST-VSLNKGMNNISLLSATVGLPNSGAYLEH  1042
               H+LH FVN    G  HG+    +  + ST +SL +G N ISLLSA VG P+SGA++E 
Sbjct  510   RAHILHAFVNNAYVGRIHGSHGGPANIIFSTNISLQEGPNTISLLSAMVGSPDSGAHMER  569

Query  1043  KTLGPRKVTIESSEGSED-LSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS--SSQPL  1213
             +  G RKV+I+  +  E+ L+N+ WGYQVGL GE   IYT+  S   +W      +  PL
Sbjct  570   RVFGIRKVSIQQGQEPENLLNNELWGYQVGLFGERNNIYTQD-SKITEWTTIDNLTYSPL  628

Query  1214  IWYK  1225
              WYK
Sbjct  629   TWYK  632


 Score =   105 bits (262),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P GND + LNL  MGKGE WVNG+SIGRYWVS+   +G PSQ+ Y++PR FL P
Sbjct  632   KTTFSTPVGNDAVTLNLTGMGKGEVWVNGESIGRYWVSFKAPSGNPSQSLYHIPREFLNP  691

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               N LVLFEE  GNP  IT++ +S++
Sbjct  692   QDNTLVLFEEMGGNPQLITVNTMSVS  717



>gb|KCW64119.1| hypothetical protein EUGRSUZ_G01775 [Eucalyptus grandis]
Length=830

 Score =   322 bits (826),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 228/369 (62%), Gaps = 14/369 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RS EDIAF VA F A KNGS  NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  266   YRVFGDPPSQRSVEDIAFSVARFFA-KNGSLANYYMYHGGTNFGRTSAVFTTTRYYDEAP  324

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKWSHL+++H A+ +C + LL   PS   L    +A  F    +  CAAFL
Sbjct  325   LDEYGLQREPKWSHLRDVHKALSLCRKPLLWGNPSVQRLGADIEALTFEIPGTKVCAAFL  384

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN  K +   +F+  S+ LPP SISILPDCKT+ +NT  + +Q N R  + +   D+ +
Sbjct  385   TNNHTKIAQVAEFRGESFYLPPHSISILPDCKTLVYNTQTIVSQHNARNFRRSKVTDNLK  444

Query  695   eweefeeLVVGFDDTNIRADTLL--DHINTTKDVSDYLWYTLSLQQESSD-PK-----SA  850
                  E +    D   +  D+ +  +H   TKD +DY W+T S++    D P+       
Sbjct  445   WEMSREAIP---DTAKVPVDSKIPAEHYKLTKDTTDYAWFTTSIKISPRDLPRRTEILPV  501

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             + + SLGH + +FVNGE  G+AHG+    SF  +  V+L  G N ISLL  T+GLP+SGA
Sbjct  502   LRIASLGHAMQVFVNGEYIGTAHGSHIEKSFVFQKAVNLKPGTNYISLLGMTIGLPDSGA  561

Query  1031  YLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ  1207
             Y+EHK  GPR VTI   + G+ DL+ + WG++VGL GE ++ YT+ GS+ VQW++ +   
Sbjct  562   YMEHKFAGPRLVTILGLNTGTLDLTLNGWGHKVGLDGEKVRAYTQAGSHRVQWKKANGVG  621

Query  1208  P-LIWYKEW  1231
             P L WYK +
Sbjct  622   PALTWYKAY  630


 Score = 96.3 bits (238),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 12/114 (11%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +  F  PEG+ PLA+ L ++GKG  WVNG+SIGR+W SY T    PSQ+ Y++PRSF+KP
Sbjct  628   KAYFHAPEGDGPLAIRLPNLGKGMIWVNGKSIGRFWNSYLTPLLQPSQSEYHIPRSFIKP  687

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILLRRLA*GKGSVPSHNHTKDRKS  1812
             + NL+V+ +EE GNP  I +    +T+D+D +         S  S NH    KS
Sbjct  688   SDNLMVVLDEEGGNPQSIEI----LTVDRDTIC--------SFISENHPPHVKS  729



>ref|XP_004298189.1| PREDICTED: beta-galactosidase 13-like [Fragaria vesca subsp. 
vesca]
Length=769

 Score =   321 bits (822),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 177/388 (46%), Positives = 234/388 (60%), Gaps = 13/388 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G  A  R AEDIAF VA F + KNGS  NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  204   YRVFGDPASQRPAEDIAFSVARFFS-KNGSLANYYMYHGGTNFGRTSAIFTTTRYYDEAP  262

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQA--YVFRGDSSGACAA  508
             LDEYGL R+PKWSHLK+LH A+++C + LL   P   +L +  +A  Y  +G+SS  CAA
Sbjct  263   LDEYGLPRDPKWSHLKDLHKALRLCRKPLLWGVPGVQNLGKNIEARFYELKGNSS-ICAA  321

Query  509   FLINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDS  688
             FL NN+ +  A V ++   Y LPP SISILPDCKTV +NT  + +Q N R+        +
Sbjct  322   FLANNNSRSEAIVNWRGQDYYLPPHSISILPDCKTVVYNTQTIVSQHNARSFV-GSNLAN  380

Query  689   TeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP------KSA  850
                W E  E +    +  I   T L+     KD SDY WYT SL+  S D       +  
Sbjct  381   KMRWMESPEPIPSTKEIPINNRTPLELYGLLKDNSDYAWYTTSLELNSMDMSMKKSIQPV  440

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             + V SLGH + +FVNGE  GS HG+    SF  E  VS   G+N I+LL+ TVGLP+SGA
Sbjct  441   LRVGSLGHAMLVFVNGEYVGSGHGSHDEKSFVFEKVVSFKAGVNQIALLAMTVGLPDSGA  500

Query  1031  YLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-S  1204
             Y+EH+  GP+ + +   + G+ DL+ + WG+QVGL GE L+ +T++GS  VQW E +   
Sbjct  501   YMEHRYAGPKDIVVLGLNTGTLDLTQNGWGHQVGLNGEKLRAFTKEGSKQVQWGETNGPK  560

Query  1205  QPLIWYKEWRTIKKVYLPARAVKTGFAR  1288
             + L WYK +    +   P     TG  +
Sbjct  561   KALTWYKTYFDAPEGNDPVAIRMTGMGK  588


 Score =   102 bits (254),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 66/93 (71%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEGNDP+A+ +  MGKG  WVNG+SIGR+W+S+ +  G P+Q+ Y++PRSF+KP
Sbjct  567   KTYFDAPEGNDPVAIRMTGMGKGMIWVNGESIGRHWISFLSPLGQPTQSEYHIPRSFIKP  626

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
               NLLV+ EEE   P  I +    +T+++D + 
Sbjct  627   RKNLLVVLEEELAKPSSIDI----VTVNRDTIC  655



>ref|XP_010090335.1| Beta-galactosidase 11 [Morus notabilis]
 gb|EXB39305.1| Beta-galactosidase 11 [Morus notabilis]
Length=848

 Score =   322 bits (826),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 168/366 (46%), Positives = 222/366 (61%), Gaps = 10/366 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     R+AEDIA+ VA F + KNG+  NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  270   YRVFGDPPSQRAAEDIAYSVARFFS-KNGTLANYYMYHGGTNFGRTSAVFTTTRYYDEAP  328

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKWSHL++LH A+ +C + LL  TP    L +  +  ++    +  CAAFL
Sbjct  329   LDEYGLQREPKWSHLRDLHRALNLCKKALLWGTPGGQKLGKHTEVRMYEKPGTNICAAFL  388

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN+ K +  V+F+ S+Y LPP+SISILPDCK V +NT  + +Q N R    + K  ST 
Sbjct  389   SNNNSKVAHTVKFRGSAYYLPPRSISILPDCKNVVYNTQTIVSQHNARNYVRS-KVASTL  447

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD----PK--SAIS  856
             +W+   E +       +      +  +  KD +DY WYT S+     D    P     + 
Sbjct  448   KWKMSPEQIPSVHQVPVNNRIPHELYSLLKDTTDYAWYTTSIDLSQRDLPMRPDILPVLR  507

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             + SLGH LH FVNGE  GS HG+    SF  +  + L  G N+I++L  TVGLP+SGAY+
Sbjct  508   ISSLGHALHAFVNGEYVGSGHGSHEEKSFVFQHAIVLKPGTNHIAILGMTVGLPDSGAYM  567

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQP-  1210
             EH+  GPR VTI   + G+ DL+ + WG QVGL GE   ++TE GS  VQW +     P 
Sbjct  568   EHRFAGPRAVTILGLNTGTIDLTPNGWGNQVGLTGEKNHVFTEDGSKKVQWSKVKRQGPA  627

Query  1211  LIWYKE  1228
             L WYKE
Sbjct  628   LTWYKE  633


 Score =   109 bits (273),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             QT FD PEG DP+A+ +  MGKG  WVNGQ+IGRYW+SY +  G PSQ  Y++PRSFLKP
Sbjct  642   QTRFDAPEGRDPVAIRMNGMGKGMIWVNGQNIGRYWMSYLSPLGKPSQEEYHIPRSFLKP  701

Query  1651  TGNLLVLFEEEYGNPYGITLDKVS  1722
             T NLLV+ EEE  +P GI + KV+
Sbjct  702   TQNLLVVLEEEKASPKGIEILKVN  725



>ref|XP_004135714.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase-like [Cucumis 
sativus]
Length=712

 Score =   319 bits (817),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 174/369 (47%), Positives = 235/369 (64%), Gaps = 20/369 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y  +G     R  ED+AF VA FI + NGS +NYY+YHGGTNFGRT+  F+ TSY   AP
Sbjct  249   YTAFGGPTPYRPPEDVAFSVARFI-QNNGSLVNYYVYHGGTNFGRTSGLFIATSYDFDAP  307

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             +DEYGL+REPKW HL++LH AIK+C   L+SA P++  L + Q+A VF+  SS ACAAFL
Sbjct  308   IDEYGLIREPKWGHLRDLHKAIKLCEPALVSADPTSTWLGKNQEARVFK--SSSACAAFL  365

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N D   S KV F N+ Y LPP SISILPDCKTV FNTA++  +S    M P   F    
Sbjct  366   ANYDTSASVKVNFWNNPYDLPPWSISILPDCKTVTFNTAQIGVKSYEAKMMPISSFGWLS  425

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP--KSA----IS  856
               EE         DT  + D L++ ++ T D +DYLWY   +  +S++   KS     +S
Sbjct  426   YKEEPASAYA--KDTTTK-DGLVEQVSVTWDTTDYLWYMQDISIDSTEGFLKSGKWPLLS  482

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V S GH+LH+F+NG+L+GS +G+  +   T    V+L +G+N +S+LS TVGLPN G + 
Sbjct  483   VNSAGHLLHVFINGQLSGSVYGSLEDPRITFSKYVNLKQGVNKLSMLSVTVGLPNVGLHF  542

Query  1037  E---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE--FS  1198
             +      LGP  VT++  +EG+ D+S   W Y+VGL GE+L +Y++KGSN+VQW +   +
Sbjct  543   DTWNAGVLGP--VTLKGLNEGTRDMSKYKWSYKVGLSGESLNLYSDKGSNSVQWTKGSLT  600

Query  1199  SSQPLIWYK  1225
               QPL WYK
Sbjct  601   QKQPLTWYK  609


 Score = 85.5 bits (210),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 61/102 (60%), Gaps = 20/102 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYW-----------VSYHTV-------  1596
             +T F  P GN+PL L++ SM KG+ WVNG+SIGRY+            SY  +       
Sbjct  609   KTTFKTPAGNEPLGLDMSSMSKGQIWVNGRSIGRYFPGYIANGKCDKCSYAGLFTEKKCL  668

Query  1597  --AGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
                G PSQ WY++PR +L P+ NLLV+FEE  G+P GI+L K
Sbjct  669   GNCGEPSQKWYHIPRDWLSPSDNLLVIFEEIGGSPDGISLVK  710



>ref|XP_006590857.1| PREDICTED: beta-galactosidase 13-like isoform X2 [Glycine max]
Length=814

 Score =   321 bits (823),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 162/370 (44%), Positives = 230/370 (62%), Gaps = 20/370 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + KNGS +NYYMYHGGTNFGRT+++F  T YYD+AP
Sbjct  250   YRVFGDPPSQRSAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSSAFTTTRYYDEAP  308

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYG+ REPKWSHL+++H A+ +C + L +   +   ++Q  +  VF    S  CAAF+
Sbjct  309   LDEYGMQREPKWSHLRDVHRALSLCKRALFNGASTVTKMSQHHEVIVFEKPGSNLCAAFI  368

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPAL-----K  679
              NN  K    + F+ + Y +PP+SISILPDCKTV FNT  + +Q ++R  + ++     K
Sbjct  369   TNNHTKVPTTISFRGTDYYMPPRSISILPDCKTVVFNTQCIASQHSSRNFKRSMAANDHK  428

Query  680   FDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-PK----  844
             ++   E     + +   +   I   +LL      KD SDY WYT S++    D PK    
Sbjct  429   WEVYSETIPTTKQIPTHEKNPIELYSLL------KDTSDYAWYTTSVELRPEDLPKKNDI  482

Query  845   -SAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPN  1021
              + + + SLGH L  FVNGE  GS HG+     F  +  V+L  G+N I++L++TVGLP+
Sbjct  483   PTILRIMSLGHSLLAFVNGEFIGSNHGSHEEKGFEFQKPVTLKVGVNQIAILASTVGLPD  542

Query  1022  SGAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS  1198
             SGAY+EH+  GP+ + I   + G  DL+++ WG++VG+ GE L I+TE+GS  VQW+E  
Sbjct  543   SGAYMEHRFAGPKSIFILGLNSGKMDLTSNGWGHEVGIKGEKLGIFTEEGSKKVQWKEAK  602

Query  1199  SSQPLI-WYK  1225
                P + WYK
Sbjct  603   GPGPAVSWYK  612


 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 12/114 (11%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  PEG DP+A+ +  MGKG  W+NG+SIGR+W+SY +  G P+Q+ Y++PR++  P
Sbjct  612   KTNFATPEGTDPVAIRMTGMGKGMVWINGKSIGRHWMSYLSPLGQPTQSEYHIPRTYFNP  671

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILLRRLA*GKGSVPSHNHTKDRKS  1812
               NLLV+FEEE  NP  + +    +T+++D +         S  + NH  + KS
Sbjct  672   KDNLLVVFEEEIANPEKVEI----LTVNRDTIC--------SFVTENHPPNVKS  713



>ref|XP_010941319.1| PREDICTED: beta-galactosidase 11-like isoform X2 [Elaeis guineensis]
Length=826

 Score =   321 bits (823),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/366 (45%), Positives = 230/366 (63%), Gaps = 8/366 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIA+ VA F +  NG+ +NYYMYHGGTNFGR  AS+++T YYD+AP
Sbjct  255   YRVFGDPPSQRSAEDIAYSVARFFS-NNGALVNYYMYHGGTNFGREGASYVMTRYYDEAP  313

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL +EPK+ HL++LH A+K+  + LL   PS   L    +A ++    S  C AFL
Sbjct  314   LDEYGLPKEPKYGHLRDLHQALKLSRKGLLWGVPSVQPLGPGCEARLYESPDSKVCVAFL  373

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N + +  A V F+  +Y LP +SISILPDCKTV FNT +V  Q N+RT   A + +  +
Sbjct  374   TNTNPRTDATVNFRGVNYFLPRRSISILPDCKTVIFNTQRVNAQHNSRTFHAAGETNKND  433

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KSAIS  856
             +W  F+E +  F +T I +   L+  N TKD +DY+WYT   + E  D P     +  + 
Sbjct  434   KWHMFQERIPKFRNTRIISSKPLELYNMTKDTTDYMWYTTRFRLEDEDLPMRPDIRPVLL  493

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V SLGH +H FVNG   GS +G     SF  +  + L +G+N+IS+L  T+G P++GAYL
Sbjct  494   VSSLGHAMHAFVNGIYIGSGNGAKLEKSFVFQKPMELKRGVNHISILGLTIGFPDNGAYL  553

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPL  1213
             EH+  G     I+  + G+ DLS + WG++VG+ GE L I+TE+GS  VQW E  + +P+
Sbjct  554   EHRLAGIHTAAIQGLNTGTLDLSQNKWGHEVGMKGEKLGIFTEEGSKKVQWTEAKNDKPV  613

Query  1214  IWYKEW  1231
              WYK +
Sbjct  614   TWYKRY  619


 Score =   103 bits (258),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%), Gaps = 4/87 (5%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P GNDP+AL++ +MGKG AWVNG  IGRYWVSY +  G PSQ+ Y++PR +LKP  N
Sbjct  620   FDMPRGNDPVALDMTTMGKGLAWVNGNCIGRYWVSYLSPLGKPSQSVYHIPREWLKPKDN  679

Query  1660  LLVLFEEEYGNPYGITLDKVSITLDKD  1740
             LLV+FEE  G P GI +    +T+ +D
Sbjct  680   LLVIFEEHGGKPEGILI----VTVKRD  702



>ref|XP_004961992.1| PREDICTED: beta-galactosidase 7-like isoform X1 [Setaria italica]
Length=855

 Score =   322 bits (824),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 181/397 (46%), Positives = 234/397 (59%), Gaps = 42/397 (11%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+D  +RS EDIAF VALFIARKNGSY++YYMYHGGTNFGR ++S++ T+YYD AP
Sbjct  273   YLIYGNDTKLRSPEDIAFAVALFIARKNGSYMSYYMYHGGTNFGRFSSSYVTTNYYDGAP  332

Query  335   LDEYG---------------------------------LLREPKWSHLKELHAAIKMCSQ  415
             LDEYG                                 L+ +P W HL+ELH A+K  S+
Sbjct  333   LDEYGKYLIIYTNGSVLNIFTQFHNSKHINKFNESYPGLIWQPTWGHLRELHTAVKQSSE  392

Query  416   ILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINNDGKHSAKVQFQNSSYQLPPKSISI  595
              LL  T S FSL Q Q+A++F  +S   C AFL+N D    ++V F+N S QL PKSISI
Sbjct  393   PLLFGTYSNFSLGQEQEAHIFETESQ--CVAFLVNFDQHQISEVVFRNISLQLAPKSISI  450

Query  596   LPDCKTVAFNTAKVTTQSNTRTMQPALKF-DSTeeweefeeLVVGFDDTNIRADTLLDHI  772
             L DCK V F TAKV  Q  +RT +    F D        E +           + L DH+
Sbjct  451   LSDCKRVVFETAKVNAQHGSRTAEEVQSFSDINTWKAFKEPIPQDVSKAMYTGNQLFDHL  510

Query  773   NTTKDVSDYLWYTLSLQQESSDPKS--AISVESLGHVLHIFVNGELAGSAHGTFRN-SSF  943
             +TTKD +DYLWY +  +   SD      I+VES  H+LH FVN    G  HG+    +S 
Sbjct  511   STTKDETDYLWYIVGYEYTPSDDGQLVLINVESRAHILHAFVNNAYVGRIHGSHDGPASI  570

Query  944   TLESTVSLNKGMNNISLLSATVGLPNSGAYLEHKTLGPRKVTIESSEGSED-LSNDSWGY  1120
              L + +SLN+G NNISLLSA VG P+SGA++E +  G RKV+I+  +  E  L N+ WG 
Sbjct  571   ILSTNISLNEGPNNISLLSAMVGSPDSGAHMERRVFGIRKVSIQQGQEPEHLLDNELWGN  630

Query  1121  QVGLLGENLQIYTEKGSNAVQWREFS--SSQPLIWYK  1225
             QVGL GE   IYT++GS +V+W   +  +  PLIWYK
Sbjct  631   QVGLFGERNHIYTQEGSKSVEWTTINNLAYSPLIWYK  667


 Score =   112 bits (279),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P GND +ALNL SMGKGE W+NG+SIGRYWVS+   +G PSQ+ Y++PR FL P
Sbjct  667   KTTFPTPAGNDAIALNLTSMGKGEVWINGESIGRYWVSFKAPSGNPSQSLYHIPRQFLNP  726

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               N+LVLFEE  G+P  IT++ VS+T
Sbjct  727   QDNILVLFEEMGGDPQQITVNTVSVT  752



>ref|XP_010941318.1| PREDICTED: beta-galactosidase 11-like isoform X1 [Elaeis guineensis]
Length=843

 Score =   321 bits (823),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 164/366 (45%), Positives = 230/366 (63%), Gaps = 8/366 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIA+ VA F +  NG+ +NYYMYHGGTNFGR  AS+++T YYD+AP
Sbjct  272   YRVFGDPPSQRSAEDIAYSVARFFS-NNGALVNYYMYHGGTNFGREGASYVMTRYYDEAP  330

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL +EPK+ HL++LH A+K+  + LL   PS   L    +A ++    S  C AFL
Sbjct  331   LDEYGLPKEPKYGHLRDLHQALKLSRKGLLWGVPSVQPLGPGCEARLYESPDSKVCVAFL  390

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N + +  A V F+  +Y LP +SISILPDCKTV FNT +V  Q N+RT   A + +  +
Sbjct  391   TNTNPRTDATVNFRGVNYFLPRRSISILPDCKTVIFNTQRVNAQHNSRTFHAAGETNKND  450

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KSAIS  856
             +W  F+E +  F +T I +   L+  N TKD +DY+WYT   + E  D P     +  + 
Sbjct  451   KWHMFQERIPKFRNTRIISSKPLELYNMTKDTTDYMWYTTRFRLEDEDLPMRPDIRPVLL  510

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V SLGH +H FVNG   GS +G     SF  +  + L +G+N+IS+L  T+G P++GAYL
Sbjct  511   VSSLGHAMHAFVNGIYIGSGNGAKLEKSFVFQKPMELKRGVNHISILGLTIGFPDNGAYL  570

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPL  1213
             EH+  G     I+  + G+ DLS + WG++VG+ GE L I+TE+GS  VQW E  + +P+
Sbjct  571   EHRLAGIHTAAIQGLNTGTLDLSQNKWGHEVGMKGEKLGIFTEEGSKKVQWTEAKNDKPV  630

Query  1214  IWYKEW  1231
              WYK +
Sbjct  631   TWYKRY  636


 Score =   103 bits (258),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 63/87 (72%), Gaps = 4/87 (5%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P GNDP+AL++ +MGKG AWVNG  IGRYWVSY +  G PSQ+ Y++PR +LKP  N
Sbjct  637   FDMPRGNDPVALDMTTMGKGLAWVNGNCIGRYWVSYLSPLGKPSQSVYHIPREWLKPKDN  696

Query  1660  LLVLFEEEYGNPYGITLDKVSITLDKD  1740
             LLV+FEE  G P GI +    +T+ +D
Sbjct  697   LLVIFEEHGGKPEGILI----VTVKRD  719



>ref|XP_006590856.1| PREDICTED: beta-galactosidase 13-like isoform X1 [Glycine max]
 gb|KHN39877.1| Beta-galactosidase 13 [Glycine soja]
Length=842

 Score =   321 bits (823),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 162/370 (44%), Positives = 230/370 (62%), Gaps = 20/370 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + KNGS +NYYMYHGGTNFGRT+++F  T YYD+AP
Sbjct  278   YRVFGDPPSQRSAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSSAFTTTRYYDEAP  336

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYG+ REPKWSHL+++H A+ +C + L +   +   ++Q  +  VF    S  CAAF+
Sbjct  337   LDEYGMQREPKWSHLRDVHRALSLCKRALFNGASTVTKMSQHHEVIVFEKPGSNLCAAFI  396

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPAL-----K  679
              NN  K    + F+ + Y +PP+SISILPDCKTV FNT  + +Q ++R  + ++     K
Sbjct  397   TNNHTKVPTTISFRGTDYYMPPRSISILPDCKTVVFNTQCIASQHSSRNFKRSMAANDHK  456

Query  680   FDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-PK----  844
             ++   E     + +   +   I   +LL      KD SDY WYT S++    D PK    
Sbjct  457   WEVYSETIPTTKQIPTHEKNPIELYSLL------KDTSDYAWYTTSVELRPEDLPKKNDI  510

Query  845   -SAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPN  1021
              + + + SLGH L  FVNGE  GS HG+     F  +  V+L  G+N I++L++TVGLP+
Sbjct  511   PTILRIMSLGHSLLAFVNGEFIGSNHGSHEEKGFEFQKPVTLKVGVNQIAILASTVGLPD  570

Query  1022  SGAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS  1198
             SGAY+EH+  GP+ + I   + G  DL+++ WG++VG+ GE L I+TE+GS  VQW+E  
Sbjct  571   SGAYMEHRFAGPKSIFILGLNSGKMDLTSNGWGHEVGIKGEKLGIFTEEGSKKVQWKEAK  630

Query  1199  SSQPLI-WYK  1225
                P + WYK
Sbjct  631   GPGPAVSWYK  640


 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 71/114 (62%), Gaps = 12/114 (11%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  PEG DP+A+ +  MGKG  W+NG+SIGR+W+SY +  G P+Q+ Y++PR++  P
Sbjct  640   KTNFATPEGTDPVAIRMTGMGKGMVWINGKSIGRHWMSYLSPLGQPTQSEYHIPRTYFNP  699

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILLRRLA*GKGSVPSHNHTKDRKS  1812
               NLLV+FEEE  NP  + +    +T+++D +         S  + NH  + KS
Sbjct  700   KDNLLVVFEEEIANPEKVEI----LTVNRDTIC--------SFVTENHPPNVKS  741



>ref|XP_004144843.1| PREDICTED: beta-galactosidase 13-like [Cucumis sativus]
 ref|XP_004162905.1| PREDICTED: beta-galactosidase 13-like [Cucumis sativus]
Length=766

 Score =   319 bits (818),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 159/365 (44%), Positives = 225/365 (62%), Gaps = 10/365 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     R+AEDIAF VA F + KNGS +NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  204   YRVFGDPPSQRAAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSAVFTTTRYYDEAP  262

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDE+GL REPKW HL+++H A+ +C + LL  TP    + +  +A  +    +  CAAFL
Sbjct  263   LDEFGLQREPKWGHLRDVHKALNLCKKPLLWGTPGIQVIGKGLEARFYEKPGTNICAAFL  322

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NND K +  + F+   + LPP+SISILPDCKTV FNT  + +Q N R   P+ K  +  
Sbjct  323   ANNDTKSAQTINFRGREFLLPPRSISILPDCKTVVFNTETIVSQHNARNFIPS-KNANKL  381

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKS------AIS  856
             +W+   E +   +   +     L+  +  KD +DY WYT S++ +  D          + 
Sbjct  382   KWKMSPESIPTVEQVPVNNKIPLELYSLLKDTTDYGWYTTSIELDKEDVSKRPDILPVLR  441

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             + SLGH + +FVNGE  G+AHG+    +F  + +V    G+NNI+LL   VGLP+SGAY+
Sbjct  442   IASLGHAMLVFVNGEYIGTAHGSHEEKNFVFQGSVPFKAGVNNIALLGILVGLPDSGAYM  501

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ-P  1210
             EH+  GPR +TI   + G+ D+S + WG+QV L GE ++++T+ GS+ V W E    +  
Sbjct  502   EHRFAGPRSITILGLNTGTLDISKNGWGHQVALQGEKVKVFTQGGSHRVDWSEIKEEKSA  561

Query  1211  LIWYK  1225
             L WYK
Sbjct  562   LTWYK  566


 Score = 97.8 bits (242),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 63/87 (72%), Gaps = 5/87 (6%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEGNDP+A+ +  MGKG+ WVNG+SIGRYW+SY +     +Q+ Y++PRSF+KP
Sbjct  566   KTYFDAPEGNDPVAIRMNGMGKGQIWVNGKSIGRYWMSYLSPLKLSTQSEYHIPRSFIKP  625

