BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25453_g1_i1 len=844 path=[687:0-26 714:27-63 751:64-104 792:105-227
4767:228-233 4773:234-234 2520:235-239 927:240-275 4797:276-281
969:282-287 975:288-294 982:295-309 4812:310-323 4826:324-335
1023:336-369 1057:370-395 1083:396-444 1132:445-483 1171:484-588
112:589-622 146:623-746 270:747-843]

Length=844
                                                                      Score     E

ref|XP_004250402.1|  PREDICTED: lignin-forming anionic peroxidase       391   9e-133   
ref|XP_009608056.1|  PREDICTED: lignin-forming anionic peroxidase       390   2e-132   
ref|XP_006351920.1|  PREDICTED: lignin-forming anionic peroxidase...    389   6e-132   
ref|XP_009801852.1|  PREDICTED: lignin-forming anionic peroxidase...    389   7e-132   
ref|XP_009620122.1|  PREDICTED: lignin-forming anionic peroxidase...    388   2e-131   
ref|NP_001289531.1|  lignin-forming anionic peroxidase precursor        387   2e-131   
ref|XP_006361366.1|  PREDICTED: lignin-forming anionic peroxidase...    384   3e-130   
ref|XP_006351919.1|  PREDICTED: lignin-forming anionic peroxidase...    382   2e-129   
ref|XP_011070595.1|  PREDICTED: lignin-forming anionic peroxidase...    377   2e-127   
gb|ABF48527.1|  cell wall peroxidase                                    377   2e-127   Capsicum annuum
ref|XP_011070596.1|  PREDICTED: lignin-forming anionic peroxidase...    375   2e-126   
ref|XP_011070600.1|  PREDICTED: lignin-forming anionic peroxidase...    365   6e-123   
ref|XP_009605441.1|  PREDICTED: lignin-forming anionic peroxidase...    359   4e-122   
ref|XP_011070599.1|  PREDICTED: lignin-forming anionic peroxidase...    363   8e-122   
emb|CDP08160.1|  unnamed protein product                                360   1e-120   
ref|XP_011070597.1|  PREDICTED: lignin-forming anionic peroxidase...    358   8e-120   
emb|CDP16309.1|  unnamed protein product                                357   1e-119   
ref|XP_011070598.1|  PREDICTED: lignin-forming anionic peroxidase...    357   1e-119   
ref|XP_007045348.1|  Lignin-forming anionic peroxidase                  345   7e-115   
ref|XP_004140450.1|  PREDICTED: lignin-forming anionic peroxidase...    345   1e-114   
ref|XP_008460239.1|  PREDICTED: lignin-forming anionic peroxidase...    344   2e-114   
ref|XP_002521867.1|  Lignin-forming anionic peroxidase precursor,...    344   3e-114   Ricinus communis
emb|CDP16312.1|  unnamed protein product                                341   5e-114   
gb|EYU30095.1|  hypothetical protein MIMGU_mgv1a021792mg                343   9e-114   
ref|XP_010030093.1|  PREDICTED: lignin-forming anionic peroxidase...    341   3e-113   
ref|XP_011024238.1|  PREDICTED: peroxidase 5-like                       341   2e-112   
ref|XP_006387938.1|  hypothetical protein POPTR_0466s00210g             337   7e-112   
gb|EYU30092.1|  hypothetical protein MIMGU_mgv1a010078mg                337   1e-111   
gb|AAQ55233.1|  peroxidase                                              335   1e-111   Orobanche cernua var. cumana
ref|XP_006470943.1|  PREDICTED: lignin-forming anionic peroxidase...    337   1e-111   
ref|XP_009605266.1|  PREDICTED: lignin-forming anionic peroxidase...    332   1e-111   
ref|XP_004140410.1|  PREDICTED: lignin-forming anionic peroxidase...    337   2e-111   
ref|XP_009603345.1|  PREDICTED: lignin-forming anionic peroxidase...    336   5e-111   
ref|XP_006470944.1|  PREDICTED: lignin-forming anionic peroxidase...    336   5e-111   
ref|XP_009781728.1|  PREDICTED: lignin-forming anionic peroxidase...    335   9e-111   
ref|XP_006378808.1|  hypothetical protein POPTR_0010s24340g             335   9e-111   
emb|CDP07980.1|  unnamed protein product                                335   1e-110   
gb|KDO57833.1|  hypothetical protein CISIN_1g024722mg                   332   1e-110   
ref|XP_002509730.1|  Lignin-forming anionic peroxidase precursor,...    334   2e-110   Ricinus communis
emb|CBI27501.3|  unnamed protein product                                331   5e-110   