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITL  1731
             + NLLV+ EEE      +T +KV I L
Sbjct  626   SENLLVILEEE-----NVTPEKVEILL  647



>dbj|BAJ94712.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=672

 Score =   317 bits (811),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 168/364 (46%), Positives = 230/364 (63%), Gaps = 9/364 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+D  +RS EDIAF VALFIARK GS+++YYMYHGGTNFGR A+S++ TSYYD AP
Sbjct  273   YPIYGNDTKLRSTEDIAFAVALFIARKKGSFVSYYMYHGGTNFGRFASSYVTTSYYDGAP  332

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+  P W HL+ELHAA+K+ S+ LL    S FSL   Q+A++F  ++   C AFL
Sbjct  333   LDEYGLIWRPTWGHLRELHAAVKLSSEALLFGRYSNFSLGPEQEAHIF--ETELKCVAFL  390

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKF-DST  691
             +N D   +  V F+N  +QL PKSIS+L +C+TV F TA+V  Q  +RT +      D  
Sbjct  391   VNFDKHQTPTVVFRNIYFQLAPKSISVLSECRTVVFETARVNAQYGSRTAEVVESLNDIH  450

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAI--SVES  865
                   E +           + L +H++ TKD +DYLWY +S +   SD    +  +VES
Sbjct  451   TWKAFKEPIPEDISKAVYTGNQLFEHLSMTKDETDYLWYIVSYEYIPSDDGQLVLLNVES  510

Query  866   LGHVLHIFVNGELAGSAHGTFRN-SSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEH  1042
               HVLH FVN E AGS HG+     +  L + +SLN+G N ISLLS  VG P+SGA++E 
Sbjct  511   RAHVLHAFVNTEYAGSVHGSHDGPGNIILNTNISLNEGQNTISLLSVMVGSPDSGAHMER  570

Query  1043  KTLGPRKVTIESSEGS-EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS--SSQPL  1213
             ++ G  KV+I+  +     L+N+ W YQVGL GE  +IYT++ S++ +W E +  +  P 
Sbjct  571   RSFGIHKVSIQQGQQPLHLLNNELWAYQVGLYGEANRIYTQEESSSAEWTEINNLTYHPF  630

Query  1214  IWYK  1225
              WYK
Sbjct  631   TWYK  634


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY  1587
             +T F  P GND +ALNL SMGKGE WVNG+S+GRYWVS+
Sbjct  634   KTTFATPVGNDVVALNLTSMGKGEVWVNGESLGRYWVSF  672



>ref|XP_010093111.1| Beta-galactosidase 10 [Morus notabilis]
 gb|EXB53549.1| Beta-galactosidase 10 [Morus notabilis]
Length=607

 Score =   315 bits (806),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 173/368 (47%), Positives = 226/368 (61%), Gaps = 14/368 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QA  331
             ++ +G+    R AED+AF VA F  +K GS  NYYMYHGGTNFGRT+    IT+ YD +A
Sbjct  28    FKTFGAPDPHRPAEDVAFSVARFF-QKGGSVHNYYMYHGGTNFGRTSGGPFITTSYDYEA  86

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             P+DEYGL R PKW HLKELH +IK C   LL+  P+  SL   Q+A V+  DSSGACAAF
Sbjct  87    PIDEYGLPRNPKWGHLKELHQSIKACEHFLLNGEPTNISLGPNQEADVYT-DSSGACAAF  145

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             + N D K+   ++F+NSSY LP  S+SILPDCK V FNTAKV TQ+    M P    ++ 
Sbjct  146   ISNTDDKNDKTIEFRNSSYHLPAWSVSILPDCKNVVFNTAKVGTQTAVVEMVPGEDLNTL  205

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD------PKSAI  853
             +     E+  + +D  +   +  +DHINTTKD +DYLWYT S+  + ++       +  +
Sbjct  206   KWEVFVEKAGI-WDQADFVKNGFVDHINTTKDTTDYLWYTTSIYVDENEGFLKKGSQPVL  264

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
              VES GH LH FVN EL GSA G   +S +  +  +SL  G N I+LLS TVGL N+G++
Sbjct  265   LVESKGHALHAFVNQELQGSASGNGTHSPYKFKKPISLKAGKNEIALLSMTVGLQNAGSF  324

Query  1034  LEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS---S  1201
              E    G   V I   + G+ +LSN +W Y++GL GE+L IY E G   V W   S    
Sbjct  325   YEWVGAGLTNVEISGFNNGTVNLSNSTWTYKIGLQGEHLGIYKEDGMTKVNWIATSRPPK  384

Query  1202  SQPLIWYK  1225
              QPL WYK
Sbjct  385   KQPLTWYK  392


 Score = 84.0 bits (206),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/104 (41%), Positives = 59/104 (57%), Gaps = 22/104 (21%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYW-------------VSYH-------  1590
             + V D P G+ P+ L++  MGKG AW+NG+ IGRYW               Y        
Sbjct  392   KAVIDPPPGDKPVGLDMLHMGKGLAWLNGEEIGRYWPRKSSTLQKCVHECDYRGKFMPDK  451

Query  1591  --TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
               T  G P+Q WY+VPRS+ KP+GN+LV+FEE+ G+P  IT  +
Sbjct  452   CFTGCGEPTQRWYHVPRSWFKPSGNILVIFEEKGGDPSKITFSR  495



>ref|XP_008347518.1| PREDICTED: beta-galactosidase 13-like [Malus domestica]
Length=769

 Score =   319 bits (817),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 171/389 (44%), Positives = 228/389 (59%), Gaps = 16/389 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + K+G+  NYYMYHGGTNFGRT++ F  T YYD+AP
Sbjct  204   YRVFGDPPSQRSAEDIAFSVARFFS-KDGTLTNYYMYHGGTNFGRTSSIFTTTRYYDEAP  262

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLK+LH A+ +C + LL+  P    L +  +A  +    +  C AFL
Sbjct  263   LDEYGLQREPKWGHLKDLHKALNLCKKSLLAGAPGVLKLGKETEARFYEKPGTDICVAFL  322

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTM---QPALKFD  685
              NN  K    V ++   Y LPP SISILPDCKTV FN+ ++ +Q NTR     + A K +
Sbjct  323   ANNHSKLETSVTWRGQEYFLPPHSISILPDCKTVVFNSQQIVSQXNTRNFVRSKAAKKLN  382

Query  686   STeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KS  847
                  E    +V      N +    L H+   KD +DY W+T SL     D P     + 
Sbjct  383   WEMSPEPIPTVVQ--VPVNQKKPQELYHL--LKDATDYGWFTTSLDLGPYDLPMKDSIRP  438

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              I + SLGH + +FVNGE  G+ HG+     F  E  V+  +G+N ISLL  TVGLP+SG
Sbjct  439   VIRIPSLGHAMGVFVNGEYIGTEHGSHAEKGFVFEKPVTFKQGLNYISLLCMTVGLPDSG  498

Query  1028  AYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REFSS  1201
             AY+EH+  GPR +T+   + G+ DLS + WG++VGL GENLQ++TEKG+  VQW +    
Sbjct  499   AYMEHRYAGPRTITVLGLNTGTIDLSQNGWGHRVGLNGENLQVFTEKGAQKVQWTKAAGK  558

Query  1202  SQPLIWYKEWRTIKKVYLPARAVKTGFAR  1288
              + L WYK +    +   P     TG  +
Sbjct  559   GRALTWYKTYFDAPEGKDPVAIRMTGMGK  587


 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 70/116 (60%), Gaps = 7/116 (6%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG DP+A+ +  MGKG  WVNG SIGR+W+S+ +  G P+Q  Y++PRSF+KP
Sbjct  566   KTYFDAPEGKDPVAIRMTGMGKGMVWVNGLSIGRHWMSFLSPLGQPTQAEYHIPRSFIKP  625

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILLRRLA*GKGSVPSHNHTKDRKSKK  1818
               N LV+ EE+  +P  I +    +T+++D +           P H +  +RK  K
Sbjct  626   GKNFLVVLEEQDADPKDIEI----LTVNRDTICSM---SSQMHPPHVNAFERKGGK  674



>ref|XP_009396354.1| PREDICTED: beta-galactosidase 5-like [Musa acuminata subsp. malaccensis]
Length=848

 Score =   320 bits (821),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 178/367 (49%), Positives = 230/367 (63%), Gaps = 17/367 (5%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QAPLD  340
             +G     R AED+AF VA FI +  GS+INYYMYHGGTNFGRTA    IT+ YD  AP+D
Sbjct  262   FGGTIRHRPAEDLAFAVARFI-QNGGSFINYYMYHGGTNFGRTAGGPFITTSYDYDAPID  320

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             EYGL+REPK+ HLKELH AIK+C Q L+SA P+  SL   QQA+VF  + SG CAAFL N
Sbjct  321   EYGLIREPKYGHLKELHKAIKLCEQALVSADPTVTSLGSLQQAHVFSSE-SGGCAAFLSN  379

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeew  700
             ++    AK+ F N  Y LPP SISILPDC+ V FNTAK+  Q++   M P     S    
Sbjct  380   HEPNSYAKIMFNNMHYNLPPWSISILPDCRNVVFNTAKIGVQTSQMQMYPT-NTQSLMWE  438

Query  701   eefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD------PKSAISVE  862
                EE+    +++ I A  LL+ IN T+D SDYLWY  S+   S++          ++V 
Sbjct  439   RYDEEVASLEENSLITATGLLEQINVTRDTSDYLWYITSVDISSAEEFLKGGKLPVLTVR  498

Query  863   SLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE-  1039
             S GH LHIFVNG+L+GSA+GT  N        ++L  G N I+LLS  VGLPNSG + E 
Sbjct  499   SAGHALHIFVNGQLSGSAYGTRENKRIKFSGNINLRAGTNRIALLSVAVGLPNSGVHYEL  558

Query  1040  --HKTLGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS---SS  1204
                  LGP  V  E  EGS DL+  +W YQVGL GE++ + + +G+++V+W + S   + 
Sbjct  559   WSTGVLGP-VVLHELDEGSRDLTWQTWSYQVGLKGEDMNLNSLEGASSVEWMQGSLVQNQ  617

Query  1205  QPLIWYK  1225
             QPL WY+
Sbjct  618   QPLTWYR  624


 Score = 95.1 bits (235),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 64/106 (60%), Gaps = 20/106 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +  FD P+G++PLAL++ SMGKG  W+NGQSIGRYW +Y                     
Sbjct  624   RAYFDAPDGDEPLALDMASMGKGHVWINGQSIGRYWTAYAPKENCKSCSYTGTYRSPKCQ  683

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +  G P+Q WY+VPRS+L+PT NLLV+FEE  G+   I L   S++
Sbjct  684   SGCGQPTQRWYHVPRSWLQPTRNLLVVFEELGGDATKIALMMRSVS  729



>gb|AAB61470.1| beta-D-galactosidase [Mangifera indica]
Length=663

 Score =   316 bits (809),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 174/373 (47%), Positives = 227/373 (61%), Gaps = 25/373 (7%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             +  +G     R AED+AF VA FI +  GS++NYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  264   FTAFGGPTPQRPAEDVAFSVARFI-QNGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDA  322

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDEYGLLREPKW HL++LH AIK+C   L+S  P+  SL   Q+ +VF    SG+CAAF
Sbjct  323   PLDEYGLLREPKWGHLRDLHKAIKLCESALVSTDPTVTSLGNNQEVHVFN-PKSGSCAAF  381

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N D   SAKV F+   Y+LPP SISILPDCKT  FNTA++  QS+ + M P   F   
Sbjct  382   LANYDTTSSAKVNFKIMQYELPPWSISILPDCKTAVFNTARLGAQSSLKQMTPVSTFSWQ  441

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESS--------DPKS  847
                EE        DD     D L + +N T+D SDYLWY  ++  +S+        DP  
Sbjct  442   SYIEESAS---SSDDKTFTTDGLWEQLNVTRDASDYLWYMTNINIDSNEGFLKNGQDP--  496

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              +++ S GH LH+F+NG+L+G+ +G   N   T    V +  G+N +SLLS +VGL N G
Sbjct  497   LLTIWSAGHALHVFINGQLSGTVYGGVDNPKLTFSQNVKMRVGVNQLSLLSISVGLQNVG  556

Query  1028  AYLEH---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF  1195
              + E      LGP  VT+   +EG+ DLS   W Y++GL GE+L ++T  GS++V+W E 
Sbjct  557   THFEQWNTGVLGP--VTLRGLNEGTRDLSKQQWSYKIGLKGEDLSLHTVSGSSSVEWVEG  614

Query  1196  SS---SQPLIWYK  1225
             SS    QPL WYK
Sbjct  615   SSLAQKQPLTWYK  627



>gb|KGN43246.1| hypothetical protein Csa_7G011860 [Cucumis sativus]
Length=828

 Score =   319 bits (818),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/365 (44%), Positives = 225/365 (62%), Gaps = 10/365 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     R+AEDIAF VA F + KNGS +NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  266   YRVFGDPPSQRAAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSAVFTTTRYYDEAP  324

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDE+GL REPKW HL+++H A+ +C + LL  TP    + +  +A  +    +  CAAFL
Sbjct  325   LDEFGLQREPKWGHLRDVHKALNLCKKPLLWGTPGIQVIGKGLEARFYEKPGTNICAAFL  384

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NND K +  + F+   + LPP+SISILPDCKTV FNT  + +Q N R   P+ K  +  
Sbjct  385   ANNDTKSAQTINFRGREFLLPPRSISILPDCKTVVFNTETIVSQHNARNFIPS-KNANKL  443

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKS------AIS  856
             +W+   E +   +   +     L+  +  KD +DY WYT S++ +  D          + 
Sbjct  444   KWKMSPESIPTVEQVPVNNKIPLELYSLLKDTTDYGWYTTSIELDKEDVSKRPDILPVLR  503

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             + SLGH + +FVNGE  G+AHG+    +F  + +V    G+NNI+LL   VGLP+SGAY+
Sbjct  504   IASLGHAMLVFVNGEYIGTAHGSHEEKNFVFQGSVPFKAGVNNIALLGILVGLPDSGAYM  563

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQ-P  1210
             EH+  GPR +TI   + G+ D+S + WG+QV L GE ++++T+ GS+ V W E    +  
Sbjct  564   EHRFAGPRSITILGLNTGTLDISKNGWGHQVALQGEKVKVFTQGGSHRVDWSEIKEEKSA  623

Query  1211  LIWYK  1225
             L WYK
Sbjct  624   LTWYK  628


 Score = 98.2 bits (243),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 63/87 (72%), Gaps = 5/87 (6%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEGNDP+A+ +  MGKG+ WVNG+SIGRYW+SY +     +Q+ Y++PRSF+KP
Sbjct  628   KTYFDAPEGNDPVAIRMNGMGKGQIWVNGKSIGRYWMSYLSPLKLSTQSEYHIPRSFIKP  687

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITL  1731
             + NLLV+ EEE      +T +KV I L
Sbjct  688   SENLLVILEEE-----NVTPEKVEILL  709



>ref|XP_004170887.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase-like [Cucumis 
sativus]
Length=716

 Score =   317 bits (811),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 175/369 (47%), Positives = 232/369 (63%), Gaps = 20/369 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y  +G     R  ED+AF VA FI + NGS +NYY+YHGGTNFGRT+  F+ TSY   AP
Sbjct  253   YTAFGGPTPYRPPEDVAFSVARFI-QNNGSLVNYYVYHGGTNFGRTSGLFIATSYDFDAP  311

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             +DEYGL+REPKW HL++LH AIK C   L+SA P+   L + Q+A VF+  SS ACAAFL
Sbjct  312   IDEYGLIREPKWGHLRDLHKAIKSCEPALVSADPTITWLGKNQEARVFK--SSSACAAFL  369

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N D   S KV F N+ Y LPP SISILPDC TV FNTA+V  +S    M P   F    
Sbjct  370   ANYDTSASVKVNFWNNPYDLPPWSISILPDCXTVTFNTAQVGVKSYQAKMMPISSFGWLS  429

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP--KSA----IS  856
               EE         DT  +A  L++ ++ T D +DYLWY   +  +S++   KS     +S
Sbjct  430   YKEEPASAYA--KDTTTKAG-LVEQVSITWDTTDYLWYMQDISIDSTEGFLKSGKWPLLS  486

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V S GH+LH+F+NG+L+GS +G+  + + T    V L +G+N +S+LS TVGLPN G + 
Sbjct  487   VNSAGHLLHVFINGQLSGSVYGSLEDPAITFSKNVDLKQGVNKLSMLSVTVGLPNVGLHF  546

Query  1037  E---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE--FS  1198
             +      LGP  VT+E  +EG+ D+S   W Y+VGL GE+L +Y++KGSN+VQW +   +
Sbjct  547   DTWNAGVLGP--VTLEGLNEGTRDMSKYKWSYKVGLSGESLNLYSDKGSNSVQWTKGSLT  604

Query  1199  SSQPLIWYK  1225
               QPL WYK
Sbjct  605   QKQPLTWYK  613


 Score = 86.3 bits (212),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 61/102 (60%), Gaps = 20/102 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYW-----------VSYHTV-------  1596
             +T F  P GN+PL L++ SM KG+ W+NGQSIGRY+            SY  +       
Sbjct  613   KTTFKTPAGNEPLGLDMSSMSKGQIWINGQSIGRYFPGYIANGKCDKCSYAGLFTEKKCL  672

Query  1597  --AGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
                G PSQ WY++PR +L P+ NLLV+FEE  G+P GI+L K
Sbjct  673   GNCGEPSQKWYHIPRDWLSPSDNLLVIFEEIGGSPDGISLVK  714



>ref|XP_002514108.1| beta-galactosidase, putative [Ricinus communis]
 gb|EEF48062.1| beta-galactosidase, putative [Ricinus communis]
Length=840

 Score =   319 bits (817),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 177/374 (47%), Positives = 228/374 (61%), Gaps = 27/374 (7%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QA  331
             Y  +G     R AED+AF VA FI +  GS++NYYMYHGGTNFGRT+A   I + YD  A
Sbjct  261   YTEFGGAVPYRPAEDLAFSVARFI-QNGGSFMNYYMYHGGTNFGRTSAGLFIATSYDYDA  319

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDEYGL R+PKW HL++LH AIK+C   L+S  P+  SL   Q+A+VF+  SS  CAAF
Sbjct  320   PLDEYGLTRDPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGSNQEAHVFQSKSS--CAAF  377

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQP---ALKF  682
             L N D K+S KV F N  Y LPP SISILPDCKT  FNTA++  QS+   M P   AL +
Sbjct  378   LANYDTKYSVKVTFGNGQYDLPPWSISILPDCKTAVFNTARLGAQSSQMKMTPVGGALSW  437

Query  683   DSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD------PK  844
              S  E         G+ D     + L + IN T+D SDYLWY  ++  +S +        
Sbjct  438   QSYIEEA-----ATGYTDDTTTLEGLWEQINVTRDASDYLWYMTNVNIDSDEGFLKNGDS  492

Query  845   SAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNS  1024
               +++ S GH LH+F+NG+LAG+ +G+  N   T    V L  G+N ISLLS  VGLPN 
Sbjct  493   PVLTIFSAGHSLHVFINGQLAGTVYGSLENPKLTFSQNVKLTAGINKISLLSVAVGLPNV  552

Query  1025  GAYLEH---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE  1192
             G + E      LGP  VT++  +EG+ DLS   W Y++GL GE L ++T  GS++V+W E
Sbjct  553   GVHFEKWNAGILGP--VTLKGLNEGTRDLSGWKWSYKIGLKGEALSLHTVTGSSSVEWVE  610

Query  1193  FSSS---QPLIWYK  1225
              S S   QPL WYK
Sbjct  611   GSLSAKKQPLTWYK  624


 Score =   102 bits (255),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 65/102 (64%), Gaps = 20/102 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +  FD PEGNDP+AL++ SMGKG+ WVNGQSIGR+W +Y                     
Sbjct  624   KATFDAPEGNDPVALDMSSMGKGQIWVNGQSIGRHWPAYTARGSCSACNYAGTYDDKKCR  683

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
             +  G PSQ WY+VPRS+L P+GNLLV+FEE  G P GI+L K
Sbjct  684   SNCGEPSQRWYHVPRSWLNPSGNLLVVFEEWGGEPSGISLVK  725



>ref|XP_004963754.1| PREDICTED: beta-galactosidase 7-like [Setaria italica]
Length=783

 Score =   317 bits (813),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 170/364 (47%), Positives = 228/364 (63%), Gaps = 9/364 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             +  YGSD  +RS EDIAF VALFIARK GS++NYYMYHGGTNFGR A+S++ TSYYD AP
Sbjct  260   FLTYGSDTQLRSPEDIAFAVALFIARKKGSFVNYYMYHGGTNFGRFASSYVTTSYYDGAP  319

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+ +P W HL+ELHAA+K  S+ LL    S+F L Q Q+A+VF  +S   C AFL
Sbjct  320   LDEYGLIWQPTWGHLRELHAAVKQLSEPLLFGKYSSFLLGQEQEAHVFETESK--CVAFL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKF-DST  691
             +N D     KV F++ S+QL PKSISIL DC+ V   TAK+  Q  +R  +      D  
Sbjct  378   VNFDKSQMPKVTFRHISFQLAPKSISILSDCRRVVHETAKIKAQHGSRIAEVVQSLSDIN  437

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQ-QESSDPKSA-ISVES  865
                   E + +           LL+ ++ TKD +DYLWYT+S + +   D +   ++VES
Sbjct  438   TWKAFKEPIPLDVKKAMHATRQLLEQLSATKDETDYLWYTVSHEYRPIGDGQPVLLNVES  497

Query  866   LGHVLHIFVNGELAGSAHGTFRNS-SFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEH  1042
               H++H FVN +  GS HG+   S +  L++ V+L +G N ISLL+  VG P+SG ++E 
Sbjct  498   RAHIVHAFVNKQYVGSVHGSHDESDNIILKTRVALKEGQNTISLLNVMVGSPDSGPHMER  557

Query  1043  KTLGPRKVTIESSEGSEDLSNDS-WGYQVGLLGENLQIYTEKGSNAVQWREFSSS--QPL  1213
             K  G RKVTI+  +  E L N+  WGY VGL GE   IYT+ GS  ++W   +++   PL
Sbjct  558   KVFGIRKVTIQKGKQPEQLLNNRLWGYHVGLFGERNHIYTQGGSQGIEWTTINNTTYHPL  617

Query  1214  IWYK  1225
              WYK
Sbjct  618   TWYK  621


 Score =   114 bits (284),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P GND +ALNL  MGKGE W+NG+SIGRYWVS+   +G PSQ+ Y++PR FLKP
Sbjct  621   KTTFASPVGNDAVALNLAGMGKGEVWINGESIGRYWVSFKAPSGNPSQSLYHIPRQFLKP  680

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI  1725
              GN LVLFEE  GNP  IT++ VS+
Sbjct  681   QGNTLVLFEEMGGNPKQITVNTVSV  705



>ref|XP_006451462.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64702.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=581

 Score =   312 bits (799),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 225/369 (61%), Gaps = 23/369 (6%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPLDE  343
             +GS    R AED+ F VA FI +  GS+INYYMYHGGTNFGRT+  F+ TSY   AP+DE
Sbjct  117   FGSAVPTRPAEDLVFSVARFI-QSGGSFINYYMYHGGTNFGRTSGGFVATSYDYDAPIDE  175

Query  344   YGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINN  523
             YGLL EPKW HL++LH AIK+C   L+S  P+  SL + Q+A+VF    SG CAAFL N 
Sbjct  176   YGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFN-SKSGKCAAFLANY  234

Query  524   DGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeewe  703
             D   SAKV F N+ Y LPP SIS+LPDCKT  FNTA+V  QS+ +   P +  ++     
Sbjct  235   DTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVI--NAFSWQS  292

Query  704   efeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESS--------DPKSAISV  859
               EE     DD     D L + +  T D SDYLWY   +  +S+        DP   +++
Sbjct  293   YIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDP--LLTI  350

Query  860   ESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE  1039
              S GH L +F+NG+L+G+ +G+  N   T    V L  G+N ISLLS +VGLPN G + E
Sbjct  351   WSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFE  410

Query  1040  H---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--  1201
                   LGP  VT++  +EG+ D+S   W Y++GL GE L ++T  GS++V+W + +S  
Sbjct  411   KWNAGVLGP--VTLKGLNEGTRDISKQKWTYKIGLKGEALSLHTISGSSSVEWAQGASLA  468

Query  1202  -SQPLIWYK  1225
               QP+ WYK
Sbjct  469   QKQPMTWYK  477


 Score =   101 bits (251),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 65/102 (64%), Gaps = 20/102 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +T F+ P GNDPLAL++G+MGKG  W+NGQSIGR+W  Y                     
Sbjct  477   KTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGRHWPGYIGNGNCGGCNYAGTYTEKKCR  536

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
             T  G PSQ WY+VPRS+LKP+GNLLV+FEE  G P+ I+L K
Sbjct  537   TYCGKPSQRWYHVPRSWLKPSGNLLVVFEEWGGEPHWISLLK  578



>ref|XP_010028723.1| PREDICTED: beta-galactosidase 13 [Eucalyptus grandis]
Length=770

 Score =   317 bits (811),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 170/369 (46%), Positives = 230/369 (62%), Gaps = 17/369 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAED+AF VA F A KNG+  NYYMYHGGTN GRT+A F  T YYD+AP
Sbjct  204   YRVFGDPPSQRSAEDLAFSVARFFA-KNGTLTNYYMYHGGTNLGRTSAVFTTTRYYDEAP  262

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLK+LH A+++C + LL  +P    L++  +A  +    +  CAAFL
Sbjct  263   LDEYGLQREPKWGHLKDLHKALRLCRKALLWGSPKVQRLSKDLEARYYEIPGTKVCAAFL  322

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN    +  V+F+   Y LP  SISILPDCKTV +NT ++ +Q N+R +   +K +   
Sbjct  323   TNNSTLSAQVVKFRGQEYYLPQHSISILPDCKTVVYNTQRIVSQHNSRNL---VKSEKAN  379

Query  695   eweefeeLVVGFDDTN---IRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KS  847
             + +    L +   DTN   + A    +  +  KD +DY W+T SL     D P     K 
Sbjct  380   KLKWEMSLEI-IPDTNRVPVNAKIPAELYSLLKDTTDYAWFTTSLDLGVRDLPMRKNIKP  438

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              + V SLGH +  FVNGE  GSAHG+  + SF L+  + L  G+N+ISLL +TVGLP+SG
Sbjct  439   VLRVASLGHAMLAFVNGEFIGSAHGSHIDKSFVLQQPIDLKPGVNHISLLGSTVGLPDSG  498

Query  1028  AYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-  1201
             AY+EH+  GPR VTI   + G+ DL+ + WG+QVGL GE +++YT+ GS+  QW E +  
Sbjct  499   AYMEHRYAGPRLVTILGLNTGTLDLTLNGWGHQVGLDGEKVRVYTQSGSHRAQWTEATKG  558

Query  1202  -SQPLIWYK  1225
               + L WYK
Sbjct  559   VGRALTWYK  567


 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 66/93 (71%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG+ P+A++L  M KG  WVNG+SIGRYW +Y +  G PSQ+ Y++PRSF+KP
Sbjct  567   KTYFDAPEGDQPVAIHLPQMTKGMVWVNGKSIGRYWYTYLSPLGQPSQSEYHIPRSFIKP  626

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             T NLLV+ +E+ GNP  I +    + +D+D + 
Sbjct  627   TDNLLVVLDEDGGNPESIEI----LNVDRDTIC  655



>gb|EMT10431.1| Beta-galactosidase 7 [Aegilops tauschii]
Length=831

 Score =   318 bits (815),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 173/372 (47%), Positives = 231/372 (62%), Gaps = 17/372 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+D  +RS EDIAF VALFIARK GS+++YYMYHGGTNFGR A+S++ TSYYD AP
Sbjct  274   YPIYGNDTKLRSTEDIAFAVALFIARKKGSFVSYYMYHGGTNFGRFASSYVTTSYYDGAP  333

Query  335   LDEY--------GLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDS  490
             LDEY        GL+  P W HL+ELHAA+ + S+ LL  T S FSL Q Q+A++F  ++
Sbjct  334   LDEYGKYFKESQGLIWRPTWGHLRELHAAVNLSSEPLLFGTYSNFSLGQEQEAHIF--ET  391

Query  491   SGACAAFLINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQP  670
                C AFL+N D   S  V F+N  +QL PKSISIL +C+TV F TAKV  Q  +RT + 
Sbjct  392   ELKCVAFLVNFDKHQSPTVVFRNIPFQLAPKSISILSECRTVVFETAKVNAQYGSRTAKV  451

Query  671   ALKF-DSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKS  847
                  D        E +           + L +H++ TKD +DYLWY +S +   SD   
Sbjct  452   VESLNDIHTWKAFKEPIPEDISKAVYTGNQLFEHLSMTKDETDYLWYIVSYEYRPSDDGQ  511

Query  848   AI--SVESLGHVLHIFVNGELAGSAHGTFRN-SSFTLESTVSLNKGMNNISLLSATVGLP  1018
              +  + ES  HVLH FVN E  G  HG+     +  L + +SL +G N ISLLS  VG P
Sbjct  512   LVLLNAESRAHVLHAFVNTEYVGCVHGSHDGPGNIILNTNISLKEGQNTISLLSVMVGSP  571

Query  1019  NSGAYLEHKTLGPRKVTIESSEGS-EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF  1195
             +SGA++E ++ G RKV+I+  +     L+N+ WGYQVGL GE  +IYT++ S++V+W E 
Sbjct  572   DSGAHMERRSFGIRKVSIQQGQQPLHLLNNELWGYQVGLYGEGKRIYTQEESSSVEWTEI  631

Query  1196  SS--SQPLIWYK  1225
             +S    PL WYK
Sbjct  632   NSLTYHPLTWYK  643


 Score =   114 bits (284),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P GND +ALNL SMGKGE WVNG+SIGRYWVS+   +G PSQ+ Y++P+ FLKP
Sbjct  643   KTTFAAPVGNDAVALNLTSMGKGEVWVNGESIGRYWVSFKAPSGQPSQSLYHIPQHFLKP  702

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
             T NLLVL EE  GNP  IT++ VSIT
Sbjct  703   TDNLLVLVEEIGGNPLEITVNTVSIT  728



>ref|XP_008377743.1| PREDICTED: beta-galactosidase 13 [Malus domestica]
Length=860

 Score =   318 bits (816),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 171/389 (44%), Positives = 228/389 (59%), Gaps = 16/389 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + K+G+  NYYMYHGGTNFGRT++ F  T YYD+AP
Sbjct  295   YRVFGDPPSQRSAEDIAFSVARFFS-KDGTLTNYYMYHGGTNFGRTSSIFTTTRYYDEAP  353

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLK+LH A+ +C + LL+  P    L +  +A  +    +  C AFL
Sbjct  354   LDEYGLQREPKWGHLKDLHKALNLCKKSLLAGAPGVLKLGKETEARFYEKPGTDICVAFL  413

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTM---QPALKFD  685
              NN  K    V ++   Y LPP SISILPDCKTV FN+ ++ +Q NTR     + A K +
Sbjct  414   ANNHSKLETSVTWRGQXYFLPPHSISILPDCKTVVFNSQQIVSQHNTRNFVRSKAAKKLN  473

Query  686   STeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KS  847
                  E    +V      N +    L H+   KD +DY W+T SL     D P     + 
Sbjct  474   WEMSPEPIPTVVQ--VPVNQKKPQELYHL--LKDATDYGWFTTSLDLGPYDLPMKDSIRP  529

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              I + SLGH + +FVNGE  G+ HG+     F  E  V+  +G+N ISLL  TVGLP+SG
Sbjct  530   VIRIPSLGHAMGVFVNGEYIGTEHGSHAEKGFVFEKPVTFKQGLNYISLLCMTVGLPDSG  589

Query  1028  AYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REFSS  1201
             AY+EH+  GPR +T+   + G+ DLS + WG++VGL GENLQ++TEKG+  VQW +    
Sbjct  590   AYMEHRYAGPRTITVLGLNTGTIDLSQNGWGHRVGLNGENLQVFTEKGAQKVQWTKAAGK  649

Query  1202  SQPLIWYKEWRTIKKVYLPARAVKTGFAR  1288
              + L WYK +    +   P     TG  +
Sbjct  650   GRALTWYKTYFDAPEGKDPVAIRMTGMGK  678


 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 70/116 (60%), Gaps = 7/116 (6%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG DP+A+ +  MGKG  WVNG SIGR+W+S+ +  G P+Q  Y++PRSF+KP
Sbjct  657   KTYFDAPEGKDPVAIRMTGMGKGMVWVNGLSIGRHWMSFLSPLGQPTQAEYHIPRSFIKP  716

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILLRRLA*GKGSVPSHNHTKDRKSKK  1818
               N LV+ EE+  +P  I +    +T+++D +           P H +  +RK  K
Sbjct  717   GKNFLVVLEEQDADPKDIEI----LTVNRDTICSM---SSQMHPPHVNAFERKGGK  765



>ref|XP_009374634.1| PREDICTED: beta-galactosidase 13-like [Pyrus x bretschneideri]
Length=769

 Score =   316 bits (810),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 167/365 (46%), Positives = 228/365 (62%), Gaps = 10/365 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + KNG+  NYYMYHGGTNFGRT++ F  T YYD+AP
Sbjct  204   YRVFGDPPSQRSAEDIAFSVARFFS-KNGTLTNYYMYHGGTNFGRTSSIFTTTRYYDEAP  262

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKWSHLK+LH A+K+  + LL   P    +++  + + +   ++  CAAFL
Sbjct  263   LDEYGLPRDPKWSHLKDLHKALKLSRKALLWGVPGVQKISKDIEVHFYETAATNICAAFL  322

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN+ +  A V ++   Y LPP+SISILPDCKTV FNT +V +Q N+R    + K  +  
Sbjct  323   TNNNFQTEAIVNWRGVDYHLPPRSISILPDCKTVVFNTQRVVSQLNSRNFVRS-KVANNL  381

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KSAIS  856
             +W ++ E V       +   T L+  +  KD +DY WYT  L     D P     +  + 
Sbjct  382   KWTKYVEPVPSTLQVPVNNPTPLELYSLLKDTTDYAWYTTKLALSPQDLPMKESIRPVLR  441

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             + SLGH LH FV+GE  G AHG+    SF  E  V L  G+N ISLL+ T+GLP+SGAY+
Sbjct  442   IASLGHALHAFVDGEYIGFAHGSHDEKSFVFEKPVPLKAGINQISLLAMTIGLPDSGAYM  501

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSSQP  1210
             EH+  GP  V +   + G+ DL+ + WG+Q+GL GE LQ++TE+GS  VQW +   + + 
Sbjct  502   EHRYAGPNLVAVLGLNTGTLDLTRNGWGHQLGLSGEKLQVFTEEGSKQVQWHKTKEAPEG  561

Query  1211  LIWYK  1225
             L WYK
Sbjct  562   LTWYK  566


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 64/93 (69%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG+DP+A+ +  MGKG  WVNG+SIGR+W S+ +  G P+Q  Y++PRSF+KP
Sbjct  566   KTYFDAPEGHDPIAIRMAGMGKGMIWVNGKSIGRHWTSFLSPLGEPTQAEYHIPRSFIKP  625

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
               NLLV+ EE+   P  I +    +T+++D + 
Sbjct  626   KQNLLVVLEEQPAKPKPIEI----LTVNRDTVC  654



>gb|KDO57771.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=608

 Score =   312 bits (799),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 225/369 (61%), Gaps = 23/369 (6%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPLDE  343
             +GS    R AED+ F VA FI +  GS+INYYMYHGGTNFGRT+  F+ TSY   AP+DE
Sbjct  144   FGSAVPTRPAEDLVFSVARFI-QSGGSFINYYMYHGGTNFGRTSGGFVATSYDYDAPIDE  202

Query  344   YGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINN  523
             YGLL EPKW HL++LH AIK+C   L+S  P+  SL + Q+A+VF    SG CAAFL N 
Sbjct  203   YGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFN-SKSGKCAAFLANY  261

Query  524   DGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeewe  703
             D   SAKV F N+ Y LPP SIS+LPDCKT  FNTA+V  QS+ +   P +  ++     
Sbjct  262   DTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVI--NAFSWQS  319

Query  704   efeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESS--------DPKSAISV  859
               EE     DD     D L + +  T D SDYLWY   +  +S+        DP   +++
Sbjct  320   YIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDP--LLTI  377

Query  860   ESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE  1039
              S GH L +F+NG+L+G+ +G+  N   T    V L  G+N ISLLS +VGLPN G + E
Sbjct  378   WSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFE  437

Query  1040  H---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--  1201
                   LGP  VT++  +EG+ D+S   W Y++GL GE L ++T  GS++V+W + +S  
Sbjct  438   KWNAGVLGP--VTLKGLNEGTRDISKQKWTYKIGLKGEALSLHTVSGSSSVEWAQGASLA  495

Query  1202  -SQPLIWYK  1225
               QP+ WYK
Sbjct  496   QKQPMTWYK  504


 Score =   100 bits (250),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 65/102 (64%), Gaps = 20/102 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +T F+ P GNDPLAL++G+MGKG  W+NGQSIGR+W  Y                     
Sbjct  504   KTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGRHWPGYIGNGNCGGCNYAGTYTEKKCR  563

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
             T  G PSQ WY+VPRS+LKP+GNLLV+FEE  G P+ I+L K
Sbjct  564   TYCGKPSQRWYHVPRSWLKPSGNLLVVFEEWGGEPHWISLLK  605



>ref|XP_010242207.1| PREDICTED: beta-galactosidase [Nelumbo nucifera]
Length=846

 Score =   318 bits (814),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 177/370 (48%), Positives = 230/370 (62%), Gaps = 19/370 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             Y  +G     R  EDIAF VA F+ +K+GS+INYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  272   YTEFGGPVPHRPVEDIAFSVAKFV-QKSGSFINYYMYHGGTNFGRTAGGPFIATSYDFDA  330

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             P+DEYGLLREPKW HL++LH AIK+C   L+SA P+  S   +Q+A+VFR + SGACAAF
Sbjct  331   PIDEYGLLREPKWGHLRDLHRAIKLCEPALVSADPTVISFGNYQEAHVFRSN-SGACAAF  389

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N D    AKV F+N  Y LPP SISILPDCK   FNTA++  QS+   M  A+  +  
Sbjct  390   LANYDSNAYAKVAFENMHYDLPPWSISILPDCKNTIFNTARIGAQSSLMKMT-AVSSEGF  448

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP--KSA----I  853
                   EE    +DD +     LL+ IN T+D SDYLWY   +Q + ++   KS     +
Sbjct  449   PWQSYTEE-TASYDDNSFTMVGLLEQINLTRDASDYLWYMTDVQIDPNEEFLKSGQYPVL  507

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             +V S GH LH+F+NG+L+G+ +G+  N   T    V L  G+N ISLLS  VGLPN G +
Sbjct  508   TVSSAGHALHVFINGQLSGTVYGSLENPKLTFSDNVKLIAGINKISLLSIAVGLPNVGTH  567

Query  1034  LE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWR--EF  1195
              E      LGP  V ++  +EG+ DLS   W Y++GL GE L ++T  GS++V+W     
Sbjct  568   FETWNAGVLGP--VVLKGLNEGTRDLSWQKWSYKIGLQGEALGLHTVSGSSSVEWEGSSI  625

Query  1196  SSSQPLIWYK  1225
             +  QPL WYK
Sbjct  626   AKQQPLSWYK  635


 Score =   100 bits (249),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 70/112 (63%), Gaps = 21/112 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             + +FD P GN+PLAL++ SMGKG+ W+NGQSIGRYW +Y                     
Sbjct  635   KAIFDAPTGNEPLALDMSSMGKGQIWINGQSIGRYWPAYKASGTCGNCSYAGEYDDSKCQ  694

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSI-TLDKDI  1743
             +  G  SQ WY+VPRS+L PTGNL V+FEE  G+P  I+L+K ++ +L  DI
Sbjct  695   SNCGEASQRWYHVPRSWLNPTGNLFVIFEEWGGDPTWISLNKRTVGSLCADI  746



>gb|KCW55522.1| hypothetical protein EUGRSUZ_I01412 [Eucalyptus grandis]
Length=830

 Score =   317 bits (813),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 170/369 (46%), Positives = 230/369 (62%), Gaps = 17/369 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAED+AF VA F A KNG+  NYYMYHGGTN GRT+A F  T YYD+AP
Sbjct  264   YRVFGDPPSQRSAEDLAFSVARFFA-KNGTLTNYYMYHGGTNLGRTSAVFTTTRYYDEAP  322

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLK+LH A+++C + LL  +P    L++  +A  +    +  CAAFL
Sbjct  323   LDEYGLQREPKWGHLKDLHKALRLCRKALLWGSPKVQRLSKDLEARYYEIPGTKVCAAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN    +  V+F+   Y LP  SISILPDCKTV +NT ++ +Q N+R +   +K +   
Sbjct  383   TNNSTLSAQVVKFRGQEYYLPQHSISILPDCKTVVYNTQRIVSQHNSRNL---VKSEKAN  439

Query  695   eweefeeLVVGFDDTN---IRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KS  847
             + +    L +   DTN   + A    +  +  KD +DY W+T SL     D P     K 
Sbjct  440   KLKWEMSLEI-IPDTNRVPVNAKIPAELYSLLKDTTDYAWFTTSLDLGVRDLPMRKNIKP  498

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              + V SLGH +  FVNGE  GSAHG+  + SF L+  + L  G+N+ISLL +TVGLP+SG
Sbjct  499   VLRVASLGHAMLAFVNGEFIGSAHGSHIDKSFVLQQPIDLKPGVNHISLLGSTVGLPDSG  558

Query  1028  AYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-  1201
             AY+EH+  GPR VTI   + G+ DL+ + WG+QVGL GE +++YT+ GS+  QW E +  
Sbjct  559   AYMEHRYAGPRLVTILGLNTGTLDLTLNGWGHQVGLDGEKVRVYTQSGSHRAQWTEATKG  618

Query  1202  -SQPLIWYK  1225
               + L WYK
Sbjct  619   VGRALTWYK  627


 Score =   100 bits (249),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 66/93 (71%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG+ P+A++L  M KG  WVNG+SIGRYW +Y +  G PSQ+ Y++PRSF+KP
Sbjct  627   KTYFDAPEGDQPVAIHLPQMTKGMVWVNGKSIGRYWYTYLSPLGQPSQSEYHIPRSFIKP  686

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             T NLLV+ +E+ GNP  I +    + +D+D + 
Sbjct  687   TDNLLVVLDEDGGNPESIEI----LNVDRDTIC  715



>ref|XP_008450855.1| PREDICTED: beta-galactosidase-like [Cucumis melo]
Length=719

 Score =   315 bits (806),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 173/372 (47%), Positives = 232/372 (62%), Gaps = 25/372 (7%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y  +G+    R AED+AF VA FI + NGS +NYYMYHGGTNFGRT+  F+  SY   AP
Sbjct  253   YTAFGAPTPYRPAEDVAFSVARFI-QNNGSLVNYYMYHGGTNFGRTSGLFIANSYDFDAP  311

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             +DEYGL+REPKW HL++LH AIK C   L+SA P++    + Q+A VF+   SGACAAFL
Sbjct  312   IDEYGLIREPKWGHLRDLHKAIKSCEPALVSADPTSTWPGKNQEARVFK-SRSGACAAFL  370

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N D   S  V F N  Y LPP SISILPDCKTVAFNTAK+  +S+   M     F    
Sbjct  371   ANYDTSASVTVNFWNHPYDLPPWSISILPDCKTVAFNTAKIGVKSSQEKMTSISSFGWLS  430

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSA--------  850
               EE         DT  +A  L++ ++ T D +DYLWY   +   + DP           
Sbjct  431   YKEEPASAYA--TDTTTKAG-LVEQVSVTWDTTDYLWYMTDI---TIDPTEGFLKSRKWP  484

Query  851   -ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              +++ S GHVLH+F+NG+L+G+ +G+ ++ + T    V+L KG+N +S+LSATVGLPN G
Sbjct  485   LLTINSAGHVLHVFINGQLSGTVYGSLKDPAVTFSKYVNLEKGVNKLSMLSATVGLPNVG  544

Query  1028  AYLE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF  1195
              + +      LGP  VT++  +EG+ D+S   W Y+VGL GE L +Y++KGSN+V+W + 
Sbjct  545   LHFDTWNAGVLGP--VTLKGLNEGTRDMSKYKWSYKVGLRGEALNLYSDKGSNSVEWTKG  602

Query  1196  S--SSQPLIWYK  1225
             S    QPL WYK
Sbjct  603   SLVQKQPLTWYK  614


 Score = 92.0 bits (227),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 60/102 (59%), Gaps = 20/102 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTV------------------  1596
             +T F+ P G +PLAL++ SM KG+ WVNGQSIGRY+  Y                     
Sbjct  614   KTTFNTPAGKEPLALDMSSMSKGQMWVNGQSIGRYFPGYIASGKCNKCSYTGTFTDDKCL  673

Query  1597  --AGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
                G PSQ WY+VPR +L P GNLLV+FEE  GNP GI+L K
Sbjct  674   WNCGGPSQKWYHVPRDWLSPKGNLLVIFEEIGGNPEGISLVK  715



>ref|XP_006655346.1| PREDICTED: beta-galactosidase 7-like, partial [Oryza brachyantha]
Length=799

 Score =   316 bits (810),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 174/364 (48%), Positives = 231/364 (63%), Gaps = 9/364 (2%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y +YG+D  MRS EDIAF VALFIARK GS+++YYMYHGGTNFGR AAS++ TSYYD AP
Sbjct  250   YPIYGNDTKMRSPEDIAFAVALFIARKKGSFVSYYMYHGGTNFGRFAASYVTTSYYDGAP  309

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL+ +P W HL+E+HAAIK  S+ LL  + S FSL Q Q+A+VF  ++   C AFL
Sbjct  310   LDEYGLIWQPTWGHLREMHAAIKHSSEPLLFGSYSNFSLGQQQEAHVF--ETGYECVAFL  367

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
             +N D  ++ KV+F+N S QL PKSISIL DC++V F TAKV     +RT       +   
Sbjct  368   VNFDQHNTPKVEFRNISLQLAPKSISILSDCRSVVFETAKVNAPQGSRTANIVQSLNEIN  427

Query  695   eweefeeLVV-GFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSAIS--VES  865
              W+ F E V           + L + + TTKD +DYLWY  S +  +SD    +   V S
Sbjct  428   NWKAFIEPVPQDMSKCMYTGNQLFEQLTTTKDETDYLWYIASYENRASDGDQLVRLYVVS  487

Query  866   LGHVLHIFVNGELAGSAHGTFRNS-SFTLESTVSLNKGMNNISLLSATVGLPNSGAYLEH  1042
             L H+LH FVN E  GS HG+     +  L + +SL +G N ISLLS  VG P+SGAY+E 
Sbjct  488   LAHILHAFVNNEYIGSVHGSHDGPRNIVLNTHISLKEGNNTISLLSVMVGSPDSGAYMER  547

Query  1043  KTLGPRKVTIESSEGS-EDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS--SSQPL  1213
             +  G +KV I+  +     L+N+ WGYQVGL GE  +IY ++ +++V W + +  +   L
Sbjct  548   RYFGIQKVGIQQGQQPLHLLNNNLWGYQVGLFGEEDRIYMQEQTDSVGWMDINNWTYHLL  607

Query  1214  IWYK  1225
              WYK
Sbjct  608   TWYK  611


 Score =   106 bits (264),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P G+D + LNL SMGKGE WVNG SIGRYWVS+   +G PSQ+ Y++PR FLKP
Sbjct  611   KTTFATPVGDDAVTLNLTSMGKGEVWVNGDSIGRYWVSFKAPSGQPSQSLYHIPRGFLKP  670

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
               NLLVL EE  G+P  IT++ +S+T
Sbjct  671   KDNLLVLVEEMGGDPLQITVNTMSVT  696



>gb|KDO57766.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=649

 Score =   312 bits (799),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 225/369 (61%), Gaps = 23/369 (6%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPLDE  343
             +GS    R AED+ F VA FI +  GS+INYYMYHGGTNFGRT+  F+ TSY   AP+DE
Sbjct  273   FGSAVPTRPAEDLVFSVARFI-QSGGSFINYYMYHGGTNFGRTSGGFVATSYDYDAPIDE  331

Query  344   YGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINN  523
             YGLL EPKW HL++LH AIK+C   L+S  P+  SL + Q+A+VF    SG CAAFL N 
Sbjct  332   YGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFN-SKSGKCAAFLANY  390

Query  524   DGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeewe  703
             D   SAKV F N+ Y LPP SIS+LPDCKT  FNTA+V  QS+ +   P +  ++     
Sbjct  391   DTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVI--NAFSWQS  448

Query  704   efeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESS--------DPKSAISV  859
               EE     DD     D L + +  T D SDYLWY   +  +S+        DP   +++
Sbjct  449   YIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDP--LLTI  506

Query  860   ESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE  1039
              S GH L +F+NG+L+G+ +G+  N   T    V L  G+N ISLLS +VGLPN G + E
Sbjct  507   WSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFE  566

Query  1040  H---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--  1201
                   LGP  VT++  +EG+ D+S   W Y++GL GE L ++T  GS++V+W + +S  
Sbjct  567   KWNAGVLGP--VTLKGLNEGTRDISKQKWTYKIGLKGEALSLHTVSGSSSVEWAQGASLA  624

Query  1202  -SQPLIWYK  1225
               QP+ WYK
Sbjct  625   QKQPMTWYK  633



>gb|KDO65276.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=618

 Score =   311 bits (797),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 172/371 (46%), Positives = 226/371 (61%), Gaps = 20/371 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             Y  +G     R  ED+AF VA FI +K GS+INYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  37    YTEFGGPVPHRPVEDLAFSVAKFI-QKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDA  95

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDEYGLLR+PKW HLK+LH AIK+C   L+S  P+   L  +Q+A+VF+  S  ACAAF
Sbjct  96    PLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFKSKS--ACAAF  153

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N + +  AKV F N  Y LPP SISILPDCK   +NTA+V  QS    M P +     
Sbjct  154   LANYNQRTFAKVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTP-VPIHGG  212

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP------KSAI  853
               W+ F E+   + D++     LL+ INTT+D +DYLWY   ++ + S+          +
Sbjct  213   FSWQAFNEVPSAYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVL  272

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             +V S GH LH+FVNG+LAG+A+G+      T    V++  G+N I+LLS  VGLPN G +
Sbjct  273   TVMSAGHALHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPH  332

Query  1034  LE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS-  1198
              E      LGP  VT+   +EG  DLS   W Y++GL GE L +++  G ++V+W E S 
Sbjct  333   FETWNAGVLGP--VTLNGLNEGRRDLSWQKWTYKIGLEGEKLNLHSLSGGSSVEWAEGSL  390

Query  1199  --SSQPLIWYK  1225
                 QPL WY+
Sbjct  391   VAQRQPLTWYR  401


 Score =   102 bits (254),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 20/105 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTV------------------  1596
             +T F  P GN PLAL++GSMGKG+ WVNGQSIGR+W +Y                     
Sbjct  401   RTTFSAPAGNAPLALDMGSMGKGQVWVNGQSIGRHWPAYKASGSCGYCSYTGTYTEKKCL  460

Query  1597  --AGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSI  1725
                G  SQ WY+VPRS+LKPTGNLLV+FEE  GNP GI+L +  I
Sbjct  461   SNCGEASQRWYHVPRSWLKPTGNLLVVFEEWGGNPNGISLVRREI  505



>ref|XP_009628690.1| PREDICTED: beta-galactosidase 3 [Nicotiana tomentosiformis]
Length=844

 Score =   317 bits (811),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 179/373 (48%), Positives = 229/373 (61%), Gaps = 28/373 (8%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QAPLD  340
             +GS    R  +D+AF VA FI R  GS++NYYMYHGGTNFGR+A    IT+ YD  AP+D
Sbjct  262   FGSTLHQRPVQDLAFAVAQFIQR-GGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPID  320

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             EYGL+R+PK+ HLKELH A+KMC + L+SA P+  SL   QQAYV+  + +G CAAFL N
Sbjct  321   EYGLIRQPKYGHLKELHRAVKMCEKALVSADPAITSLGNLQQAYVYSSE-TGDCAAFLSN  379

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPA----LKFDS  688
             ND K +A+V F N  Y LPP SISILPDC+ V FNTAKV  Q++   M P     L ++S
Sbjct  380   NDWKSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTNSEMLSWES  439

Query  689   TeeweefeeLVVGFDD-TNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD------PKS  847
               E       +   DD ++IR+  LL+ IN T+D SDYLWY  S+   S++         
Sbjct  440   YNED------ISALDDSSSIRSFGLLEQINVTRDTSDYLWYITSVDISSTESFLHGGELP  493

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              + VES GH LH+F+NG+L+GSA GT +N  F  +  V+L  G N ISLLS  VGLPN G
Sbjct  494   TLIVESTGHALHVFINGQLSGSAFGTRKNRRFVFKGKVNLRAGTNRISLLSVAVGLPNMG  553

Query  1028  AYLE---HKTLGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS  1198
              + E      LGP  V     +G  DLS   W YQVGL GE + + +  G +AV W + S
Sbjct  554   GHFETWSTGVLGPVAVH-GLDQGKWDLSWAKWTYQVGLKGEAMNLVSPNGISAVDWMQGS  612

Query  1199  ----SSQPLIWYK  1225
                   QPL W+K
Sbjct  613   LIAQRQQPLTWHK  625


 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 19/105 (18%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHT-------------------  1593
             +  F+ P G++PLAL++ SMGKG+ W+NGQSIGRYW +Y T                   
Sbjct  625   KAYFNTPNGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCHYSGNFRPPKCQF  684

Query  1594  VAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
               G P+Q WY+VPRS+LKPT NLLVLFEE  G+P  I+L K +++
Sbjct  685   GCGQPTQKWYHVPRSWLKPTQNLLVLFEELGGDPSRISLVKRTVS  729



>ref|XP_002310540.2| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE90990.2| beta-galactosidase family protein [Populus trichocarpa]
Length=841

 Score =   317 bits (811),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 179/380 (47%), Positives = 230/380 (61%), Gaps = 33/380 (9%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QA  331
             +Q +G+    R AED+AF VA F  +K GS  NYYMYHGGTNFGRTA    IT+ YD +A
Sbjct  253   FQTFGAPNPHRPAEDVAFSVARFF-QKGGSVQNYYMYHGGTNFGRTAGGPFITTSYDYEA  311