gb|EYU30094.1|  hypothetical protein MIMGU_mgv1a0094071mg               333   7e-110   
ref|XP_011024237.1|  PREDICTED: lignin-forming anionic peroxidase...    332   1e-109   
ref|XP_003556178.1|  PREDICTED: lignin-forming anionic peroxidase...    332   1e-109   
gb|KHN00767.1|  Lignin-forming anionic peroxidase                       332   2e-109   
emb|CBI27502.3|  unnamed protein product                                329   2e-109   
ref|XP_006589469.1|  PREDICTED: lignin-forming anionic peroxidase...    332   2e-109   
ref|XP_007131640.1|  hypothetical protein PHAVU_011G030200g             331   4e-109   
ref|XP_002269266.1|  PREDICTED: lignin-forming anionic peroxidase...    330   6e-109   Vitis vinifera
gb|AAY89058.1|  class III peroxidase                                    330   7e-109   Phelipanche ramosa
ref|XP_007045344.1|  Peroxidase superfamily protein                     330   1e-108   
ref|XP_010270789.1|  PREDICTED: lignin-forming anionic peroxidase...    330   1e-108   
gb|AAB97853.1|  ferriprotein porphyrin-containing peroxidase            330   1e-108   Striga asiatica [witchweed]
gb|EYU30097.1|  hypothetical protein MIMGU_mgv1a010056mg                330   1e-108   
gb|KDP38219.1|  hypothetical protein JCGZ_04862                         337   2e-108   
ref|XP_002269169.1|  PREDICTED: lignin-forming anionic peroxidase       329   2e-108   Vitis vinifera
emb|CBI27506.3|  unnamed protein product                                327   3e-108   
ref|XP_010270786.1|  PREDICTED: lignin-forming anionic peroxidase...    328   3e-108   
ref|XP_010270787.1|  PREDICTED: lignin-forming anionic peroxidase...    328   4e-108   
gb|AHL39166.1|  class III peroxidase                                    328   5e-108   
gb|KHN32283.1|  Lignin-forming anionic peroxidase                       326   6e-108   
ref|XP_006378807.1|  hypothetical protein POPTR_0010s24330g             327   6e-108   
ref|XP_004305595.1|  PREDICTED: lignin-forming anionic peroxidase...    328   6e-108   
ref|XP_010270788.1|  PREDICTED: lignin-forming anionic peroxidase...    328   7e-108   
emb|CAN80097.1|  hypothetical protein VITISV_011206                     328   7e-108   Vitis vinifera
ref|XP_007045349.1|  Lignin-forming anionic peroxidase                  328   9e-108   
ref|XP_002269145.1|  PREDICTED: lignin-forming anionic peroxidase       327   1e-107   Vitis vinifera
ref|XP_003538964.1|  PREDICTED: lignin-forming anionic peroxidase...    327   2e-107   
ref|XP_006387287.1|  hypothetical protein POPTR_1332s00200g             324   2e-107   
dbj|BAA77388.1|  peroxidase 2                                           326   3e-107   Scutellaria baicalensis [Baikal skullcap]
ref|XP_002311022.2|  hypothetical protein POPTR_0008s02340g             326   3e-107   Populus trichocarpa [western balsam poplar]
emb|CBI27505.3|  unnamed protein product                                325   3e-107   
ref|XP_010654887.1|  PREDICTED: lignin-forming anionic peroxidase...    326   3e-107   
gb|AES90060.2|  lignin-forming anionic peroxidase                       326   4e-107   
ref|XP_002269058.1|  PREDICTED: lignin-forming anionic peroxidase...    325   5e-107   Vitis vinifera
ref|XP_002521868.1|  Lignin-forming anionic peroxidase precursor,...    325   5e-107   Ricinus communis
ref|XP_004505715.1|  PREDICTED: lignin-forming anionic peroxidase...    325   5e-107   
ref|XP_003607863.1|  Peroxidase                                         325   5e-107   
ref|XP_007131639.1|  hypothetical protein PHAVU_011G030100g             325   5e-107   
ref|XP_004505714.1|  PREDICTED: lignin-forming anionic peroxidase...    325   7e-107   
ref|XP_008220986.1|  PREDICTED: lignin-forming anionic peroxidase...    325   7e-107   
gb|KDP25492.1|  hypothetical protein JCGZ_20648                         325   8e-107   
ref|XP_006379469.1|  hypothetical protein POPTR_0008s02330g             325   8e-107   
ref|XP_002274693.1|  PREDICTED: lignin-forming anionic peroxidase...    325   8e-107   Vitis vinifera
gb|KDP25488.1|  hypothetical protein JCGZ_20644                         325   1e-106   