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             P+DEYGL R PKW HLKELH AIK+C  +LL++ P   SL   Q+A V+  D+SG C AF
Sbjct  312   PIDEYGLPRLPKWGHLKELHKAIKLCEHVLLNSKPVNLSLGPSQEADVY-ADASGGCVAF  370

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQP-------  670
             L N D K+   V FQN S++LP  S+SILPDCK V +NTAKVT+Q+    M P       
Sbjct  371   LANIDDKNDKTVDFQNVSFKLPAWSVSILPDCKNVVYNTAKVTSQTALVEMVPDNLQQKD  430

Query  671   ---ALKFDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQ------  823
                ALK++   E          + + +   +  +DHINTTKD +DYLWYT S+       
Sbjct  431   GSKALKWEVFVEKAGI------WGEPDFMKNGFVDHINTTKDTTDYLWYTTSIVVGENEE  484

Query  824   --QESSDPKSAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLL  997
               +E   P   + +ES+GH LH FVN EL GSA G   +S F  ++ +SL  G N I+LL
Sbjct  485   FLKEGRHP--VLLIESMGHALHAFVNQELQGSASGNGSHSPFKFKNPISLKAGNNEIALL  542

Query  998   SATVGLPNSGAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSN  1174
             S TVGLPN+G++ E    G   V IE  + G+ DLS+ +W Y++GL GE L IY  +G N
Sbjct  543   SMTVGLPNAGSFYEWVGAGLTSVRIEGFNNGTVDLSHFNWIYKIGLQGEKLGIYKPEGVN  602

Query  1175  AVQW---REFSSSQPLIWYK  1225
             +V W    E    QPL WYK
Sbjct  603   SVSWVATSEPPKKQPLTWYK  622


 Score = 89.0 bits (219),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 62/108 (57%), Gaps = 22/108 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTV------------------  1596
             + V D P GN+P+ L++  MGKG AW+NG+ IGRYW    +V                  
Sbjct  622   KVVLDPPAGNEPVGLDMLHMGKGLAWLNGEEIGRYWPRKSSVHEKCVTECDYRGKFMPDK  681

Query  1597  ----AGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
                  G P+Q WY+VPRS+ KP+GNLLV+FEE+ G+P  IT  +  ++
Sbjct  682   CFTGCGQPTQRWYHVPRSWFKPSGNLLVIFEEKGGDPEKITFSRRKMS  729



>gb|KCW53602.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=673

 Score =   312 bits (799),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 175/371 (47%), Positives = 222/371 (60%), Gaps = 19/371 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             Y  +G     R  ED+AF VA FI +K G++INYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  262   YTEFGGPVPNRPVEDLAFSVARFI-KKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDA  320

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDEYGLLR+PKW HLK+LH AIK+C   L+S  P+   L  +++A+VFR   SGACAAF
Sbjct  321   PLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGNPTVTKLGNYEEAHVFR-SKSGACAAF  379

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N      AKV + N  Y LPP SISILPDCK   +NTA+V  QS    M P +     
Sbjct  380   LSNYHSNAFAKVSWGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTP-VPIHGG  438

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPKSAI  853
               W+ + E   G++D +     LL+ INTT+DVSDYLWY   +   S      S     +
Sbjct  439   FSWQAYNEEPAGYEDNSFTMAGLLEQINTTRDVSDYLWYITDVYINSKEGFLRSGKYPTL  498

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             +V+S GH LH+FVNG+ +G+A+G+      T    V L  G N I+LLS  VGLPN G +
Sbjct  499   TVQSAGHALHVFVNGQASGTAYGSLEFPKLTFNQGVKLRAGSNRIALLSIAVGLPNVGPH  558

Query  1034  LEH---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS-  1198
              E      LGP  VT+    EG  DLS   W Y+VGL GE L +++  GS++V+W E S 
Sbjct  559   FERWNAGVLGP--VTLYGLDEGKRDLSRQKWSYKVGLKGEALNLHSLTGSSSVEWAEGSL  616

Query  1199  --SSQPLIWYK  1225
                 QPL W+K
Sbjct  617   VARKQPLTWFK  627



>ref|XP_007201748.1| hypothetical protein PRUPE_ppa001308mg [Prunus persica]
 gb|EMJ02947.1| hypothetical protein PRUPE_ppa001308mg [Prunus persica]
Length=857

 Score =   316 bits (810),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 225/370 (61%), Gaps = 20/370 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + K+G+  NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  292   YRVFGDPPSQRSAEDIAFSVARFFS-KDGTLTNYYMYHGGTNFGRTSAIFTTTRYYDEAP  350

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLK+LH A+ +C + L + TP    L +  +A  +    +  C AFL
Sbjct  351   LDEYGLKREPKWGHLKDLHRALSLCKKPLFAGTPGVQRLGKETEARFYERPGTDICVAFL  410

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTM---QPALKFD  685
              NN       V ++   Y LPP SISILPDCKTV FN+ ++ +Q N+R     + A KF+
Sbjct  411   ANNHSTIETTVNWRGQEYFLPPHSISILPDCKTVVFNSQQIVSQHNSRNFVRSKAANKFN  470

Query  686   STeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQ--------QESSDP  841
                  E     V      N ++   L H+   KD +DY W+T SL+        +ES  P
Sbjct  471   WERFSEPIPTTVQ--IPVNQKSPQELYHL--LKDATDYGWFTSSLELGPYDLPMKESIRP  526

Query  842   KSAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPN  1021
                + + SLGH + +FVNGE  G+ HG+     F  E  V+  +G+N+ISLL  TVGLP+
Sbjct  527   --VLRIPSLGHAMSVFVNGEFVGTEHGSHAEKGFVFERPVTFKQGVNHISLLCMTVGLPD  584

Query  1022  SGAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REF  1195
             SGAY+EH+  GPR +T+   + G+ DLS + WG++VGL GENLQ++T+KG+  VQW +  
Sbjct  585   SGAYMEHRYAGPRTITVLGLNTGTIDLSQNGWGHRVGLNGENLQVFTKKGAQKVQWTKAA  644

Query  1196  SSSQPLIWYK  1225
                + L WYK
Sbjct  645   GKGRALTWYK  654


 Score = 91.3 bits (225),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 64/93 (69%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F+ PEG DP+A+ +  MGKG  WVNG+SIGR+W+S+ +  G P+Q+ Y++PR+F++P
Sbjct  654   KTNFEAPEGKDPVAIRMAGMGKGMIWVNGKSIGRHWMSFLSPLGQPTQSEYHIPRAFIEP  713

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
               N LV+ EE+  +P  I +    +T ++D + 
Sbjct  714   GQNFLVVLEEQEADPKDIEI----LTANRDTIC  742



>gb|KDO57770.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=683

 Score =   311 bits (798),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 225/369 (61%), Gaps = 23/369 (6%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPLDE  343
             +GS    R AED+ F VA FI +  GS+INYYMYHGGTNFGRT+  F+ TSY   AP+DE
Sbjct  219   FGSAVPTRPAEDLVFSVARFI-QSGGSFINYYMYHGGTNFGRTSGGFVATSYDYDAPIDE  277

Query  344   YGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINN  523
             YGLL EPKW HL++LH AIK+C   L+S  P+  SL + Q+A+VF    SG CAAFL N 
Sbjct  278   YGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFN-SKSGKCAAFLANY  336

Query  524   DGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeewe  703
             D   SAKV F N+ Y LPP SIS+LPDCKT  FNTA+V  QS+ +   P +  ++     
Sbjct  337   DTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVI--NAFSWQS  394

Query  704   efeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESS--------DPKSAISV  859
               EE     DD     D L + +  T D SDYLWY   +  +S+        DP   +++
Sbjct  395   YIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDP--LLTI  452

Query  860   ESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE  1039
              S GH L +F+NG+L+G+ +G+  N   T    V L  G+N ISLLS +VGLPN G + E
Sbjct  453   WSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFE  512

Query  1040  H---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--  1201
                   LGP  VT++  +EG+ D+S   W Y++GL GE L ++T  GS++V+W + +S  
Sbjct  513   KWNAGVLGP--VTLKGLNEGTRDISKQKWTYKIGLKGEALSLHTVSGSSSVEWAQGASLA  570

Query  1202  -SQPLIWYK  1225
               QP+ WYK
Sbjct  571   QKQPMTWYK  579


 Score =   100 bits (249),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 65/102 (64%), Gaps = 20/102 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +T F+ P GNDPLAL++G+MGKG  W+NGQSIGR+W  Y                     
Sbjct  579   KTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGRHWPGYIGNGNCGGCNYAGTYTEKKCR  638

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
             T  G PSQ WY+VPRS+LKP+GNLLV+FEE  G P+ I+L K
Sbjct  639   TYCGKPSQRWYHVPRSWLKPSGNLLVVFEEWGGEPHWISLLK  680



>ref|XP_002306183.1| glycosyl hydrolase family 35 family protein [Populus trichocarpa]
 gb|EEE86694.1| glycosyl hydrolase family 35 family protein [Populus trichocarpa]
Length=838

 Score =   315 bits (808),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 168/367 (46%), Positives = 230/367 (63%), Gaps = 15/367 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             ++V+G     RSAED AF VA + + KNGS +NYYMYHGGTNF RTAASF+ T YYD+AP
Sbjct  264   FRVFGDPPSQRSAEDTAFSVARWFS-KNGSLVNYYMYHGGTNFDRTAASFVTTRYYDEAP  322

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLK+LH A+ +C + LL  TP+   L+   +A  F    +  CAAFL
Sbjct  323   LDEYGLQREPKWGHLKDLHRALNLCKKALLWGTPNVQRLSADVEARFFEQPRTNDCAAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN+ K    V F+   Y LP KSISILPDCKTV +NT  V +Q N+R    + K D   
Sbjct  383   ANNNTKDPETVTFRGKKYYLPAKSISILPDCKTVVYNTMTVVSQHNSRNFVKSRKTDGKL  442

Query  695   eweefeeLVVGFDDTNIRADTLLDH--INTTKDVSDYLWYTLSLQQESSDPKS------A  850
             EW+ F E +     +N+  D+ +     N TKD +DY W+T ++  + +D  +       
Sbjct  443   EWKMFSETI----PSNLLVDSRIPRELYNLTKDKTDYAWFTTTINVDRNDLSARKDINPV  498

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             + V SLGH +  F+NGE  GSAHG+    SF L+ +V L  G+N ++LL + VGLP+SGA
Sbjct  499   LRVASLGHAMVAFINGEFIGSAHGSQIEKSFVLQHSVKLKPGINFVTLLGSLVGLPDSGA  558

Query  1031  YLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-S  1204
             Y+EH+  GPR V+I   + G+ DLS++ WG+QV L GE  +++T++G   V W + +   
Sbjct  559   YMEHRYAGPRGVSILGLNTGTLDLSSNGWGHQVALSGETAKVFTKEGGRKVTWTKVNKDG  618

Query  1205  QPLIWYK  1225
              P+ WYK
Sbjct  619   PPVTWYK  625


 Score = 95.1 bits (235),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 65/93 (70%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG  P+A+ +  M KG  W+NG+SIGRYW++Y +  G P+Q+ Y++PRS+LKP
Sbjct  625   KTRFDAPEGKSPVAVRMTGMKKGMIWINGKSIGRYWMNYISPLGEPTQSEYHIPRSYLKP  684

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             T NL+V+ EEE  +P  I +    +T+++D + 
Sbjct  685   TNNLMVILEEEGASPEKIEI----LTVNRDTIC  713



>gb|KCW53601.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=696

 Score =   312 bits (799),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 175/371 (47%), Positives = 222/371 (60%), Gaps = 19/371 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             Y  +G     R  ED+AF VA FI +K G++INYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  262   YTEFGGPVPNRPVEDLAFSVARFI-KKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDA  320

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDEYGLLR+PKW HLK+LH AIK+C   L+S  P+   L  +++A+VFR   SGACAAF
Sbjct  321   PLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGNPTVTKLGNYEEAHVFR-SKSGACAAF  379

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N      AKV + N  Y LPP SISILPDCK   +NTA+V  QS    M P +     
Sbjct  380   LSNYHSNAFAKVSWGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTP-VPIHGG  438

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPKSAI  853
               W+ + E   G++D +     LL+ INTT+DVSDYLWY   +   S      S     +
Sbjct  439   FSWQAYNEEPAGYEDNSFTMAGLLEQINTTRDVSDYLWYITDVYINSKEGFLRSGKYPTL  498

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             +V+S GH LH+FVNG+ +G+A+G+      T    V L  G N I+LLS  VGLPN G +
Sbjct  499   TVQSAGHALHVFVNGQASGTAYGSLEFPKLTFNQGVKLRAGSNRIALLSIAVGLPNVGPH  558

Query  1034  LEH---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS-  1198
              E      LGP  VT+    EG  DLS   W Y+VGL GE L +++  GS++V+W E S 
Sbjct  559   FERWNAGVLGP--VTLYGLDEGKRDLSRQKWSYKVGLKGEALNLHSLTGSSSVEWAEGSL  616

Query  1199  --SSQPLIWYK  1225
                 QPL W+K
Sbjct  617   VARKQPLTWFK  627


 Score = 60.5 bits (145),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY  1587
             +T F  P GN PLAL++ SMGKG+ W+NGQSIGRYW +Y
Sbjct  627   KTTFSAPAGNTPLALDMNSMGKGQIWINGQSIGRYWPAY  665



>gb|KDO57764.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=702

 Score =   312 bits (799),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 225/369 (61%), Gaps = 23/369 (6%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPLDE  343
             +GS    R AED+ F VA FI +  GS+INYYMYHGGTNFGRT+  F+ TSY   AP+DE
Sbjct  273   FGSAVPTRPAEDLVFSVARFI-QSGGSFINYYMYHGGTNFGRTSGGFVATSYDYDAPIDE  331

Query  344   YGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINN  523
             YGLL EPKW HL++LH AIK+C   L+S  P+  SL + Q+A+VF    SG CAAFL N 
Sbjct  332   YGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFN-SKSGKCAAFLANY  390

Query  524   DGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeewe  703
             D   SAKV F N+ Y LPP SIS+LPDCKT  FNTA+V  QS+ +   P +  ++     
Sbjct  391   DTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVI--NAFSWQS  448

Query  704   efeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESS--------DPKSAISV  859
               EE     DD     D L + +  T D SDYLWY   +  +S+        DP   +++
Sbjct  449   YIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDP--LLTI  506

Query  860   ESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE  1039
              S GH L +F+NG+L+G+ +G+  N   T    V L  G+N ISLLS +VGLPN G + E
Sbjct  507   WSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFE  566

Query  1040  H---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--  1201
                   LGP  VT++  +EG+ D+S   W Y++GL GE L ++T  GS++V+W + +S  
Sbjct  567   KWNAGVLGP--VTLKGLNEGTRDISKQKWTYKIGLKGEALSLHTVSGSSSVEWAQGASLA  624

Query  1202  -SQPLIWYK  1225
               QP+ WYK
Sbjct  625   QKQPMTWYK  633


 Score = 61.2 bits (147),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 20/70 (29%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +T F+ P GNDPLAL++G+MGKG  W+NGQSIGR+W  Y                     
Sbjct  633   KTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGRHWPGYIGNGNCGGCNYAGTYTEKKCR  692

Query  1591  TVAGTPSQTW  1620
             T  G PSQ W
Sbjct  693   TYCGKPSQRW  702



>tpg|DAA48742.1| TPA: hypothetical protein ZEAMMB73_126543 [Zea mays]
Length=706

 Score =   312 bits (799),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 226/369 (61%), Gaps = 15/369 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F +   G+  NYYMYHGGTNFGRT+A+F++  YYD+AP
Sbjct  276   YRVFGDPPSQRSAEDIAFAVARFFS-VGGTLANYYMYHGGTNFGRTSAAFVMPKYYDEAP  334

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDE+GL +EPKW HL++LH A+K+C + LL  TPST  L +  +A VF       C AFL
Sbjct  335   LDEFGLYKEPKWGHLRDLHQALKLCKKALLWGTPSTEKLGKQLEARVFEMPEQKVCVAFL  394

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N++ K  A + F+   Y +P  SIS+L DC+TV F T  V  Q N RT   A   D T 
Sbjct  395   SNHNTKDDATMTFRGRPYFVPRHSISVLADCETVVFGTQHVNAQHNQRTFHFA---DQTA  451

Query  695   eweefeeL----VVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPK  844
             +   +E      V  +    IR     D  N TKD +DY+WYT S + E+      SD K
Sbjct  452   QNNVWEMFDGENVPKYKQAKIRLRKAGDLYNLTKDKTDYVWYTSSFKLEADDMPIRSDIK  511

Query  845   SAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNS  1024
             + + V S GH    FVN +  G  HGT  N +FTLE  + L KG+N++++L++++G+ +S
Sbjct  512   TVLEVNSHGHASVAFVNNKFVGCGHGTKMNKAFTLEKPMDLKKGVNHVAVLASSMGMTDS  571

Query  1025  GAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS  1201
             GAY+EH+  G  +V I   + G+ DL+N+ WG+ VGL+GE  QIYT+KG  +V W+   +
Sbjct  572   GAYMEHRLAGVDRVQITGLNAGTLDLTNNGWGHIVGLVGERKQIYTDKGMGSVTWKPAMN  631

Query  1202  SQPLIWYKE  1228
              +PL WYK 
Sbjct  632   DRPLTWYKR  640


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQ  1614
             FD P G DP+ L++ +MGKG  +VNGQ IGRYW+SY    G PSQ
Sbjct  642   FDMPSGEDPVVLDMSTMGKGMMFVNGQGIGRYWISYKHALGRPSQ  686



>ref|XP_009789452.1| PREDICTED: beta-galactosidase 3 [Nicotiana sylvestris]
Length=844

 Score =   315 bits (807),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 178/373 (48%), Positives = 228/373 (61%), Gaps = 28/373 (8%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QAPLD  340
             +G     R  +D+AF VA FI R  GS++NYYMYHGGTNFGR+A    IT+ YD  AP+D
Sbjct  262   FGGTLHQRPVQDLAFAVAQFIQR-GGSFVNYYMYHGGTNFGRSAGGPFITTSYDYDAPID  320

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             EYGL+R+PK+ HLKELH A+KMC + L+SA P+  SL   QQAYV+  + +G CAAFL N
Sbjct  321   EYGLIRQPKYGHLKELHKAVKMCEKALVSADPAITSLGNLQQAYVYSSE-TGDCAAFLSN  379

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPA----LKFDS  688
             ND K +A+V F N  Y LPP SISILPDC+ V FNTAKV  Q++   M P     L ++S
Sbjct  380   NDWKSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTNSEMLSWES  439

Query  689   TeeweefeeLVVGFDD-TNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD------PKS  847
               E       +   DD ++IR+  LL+ IN T+D SDYLWY  S+   S++         
Sbjct  440   YNED------ISALDDSSSIRSLGLLEQINVTRDTSDYLWYITSVDIGSTESFLHGGELP  493

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              + VES GH LH+F+NG+L+GSA GT +N  F  +  V+L  G N ISLLS  VGLPN G
Sbjct  494   TLIVESTGHALHVFINGQLSGSAFGTRKNRRFVFKGKVNLRAGTNRISLLSVAVGLPNMG  553

Query  1028  AYLE---HKTLGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS  1198
              + E      LGP  V     +G  DLS   W YQVGL GE + + +  G +AV W + S
Sbjct  554   GHFETWSTGVLGPVAVH-GLDQGKWDLSWAKWTYQVGLKGEAMNLVSPNGISAVDWMQGS  612

Query  1199  ----SSQPLIWYK  1225
                   QPL W+K
Sbjct  613   LIAQRQQPLTWHK  625


 Score =   101 bits (251),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 68/105 (65%), Gaps = 19/105 (18%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHT-------------------  1593
             +  F+ P+G++PLAL++ SMGKG+ W+NGQSIGRYW +Y T                   
Sbjct  625   KAYFNSPDGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCHYSGNFRPPKCQL  684

Query  1594  VAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
               G P+Q WY+VPRS+LKPT NLLVLFEE  G+P  I+L K +++
Sbjct  685   GCGQPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRTVS  729



>ref|XP_008224548.1| PREDICTED: beta-galactosidase 13-like [Prunus mume]
Length=826

 Score =   315 bits (806),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 172/391 (44%), Positives = 228/391 (58%), Gaps = 20/391 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     R  +DIAF VA F ++K GS  NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  259   YRVFGDPPSQRPVDDIAFAVARFFSKK-GSLTNYYMYHGGTNFGRTSAIFTTTRYYDEAP  317

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKWSHLK+LH A+++  + LL   P    ++   + Y +   ++  CAAFL
Sbjct  318   LDEYGLRRDPKWSHLKDLHKALRLSRKALLWGVPGVQKMSANTEVYFYEMPATNICAAFL  377

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTR-----TMQPALK  679
              NN+    A V ++   Y LPP SISILPDCKTV FNT  +  Q N+R     T+   LK
Sbjct  378   TNNNLTTEATVSWRGQDYYLPPHSISILPDCKTVVFNTQTIVAQHNSRNFVRSTVANNLK  437

Query  680   FDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-PKSA--  850
             +    E       V   + T +   TLL      KD SDY WYT SL     D P+ A  
Sbjct  438   WKKYAEPIPTSLQVPVNNPTPLELYTLL------KDSSDYAWYTTSLALNPQDLPRKASI  491

Query  851   ---ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPN  1021
                + + SLGH LH+FVNGE  G  HG+    SF LE  V    G+N I+LL+ T+GLP+
Sbjct  492   QPVLRIASLGHALHLFVNGEYIGFGHGSHDEKSFVLEKPVHFKAGVNQITLLAMTLGLPD  551

Query  1022  SGAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REF  1195
              GAY+EH+  GP  + +   + G+ D++ + WG+QVGL GE LQ++TE+GS  VQW +  
Sbjct  552   GGAYMEHRYAGPNLIIVLGLNTGTLDITKNGWGHQVGLNGEKLQVFTEEGSKQVQWDKTK  611

Query  1196  SSSQPLIWYKEWRTIKKVYLPARAVKTGFAR  1288
              S+Q L WYK +    +   P     TG  +
Sbjct  612   GSAQGLTWYKTYFDAPEGNKPVAIRMTGMGK  642


 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 65/93 (70%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEGN P+A+ +  MGKG  WVNG+SIGR+W+S+ +  G P+Q+ Y++PRSF+KP
Sbjct  621   KTYFDAPEGNKPVAIRMTGMGKGMIWVNGRSIGRHWMSFLSPLGEPTQSEYHIPRSFIKP  680

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             T N LV+ EE+   P  I +    +T+++D + 
Sbjct  681   TQNTLVVLEEQPAKPKHIEI----LTVNRDTIC  709



>ref|XP_006451459.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64699.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=702

 Score =   311 bits (798),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 225/369 (61%), Gaps = 23/369 (6%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPLDE  343
             +GS    R AED+ F VA FI +  GS+INYYMYHGGTNFGRT+  F+ TSY   AP+DE
Sbjct  273   FGSAVPTRPAEDLVFSVARFI-QSGGSFINYYMYHGGTNFGRTSGGFVATSYDYDAPIDE  331

Query  344   YGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINN  523
             YGLL EPKW HL++LH AIK+C   L+S  P+  SL + Q+A+VF    SG CAAFL N 
Sbjct  332   YGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFN-SKSGKCAAFLANY  390

Query  524   DGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeewe  703
             D   SAKV F N+ Y LPP SIS+LPDCKT  FNTA+V  QS+ +   P +  ++     
Sbjct  391   DTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVI--NAFSWQS  448

Query  704   efeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESS--------DPKSAISV  859
               EE     DD     D L + +  T D SDYLWY   +  +S+        DP   +++
Sbjct  449   YIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDP--LLTI  506

Query  860   ESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE  1039
              S GH L +F+NG+L+G+ +G+  N   T    V L  G+N ISLLS +VGLPN G + E
Sbjct  507   WSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFE  566

Query  1040  H---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--  1201
                   LGP  VT++  +EG+ D+S   W Y++GL GE L ++T  GS++V+W + +S  
Sbjct  567   KWNAGVLGP--VTLKGLNEGTRDISKQKWTYKIGLKGEALSLHTISGSSSVEWAQGASLA  624

Query  1202  -SQPLIWYK  1225
               QP+ WYK
Sbjct  625   QKQPMTWYK  633


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 38/70 (54%), Gaps = 20/70 (29%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +T F+ P GNDPLAL++G+MGKG  W+NGQSIGR+W  Y                     
Sbjct  633   KTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGRHWPGYIGNGNCGGCNYAGTYTEKKCR  692

Query  1591  TVAGTPSQTW  1620
             T  G PSQ W
Sbjct  693   TYCGKPSQRW  702



>gb|KDO65278.1| hypothetical protein CISIN_1g002867mg [Citrus sinensis]
Length=697

 Score =   311 bits (798),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 172/371 (46%), Positives = 226/371 (61%), Gaps = 20/371 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             Y  +G     R  ED+AF VA FI +K GS+INYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  264   YTEFGGPVPHRPVEDLAFSVAKFI-QKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDA  322

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDEYGLLR+PKW HLK+LH AIK+C   L+S  P+   L  +Q+A+VF+  S  ACAAF
Sbjct  323   PLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFK--SKSACAAF  380

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N + +  AKV F N  Y LPP SISILPDCK   +NTA+V  QS    M P +     
Sbjct  381   LANYNQRTFAKVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTP-VPIHGG  439

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP------KSAI  853
               W+ F E+   + D++     LL+ INTT+D +DYLWY   ++ + S+          +
Sbjct  440   FSWQAFNEVPSAYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVL  499

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             +V S GH LH+FVNG+LAG+A+G+      T    V++  G+N I+LLS  VGLPN G +
Sbjct  500   TVMSAGHALHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPH  559

Query  1034  LE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS-  1198
              E      LGP  VT+   +EG  DLS   W Y++GL GE L +++  G ++V+W E S 
Sbjct  560   FETWNAGVLGP--VTLNGLNEGRRDLSWQKWTYKIGLEGEKLNLHSLSGGSSVEWAEGSL  617

Query  1199  --SSQPLIWYK  1225
                 QPL WY+
Sbjct  618   VAQRQPLTWYR  628


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY  1587
             +T F  P GN PLAL++GSMGKG+ WVNGQSIGR+W +Y
Sbjct  628   RTTFSAPAGNAPLALDMGSMGKGQVWVNGQSIGRHWPAY  666



>ref|XP_009388558.1| PREDICTED: beta-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=738

 Score =   312 bits (800),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 171/370 (46%), Positives = 227/370 (61%), Gaps = 23/370 (6%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QA  331
             Y  +G     R  ED+AF VA FI +K GS++NYYMYHGGTNFGRTA    I++ YD  A
Sbjct  274   YTAFGGPVPERPVEDLAFAVARFI-QKGGSFVNYYMYHGGTNFGRTAGGPFISTSYDYDA  332

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             P+DEYGLLR+PKW HL+++H AIKMC   L+SA  +   L  ++QA+VF+   SGACAAF
Sbjct  333   PIDEYGLLRKPKWGHLRDMHKAIKMCEPALVSADATVTKLGNYEQAHVFK-SKSGACAAF  391

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N + K SA V +    Y +PP SISILPDCKT  FNTA+V  Q++   M P  KF  T
Sbjct  392   LSNYNPKSSAIVTYNGKKYDIPPWSISILPDCKTAVFNTARVGAQTSQVKMSPVGKFSWT  451

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQ--------QESSDPKS  847
                EE   L    DD +   + L++ I+ T D +DYLWYT S+         +   +P  
Sbjct  452   SFSEETNSL----DDNSFTKNGLVEQISMTWDRTDYLWYTTSIDIGRNENFLKNGQNP--  505

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              ++V S GH +H+F+NG+ AG+ +G   +   T    V L  G N IS+LS  VGLPN G
Sbjct  506   VLTVMSAGHAMHVFINGQKAGTVYGGLDSPKLTYTGNVKLWAGSNKISILSVAVGLPNVG  565

Query  1028  AYLEH---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF  1195
              + E      LGP  VT+E  +EG  DL++  W YQ+GL GE+L ++T  GS++V+W   
Sbjct  566   NHFETWNVGVLGP--VTLEGLNEGRIDLTSQKWTYQIGLRGESLNLHTISGSSSVEWGGA  623

Query  1196  SSSQPLIWYK  1225
             S +QPL WYK
Sbjct  624   SINQPLTWYK  633


 Score =   101 bits (252),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 64/102 (63%), Gaps = 20/102 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +  F+ P GN+PLAL++ SMGKGEAW+NGQSIGRYW +Y                     
Sbjct  633   KAFFNAPAGNEPLALDMSSMGKGEAWINGQSIGRYWPAYKAYGSCGGCDYHGTYSEKKCQ  692

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
             T  G  SQ WY+VPRS+L PTGNL+V+FEE  GNP GI L K
Sbjct  693   TKCGESSQKWYHVPRSWLNPTGNLVVVFEEWGGNPTGINLVK  734



>ref|XP_006838689.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
 gb|ERN01258.1| hypothetical protein AMTR_s00002p00246870 [Amborella trichopoda]
Length=843

 Score =   315 bits (806),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 174/370 (47%), Positives = 230/370 (62%), Gaps = 22/370 (6%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QAPLD  340
             +G     R  +D+A+ VA F+ +K GS++NYYMYHGGTNFGRTA    IT+ YD  AP+D
Sbjct  258   FGGSVPERPVQDLAYSVARFV-QKGGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPID  316

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             EYGLLR+PKW HLKELH AIK+C   L+SA P   +L   QQ+ VF  D SG CAAFL N
Sbjct  317   EYGLLRQPKWGHLKELHRAIKLCEPALISADPIVTTLGSLQQSSVFSSD-SGGCAAFLAN  375

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeew  700
              D + +A+V F N  Y LPP SISILPDC+ V FNTAK+  Q  T  M+  +    T  W
Sbjct  376   FDSRSTARVMFNNVHYNLPPWSISILPDCRNVVFNTAKIGVQ--TSQMEMKVSDSETFSW  433

Query  701   eefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP------KSAISVE  862
             + ++E V  F D  I A  LL+ +N T+D +DYLWY  S++   S+          +SV+
Sbjct  434   DMYDEDVAAFSDDTITAVGLLEQLNVTRDTTDYLWYMTSVEISPSESFLQNGQFPVLSVQ  493

Query  863   SLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE-  1039
             S GH LH+F+NG+L+GSA+G+  N  FT    ++L  G N ISLLS  VGLPN+G + E 
Sbjct  494   SAGHALHVFINGQLSGSAYGSRENQKFTYSGGINLRAGTNKISLLSMAVGLPNNGPHFET  553

Query  1040  --HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS----  1198
                  LGP  VTI+   EG  D++   W YQVGL GE++ +++  G ++V+W + S    
Sbjct  554   WNTGVLGP--VTIKGLDEGRRDITWQKWSYQVGLKGESMGLHSINGISSVEWIKASLVAQ  611

Query  1199  -SSQPLIWYK  1225
                Q L WYK
Sbjct  612   KQQQTLTWYK  621


 Score =   100 bits (249),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 20/105 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +  FD P G+DPLAL++G+M KG+ WVNGQSIGRYW +Y                     
Sbjct  621   KAYFDAPAGDDPLALDMGTMHKGQVWVNGQSIGRYWPAYLAQGQCGACDYTGTYRPNKCQ  680

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSI  1725
             T  G P+Q WY+VPRS+L+PTGNLL++FEE  G+  GI+L + S+
Sbjct  681   TGCGHPTQRWYHVPRSWLQPTGNLLIVFEEIGGDVSGISLGRRSV  725



>gb|KDO57765.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=710

 Score =   311 bits (798),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 225/369 (61%), Gaps = 23/369 (6%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPLDE  343
             +GS    R AED+ F VA FI +  GS+INYYMYHGGTNFGRT+  F+ TSY   AP+DE
Sbjct  273   FGSAVPTRPAEDLVFSVARFI-QSGGSFINYYMYHGGTNFGRTSGGFVATSYDYDAPIDE  331

Query  344   YGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINN  523
             YGLL EPKW HL++LH AIK+C   L+S  P+  SL + Q+A+VF    SG CAAFL N 
Sbjct  332   YGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFN-SKSGKCAAFLANY  390

Query  524   DGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeewe  703
             D   SAKV F N+ Y LPP SIS+LPDCKT  FNTA+V  QS+ +   P +  ++     
Sbjct  391   DTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVI--NAFSWQS  448

Query  704   efeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESS--------DPKSAISV  859
               EE     DD     D L + +  T D SDYLWY   +  +S+        DP   +++
Sbjct  449   YIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDP--LLTI  506

Query  860   ESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE  1039
              S GH L +F+NG+L+G+ +G+  N   T    V L  G+N ISLLS +VGLPN G + E
Sbjct  507   WSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFE  566

Query  1040  H---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--  1201
                   LGP  VT++  +EG+ D+S   W Y++GL GE L ++T  GS++V+W + +S  
Sbjct  567   KWNAGVLGP--VTLKGLNEGTRDISKQKWTYKIGLKGEALSLHTVSGSSSVEWAQGASLA  624

Query  1202  -SQPLIWYK  1225
               QP+ WYK
Sbjct  625   QKQPMTWYK  633



>ref|XP_011083609.1| PREDICTED: beta-galactosidase 3-like [Sesamum indicum]
Length=845

 Score =   315 bits (806),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 179/372 (48%), Positives = 233/372 (63%), Gaps = 22/372 (6%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QAPLD  340
             +G   L R  +D+AF VA FI +K GS+INYYM+HGGTNFGRTA    +T+ YD  AP+D
Sbjct  262   FGGPILQRPVQDLAFAVARFI-QKGGSFINYYMFHGGTNFGRTAGGPFVTTSYDYDAPVD  320

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVF-RGDSSGACAAFLI  517
             EYGL+REPK+ HLKELH AIK+C   L+S+ P+  SL   Q+A+VF  GD  G+CAAFL 
Sbjct  321   EYGLIREPKYGHLKELHKAIKLCEHALVSSDPTVTSLGSSQEAHVFSSGD--GSCAAFLA  378

Query  518   NNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTee  697
             N +   +A+V F N  Y LPP SISILPDCK V FNTAKV TQ++   M P+   DS   
Sbjct  379   NFNSTSAARVLFNNKHYNLPPWSISILPDCKNVVFNTAKVGTQTSQFQMLPS---DSQLH  435

Query  698   w-eefeeLVVGFDD-TNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP------KSAI  853
               E + E +   DD T   A  LL+ IN T+D SDYLWY  S+   SS+       K  +
Sbjct  436   SWETYGEDMTSLDDSTTFAAIGLLEQINVTRDSSDYLWYITSIDIGSSESFLRGGQKPTL  495

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             +V S GH LH+F+NG+LAGSA+GT  N+ FT    VSL  G N ISLLS  +GLPN+G +
Sbjct  496   TVNSRGHALHVFINGQLAGSAYGTRENTRFTFTGPVSLQVGTNKISLLSIAMGLPNNGVH  555

Query  1034  LEHKTLG--PRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--  1201
              E+  +G   R       +G  DLS  +W Y+VGL GE + + +    ++V+W + S+  
Sbjct  556   FENWNVGVLGRVELAGLDQGKRDLSRQTWSYKVGLKGEQMNLVSPDKVSSVEWAQVSAIT  615

Query  1202  --SQPLIWYKEW  1231
                QPL WYK +
Sbjct  616   QNQQPLRWYKAY  627


 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 62/98 (63%), Gaps = 19/98 (19%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY-------------------HTVAG  1602
             FD P G++PLAL++ SMGKG+ W+NGQ+IGRYW++Y                       G
Sbjct  628   FDAPSGDEPLALDMRSMGKGQVWINGQNIGRYWMAYSNGNCGVCHYAGTFRATKCQRSCG  687

Query  1603  TPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
              P+Q WY+VPRS+L+PT NL+VLFEE  G+   I+L K
Sbjct  688   QPTQRWYHVPRSWLQPTQNLIVLFEELGGDASKISLVK  725



>ref|XP_004144120.1| PREDICTED: beta-galactosidase-like [Cucumis sativus]
Length=782

 Score =   313 bits (802),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 175/370 (47%), Positives = 233/370 (63%), Gaps = 20/370 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y  +G     R  ED+AF VA FI +  GS +NYYMYHGGTNFGRT+  F+ TSY   AP
Sbjct  315   YTAFGGPTPYRPPEDVAFSVARFI-QNGGSLVNYYMYHGGTNFGRTSGLFVTTSYDFDAP  373

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             +DEYGLLREPKW HL++LH AIK+C   L+SA P++  L + Q+A VF+  SSGACAAFL
Sbjct  374   IDEYGLLREPKWGHLRDLHKAIKLCEPALVSADPTSTWLGKNQEARVFK-SSSGACAAFL  432

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTA--KVTTQSNTRTMQPALKFDS  688
              N D     +V F N  Y LPP SISILPDCKTV FNT   ++  +S    M P   F  
Sbjct  433   ANYDTSAFVRVNFWNHPYDLPPWSISILPDCKTVTFNTGSLQIGVKSYEAKMTPISSFWW  492

Query  689   TeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP--KSA----  850
                 EE         DT  + D L++ ++ T D +DYLWY LS++ +S++   KS     
Sbjct  493   LSYKEEPASAYA--QDTTTK-DGLVEQVSVTWDTTDYLWYILSIRIDSTEGFLKSGQWPL  549

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             ++V S GH+LH+F+NG+L+GS +G+  +   T    V+L +G+N +S+LS TVGLPN G 
Sbjct  550   LTVNSAGHILHVFINGQLSGSVYGSLEDPRITFSKYVNLKQGVNKLSMLSVTVGLPNVGL  609

Query  1031  YLE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS  1198
             + +      LGP  VT++  +EG+ D+S   W Y+VGL GE L +Y+ KGSN+VQW + S
Sbjct  610   HFDTWNAGVLGP--VTLKGLNEGTRDMSKYKWSYKVGLRGEILNLYSVKGSNSVQWMKGS  667

Query  1199  -SSQPLIWYK  1225
                QPL WYK
Sbjct  668   FQKQPLTWYK  677


 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/102 (45%), Positives = 60/102 (59%), Gaps = 20/102 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTV------------------  1596
             +T F+ P GN+PLAL++ SM KG+ WVNG+SIGRY+  Y                     
Sbjct  677   KTTFNTPAGNEPLALDMSSMSKGQIWVNGRSIGRYFPGYIARGKCNKCSYTGFFTEKKCL  736

Query  1597  --AGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
                G PSQ WY++PR +L P GNLL++ EE  GNP GI+L K
Sbjct  737   WNCGGPSQKWYHIPRDWLSPNGNLLIILEEIGGNPQGISLVK  778



>gb|KDO57763.1| hypothetical protein CISIN_1g004219mg [Citrus sinensis]
Length=737

 Score =   312 bits (799),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 225/369 (61%), Gaps = 23/369 (6%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPLDE  343
             +GS    R AED+ F VA FI +  GS+INYYMYHGGTNFGRT+  F+ TSY   AP+DE
Sbjct  273   FGSAVPTRPAEDLVFSVARFI-QSGGSFINYYMYHGGTNFGRTSGGFVATSYDYDAPIDE  331

Query  344   YGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINN  523
             YGLL EPKW HL++LH AIK+C   L+S  P+  SL + Q+A+VF    SG CAAFL N 
Sbjct  332   YGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFN-SKSGKCAAFLANY  390

Query  524   DGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeewe  703
             D   SAKV F N+ Y LPP SIS+LPDCKT  FNTA+V  QS+ +   P +  ++     
Sbjct  391   DTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVI--NAFSWQS  448

Query  704   efeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESS--------DPKSAISV  859
               EE     DD     D L + +  T D SDYLWY   +  +S+        DP   +++
Sbjct  449   YIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDP--LLTI  506

Query  860   ESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE  1039
              S GH L +F+NG+L+G+ +G+  N   T    V L  G+N ISLLS +VGLPN G + E
Sbjct  507   WSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFE  566

Query  1040  H---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--  1201
                   LGP  VT++  +EG+ D+S   W Y++GL GE L ++T  GS++V+W + +S  
Sbjct  567   KWNAGVLGP--VTLKGLNEGTRDISKQKWTYKIGLKGEALSLHTVSGSSSVEWAQGASLA  624

Query  1202  -SQPLIWYK  1225
               QP+ WYK
Sbjct  625   QKQPMTWYK  633


 Score =   100 bits (250),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 65/102 (64%), Gaps = 20/102 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +T F+ P GNDPLAL++G+MGKG  W+NGQSIGR+W  Y                     
Sbjct  633   KTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGRHWPGYIGNGNCGGCNYAGTYTEKKCR  692

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
             T  G PSQ WY+VPRS+LKP+GNLLV+FEE  G P+ I+L K
Sbjct  693   TYCGKPSQRWYHVPRSWLKPSGNLLVVFEEWGGEPHWISLLK  734



>ref|XP_011045966.1| PREDICTED: beta-galactosidase-like isoform X2 [Populus euphratica]
Length=838

 Score =   314 bits (805),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 174/371 (47%), Positives = 226/371 (61%), Gaps = 21/371 (6%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             Y  +G     R AED+AF VA FI +  GSYINYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  259   YTEFGGAVPHRPAEDMAFSVARFI-QNGGSYINYYMYHGGTNFGRTAGGPFIATSYDYDA  317

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDE+GL REPKW HL++LH AIK+C   L+S  P+  SL   Q+ +VF+  S   CAAF
Sbjct  318   PLDEFGLPREPKWGHLRDLHKAIKLCEPALVSVDPTVTSLGSNQEVHVFK--SKSVCAAF  375

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N D K+S KV F N  Y+LPP SISILPDCKTV +NTA++ +QS+   M PA    S 
Sbjct  376   LANYDTKYSVKVTFGNGQYELPPWSISILPDCKTVVYNTARLGSQSSQMKMVPAS--SSF  433

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPKSAI  853
                   EE     DD     + L + IN T+D +DYLWY   ++ ++      S     +
Sbjct  434   SWQSYNEETASADDDDTTTMNGLWEQINVTRDATDYLWYLTDVKIDADEGFLKSGQNPLL  493

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             ++ S GH LH+F+NG+LAG+A+G   N   T    + L +G+N ISLLS  VGLPN G +
Sbjct  494   TIFSAGHALHVFINGQLAGTAYGGLSNPKLTFSQNIKLTEGINKISLLSVAVGLPNVGLH  553

Query  1034  LE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE---  1192
              E      LGP  VT++  +EG+ DLS   W Y++GL GE+L ++T  GS +V+W E   
Sbjct  554   FETWNAGVLGP--VTLKGLNEGTRDLSGQKWSYKIGLKGESLGLHTASGSESVEWVEGSL  611

Query  1193  FSSSQPLIWYK  1225
              +  Q L WYK
Sbjct  612   LAQKQALTWYK  622


 Score =   104 bits (260),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 75/124 (60%), Gaps = 21/124 (17%)
 Frame = +1

Query  1438  LLIKLKVETT*QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY----------  1587
             LL + +  T  +T FD P GNDPLAL++ SMGKG+ W+NGQ+IGR+W  Y          
Sbjct  611   LLAQKQALTWYKTAFDAPPGNDPLALDMSSMGKGQMWINGQNIGRHWPGYIAHGSCGDCN  670

Query  1588  ----------HTVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGIT-LDKVSITLD  1734
                        T  G PSQ WY+VPRS+LKP+GNLL +FEE  G+P GI+ + + + ++ 
Sbjct  671   YAGTFDDKKCRTNCGEPSQRWYHVPRSWLKPSGNLLAVFEEWGGDPTGISFVKRTTASVC  730

Query  1735  KDIL  1746
              DI 
Sbjct  731   ADIF  734



>ref|XP_007224244.1| hypothetical protein PRUPE_ppa019277mg, partial [Prunus persica]
 gb|EMJ25443.1| hypothetical protein PRUPE_ppa019277mg, partial [Prunus persica]
Length=804

 Score =   313 bits (802),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/370 (45%), Positives = 222/370 (60%), Gaps = 20/370 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     R  +DIAF VA F ++K GS  NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  237   YRVFGDPPSQRPVDDIAFAVARFFSKK-GSLTNYYMYHGGTNFGRTSAIFTTTRYYDEAP  295

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKWSHLK+LH A+++  + LL   P    ++   + Y +   ++  CAAFL
Sbjct  296   LDEYGLPRDPKWSHLKDLHKALRLSRKALLWGVPGVQKMSANTEVYFYEMPATNICAAFL  355

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTR-----TMQPALK  679
              NN+    A V ++   Y LPP SISILPDCKTV FNT  +  Q N+R     T+   LK
Sbjct  356   TNNNLTTEATVSWRGQDYYLPPHSISILPDCKTVVFNTQTIVAQHNSRNFVQSTVANNLK  415

Query  680   FDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-PKSA--  850
             +    E       V   + T +   TLL      KD SDY WYT SL     D P+ A  
Sbjct  416   WKKYAEPIPSTLQVPVNNPTPLELYTLL------KDTSDYAWYTTSLALNPQDLPRKASI  469

Query  851   ---ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPN  1021
                + + SLGH LH+FVNG+  G  HG+    SF LE  V    G+N I+LL+ T+GLP+
Sbjct  470   QPVLRIASLGHALHLFVNGKYIGFGHGSHDEKSFVLEKPVHFKAGVNQITLLAMTLGLPD  529

Query  1022  SGAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REF  1195
              GAY+EH+  GP  + +   + G+ D++ + WG+QVGL GE LQ++TE+GS  VQW +  
Sbjct  530   GGAYMEHRYAGPNLIIVLGLNTGTLDITKNGWGHQVGLNGEKLQVFTEEGSKQVQWDKTK  589

Query  1196  SSSQPLIWYK  1225
              S+Q L WYK
Sbjct  590   GSAQGLTWYK  599


 Score = 97.8 bits (242),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 67/93 (72%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEGN+P+A+ +  MGKG  WVNG+SIGR+W+S+ +  G P+Q+ Y++PRSF+KP
Sbjct  599   KTYFDAPEGNNPVAIRMTGMGKGMIWVNGRSIGRHWMSFLSPLGEPTQSEYHIPRSFIKP  658

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             T N+LV+ EE+   P  I +    +T+++D + 
Sbjct  659   TQNILVVLEEQPAKPKHIEI----LTVNRDTIC  687



>ref|XP_009376956.1| PREDICTED: beta-galactosidase 11-like [Pyrus x bretschneideri]
 ref|XP_009376964.1| PREDICTED: beta-galactosidase 11-like [Pyrus x bretschneideri]
Length=859

 Score =   314 bits (805),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 166/386 (43%), Positives = 227/386 (59%), Gaps = 10/386 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + K+G+  NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  294   YRVFGDPPSQRSAEDIAFSVARFFS-KDGTLTNYYMYHGGTNFGRTSAIFTTTRYYDEAP  352

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKWSHLK+LH A+ +C + L +       L +  +A  +    + +C AFL
Sbjct  353   LDEYGLQREPKWSHLKDLHKALNLCKKPLFAGASGVLRLGKETEARFYEKPGTDSCVAFL  412

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN  K    V ++   Y LPP SISILPDCKTV FN+ ++ +Q N+R    + K  +  
Sbjct  413   ANNHSKLETSVTWRGQEYFLPPHSISILPDCKTVVFNSQQIVSQHNSRNFVRS-KAANKL  471

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-P-----KSAIS  856
              WE   E +   +   +      +  +  KD +DY W+T SL     D P     +  + 
Sbjct  472   NWEMSPEPIPTVEQVPVNQKKPQELYHFLKDATDYGWFTTSLNLGPYDLPMKDSIRPVLR  531

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             + SLGH + +FVNGE  GS HG+     F  E  V+  +G+N+ISLL  TVGLP+SGAY+
Sbjct  532   IPSLGHAMGVFVNGEYIGSEHGSHEEKGFVFERPVTFKQGINHISLLCMTVGLPDSGAYM  591

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REFSSSQP  1210
             EH+  GPR + +   + G+ DLS + WG++VGL GENLQ++TEKG+  VQW +     + 
Sbjct  592   EHRYAGPRTINVLGLNTGTLDLSQNGWGHRVGLNGENLQVFTEKGAEKVQWTKAVGKGRG  651

Query  1211  LIWYKEWRTIKKVYLPARAVKTGFAR  1288
             L WYK +    +   P     TG  +
Sbjct  652   LTWYKTYFDAPEGRDPVAIRMTGMGK  677


 Score = 97.4 bits (241),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 71/116 (61%), Gaps = 7/116 (6%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG DP+A+ +  MGKG  WVNG SIGR+W+ + +  G P+QT Y++PRSF+KP
Sbjct  656   KTYFDAPEGRDPVAIRMTGMGKGMIWVNGLSIGRHWMCFLSPLGQPTQTEYHIPRSFIKP  715

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILLRRLA*GKGSVPSHNHTKDRKSKK  1818
             + N LV+ EE+  +P  I +    +T+++D +           P H    DRK+ K
Sbjct  716   SKNFLVVLEEQDADPKDIEI----LTVNRDTICSM---STQMHPPHVKAFDRKAGK  764



>ref|XP_006451461.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
 gb|ESR64701.1| hypothetical protein CICLE_v10007531mg [Citrus clementina]
Length=737

 Score =   311 bits (798),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 169/369 (46%), Positives = 225/369 (61%), Gaps = 23/369 (6%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAPLDE  343
             +GS    R AED+ F VA FI +  GS+INYYMYHGGTNFGRT+  F+ TSY   AP+DE
Sbjct  273   FGSAVPTRPAEDLVFSVARFI-QSGGSFINYYMYHGGTNFGRTSGGFVATSYDYDAPIDE  331

Query  344   YGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINN  523
             YGLL EPKW HL++LH AIK+C   L+S  P+  SL + Q+A+VF    SG CAAFL N 
Sbjct  332   YGLLNEPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGKNQEAHVFN-SKSGKCAAFLANY  390

Query  524   DGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeewe  703
             D   SAKV F N+ Y LPP SIS+LPDCKT  FNTA+V  QS+ +   P +  ++     
Sbjct  391   DTTFSAKVSFGNAQYDLPPWSISVLPDCKTAVFNTARVGVQSSQKKFVPVI--NAFSWQS  448

Query  704   efeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESS--------DPKSAISV  859
               EE     DD     D L + +  T D SDYLWY   +  +S+        DP   +++
Sbjct  449   YIEETASSTDDNTFTKDGLWEQVYLTADASDYLWYMTDVNIDSNEGFLKNGQDP--LLTI  506

Query  860   ESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE  1039
              S GH L +F+NG+L+G+ +G+  N   T    V L  G+N ISLLS +VGLPN G + E
Sbjct  507   WSAGHALQVFINGQLSGTVYGSLENPKLTFSKNVKLRPGVNKISLLSTSVGLPNVGTHFE  566

Query  1040  H---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS--  1201
                   LGP  VT++  +EG+ D+S   W Y++GL GE L ++T  GS++V+W + +S  
Sbjct  567   KWNAGVLGP--VTLKGLNEGTRDISKQKWTYKIGLKGEALSLHTISGSSSVEWAQGASLA  624

Query  1202  -SQPLIWYK  1225
               QP+ WYK
Sbjct  625   QKQPMTWYK  633


 Score =   100 bits (250),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 65/102 (64%), Gaps = 20/102 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +T F+ P GNDPLAL++G+MGKG  W+NGQSIGR+W  Y                     
Sbjct  633   KTTFNVPPGNDPLALDMGAMGKGMVWINGQSIGRHWPGYIGNGNCGGCNYAGTYTEKKCR  692

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
             T  G PSQ WY+VPRS+LKP+GNLLV+FEE  G P+ I+L K
Sbjct  693   TYCGKPSQRWYHVPRSWLKPSGNLLVVFEEWGGEPHWISLLK  734



>ref|XP_011045964.1| PREDICTED: beta-galactosidase-like isoform X1 [Populus euphratica]
Length=880

 Score =   315 bits (806),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 174/371 (47%), Positives = 226/371 (61%), Gaps = 21/371 (6%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             Y  +G     R AED+AF VA FI +  GSYINYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  301   YTEFGGAVPHRPAEDMAFSVARFI-QNGGSYINYYMYHGGTNFGRTAGGPFIATSYDYDA  359

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDE+GL REPKW HL++LH AIK+C   L+S  P+  SL   Q+ +VF+  S   CAAF
Sbjct  360   PLDEFGLPREPKWGHLRDLHKAIKLCEPALVSVDPTVTSLGSNQEVHVFK--SKSVCAAF  417

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N D K+S KV F N  Y+LPP SISILPDCKTV +NTA++ +QS+   M PA    S 
Sbjct  418   LANYDTKYSVKVTFGNGQYELPPWSISILPDCKTVVYNTARLGSQSSQMKMVPAS--SSF  475

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPKSAI  853
                   EE     DD     + L + IN T+D +DYLWY   ++ ++      S     +
Sbjct  476   SWQSYNEETASADDDDTTTMNGLWEQINVTRDATDYLWYLTDVKIDADEGFLKSGQNPLL  535

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             ++ S GH LH+F+NG+LAG+A+G   N   T    + L +G+N ISLLS  VGLPN G +
Sbjct  536   TIFSAGHALHVFINGQLAGTAYGGLSNPKLTFSQNIKLTEGINKISLLSVAVGLPNVGLH  595

Query  1034  LE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE---  1192
              E      LGP  VT++  +EG+ DLS   W Y++GL GE+L ++T  GS +V+W E   
Sbjct  596   FETWNAGVLGP--VTLKGLNEGTRDLSGQKWSYKIGLKGESLGLHTASGSESVEWVEGSL  653

Query  1193  FSSSQPLIWYK  1225
              +  Q L WYK
Sbjct  654   LAQKQALTWYK  664


 Score =   104 bits (260),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 75/124 (60%), Gaps = 21/124 (17%)
 Frame = +1

Query  1438  LLIKLKVETT*QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY----------  1587
             LL + +  T  +T FD P GNDPLAL++ SMGKG+ W+NGQ+IGR+W  Y          
Sbjct  653   LLAQKQALTWYKTAFDAPPGNDPLALDMSSMGKGQMWINGQNIGRHWPGYIAHGSCGDCN  712

Query  1588  ----------HTVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGIT-LDKVSITLD  1734
                        T  G PSQ WY+VPRS+LKP+GNLL +FEE  G+P GI+ + + + ++ 
Sbjct  713   YAGTFDDKKCRTNCGEPSQRWYHVPRSWLKPSGNLLAVFEEWGGDPTGISFVKRTTASVC  772

Query  1735  KDIL  1746
              DI 
Sbjct  773   ADIF  776



>gb|ACC60981.1| beta-galactosidase 1 precursor [Petunia x hybrida]
Length=842

 Score =   313 bits (803),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 175/367 (48%), Positives = 227/367 (62%), Gaps = 19/367 (5%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQAPLD  340
             +GS    R  ED+AF VA FI +  GS+INYYMYHGGTNFGRTA   F+ TSY   APLD
Sbjct  265   FGSPVPYRPVEDLAFGVANFI-QTGGSFINYYMYHGGTNFGRTAGGPFVATSYDYDAPLD  323

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             E+GLLR+PKW HLK+LH AIK+C   L+S  P+  +L  +Q+A+VFR  +SGACAAFL N
Sbjct  324   EFGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTALGNYQKAHVFR-STSGACAAFLAN  382

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeew  700
             ND    A V F N  Y LPP SISILPDCK   +NTA+V  QS    M PA +  S + +
Sbjct  383   NDPNSFATVAFGNKHYNLPPWSISILPDCKHTVYNTARVGAQSALMKMTPANEGYSWQSY  442

Query  701   eefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP--KSA----ISVE  862
              +       +DD       LL+ +NTT+DVSDYLWY   ++ + S+   +S     ++V 
Sbjct  443   NDQTAF---YDDNAFTVVGLLEQLNTTRDVSDYLWYMTDVKIDPSEGFLRSGNWPWLTVS  499

Query  863   SLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE-  1039
             S G  LH+FVNG+LAG+ +G+ +    T    V+L  G+N ISLLS  VGLPN G + E 
Sbjct  500   SAGDALHVFVNGQLAGTVYGSLKKQKITFSKAVNLRAGVNKISLLSIAVGLPNIGPHFET  559

Query  1040  --HKTLGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS---SS  1204
                  LGP  ++    EG  DL+   W Y+VGL GE L +++  GS++V+W E S     
Sbjct  560   WNTGVLGPVSLS-GLDEGKRDLTWQKWSYKVGLKGEALNLHSLSGSSSVEWVEGSLVAQR  618

Query  1205  QPLIWYK  1225
             QPL WYK
Sbjct  619   QPLTWYK  625


 Score = 98.6 bits (244),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 63/102 (62%), Gaps = 20/102 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTV------------------  1596
             +T F+ P GN+PLAL++ SMGKG+ W+NGQSIGRYW  Y                     
Sbjct  625   KTTFNAPAGNEPLALDMNSMGKGQVWINGQSIGRYWPGYKASGTCDACNYAGPFNEKKCL  684

Query  1597  --AGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
                G  SQ WY+VPRS+L PTGNLLV+FEE  G+P GI+L K
Sbjct  685   SNCGDASQRWYHVPRSWLHPTGNLLVVFEEWGGDPNGISLVK  726



>ref|XP_002308268.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
 gb|EEE91791.2| hypothetical protein POPTR_0006s14680g [Populus trichocarpa]
Length=837

 Score =   313 bits (803),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 172/371 (46%), Positives = 226/371 (61%), Gaps = 21/371 (6%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             Y  +G     R AED+AF VA FI +  GSYINYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  258   YTEFGGAVPHRPAEDMAFSVARFI-QNGGSYINYYMYHGGTNFGRTAGGPFIATSYDYDA  316

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDE+GL REPKW HL++LH AIK+C   L+S  P+  SL   Q+A+VF+  S   CAAF
Sbjct  317   PLDEFGLPREPKWGHLRDLHKAIKLCEPALVSVDPTVTSLGSNQEAHVFK--SKSVCAAF  374

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N D K+S KV F N  Y+LPP S+SILPDCKT  +NTA++ +QS+   M PA    S 
Sbjct  375   LANYDTKYSVKVTFGNGQYELPPWSVSILPDCKTAVYNTARLGSQSSQMKMVPAS--SSF  432

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPKSAI  853
                   EE     DD     + L + IN T+D +DYLWY   ++ ++      S     +
Sbjct  433   SWQSYNEETASADDDDTTTMNGLWEQINVTRDATDYLWYLTDVKIDADEGFLKSGQNPLL  492

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             ++ S GH LH+F+NG+LAG+A+G   N   T    + L +G+N ISLLS  VGLPN G +
Sbjct  493   TIFSAGHALHVFINGQLAGTAYGGLSNPKLTFSQNIKLTEGINKISLLSVAVGLPNVGLH  552

Query  1034  LE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE---  1192
              E      LGP  +T++  +EG+ DLS   W Y++GL GE+L ++T  GS +V+W E   
Sbjct  553   FETWNAGVLGP--ITLKGLNEGTRDLSGQKWSYKIGLKGESLSLHTASGSESVEWVEGSL  610

Query  1193  FSSSQPLIWYK  1225
              +  Q L WYK
Sbjct  611   LAQKQALTWYK  621


 Score =   106 bits (264),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 76/124 (61%), Gaps = 21/124 (17%)
 Frame = +1

Query  1438  LLIKLKVETT*QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY----------  1587
             LL + +  T  +T FD P+GNDPLAL++ SMGKG+ W+NGQ+IGR+W  Y          
Sbjct  610   LLAQKQALTWYKTAFDAPQGNDPLALDMSSMGKGQMWINGQNIGRHWPGYIAHGSCGDCN  669

Query  1588  ----------HTVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGIT-LDKVSITLD  1734
                        T  G PSQ WY+VPRS+LKP+GNLL +FEE  G+P GI+ + + + ++ 
Sbjct  670   YAGTFDDKKCRTNCGEPSQRWYHVPRSWLKPSGNLLAVFEEWGGDPTGISFVKRTTASVC  729

Query  1735  KDIL  1746
              DI 
Sbjct  730   ADIF  733



>gb|KDO71286.1| hypothetical protein CISIN_1g045037mg [Citrus sinensis]
Length=832

 Score =   313 bits (802),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 160/367 (44%), Positives = 232/367 (63%), Gaps = 13/367 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAE++AF VA F + KNG+  NYYMY+GGTN+GR  +SF+ T YYD+AP
Sbjct  264   YRVFGDPPSRRSAENLAFSVARFFS-KNGTLANYYMYYGGTNYGRLGSSFVTTRYYDEAP  322

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             +DEYG+LREPKW HL++LH+A+++C + LLS  PS  +     +A+++    + AC AFL
Sbjct  323   IDEYGMLREPKWGHLRDLHSALRLCKKALLSGKPSVENFGPNLEAHIYEQPKTKACVAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NND +  A + F+ S Y LP  SISILPDCKTV +NT  +  Q ++R  Q +   +   
Sbjct  383   SNNDSRTPATLTFRGSKYYLPQYSISILPDCKTVVYNTRMIVAQHSSRHYQKSKAANKDL  442

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQ--------QESSDPKSA  850
              WE F E +   ++  I++ + L+  + TKD +DYLW+T S+         +E   P   
Sbjct  443   RWEMFIEDIPTLNENLIKSASPLEQWSVTKDTTDYLWHTTSISLDGFHLPLREKVLP--V  500

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             + + SLGH++H FVNG   GS HGT + +SF  +  + L  G+N+ISLL  T+GLP+SG 
Sbjct  501   LRIASLGHMMHGFVNGHYIGSGHGTNKENSFVFQKPIILKPGINHISLLGVTIGLPDSGV  560

Query  1031  YLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-S  1204
             YLE +  G R V I+  + G+ D++   WG +VGL GE  Q+YT++GS+ V+W +     
Sbjct  561   YLERRYAGTRTVAIQGLNTGTLDVTYSEWGQKVGLDGEKFQVYTQEGSDRVKWNKTKGLG  620

Query  1205  QPLIWYK  1225
              PL WYK
Sbjct  621   GPLTWYK  627


 Score =   104 bits (259),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 76/113 (67%), Gaps = 7/113 (6%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEGNDPLA+ + +M KG  WVNG+SIGRYWVS+ +  G PSQ+ Y++PR+FLKP
Sbjct  627   KTYFDAPEGNDPLAIEVATMSKGMVWVNGKSIGRYWVSFLSPTGKPSQSVYHIPRAFLKP  686

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILLRRLA*GKGSVPSHNHTKDRK  1809
               NLL +FEE  GN  G+ +    +T++++ +   +   K S P+  + + R+
Sbjct  687   KDNLLAIFEEIGGNIDGVQI----VTVNRNTICSYI---KESDPTRVNNRKRE  732



>ref|XP_003523495.1| PREDICTED: beta-galactosidase 13 [Glycine max]
Length=844

 Score =   313 bits (802),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 161/365 (44%), Positives = 225/365 (62%), Gaps = 10/365 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + KNG+ +NYYMYHGGTNFGRT++ F  T YYD+AP
Sbjct  279   YRVHGDPPSQRSAEDIAFSVARFFS-KNGNLVNYYMYHGGTNFGRTSSVFSTTRYYDEAP  337

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKWSHL+++H A+ +C + +L   PS   L  F +   F    +  CAAF+
Sbjct  338   LDEYGLPREPKWSHLRDVHKALLLCRRAILGGVPSVQKLNHFHEVRTFERVGTNMCAAFI  397

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN     A + F+ ++Y LPP SISILPDCKTV FNT ++ +Q N+R  + +   ++  
Sbjct  398   TNNHTMEPATINFRGTNYFLPPHSISILPDCKTVVFNTQQIVSQHNSRNYERSPAANNFH  457

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLS--LQQESSDPKSAI----S  856
                  E +        I      +  +  KD +DY WYT S  L QE    K  +     
Sbjct  458   WEMFNEAIPTA-KKMPINLPVPAELYSLLKDTTDYAWYTTSFELSQEDMSMKPGVLPVLR  516

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V SLGH +  FVNG++ G+AHGT    SF  ++ V L  G N ISLLS+TVGLP+SGAY+
Sbjct  517   VMSLGHSMVAFVNGDIVGTAHGTHEEKSFEFQTPVLLRVGTNYISLLSSTVGLPDSGAYM  576

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-SQP  1210
             EH+  GP+ + I   + G+ DL+ + WG++VGL GE  ++++E+GS +V+W+   +  + 
Sbjct  577   EHRYAGPKSINILGLNRGTLDLTRNGWGHRVGLKGEGKKVFSEEGSTSVKWKPLGAVPRA  636

Query  1211  LIWYK  1225
             L WY+
Sbjct  637   LSWYR  641


 Score = 89.7 bits (221),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  PEG  P+A+ +  M KG  WVNG +IGRYW+SY +  G P+Q+ Y++PRSFL P
Sbjct  641   RTRFGTPEGTGPVAIRMSGMAKGMVWVNGNNIGRYWMSYLSPLGKPTQSEYHIPRSFLNP  700

Query  1651  TGNLLVLFEEEYGNPYGITLDKVS  1722
               NLLV+FEEE   P  + +  V+
Sbjct  701   QDNLLVIFEEEARVPAQVEILNVN  724



>gb|KHN33673.1| Beta-galactosidase 13 [Glycine soja]
Length=833

 Score =   313 bits (802),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 161/365 (44%), Positives = 225/365 (62%), Gaps = 10/365 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + KNG+ +NYYMYHGGTNFGRT++ F  T YYD+AP
Sbjct  268   YRVHGDPPSQRSAEDIAFSVARFFS-KNGNLVNYYMYHGGTNFGRTSSVFSTTRYYDEAP  326

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKWSHL+++H A+ +C + +L   PS   L  F +   F    +  CAAF+
Sbjct  327   LDEYGLPREPKWSHLRDVHKALLLCRRAILGGVPSVQKLNHFHEVRTFERVGTNMCAAFI  386

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN     A + F+ ++Y LPP SISILPDCKTV FNT ++ +Q N+R  + +   ++  
Sbjct  387   TNNHTMEPATINFRGTNYFLPPHSISILPDCKTVVFNTQQIVSQHNSRNYERSPAANNFH  446

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLS--LQQESSDPKSAI----S  856
                  E +        I      +  +  KD +DY WYT S  L QE    K  +     
Sbjct  447   WEMFNEAIPTA-KKMPINLPVPAELYSLLKDTTDYAWYTTSFELSQEDMSMKPGVLPVLR  505

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             V SLGH +  FVNG++ G+AHGT    SF  ++ V L  G N ISLLS+TVGLP+SGAY+
Sbjct  506   VMSLGHSMVAFVNGDIVGTAHGTHEEKSFEFQTPVLLRVGTNYISLLSSTVGLPDSGAYM  565

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-SQP  1210
             EH+  GP+ + I   + G+ DL+ + WG++VGL GE  ++++E+GS +V+W+   +  + 
Sbjct  566   EHRYAGPKSINILGLNRGTLDLTRNGWGHRVGLKGEGKKVFSEEGSTSVKWKPLGAVPRA  625

Query  1211  LIWYK  1225
             L WY+
Sbjct  626   LSWYR  630


 Score = 89.4 bits (220),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  PEG  P+A+ +  M KG  WVNG +IGRYW+SY +  G P+Q+ Y++PRSFL P
Sbjct  630   RTRFGTPEGTGPVAIRMSGMAKGMVWVNGNNIGRYWMSYLSPLGKPTQSEYHIPRSFLNP  689

Query  1651  TGNLLVLFEEEYGNPYGITLDKVS  1722
               NLLV+FEEE   P  + +  V+
Sbjct  690   QDNLLVIFEEEARVPAQVEILNVN  713



>gb|KDP33829.1| hypothetical protein JCGZ_07400 [Jatropha curcas]
Length=838

 Score =   313 bits (802),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 173/373 (46%), Positives = 227/373 (61%), Gaps = 25/373 (7%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             Y  +G     R AED+AF VA FI +  GS++NYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  259   YTEFGGSVPYRPAEDLAFSVARFI-QNGGSFMNYYMYHGGTNFGRTAGGPFIATSYDYDA  317

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             P+DEYGL R+PKW HL++LH AIK+C   L+S  P+  SL   Q+A+VF+  S  ACAAF
Sbjct  318   PIDEYGLPRDPKWGHLRDLHKAIKLCEPALVSVDPTVKSLGDNQEAHVFQ--SKSACAAF  375

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N D K+S KV F N  Y LPP SISILPDCKT  FNTA++  QS    M P     S 
Sbjct  376   LANYDTKYSVKVTFGNGQYDLPPWSISILPDCKTAVFNTARLGAQSTQMKMTPVGSGFSW  435

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQ--------QESSDPKS  847
             + + E      G+ D     D L + IN T+D +DYLWY  +++        +   DP  
Sbjct  436   QSYIEEA--ASGYTDDTTTLDGLWEQINVTRDATDYLWYMTNVKIDPDEGFLKNGQDP--  491

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              +++ S GH LH+F+N +LAG+ +G+  N   T    V L  G+N ISLLS  VGLPN G
Sbjct  492   LLTILSAGHSLHVFINDQLAGTVYGSLDNPKVTFSKNVKLTSGINKISLLSVAVGLPNVG  551

Query  1028  AYLEH---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE-  1192
              + E      LGP  VT++  +EG++DLS   W Y++GL GE L ++T  GS++V+W E 
Sbjct  552   VHFERWNSGVLGP--VTLKGLNEGTKDLSGWKWSYKIGLKGEALNLHTVTGSSSVEWAEG  609

Query  1193  --FSSSQPLIWYK  1225
                ++ QPL WYK
Sbjct  610   SLLATKQPLTWYK  622


 Score =   107 bits (266),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 71/112 (63%), Gaps = 21/112 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +T FD PEGNDPLAL++ SMGKG+ WVNGQSIGR+W +Y                     
Sbjct  622   KTTFDAPEGNDPLALDMSSMGKGQIWVNGQSIGRHWPAYTARGSCGDCNYAGTFDDKKCR  681

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSI-TLDKDI  1743
                G PSQ WY+VPRS+L P+GNLLV+FEE  GNP GI+L K +  T+  DI
Sbjct  682   RNCGEPSQRWYHVPRSWLNPSGNLLVVFEEFGGNPSGISLVKRTTGTVCADI  733



>ref|XP_006467171.1| PREDICTED: beta-galactosidase 13-like [Citrus sinensis]
Length=832

 Score =   313 bits (801),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 233/367 (63%), Gaps = 13/367 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSA+++AF VA F + KNG+  NYYMY+GGTN+GR+ +SF+ T YYD+AP
Sbjct  264   YRVFGDPPSRRSAQNLAFSVARFFS-KNGTLANYYMYYGGTNYGRSGSSFVTTRYYDEAP  322

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             +DEYG+LREPKW HL++LH+A+++C + LLS  PS  +     +A+++    + AC AFL
Sbjct  323   IDEYGMLREPKWGHLRDLHSALRLCKKALLSGKPSVENFGPNLEAHIYEQPKTKACVAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NND +  A + F+ S Y LP  SISILPDCKTV +NT  +  Q ++R  Q +   +   
Sbjct  383   SNNDSRTPATLTFRGSKYYLPQYSISILPDCKTVVYNTRMIVAQHSSRHYQKSKAANKAL  442

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQ--------QESSDPKSA  850
              WE F E +   ++  I++ + L+  + TKD +DYLW+T S+         +E   P   
Sbjct  443   RWEMFIEDIPTLNENLIKSASPLEQWSVTKDTTDYLWHTTSISLDGFHLPLREKVLP--V  500

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             + + SLGH++H FVNG   GS HGT + +SF  +  + L  G+N+ISLL  T+GLP+SG 
Sbjct  501   LRIASLGHMMHGFVNGHYIGSGHGTNKENSFVFQKPIILKPGINHISLLGVTIGLPDSGV  560

Query  1031  YLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-S  1204
             YLE +  G R V I+  + G+ D++   WG +VGL GE  Q+YT++GS+ V+W +     
Sbjct  561   YLERRYAGTRTVAIQGLNTGTLDVTYSEWGQKVGLDGEKFQVYTQEGSDRVKWNKTKGLG  620

Query  1205  QPLIWYK  1225
              PL WYK
Sbjct  621   GPLTWYK  627


 Score =   104 bits (259),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 76/113 (67%), Gaps = 7/113 (6%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEGNDPLA+ + +M KG  WVNG+SIGRYWVS+ +  G PSQ+ Y++PR+FLKP
Sbjct  627   KTYFDAPEGNDPLAIEVATMSKGMVWVNGKSIGRYWVSFLSPTGKPSQSVYHIPRAFLKP  686

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILLRRLA*GKGSVPSHNHTKDRK  1809
               NLL +FEE  GN  G+ +    +T++++ +   +   K S P+  + + R+
Sbjct  687   KDNLLAIFEEIGGNIDGVQI----VTVNRNTICSYI---KESDPTRVNNRKRE  732



>ref|XP_008236010.1| PREDICTED: beta-galactosidase 11-like [Prunus mume]
Length=851

 Score =   313 bits (802),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 166/370 (45%), Positives = 223/370 (60%), Gaps = 20/370 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + K+G+  NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  286   YRVFGDPPSQRSAEDIAFSVARFFS-KDGTLTNYYMYHGGTNFGRTSAIFTTTRYYDEAP  344

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLK+LH A+ +C + L   TP    L +  +A  +    +  C AFL
Sbjct  345   LDEYGLQREPKWGHLKDLHRALNLCKKPLFGGTPGVQRLGKETEARFYERPGTDICVAFL  404

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTM---QPALKFD  685
              NN       V ++   Y LPP SISILPDC+TV FN+ ++ +Q N+R     + A KF+
Sbjct  405   ANNHSTIETTVNWRGQEYFLPPHSISILPDCRTVVFNSQQIVSQHNSRNFVRSKAANKFN  464

Query  686   STeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSL--------QQESSDP  841
                  E     V      N ++   L H+   KD +DY W+T SL         +ES  P
Sbjct  465   WEMFSEPIPTTVQ--IPVNHKSPQELYHL--LKDATDYGWFTSSLDLGPYDLPMKESIRP  520

Query  842   KSAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPN  1021
                + + SLGH + +FVNGE  G+ HG+     F  E  V+  +G+N+ISLL  TVGLP+
Sbjct  521   --VLRIPSLGHAMSVFVNGEYVGTEHGSHAEKGFVFERPVTFKQGVNHISLLCMTVGLPD  578

Query  1022  SGAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REF  1195
             SGAY+EH+  GPR +T+   + G+ DLS + WG++VGL GENL+++TEKG+  VQW +  
Sbjct  579   SGAYMEHRYAGPRTITVLGLNTGTIDLSQNGWGHRVGLNGENLRVFTEKGAQKVQWTKAA  638

Query  1196  SSSQPLIWYK  1225
                + L WYK
Sbjct  639   GKGRALTWYK  648


 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 65/93 (70%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F+ PEG DP+A+ +  MGKG  WVNG+SIGR+W+S+ +  G P+Q+ Y++PR+F+KP
Sbjct  648   KTNFEAPEGKDPVAIRMAGMGKGMIWVNGKSIGRHWMSFLSPLGQPTQSEYHIPRAFIKP  707

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
               N L++ EE+  +P  I +    +T+++D + 
Sbjct  708   GQNFLLVLEEQEADPKDIEI----LTVNRDTIC  736



>ref|XP_008224549.1| PREDICTED: beta-galactosidase 13-like [Prunus mume]
Length=871

 Score =   313 bits (803),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 167/370 (45%), Positives = 222/370 (60%), Gaps = 20/370 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     R  EDIAF VA F ++K GS  NYYMYHGGTNFGRT+A F  T YYD+AP
Sbjct  266   YRVFGDPPSQRPVEDIAFAVARFFSKK-GSLTNYYMYHGGTNFGRTSAIFTTTRYYDEAP  324

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL R+PKWSHLK+LH A+++  + +L   P    ++   + Y +   ++  CAAFL
Sbjct  325   LDEYGLPRDPKWSHLKDLHKALRLSRKAMLWGVPGVQKMSADTEVYFYEMPATDICAAFL  384

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTR-----TMQPALK  679
              NN+    A V ++   Y LPP S+SILPDCKT+ FNT  +  Q N+R     T+   LK
Sbjct  385   TNNNLTTEATVSWRGQDYYLPPHSVSILPDCKTIVFNTQTIVAQHNSRNYVRSTVANNLK  444

Query  680   FDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-PKSA--  850
             +    E       V   + T +   TLL      KD SDY WYT SL     D P+ A  
Sbjct  445   WMKNAEPIPTTLQVPVNNSTPLELYTLL------KDSSDYAWYTTSLALNPQDLPRKASI  498

Query  851   ---ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPN  1021
                + + SLGH LH+FVNGE  G  HG+    SF LE  V    G+N I+LL+ T+GLP+
Sbjct  499   QPVLRIASLGHALHLFVNGEYIGFGHGSHDEKSFVLEKPVHFKAGVNQITLLAMTLGLPD  558

Query  1022  SGAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW-REF  1195
              GAY+EH+  GP  + +   + G+ D++ + WG+QVGL GE LQ++TE+GS  VQW +  
Sbjct  559   GGAYMEHRYAGPNLIIVLGLNTGTLDITKNGWGHQVGLNGEKLQVFTEEGSKQVQWDKTK  618

Query  1196  SSSQPLIWYK  1225
              S+Q L WYK
Sbjct  619   GSAQGLTWYK  628


 Score = 99.4 bits (246),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 67/93 (72%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEGN+P+A+ +  MGKG  WVNG+SIGR+W+S+ +  G P+Q+ Y++PRSF+KP
Sbjct  628   KTYFDAPEGNNPVAIRMTGMGKGMIWVNGKSIGRHWMSFLSPLGEPTQSEYHIPRSFIKP  687

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             T NLLV+ EE+   P  I +    +T+++D + 
Sbjct  688   TQNLLVVLEEQPAKPKHIEI----LTVNRDTIC  716



>ref|XP_011046693.1| PREDICTED: beta-galactosidase 13-like [Populus euphratica]
Length=838

 Score =   313 bits (801),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 166/367 (45%), Positives = 231/367 (63%), Gaps = 15/367 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             ++V+G     RSAED AF VA + + KNGS +NYYMYHGGTNF RTAASF+ T YYD+AP
Sbjct  264   FRVFGDPPSQRSAEDTAFSVARWFS-KNGSLVNYYMYHGGTNFDRTAASFVTTRYYDEAP  322

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLK+LH A+ +C + LL  TP+   L+   +A  F+   +  CAAFL
Sbjct  323   LDEYGLQREPKWGHLKDLHRALNLCKKALLWGTPNVQRLSADVEARFFQQPGTNDCAAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN+ K    V F+   Y LP +SISILPDCKTV +NT  V +Q N+R    + K D   
Sbjct  383   ANNNTKDPETVTFRGKKYYLPARSISILPDCKTVVYNTMTVVSQHNSRNFVKSRKTDGKL  442

Query  695   eweefeeLVVGFDDTNIRADTLLDH--INTTKDVSDYLWYTLSLQQESSDPKS------A  850
             EW+ F E +     +N+  D+ +     N TKD +DY W+T ++  + +D  +       
Sbjct  443   EWKMFSETI----PSNLLVDSRIPRELYNLTKDRTDYAWFTTTINVDRNDLSARKDINPV  498

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             + V SLGH +  F+NGE  GSAHG+    SF L+ +  L  G+N ++LL + VGLP+SGA
Sbjct  499   LRVASLGHAMVAFINGEFIGSAHGSQIEKSFVLQHSAKLKPGINFVTLLGSLVGLPDSGA  558

Query  1031  YLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS-S  1204
             Y+EH+  GPR V+I   + G+ DLS++ WG+QV L GE  +++T++G + V W + +   
Sbjct  559   YMEHRYAGPRGVSILGLNTGTLDLSSNGWGHQVALSGETAKVFTKEGGSKVTWTKVNKDG  618

Query  1205  QPLIWYK  1225
              P+ WYK
Sbjct  619   PPVTWYK  625


 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 63/93 (68%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG  P+A+ +  M KG  W+NG+SIGRYW++Y +  G P+Q+ Y++PR  LKP
Sbjct  625   KTRFDAPEGKSPVAVRMTGMKKGTIWINGKSIGRYWMNYISPLGEPTQSEYHIPRYSLKP  684

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             T NL+V+ EEE  +P  I +    +T+++D + 
Sbjct  685   TNNLMVILEEEEASPEKIEI----LTVNRDTIC  713



>ref|XP_010911843.1| PREDICTED: LOW QUALITY PROTEIN: beta-galactosidase 7-like [Elaeis 
guineensis]
Length=841

 Score =   313 bits (801),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 220/325 (68%), Gaps = 5/325 (2%)
 Frame = +2

Query  263   YHGGTNFGRTAASFMITSYYDQAPLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPST  442
             YHGGTNFG++ +S++ TSYYD+APLDEYGL+  P W HL+ELHAAIK+ S+ LL  T + 
Sbjct  330   YHGGTNFGKSPSSYVTTSYYDRAPLDEYGLIWLPTWGHLRELHAAIKLSSEPLLWGTYTN  389

Query  443   FSLAQFQQAYVFRGDSSGACAAFLINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAF  622
             FSL Q Q+A+VF+ + SG CAAFL+N     +A V   N++Y+LP KSISILPDCK VAF
Sbjct  390   FSLGQQQEAHVFQTN-SGKCAAFLVNFAQHLNATVSLHNATYELPSKSISILPDCKRVAF  448

Query  623   NTAKVTTQSNTRTMQPALKFDSTeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYL  802
             NTA+V+ Q   R+ +    F++  +W  F E +      +     LL+ ++TTKD +DYL
Sbjct  449   NTAEVSAQYGNRSARAVQSFNNANKWSTFTEGIPNVHHASFTNIELLEQMSTTKDGTDYL  508

Query  803   WYTLSLQQESSDPKSAISVESLGHVLHIFVNGELAGSAHGTFRN-SSFTLESTVSLNKGM  979
             WYT S   +SSD + A+SV+S  HVLH FVN E  GS HG+     + TL   +SL +G 
Sbjct  509   WYTFSYNHKSSDGQQALSVDSRAHVLHAFVNDEFVGSVHGSSDGPPNMTLRXNISLREGQ  568

Query  980   NNISLLSATVGLPNSGAYLEHKTLGPRKVTIESS-EGSEDLSNDSWGYQVGLLGENLQIY  1156
             NNISLLS  VGLP+ GAYLE +  G R+V+I  S  G ++L+N  WGYQ+GLLGE L+IY
Sbjct  569   NNISLLSVMVGLPDGGAYLEKRIAGLRRVSINCSGSGPQNLTNWLWGYQIGLLGEKLEIY  628

Query  1157  TEKGSNAVQWREFSSS--QPLIWYK  1225
             T++G   V WR   SS  +PL WY+
Sbjct  629   TQQGLQKVVWRTDGSSIDRPLTWYE  653


 Score =   121 bits (303),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G  P+AL+L SMGKGE W+NG+SIGRYWVS+ +  G PSQT Y+VP+SFLKP
Sbjct  653   ETTFDAPFGTKPVALDLSSMGKGEVWINGESIGRYWVSFASPNGQPSQTLYHVPQSFLKP  712

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSIT  1728
              GNLLVLFEE  G+P GITL  +S+T
Sbjct  713   FGNLLVLFEEMGGDPLGITLKTISVT  738



>dbj|BAF31233.1| beta-D-galactosidase [Persea americana]
Length=849

 Score =   313 bits (802),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 177/371 (48%), Positives = 228/371 (61%), Gaps = 22/371 (6%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             +  +G     R AED+AF +A FI R  GS+INYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  270   FTAFGGPVPYRPAEDMAFAIAKFIQR-GGSFINYYMYHGGTNFGRTAGGPFVATSYDYDA  328

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             P+DEYGL+R+PKW HLK+LH AIKMC   L+S  P   SL   Q+++VF+ + SG CAAF
Sbjct  329   PIDEYGLIRQPKWGHLKDLHKAIKMCEAALVSGDPIVTSLGSSQESHVFKSE-SGDCAAF  387

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N D K  AKV FQ   Y LPP SISILPDC    FNTA+V  Q+++ TM  ++  D  
Sbjct  388   LANYDEKSFAKVAFQGMHYNLPPWSISILPDCVNTVFNTARVGAQTSSMTMT-SVNPDGF  446

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDPKSA-------  850
                   EE    +DD +I  + LL+ IN T+DV+DYLWYT  +   + DP          
Sbjct  447   SWETYNEE-TASYDDASITMEGLLEQINVTRDVTDYLWYTTDI---TIDPNEGFLKNGEY  502

Query  851   --ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNS  1024
               ++V S GH LHIF+NGEL+G+ +G+  N   T   +V L  G N IS+LS  VGLPN 
Sbjct  503   PVLTVMSAGHALHIFINGELSGTVYGSVDNPKLTYTGSVKLLAGNNKISVLSIAVGLPNI  562

Query  1025  GAYLE---HKTLGPRKVTIESSEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF  1195
             GA+ E      LGP  V    +EG  DLS  +W Y++GL GE LQ+++  GS++V+W   
Sbjct  563   GAHFETWNTGVLGPV-VLNGLNEGRRDLSWQNWSYKIGLKGEALQLHSLTGSSSVEWSSL  621

Query  1196  -SSSQPLIWYK  1225
              +  QPL WYK
Sbjct  622   IAQKQPLTWYK  632


 Score = 90.9 bits (224),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/100 (47%), Positives = 59/100 (59%), Gaps = 20/100 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTV------------------  1596
             +T F+ PEGN P AL++  MGKG+ W+NGQSIGRYW +Y                     
Sbjct  632   KTTFNAPEGNGPFALDMSMMGKGQIWINGQSIGRYWPAYKAYGNCGECSYTGRYNEKKCL  691

Query  1597  --AGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITL  1710
                G  SQ WY+VP S+L PT NLLV+FEE  G+P GI+L
Sbjct  692   ANCGEASQRWYHVPSSWLYPTANLLVVFEEWGGDPTGISL  731



>ref|XP_006340680.1| PREDICTED: beta-galactosidase 3-like [Solanum tuberosum]
Length=845

 Score =   313 bits (801),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 173/369 (47%), Positives = 227/369 (62%), Gaps = 20/369 (5%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QAPLD  340
             +G     R  +D+AF VA FI R  GS++NYYMYHGGTNFGRTA    IT+ YD  AP+D
Sbjct  262   FGGPLHQRPVQDLAFAVAQFIQR-GGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPID  320

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             EYGL+R+PK+ HLKELH A+KMC + ++SA P+  SL   QQAYV+  + +G CAAFL N
Sbjct  321   EYGLIRQPKYGHLKELHRAVKMCEKSIVSADPAITSLGNLQQAYVYSSE-TGECAAFLSN  379

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeew  700
             ND K +A+V F N  Y LPP SISILPDC+ V FNTAKV  Q++   M P    +     
Sbjct  380   NDWKSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPT-NSEMLSWE  438

Query  701   eefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD------PKSAISVE  862
                E++    D ++IR+  LL+ IN T+D SDYLWY  S+   S++          + VE
Sbjct  439   TYSEDMSALDDSSSIRSFGLLEQINVTRDTSDYLWYITSVDIGSTESFLHGGELPTLIVE  498

Query  863   SLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE-  1039
             + GH +H+F+NG+L+GSA GT +N  F  +  V+L  G N I+LLS  VGLPN G + E 
Sbjct  499   TTGHAMHVFINGQLSGSAFGTRKNRRFVFKGKVNLRAGSNRIALLSVAVGLPNIGGHFET  558

Query  1040  --HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS----  1198
                  LGP  V I+   +G  DLS   W YQVGL GE + + +  G +AV W + S    
Sbjct  559   WSTGVLGP--VAIQGLDQGKWDLSWAKWTYQVGLKGEAMNLVSTNGISAVDWMQGSLIAQ  616

Query  1199  SSQPLIWYK  1225
               QPL W+K
Sbjct  617   KQQPLTWHK  625


 Score =   104 bits (259),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 68/105 (65%), Gaps = 19/105 (18%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHT-------------------  1593
             +  F+ PEG++PLAL++ SMGKG+ W+NGQSIGRYW +Y T                   
Sbjct  625   KAYFNTPEGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCQYSGTFRPPKCQL  684

Query  1594  VAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
               G P+Q WY+VPRS+LKPT NLLVLFEE  G+P  I+L K S+T
Sbjct  685   GCGEPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVT  729



>ref|XP_011046271.1| PREDICTED: beta-galactosidase 13-like [Populus euphratica]
Length=835

 Score =   313 bits (801),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 163/367 (44%), Positives = 228/367 (62%), Gaps = 16/367 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             ++V+G     RSAED AF VA + + KNGS +NYYMYHGGTNFGRTAASF+ T YYD+AP
Sbjct  264   FRVFGDPPSQRSAEDTAFSVARWFS-KNGSLVNYYMYHGGTNFGRTAASFVTTRYYDEAP  322

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDEYGL REPKW HLK+LH A+ +C + LL   P+   L+   +A  +    +  CAAFL
Sbjct  323   LDEYGLQREPKWGHLKDLHRALNLCKKALLWGNPNVQKLSADVEARFYEQPGTKVCAAFL  382

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              +N+ K +  V+F+   Y LP +SISILPDCKTV +NT  V +Q N+R    + K +  E
Sbjct  383   TSNNSKEAETVKFRGQEYYLPARSISILPDCKTVVYNTMTVVSQHNSRNFVKSRKTNKLE  442

Query  695   eweefeeLVVGFDDTNIRADTLL--DHINTTKDVSDYLWYTLSLQQESSDPKS------A  850
                  E +        ++ D+ L  +  N TKD +DY+W+T ++  +  D          
Sbjct  443   WKMYSETI-----PAQLQVDSSLPKELYNLTKDKTDYVWFTTTINVDRRDMNERKRINPV  497

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             + V SLGH +  FVNGE  GSAHG+    SF L+ +V L  G+N ++LL   VGLP+SGA
Sbjct  498   LRVASLGHAMVAFVNGEFIGSAHGSQIEKSFVLQHSVDLKPGINFVTLLGTLVGLPDSGA  557

Query  1031  YLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF-SSS  1204
             Y+EH+  GPR V+I   + G+ DL+++ WG+QVGL GE  +++T++G   V W +   + 
Sbjct  558   YMEHRYAGPRGVSILGLNTGTLDLTSNGWGHQVGLSGETAKLFTKEGGGKVTWTKVQKAG  617

Query  1205  QPLIWYK  1225
              P+ WYK
Sbjct  618   PPVTWYK  624


 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 64/93 (69%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD P G  P+A+ +  M KG  W+NG+SIGRYW++Y +  G P+Q+ Y++PRS+LKP
Sbjct  624   KTHFDAPGGKSPVAVRMTGMNKGMIWINGKSIGRYWMTYVSPLGEPTQSEYHIPRSYLKP  683

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
             T NL+V+FEEE  NP  I +     T+++D + 
Sbjct  684   TDNLMVIFEEEEANPEKIEI----FTVNRDTIC  712



>ref|XP_002445734.1| hypothetical protein SORBIDRAFT_07g024870 [Sorghum bicolor]
 gb|EES15229.1| hypothetical protein SORBIDRAFT_07g024870 [Sorghum bicolor]
Length=844

 Score =   313 bits (801),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 165/369 (45%), Positives = 223/369 (60%), Gaps = 15/369 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F +   G+  NYYMYHGGTNFGRTAA+F++  YYD+AP
Sbjct  271   YRVFGDPPSQRSAEDIAFAVARFFS-VGGTMTNYYMYHGGTNFGRTAAAFVMPKYYDEAP  329

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDE+GL +EPKW HL++LH A+K+C + LL   PST  L +  +A VF       C AFL
Sbjct  330   LDEFGLYKEPKWGHLRDLHLALKLCKKALLWGKPSTEKLGKQLEARVFEIPEQKVCVAFL  389

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N++ K    + F+   Y +P  SISIL DCKTV F T  V  Q N RT   A   D T 
Sbjct  390   SNHNTKDDVTLTFRGQPYFVPRHSISILADCKTVVFGTQHVNAQHNQRTFHFA---DQTN  446

Query  695   eweefeeL----VVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP------K  844
             +   ++      V  +    IR     D  N TKD +DY+WYT S + E  D       K
Sbjct  447   QNNVWQMFDEEKVPKYKQAKIRTRKAADLYNLTKDKTDYVWYTSSFKLEPDDMPIRRDIK  506

Query  845   SAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNS  1024
             + + V S GH    FVN + AG  HGT  N +FTLE  + L KG+N++++L++++G+ +S
Sbjct  507   TVVEVNSHGHASVAFVNNKFAGCGHGTKMNKAFTLEKPMELKKGVNHVAVLASSMGMMDS  566

Query  1025  GAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS  1201
             GAYLEH+  G  +V I   + G+ DL+N+ WG+ VGL+GE  +IYTEKG  +V W+   +
Sbjct  567   GAYLEHRLAGVDRVQITGLNAGTLDLTNNGWGHIVGLVGEQKEIYTEKGMASVTWKPAVN  626

Query  1202  SQPLIWYKE  1228
              +PL WYK 
Sbjct  627   DKPLTWYKR  635


 Score =   103 bits (257),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 72/113 (64%), Gaps = 7/113 (6%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P G DP+ L++ +MGKG  +VNGQ IGRYW+SY    G PSQ  Y++PRSFL+P  N
Sbjct  637   FDMPSGEDPIVLDMSTMGKGMMYVNGQGIGRYWMSYKHALGRPSQQLYHIPRSFLRPKDN  696

Query  1660  LLVLFEEEYGNPYGITLDKVSITLDKDILLRRLA*GKGSVPSHNHTKDRKSKK  1818
             +LVLFEEE+G P  I +    +T+ +D +   ++      P+H  + +RK  +
Sbjct  697   VLVLFEEEFGRPDAIMI----LTVKRDNICTYIS---ERNPAHIKSWERKDSQ  742



>ref|XP_010049746.1| PREDICTED: beta-galactosidase-like [Eucalyptus grandis]
 gb|KCW82504.1| hypothetical protein EUGRSUZ_C03896 [Eucalyptus grandis]
Length=722

 Score =   310 bits (793),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 175/371 (47%), Positives = 222/371 (60%), Gaps = 22/371 (6%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QA  331
             Y  +G     R AED+AF VA FI + +GS++NYYMYHGGTNFGRTA   MI + YD  A
Sbjct  254   YTEFGGAVPYRPAEDLAFSVARFI-QNSGSFVNYYMYHGGTNFGRTAGGPMIATSYDYDA  312

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDEYGLLREPKWSHL++LH AIK     L+SA P   SL   Q+A+VF+  S   CAAF
Sbjct  313   PLDEYGLLREPKWSHLRDLHKAIKQSEWALVSADPVVQSLGSNQEAHVFKAGS--GCAAF  370

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N D K+S +V F N  Y LPP SISILPDCKT  +NTA+V   S+   M P   F   
Sbjct  371   LANYDTKYSVRVNFGNGKYDLPPWSISILPDCKTAVYNTARVNAPSSQIKMVPVGGFS--  428

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPKSAI  853
                   EE V  F       D LL+ I+ T+D SDYLWYT  +          S     +
Sbjct  429   -WQSYIEETVSAFGSDTYTKDGLLEQISFTRDFSDYLWYTTDITISPNEAFLRSGQYPVL  487

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             ++ S GH +H+F+NGEL GSA+G+  N   +  + V L  G+N +S+LS  VGLPN G +
Sbjct  488   TIWSAGHAMHVFINGELTGSAYGSLENPKLSYSNNVKLRAGINKLSILSVAVGLPNVGLH  547

Query  1034  LE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWRE---  1192
              E      LGP  VT++  + G+ D+S   W Y+VGL GENL + T  GS++V+W E   
Sbjct  548   FETWNTGVLGP--VTLKGLNSGTWDMSKWKWSYKVGLKGENLGLNTVSGSSSVEWLEGSM  605

Query  1193  FSSSQPLIWYK  1225
              +  QPL WYK
Sbjct  606   LAQKQPLTWYK  616


 Score = 95.1 bits (235),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 64/106 (60%), Gaps = 20/106 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +  F+ P G+ PLAL++ SMGKGE W+NGQSIGR+W +Y                     
Sbjct  616   KATFNAPPGHSPLALDMNSMGKGEIWINGQSIGRHWPAYTARGSCGSCSYAGTFDENKCR  675

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
             +  G  SQ WY+VPRS+L PTGNLLV+FEE  GNP  ITL + + T
Sbjct  676   SGCGQASQRWYHVPRSWLNPTGNLLVIFEEWGGNPTQITLVQATRT  721



>ref|XP_007131709.1| hypothetical protein PHAVU_011G035300g [Phaseolus vulgaris]
 gb|ESW03703.1| hypothetical protein PHAVU_011G035300g [Phaseolus vulgaris]
Length=842

 Score =   312 bits (800),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 159/365 (44%), Positives = 225/365 (62%), Gaps = 10/365 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + KNGS +NYYMYHGGTNFGRT+++F  T YYD+AP
Sbjct  277   YRVFGDPPSQRSAEDIAFSVARFFS-KNGSLVNYYMYHGGTNFGRTSSAFSTTRYYDEAP  335

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDE+GL R PKWSHL+++H A+ +C + L         L    +  V+    S  CAAF+
Sbjct  336   LDEFGLQRNPKWSHLRDVHKALNLCRKALFGGQSVITKLTHHHEIIVYEKPGSDLCAAFI  395

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN  K    ++F+ S+Y LPP+SISILPDCKTV FNT  V ++ N+R  +   K  +  
Sbjct  396   TNNHTKTPIDIKFRGSTYHLPPRSISILPDCKTVVFNTQHVASEHNSRNFR-KTKNSNNL  454

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD-PKS-----AIS  856
             +WE F E +    D  +  +   +  +  +DV+DY WYT S++    D P+       + 
Sbjct  455   KWEVFTEAIPNAKDIPVVLNVPTELYSLLRDVTDYAWYTTSVELGPGDLPRKDEISPVLR  514

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             + SLGH LH F+NGE  G+ HGT     F  +  V+   G+N IS+L+ TVGLP+SGAY+
Sbjct  515   IMSLGHALHAFINGEYIGTNHGTHEEKGFEFQKPVTFKVGVNYISILACTVGLPDSGAYM  574

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPL  1213
             EH+  GP+ + I   + G  DL+++ WG + G+ GE L I+TE+GS  V+W+E   +  +
Sbjct  575   EHRYAGPKSILILGLNSGKIDLTSNGWGAKAGIRGEELAIFTEQGSKKVEWKEVKGTGSV  634

Query  1214  I-WYK  1225
             + WYK
Sbjct  635   LSWYK  639


 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 64/93 (69%), Gaps = 4/93 (4%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T F  P+G DP+A+ +  MGKG  W+NG+SIGR+W+S+ +  GTP+Q  Y++PR +L P
Sbjct  639   KTNFATPDGRDPVAIRMTGMGKGMIWINGKSIGRHWMSFLSPLGTPTQLEYHIPRIYLNP  698

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSITLDKDILL  1749
               NLLV+FEEE  NP  I ++    T+D+D + 
Sbjct  699   KDNLLVIFEEERANPEKIEIE----TVDRDTVC  727



>ref|XP_011072090.1| PREDICTED: beta-galactosidase 10 [Sesamum indicum]
Length=858

 Score =   313 bits (801),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 173/377 (46%), Positives = 227/377 (60%), Gaps = 22/377 (6%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QA  331
             ++ +G+    R  ED+AF VA F  +K GS  NYYMYHGGTNFGRT+    IT+ YD  A
Sbjct  265   FKTFGASDPHRPPEDVAFSVARFF-QKGGSLQNYYMYHGGTNFGRTSGGPFITTSYDYDA  323

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             P+DEYG+ R PKW HLKELH +IK+C  +LL+  P++ SL   Q+A V+  DSSGACAAF
Sbjct  324   PIDEYGIARCPKWGHLKELHRSIKLCEHVLLNGEPTSLSLGPLQEADVYE-DSSGACAAF  382

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             + N D K+   V F N+SY LP  S+SILPDCK+V FNTAKV +Q++   M P     ST
Sbjct  383   IANMDDKNDKTVVFLNTSYYLPAWSVSILPDCKSVVFNTAKVGSQTSVVEMIPIDLLPST  442

Query  692   eeweefeeLVVG---------FDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP-  841
                 +  + +           + D +   + L+DHINTTKD +DYLWYT SL  + ++  
Sbjct  443   TSPSKDLKGLQWNVFKEKAGIWGDADFTKNGLVDHINTTKDTTDYLWYTTSLLVDETEEF  502

Query  842   -----KSAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSAT  1006
                     + VES GH +H+F+N +L  SA G    S F  +S +SL  G N I+LLS T
Sbjct  503   FRNGTNPVLVVESKGHAMHVFINQKLQASASGNGTVSPFKFKSPISLKAGKNEIALLSMT  562

Query  1007  VGLPNSGAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQ  1183
             VGL N+GA+ E    GP  V I     G+ DLSN +W Y++GL GE+L+IY     N+V 
Sbjct  563   VGLQNAGAFYEWVGAGPTSVRILGMKRGTVDLSNSTWTYKIGLQGEHLRIYDTDSLNSVN  622

Query  1184  W---REFSSSQPLIWYK  1225
             W    E    QPL WYK
Sbjct  623   WVSTSEPPKHQPLTWYK  639


 Score = 87.0 bits (214),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 59/108 (55%), Gaps = 22/108 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYW---VSYH-----------------  1590
             + V D P G DP+ L++  MGKG AW+NG  IGRYW    S H                 
Sbjct  639   KAVVDSPPGQDPVGLDMIHMGKGLAWLNGNEIGRYWSRKASKHEKCVQQCDYRGKFIPNK  698

Query  1591  --TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
               T  G P+Q WY+VPRS+ KP+GN LV+FEE+ GNP  I   K  ++
Sbjct  699   CNTGCGEPTQRWYHVPRSWFKPSGNTLVIFEEKGGNPTKIHFSKRKVS  746



>ref|XP_010106660.1| Beta-galactosidase 1 [Morus notabilis]
 gb|EXC11109.1| Beta-galactosidase 1 [Morus notabilis]
Length=845

 Score =   312 bits (800),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 174/371 (47%), Positives = 229/371 (62%), Gaps = 19/371 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             Y  +G     R AED+AF VA FI +K G++INYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  263   YTEFGGPVPKRPAEDLAFAVARFI-QKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDA  321

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDEYGLLR+PKW HLK+LH AIK+C   L+S  P+   L  ++QA+VF+   SGACAAF
Sbjct  322   PLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVTQLGNYEQAHVFK-SKSGACAAF  380

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N +    AKV F N  Y LPP SISILPDC+   +NTA+V  QS+T  M   +     
Sbjct  381   LANYNPNSFAKVSFGNMHYNLPPWSISILPDCENTVYNTARVGAQSSTMKMT-RVPIHGG  439

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD------PKSAI  853
               W+ + E    +++T+     LL+ INTT+D SDYLWY   ++ + S+          +
Sbjct  440   LSWQAYNEQTASYEETSFTVSGLLEQINTTRDASDYLWYMTDVKIDPSEEFLRSGKYPVL  499

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             +V S GH LH+FVNG+LAG+++G+      TL   V+L  G+N I+LLS  VGLPN G +
Sbjct  500   TVSSAGHALHVFVNGQLAGTSYGSLEFPKLTLSKGVNLRAGINTIALLSIAVGLPNVGPH  559

Query  1034  LE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS-  1198
              E      LGP  VT+   +EG  DLS   W Y+VGL GE L +++  GS++V W + S 
Sbjct  560   FETWNAGVLGP--VTLNGLNEGRRDLSWQKWSYKVGLRGEALSLHSLTGSSSVDWIQGSL  617

Query  1199  --SSQPLIWYK  1225
                 QPL W+K
Sbjct  618   VARKQPLTWFK  628


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 69/112 (62%), Gaps = 21/112 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYH--------------------  1590
             +T FD P G  PLAL++GSMGKG+ W+NGQS+GRYW +Y                     
Sbjct  628   KTSFDAPAGYAPLALDMGSMGKGQIWINGQSLGRYWPAYKAQGSCGGCDYAGTYNEKKCL  687

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSI-TLDKDI  1743
             +  G  SQ WY+VP+S+LKPTGNLLV+FEE  G+P G+ L +  + T+  DI
Sbjct  688   SNCGDASQRWYHVPKSWLKPTGNLLVVFEEWGGDPNGVFLVRRDVDTVCADI  739



>gb|AHG94611.1| beta-galactosidase [Camellia sinensis]
Length=843

 Score =   312 bits (800),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 179/368 (49%), Positives = 233/368 (63%), Gaps = 19/368 (5%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQAPLD  340
             +G     R AED+AF VA FI +K GS+INYYMYHGGTNFGRT+   F+ TSY   APLD
Sbjct  264   FGGAVPYRPAEDLAFSVARFI-QKGGSFINYYMYHGGTNFGRTSGGPFIATSYDYDAPLD  322

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             EYGLLR+PKW HLK+LH AIK+C   L+S  P+ FSL   Q+AYVF+   SGACAAFL N
Sbjct  323   EYGLLRQPKWGHLKDLHRAIKLCEPALVSGDPTVFSLGNNQEAYVFK-TKSGACAAFLTN  381

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeew  700
             +D K  AKV F N  Y LPP SISILPDCK   +NTA+V  QS    M PA+ +     W
Sbjct  382   HDSKSFAKVSFANLHYNLPPWSISILPDCKNTVYNTARVGAQSAQMKMIPAV-YGIGFSW  440

Query  701   eefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPKSAISVE  862
             + F E    ++D +     LL+ INTT+D+SDYLWY   ++ +       S     ++V 
Sbjct  441   QSFNEEPASYNDNSFTTAGLLEQINTTRDMSDYLWYMTDVKIDPYEGFLKSGNYPVLTVL  500

Query  863   SLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE-  1039
             S GH LH+F+NG+L+G+A+G+  +   T    V+L  G+N I+LLS  VGLPN G + E 
Sbjct  501   SAGHALHVFINGQLSGTAYGSLEDPRLTFNQGVNLRAGVNTIALLSIAVGLPNVGPHFET  560

Query  1040  --HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS---S  1201
                  LGP  V++   +EGS DLS   W Y++GL GE L +++  GS++V+W + S    
Sbjct  561   WNAGVLGP--VSLNGLNEGSRDLSWQKWTYKIGLKGEALSLHSLSGSSSVEWAQGSFVAQ  618

Query  1202  SQPLIWYK  1225
              QPL WYK
Sbjct  619   KQPLTWYK  626


 Score =   100 bits (248),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 68/113 (60%), Gaps = 21/113 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTV------------------  1596
             +T F+ P GN+PLAL++ +MGKG  W+NG+SIGRYW  Y                     
Sbjct  626   KTAFNAPVGNEPLALDMNTMGKGNVWINGKSIGRYWPGYKATGSCSACNYAGWFYEKKCL  685

Query  1597  --AGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSI-TLDKDIL  1746
                G  SQ WY+VPRS+L PTGNLLV+FEE  GNPYGI+L K  + ++  DI 
Sbjct  686   SNCGEASQRWYHVPRSWLYPTGNLLVVFEEWGGNPYGISLVKRQVGSVCADIF  738



>ref|XP_003607189.1| Beta-galactosidase [Medicago truncatula]
 gb|AES89386.1| beta-galactosidase-like protein [Medicago truncatula]
Length=825

 Score =   312 bits (799),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 162/365 (44%), Positives = 229/365 (63%), Gaps = 10/365 (3%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F + K+GS +NYYMYHGGTNFGRT ++F  T YYD+AP
Sbjct  261   YRVFGDPPSQRSAEDIAFSVARFFS-KHGSLVNYYMYHGGTNFGRTTSAFTTTRYYDEAP  319

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDE+GL REPKWSHL++ H A+ +C + LL+  P+T  ++Q+ +  V+    S  CAAF+
Sbjct  320   LDEFGLQREPKWSHLRDAHKAVNLCKKSLLNGVPTTQKISQYHEVIVYEKKESNLCAAFI  379

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              NN  + +  + F+ S Y LPP+SISILPDCKTV FNT  + +Q ++R  + + K  +  
Sbjct  380   TNNHTQTAKTLSFRGSDYFLPPRSISILPDCKTVVFNTQNIASQHSSRHFEKS-KTGNDF  438

Query  695   eweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQ------QESSDPKSAIS  856
             +WE F E +    +   +     +  +  KD +DY WYT S++       + SD    + 
Sbjct  439   KWEVFSEPIPSAKELPSKQKLPAELYSLLKDKTDYGWYTTSVELGPEDIPKKSDVAPVLR  498

Query  857   VESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYL  1036
             + SLGH L  FVNGE  GS HG+     F  +  V+   G+N I++L+  VGLP+SGAY+
Sbjct  499   ILSLGHSLQAFVNGEYIGSKHGSHEEKGFEFQKPVNFKVGVNQIAILANLVGLPDSGAYM  558

Query  1037  EHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPL  1213
             EH+  GP+ +TI     G+ DL+++ WG+QVGL GEN  I+TEKGS  V+W++       
Sbjct  559   EHRYAGPKTITILGLMSGTIDLTSNGWGHQVGLQGENDSIFTEKGSKKVEWKDGKGKGST  618

Query  1214  I-WYK  1225
             I WYK
Sbjct  619   ISWYK  623


 Score = 99.0 bits (245),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 68/94 (72%), Gaps = 6/94 (6%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKP  1650
             +T FD PEG +P+A+ +  M KG  WVNG+SIGR+W+SY +  G P+Q+ Y++PRSFLKP
Sbjct  623   KTNFDTPEGTNPVAIGMEGMAKGMIWVNGESIGRHWMSYLSPLGKPTQSEYHIPRSFLKP  682

Query  1651  TGNLLVLFEEEYGNPYGITLDKVSI-TLDKDILL  1749
               NLLV+FEEE      I+ DK++I T+++D + 
Sbjct  683   KDNLLVIFEEE-----AISPDKIAILTVNRDTIC  711



>gb|ADO34791.1| beta-galactosidase STBG6 [Solanum lycopersicum]
Length=845

 Score =   312 bits (800),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 173/369 (47%), Positives = 226/369 (61%), Gaps = 20/369 (5%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QAPLD  340
             +G     R  +D+AF VA FI R  GS++NYYMYHGGTNFGRTA    IT+ YD  AP+D
Sbjct  262   FGGPLHQRPVQDLAFAVAQFIQR-GGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPID  320

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             EYGL+R+PK+ HLKELH A+KMC + ++SA P+  SL   QQAYV+  + +G CAAFL N
Sbjct  321   EYGLIRQPKYGHLKELHRAVKMCEKSIVSADPAITSLGNLQQAYVYSSE-TGGCAAFLSN  379

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeew  700
             ND K +A+V F N  Y LPP SISILPDC+ V FNTAKV  Q++   M P    +     
Sbjct  380   NDWKSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPT-NSEMLSWE  438

Query  701   eefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD------PKSAISVE  862
                E++    D ++IR+  LL+ IN T+D SDYLWY  S+   S++          + VE
Sbjct  439   TYSEDISALDDSSSIRSFGLLEQINVTRDTSDYLWYITSVDIGSTESFLHGGELPTLIVE  498

Query  863   SLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE-  1039
             + GH +H+F+NG+L+GSA GT +N  F  +  V+L  G N I+LLS  VGLPN G + E 
Sbjct  499   TTGHAMHVFINGQLSGSAFGTRKNRRFVFKGKVNLRAGSNRIALLSVAVGLPNIGGHFET  558

Query  1040  --HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS----  1198
                  LGP  V I+    G  DLS   W YQVGL GE + + +  G +AV W + S    
Sbjct  559   WSTGVLGP--VAIQGLDHGKWDLSWAKWTYQVGLKGEAMNLVSTNGISAVDWMQGSLIAQ  616

Query  1199  SSQPLIWYK  1225
               QPL W+K
Sbjct  617   KQQPLTWHK  625


 Score =   103 bits (258),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 68/105 (65%), Gaps = 19/105 (18%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHT-------------------  1593
             +  F+ PEG++PLAL++ SMGKG+ W+NGQSIGRYW +Y T                   
Sbjct  625   KAYFNTPEGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCQYSGVFRPPKCQL  684

Query  1594  VAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
               G P+Q WY+VPRS+LKPT NLLVLFEE  G+P  I+L K S+T
Sbjct  685   GCGEPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVT  729



>ref|XP_007012844.1| Beta-galactosidase [Theobroma cacao]
 gb|EOY30463.1| Beta-galactosidase [Theobroma cacao]
Length=847

 Score =   312 bits (800),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 177/369 (48%), Positives = 229/369 (62%), Gaps = 22/369 (6%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQAPLD  340
             +G     R AEDIAF VA FI +  GS++NYYMYHGGTNFGRTA   F+ TSY   AP+D
Sbjct  272   FGGAVPTRPAEDIAFSVARFI-QNGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPID  330

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             EYGL REPKW HL++LH AIK+    L+SA P+  SL   Q+A+VF+   SGACAAFL N
Sbjct  331   EYGLPREPKWGHLRDLHKAIKLSEPALVSADPTVTSLGSNQEAHVFKA-KSGACAAFLAN  389

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeew  700
              D K+S KV F N  Y LP  SISILPDCKT  FNTA++  QS+ + M P    +S   W
Sbjct  390   YDTKYSVKVTFGNVQYDLPAWSISILPDCKTAVFNTARLGAQSSQKKMVPV---NSAFSW  446

Query  701   eefeeLVVGFDDTNIRA-DTLLDHINTTKDVSDYLWYTLSLQQE------SSDPKSAISV  859
             + + E     DD +    D LL+ I  T+D SDYLWY   +Q +      +S    ++++
Sbjct  447   QSYNEESPSADDQDATVKDGLLEQIYVTRDASDYLWYMTDVQIDPNEGFLTSGQDPSLTI  506

Query  860   ESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE  1039
              S GH LH+F+NG+L+G+A+G   N   T    V L  G+N ISLLS  VGLPN G + E
Sbjct  507   WSAGHALHVFINGQLSGTAYGELDNPKLTFSKNVKLRAGINKISLLSIAVGLPNVGVHFE  566

Query  1040  ---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS---  1198
                   LGP  VT++  +EGS DLS   W Y++GL GE L ++T  GS++V+W + S   
Sbjct  567   TWNAGVLGP--VTLKGLNEGSRDLSKQKWSYKIGLKGEALSLHTVTGSSSVEWVKGSLLV  624

Query  1199  SSQPLIWYK  1225
               QP+ WYK
Sbjct  625   KKQPMTWYK  633


 Score =   103 bits (258),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 71/113 (63%), Gaps = 20/113 (18%)
 Frame = +1

Query  1438  LLIKLKVETT*QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY----------  1587
             LL+K +  T  +T F+ P GN+PLAL++ SMGKG+ W+NGQSIGR+W  Y          
Sbjct  622   LLVKKQPMTWYKTTFNAPGGNEPLALDMSSMGKGQIWINGQSIGRHWPGYIARGACGACD  681

Query  1588  ----------HTVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDK  1716
                        T  G PSQ WY+VPRS+L P+GNL+V+FEE  G+P GI+L K
Sbjct  682   YAGTYSDKKCRTNCGEPSQRWYHVPRSWLNPSGNLMVVFEEWGGDPSGISLVK  734



>ref|XP_011022866.1| PREDICTED: beta-galactosidase 10 [Populus euphratica]
Length=841

 Score =   312 bits (799),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 177/374 (47%), Positives = 228/374 (61%), Gaps = 21/374 (6%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QA  331
             +Q +G+    R AED+AF VA F  +K GS  NYYMYHGGTNFGRTA    IT+ YD +A
Sbjct  253   FQTFGAPNPHRPAEDVAFSVARFF-QKGGSVQNYYMYHGGTNFGRTAGGPFITTSYDYEA  311

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             P+DEYGL R PKW HLKELH AIK+C  +LL++ P   SL   Q+A ++  D+SG C AF
Sbjct  312   PIDEYGLPRLPKWGHLKELHKAIKLCEHVLLNSKPVNLSLGPSQEAEIYS-DASGGCVAF  370

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQP---ALKF  682
             L N D K+   V+FQN SY+LP  S+SILPDCK V +NTAKVT+Q+    M P     K 
Sbjct  371   LANIDDKNDKTVEFQNVSYKLPAWSVSILPDCKNVVYNTAKVTSQTALVEMVPDNLQQKD  430

Query  683   DSTeeweefeeLVVG-FDDTNIRADTLLDHINTTKDVSDYLWYTLSLQ--------QESS  835
             DS     E      G + + +   +  +DHINTTKD +DYLWYT S+         +E  
Sbjct  431   DSKALKWEVFMEKAGIWGEPDFMKNGFVDHINTTKDTTDYLWYTTSIVVGENEEFLKEGR  490

Query  836   DPKSAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGL  1015
              P   + +ES+GH LH FVN EL GSA G   +S F  ++ +SL  G N I+LLS TVGL
Sbjct  491   HP--VLLIESMGHALHAFVNQELQGSASGNGSHSPFKFKNPISLKAGKNEIALLSMTVGL  548

Query  1016  PNSGAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQW--  1186
              N+G++ E    G   V I+  + G+ DLS+ +W Y++GL GE L IY  +  N+V W  
Sbjct  549   QNAGSFYEWVGAGLTSVMIKGFNNGTVDLSHFNWIYKIGLQGEKLGIYKPEEVNSVSWVA  608

Query  1187  -REFSSSQPLIWYK  1225
               E    QPL WYK
Sbjct  609   TSEPPKKQPLTWYK  622


 Score = 89.0 bits (219),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 62/108 (57%), Gaps = 22/108 (20%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTV------------------  1596
             + V D P GN+P+ L++  MGKG AW+NG+ IGRYW    +V                  
Sbjct  622   KVVLDPPAGNEPVGLDMLHMGKGLAWLNGEEIGRYWPRKSSVHEKCVTECDYRGKFMPDK  681

Query  1597  ----AGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
                  G P+Q WY+VPRS+ KP+GNLLV+FEE+ G+P  IT  +  ++
Sbjct  682   CFTGCGQPTQRWYHVPRSWFKPSGNLLVIFEEKGGDPEKITFSRRKMS  729



>ref|NP_001234317.1| TBG6 protein precursor [Solanum lycopersicum]
 gb|AAF70825.1|AF154424_1 putative beta-galactosidase [Solanum lycopersicum]
Length=845

 Score =   312 bits (800),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 175/374 (47%), Positives = 229/374 (61%), Gaps = 30/374 (8%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QAPLD  340
             +G     R  +D+AF VA FI R  GS++NYYMYHGGTNFGRTA    IT+ YD  AP+D
Sbjct  262   FGGPLHQRPVQDLAFAVAQFIQR-GGSFVNYYMYHGGTNFGRTAGGPFITTSYDYDAPID  320

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             EYGL+R+PK+ HLKELH A+KMC + ++SA P+  SL   QQAYV+  + +G CAAFL N
Sbjct  321   EYGLIRQPKYGHLKELHRAVKMCEKSIVSADPAITSLGNLQQAYVYSSE-TGGCAAFLSN  379

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPA----LKFDS  688
             ND K +A+V F N  Y LPP SISILPDC+ V FNTAKV  Q++   M P     L +++
Sbjct  380   NDWKSAARVMFNNMHYNLPPWSISILPDCRNVVFNTAKVGVQTSKMEMLPTNSEMLSWET  439

Query  689   TeeweefeeLVVGFDD-TNIRADTLLDHINTTKDVSDYLWYTLSLQQESSD------PKS  847
               E       +   DD ++IR+  LL+ IN T+D SDYLWY  S+   S++         
Sbjct  440   YSED------ISALDDSSSIRSFGLLEQINVTRDTSDYLWYITSVDIGSTESFLHGGELP  493

Query  848   AISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSG  1027
              + VE+ GH +H+F+NG+L+GSA GT +N  F  +  V+L  G N I+LLS  VGLPN G
Sbjct  494   TLIVETTGHAMHVFINGQLSGSAFGTRKNRRFVFKGKVNLRAGSNRIALLSVAVGLPNIG  553

Query  1028  AYLE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREF  1195
              + E      LGP  V I+    G  DLS   W YQVGL GE + + +  G +AV W + 
Sbjct  554   GHFETWSTGVLGP--VAIQGLDHGKWDLSWAKWTYQVGLKGEAMNLVSTNGISAVDWMQG  611

Query  1196  S----SSQPLIWYK  1225
             S      QPL W+K
Sbjct  612   SLIAQKQQPLTWHK  625


 Score =   103 bits (258),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 68/105 (65%), Gaps = 19/105 (18%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHT-------------------  1593
             +  F+ PEG++PLAL++ SMGKG+ W+NGQSIGRYW +Y T                   
Sbjct  625   KAYFNTPEGDEPLALDMSSMGKGQVWINGQSIGRYWTAYATGDCNGCQYSGVFRPPKCQL  684

Query  1594  VAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
               G P+Q WY+VPRS+LKPT NLLVLFEE  G+P  I+L K S+T
Sbjct  685   GCGEPTQKWYHVPRSWLKPTQNLLVLFEELGGDPTRISLVKRSVT  729



>ref|XP_002305449.1| beta-galactosidase family protein [Populus trichocarpa]
 gb|EEE85960.1| beta-galactosidase family protein [Populus trichocarpa]
Length=731

 Score =   310 bits (793),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 176/373 (47%), Positives = 226/373 (61%), Gaps = 28/373 (8%)
 Frame = +2

Query  164   YGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYD-QAPLD  340
             +G     R AED+AF VA FI +K GS +NYYMYHGGTNFGRT+    IT+ YD  AP+D
Sbjct  262   FGGPNHQRPAEDLAFAVARFI-QKGGSLVNYYMYHGGTNFGRTSGGPFITTSYDYDAPID  320

Query  341   EYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLIN  520
             EYGL+R+PK+ HLKELH AIK+C + LL+A  +  SL  ++QA+VF  D SG CAAFL N
Sbjct  321   EYGLIRQPKYGHLKELHKAIKLCEKALLAADSTVTSLGSYEQAHVFSSD-SGGCAAFLSN  379

Query  521   NDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPA----LKFDS  688
              + K +A+V+F N  Y LPP SISILPDCK V FNTA V  Q++   M P     L +++
Sbjct  380   YNTKQAARVKFNNIQYSLPPWSISILPDCKNVVFNTAHVGVQTSQVHMLPTDSELLSWET  439

Query  689   TeeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP------KSA  850
               E     +     DD  I    LL+ +N T+D SDYLWYT S+   SS+          
Sbjct  440   FNEDISSVD-----DDKMITVAGLLEQLNITRDTSDYLWYTTSVHISSSESFLRGGRLPV  494

Query  851   ISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGA  1030
             ++V+S GH LH+F+NGEL+GSAHGT     FT    +  + G N ISLLS  VGLPN+G 
Sbjct  495   LTVQSAGHALHVFINGELSGSAHGTREQRRFTFTEDMKFHAGKNRISLLSVAVGLPNNGP  554

Query  1031  YLE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS  1198
               E      LGP  VT+    EG  DL+   W Y+VGL GE++ + + K  + V W + S
Sbjct  555   RFETWNTGILGP--VTLHGLDEGQRDLTWQKWSYKVGLKGEDMNLRSRKSVSLVDWIQGS  612

Query  1199  ----SSQPLIWYK  1225
                   QPL WYK
Sbjct  613   LMVGKQQPLTWYK  625


 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 63/105 (60%), Gaps = 19/105 (18%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY-------------------HT  1593
             +  F+ P+G+DPLAL++GSMGKG+ W+NG SIGRYW  Y                     
Sbjct  625   KAYFNSPKGDDPLALDMGSMGKGQVWINGHSIGRYWTLYAEGNCSGCSYSATFRPARCQL  684

Query  1594  VAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSIT  1728
               G P+Q WY+VPRS+LK T NLLVLFEE  G+   I+L K  +T
Sbjct  685   GCGQPTQKWYHVPRSWLKSTRNLLVLFEEIGGDASRISLVKRLVT  729



>gb|AAQ21370.1| beta-galactosidase [Sandersonia aurantiaca]
Length=568

 Score =   305 bits (781),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 169/358 (47%), Positives = 222/358 (62%), Gaps = 19/358 (5%)
 Frame = +2

Query  185   RSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQAPLDEYGLLRE  361
             R AEDIAF VA FI +K GS++NYYMYHGGTNFGRTA   F+ TSY   AP+DEYGLLRE
Sbjct  3     RPAEDIAFAVARFI-QKGGSFVNYYMYHGGTNFGRTAGGPFIATSYDYDAPIDEYGLLRE  61

Query  362   PKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFLINNDGKHSA  541
             PKW HL++LH AIK+C   L+S  P+  S+  +QQ++VFR   +GACAAFL N D    A
Sbjct  62    PKWGHLRDLHRAIKLCEPALVSGDPTVTSIGHYQQSHVFR-SKAGACAAFLSNYDSGSYA  120

Query  542   KVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTeeweefeeLV  721
             +V F    Y +PP SISILPDCKT  FNTA++  Q++   M+ A KF      E+     
Sbjct  121   RVVFNGIHYDIPPWSISILPDCKTTVFNTARIGAQTSQLKMEWAGKFSWESYNEDTNS--  178

Query  722   VGFDDTNIRADTLLDHINTTKDVSDYLWYT--LSLQQESSDPKSA----ISVESLGHVLH  883
               FDD +     L++ I+ T+D +DYLWYT  +++ +     K+     ++V S GH +H
Sbjct  179   --FDDRSFTKVGLVEQISMTRDNTDYLWYTTYVNIGENEGFLKNGHYPVLTVNSAGHSMH  236

Query  884   IFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAYLE---HKTLG  1054
             I++NG+L G+ +G   N   T   +V L  G N IS+LS  VGLPN G + E      LG
Sbjct  237   IYINGQLTGTIYGALENPKLTYTGSVKLWAGSNKISILSVAVGLPNIGGHFETWNTGVLG  296

Query  1055  PRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSSSQPLIWYK  1225
             P  VT+   +EG  DLS   W YQ+GL GE L ++T  GS++V+W   S  Q L WYK
Sbjct  297   P--VTLSGLNEGKRDLSWQKWIYQIGLKGEALNLHTLSGSSSVEWGGPSQKQSLTWYK  352


 Score =   100 bits (250),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 67/105 (64%), Gaps = 20/105 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSY--------------------H  1590
             +T F+ P GNDPLAL++GSMGKG+ W+NGQS+GRYW +Y                     
Sbjct  352   KTSFNAPAGNDPLALDMGSMGKGQVWINGQSVGRYWPAYKASGSCGGCDYRGTYNEKKCQ  411

Query  1591  TVAGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSI  1725
             +  G  +Q WY+VPRS+L PTGNLLV+FEE  G+P GI++ +  +
Sbjct  412   SNCGESTQRWYHVPRSWLNPTGNLLVVFEEWGGDPSGISMVRRKV  456



>ref|XP_008663872.1| PREDICTED: uncharacterized protein LOC100194296 isoform X1 [Zea 
mays]
 gb|ACL54349.1| unknown [Zea mays]
 tpg|DAA48743.1| TPA: beta-galactosidase [Zea mays]
Length=850

 Score =   312 bits (799),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 226/369 (61%), Gaps = 15/369 (4%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAASFMITSYYDQAP  334
             Y+V+G     RSAEDIAF VA F +   G+  NYYMYHGGTNFGRT+A+F++  YYD+AP
Sbjct  276   YRVFGDPPSQRSAEDIAFAVARFFS-VGGTLANYYMYHGGTNFGRTSAAFVMPKYYDEAP  334

Query  335   LDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAFL  514
             LDE+GL +EPKW HL++LH A+K+C + LL  TPST  L +  +A VF       C AFL
Sbjct  335   LDEFGLYKEPKWGHLRDLHQALKLCKKALLWGTPSTEKLGKQLEARVFEMPEQKVCVAFL  394

Query  515   INNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDSTe  694
              N++ K  A + F+   Y +P  SIS+L DC+TV F T  V  Q N RT   A   D T 
Sbjct  395   SNHNTKDDATMTFRGRPYFVPRHSISVLADCETVVFGTQHVNAQHNQRTFHFA---DQTA  451

Query  695   eweefeeL----VVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPK  844
             +   +E      V  +    IR     D  N TKD +DY+WYT S + E+      SD K
Sbjct  452   QNNVWEMFDGENVPKYKQAKIRLRKAGDLYNLTKDKTDYVWYTSSFKLEADDMPIRSDIK  511

Query  845   SAISVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNS  1024
             + + V S GH    FVN +  G  HGT  N +FTLE  + L KG+N++++L++++G+ +S
Sbjct  512   TVLEVNSHGHASVAFVNNKFVGCGHGTKMNKAFTLEKPMDLKKGVNHVAVLASSMGMTDS  571

Query  1025  GAYLEHKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFSS  1201
             GAY+EH+  G  +V I   + G+ DL+N+ WG+ VGL+GE  QIYT+KG  +V W+   +
Sbjct  572   GAYMEHRLAGVDRVQITGLNAGTLDLTNNGWGHIVGLVGERKQIYTDKGMGSVTWKPAMN  631

Query  1202  SQPLIWYKE  1228
              +PL WYK 
Sbjct  632   DRPLTWYKR  640


 Score =   101 bits (251),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 60/87 (69%), Gaps = 4/87 (5%)
 Frame = +1

Query  1480  FDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTVAGTPSQTWYNVPRSFLKPTGN  1659
             FD P G DP+ L++ +MGKG  +VNGQ IGRYW+SY    G PSQ  Y+VPRSFL+   N
Sbjct  642   FDMPSGEDPVVLDMSTMGKGMMFVNGQGIGRYWISYKHALGRPSQQLYHVPRSFLRQKDN  701

Query  1660  LLVLFEEEYGNPYGITLDKVSITLDKD  1740
             +LVLFEEE+G P  I +    +T+ +D
Sbjct  702   MLVLFEEEFGRPDAIMI----LTVKRD  724



>ref|XP_010033786.1| PREDICTED: beta-galactosidase 1-like [Eucalyptus grandis]
 gb|KCW53599.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
 gb|KCW53600.1| hypothetical protein EUGRSUZ_J02867 [Eucalyptus grandis]
Length=844

 Score =   312 bits (799),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 175/371 (47%), Positives = 222/371 (60%), Gaps = 19/371 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             Y  +G     R  ED+AF VA FI +K G++INYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  262   YTEFGGPVPNRPVEDLAFSVARFI-KKGGAFINYYMYHGGTNFGRTAGGPFIATSYDYDA  320

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDEYGLLR+PKW HLK+LH AIK+C   L+S  P+   L  +++A+VFR   SGACAAF
Sbjct  321   PLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGNPTVTKLGNYEEAHVFR-SKSGACAAF  379

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N      AKV + N  Y LPP SISILPDCK   +NTA+V  QS    M P +     
Sbjct  380   LSNYHSNAFAKVSWGNMHYNLPPWSISILPDCKNTVYNTARVGAQSARMKMTP-VPIHGG  438

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQES------SDPKSAI  853
               W+ + E   G++D +     LL+ INTT+DVSDYLWY   +   S      S     +
Sbjct  439   FSWQAYNEEPAGYEDNSFTMAGLLEQINTTRDVSDYLWYITDVYINSKEGFLRSGKYPTL  498

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             +V+S GH LH+FVNG+ +G+A+G+      T    V L  G N I+LLS  VGLPN G +
Sbjct  499   TVQSAGHALHVFVNGQASGTAYGSLEFPKLTFNQGVKLRAGSNRIALLSIAVGLPNVGPH  558

Query  1034  LEH---KTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS-  1198
              E      LGP  VT+    EG  DLS   W Y+VGL GE L +++  GS++V+W E S 
Sbjct  559   FERWNAGVLGP--VTLYGLDEGKRDLSRQKWSYKVGLKGEALNLHSLTGSSSVEWAEGSL  616

Query  1199  --SSQPLIWYK  1225
                 QPL W+K
Sbjct  617   VARKQPLTWFK  627


 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 67/112 (60%), Gaps = 21/112 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTV------------------  1596
             +T F  P GN PLAL++ SMGKG+ W+NGQSIGRYW +Y                     
Sbjct  627   KTTFSAPAGNTPLALDMNSMGKGQIWINGQSIGRYWPAYKASGTCGGCNYAGTYGEKKCL  686

Query  1597  --AGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSI-TLDKDI  1743
                G  SQ WY+VPRS+L PTGNLLV+FEE  G+P GI+L +  + ++  DI
Sbjct  687   SNCGEASQRWYHVPRSWLNPTGNLLVVFEEWGGDPNGISLVRRDVDSVCADI  738



>ref|XP_006426535.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
 gb|ESR39775.1| hypothetical protein CICLE_v10024886mg [Citrus clementina]
Length=845

 Score =   312 bits (799),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 173/371 (47%), Positives = 226/371 (61%), Gaps = 20/371 (5%)
 Frame = +2

Query  155   YQVYGSDALMRSAEDIAFHVALFIARKNGSYINYYMYHGGTNFGRTAAS-FMITSYYDQA  331
             Y  +G     R  ED+AF VA FI +K GS+INYYMYHGGTNFGRTA   F+ TSY   A
Sbjct  264   YTEFGGPVPHRPVEDLAFSVAKFI-QKGGSFINYYMYHGGTNFGRTAGGPFIATSYDYDA  322

Query  332   PLDEYGLLREPKWSHLKELHAAIKMCSQILLSATPSTFSLAQFQQAYVFRGDSSGACAAF  511
             PLDEYGLLR+PKW HLK+LH AIK+C   L+S  P+   L  +Q+A+VF+  S  ACAAF
Sbjct  323   PLDEYGLLRQPKWGHLKDLHRAIKLCEPALVSGNPTVMPLGNYQEAHVFK--SKSACAAF  380

Query  512   LINNDGKHSAKVQFQNSSYQLPPKSISILPDCKTVAFNTAKVTTQSNTRTMQPALKFDST  691
             L N + +  AKV F N  Y LPP SISILPDCK   +NTA+V  QS    M P +     
Sbjct  381   LANYNQRTFAKVAFGNQHYNLPPWSISILPDCKNTVYNTARVGHQSTQMKMTP-VPIHGG  439

Query  692   eeweefeeLVVGFDDTNIRADTLLDHINTTKDVSDYLWYTLSLQQESSDP------KSAI  853
               W+ F E+   + D++     LL+ INTT+D +DYLWY   ++ + S+          +
Sbjct  440   FSWQAFNEVPSAYGDSSFTMSGLLEQINTTRDATDYLWYMTDVKIDPSEGFLRSGNYPVL  499

Query  854   SVESLGHVLHIFVNGELAGSAHGTFRNSSFTLESTVSLNKGMNNISLLSATVGLPNSGAY  1033
             +V S GH LH+FVNG+LAG+A+G+      T    V++  G+N I+LLS  VGLPN G +
Sbjct  500   TVMSAGHALHVFVNGQLAGTAYGSLEFPKLTFTEGVNMRAGINKIALLSIAVGLPNVGPH  559

Query  1034  LE---HKTLGPRKVTIES-SEGSEDLSNDSWGYQVGLLGENLQIYTEKGSNAVQWREFS-  1198
              E      LGP  VT+   +EG  DLS   W Y+VGL GE L +++  G ++V+W E S 
Sbjct  560   FETWNAGVLGP--VTLNGLNEGRRDLSWQKWTYKVGLEGEKLNLHSLSGGSSVEWAEGSL  617

Query  1199  --SSQPLIWYK  1225
                 QPL WY+
Sbjct  618   VAQRQPLTWYR  628


 Score =   102 bits (253),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 20/105 (19%)
 Frame = +1

Query  1471  QTVFDEPEGNDPLALNLGSMGKGEAWVNGQSIGRYWVSYHTV------------------  1596
             +T F  P GN PLAL++GSMGKG+ WVNGQSIGR+W +Y                     
Sbjct  628   RTTFSAPAGNAPLALDMGSMGKGQVWVNGQSIGRHWPAYKASGSCGYCSYTGTYTEKKCL  687

Query  1597  --AGTPSQTWYNVPRSFLKPTGNLLVLFEEEYGNPYGITLDKVSI  1725
                G  SQ WY+VPRS+LKPTGNLLV+FEE  GNP GI+L +  I
Sbjct  688   SNCGEASQRWYHVPRSWLKPTGNLLVVFEEWGGNPNGISLVRREI  732



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6068496228312