ref|XP_006470885.1|  PREDICTED: lignin-forming anionic peroxidase...    324   1e-106   
ref|XP_007045351.1|  Lignin-forming anionic peroxidase                  325   1e-106   
ref|XP_002521852.1|  Lignin-forming anionic peroxidase precursor,...    325   1e-106   Ricinus communis
ref|XP_010654860.1|  PREDICTED: lignin-forming anionic peroxidase...    325   2e-106   
gb|AAB97854.1|  ferriprotein porphyrin-containing peroxidase            323   2e-106   Striga asiatica [witchweed]
ref|XP_006470886.1|  PREDICTED: lignin-forming anionic peroxidase...    323   3e-106   
ref|XP_008350979.1|  PREDICTED: lignin-forming anionic peroxidase...    323   3e-106   
ref|XP_007226601.1|  hypothetical protein PRUPE_ppa023604mg             323   4e-106   
emb|CBI27503.3|  unnamed protein product                                323   1e-105   
ref|XP_004298191.1|  PREDICTED: lignin-forming anionic peroxidase...    320   5e-105   
ref|XP_008350978.1|  PREDICTED: LOW QUALITY PROTEIN: lignin-formi...    318   6e-105   
gb|AHL39158.1|  class III peroxidase                                    320   6e-105   
ref|XP_011032836.1|  PREDICTED: lignin-forming anionic peroxidase...    319   2e-104   
ref|XP_002509738.1|  Lignin-forming anionic peroxidase precursor,...    318   5e-104   Ricinus communis
ref|XP_002521866.1|  Lignin-forming anionic peroxidase precursor,...    318   6e-104   Ricinus communis
ref|XP_002890062.1|  hypothetical protein ARALYDRAFT_312453             317   7e-104   
gb|AAF43956.1|AC012188_33  Strong similarity to an Anionic Peroxi...    316   1e-103   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172907.1|  peroxidase 5                                          316   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002521851.1|  Lignin-forming anionic peroxidase precursor,...    316   2e-103   Ricinus communis
ref|XP_004297785.1|  PREDICTED: lignin-forming anionic peroxidase...    315   4e-103   
ref|XP_010088521.1|  Lignin-forming anionic peroxidase                  315   6e-103   
ref|XP_002299006.2|  hypothetical protein POPTR_0001s46290g             314   1e-102   Populus trichocarpa [western balsam poplar]
gb|AAZ42168.1|  lignin peroxidase-like                                  311   1e-102   Cucumis sativus [cucumbers]
ref|XP_010476510.1|  PREDICTED: peroxidase 5                            314   1e-102   
ref|XP_011013621.1|  PREDICTED: lignin-forming anionic peroxidase...    313   3e-102   
ref|XP_010458957.1|  PREDICTED: peroxidase 5-like isoform X2            313   5e-102   
ref|XP_006306491.1|  hypothetical protein CARUB_v10012474mg             311   3e-101   
ref|XP_006370761.1|  Peroxidase 4 precursor family protein              310   7e-101   
ref|XP_010496213.1|  PREDICTED: peroxidase 5-like                       307   7e-100   
gb|KEH30580.1|  lignin-forming anionic peroxidase                       305   5e-99    
ref|XP_011038117.1|  PREDICTED: lignin-forming anionic peroxidase...    302   7e-98    
emb|CAN80096.1|  hypothetical protein VITISV_011205                     300   1e-97    Vitis vinifera
ref|XP_002509737.1|  Lignin-forming anionic peroxidase precursor,...    299   1e-96    Ricinus communis
ref|XP_002509733.1|  Lignin-forming anionic peroxidase precursor,...    298   2e-96    Ricinus communis
ref|XP_010527854.1|  PREDICTED: peroxidase 5-like                       298   3e-96    
gb|AAF63165.1|AC010657_1  T5E21.5                                       298   3e-96    Arabidopsis thaliana [mouse-ear cress]
emb|CDY66455.1|  BnaAnng22270D                                          297   4e-96    
emb|CDY65372.1|  BnaC05g49640D                                          295   3e-95    
ref|XP_006848019.1|  hypothetical protein AMTR_s00029p00173440          294   9e-95    
ref|XP_006305840.1|  hypothetical protein CARUB_v10010887mg             294   9e-95    
ref|XP_010458955.1|  PREDICTED: peroxidase 4                            293   2e-94    
ref|XP_006848018.1|  hypothetical protein AMTR_s00029p00173190          293   3e-94    
emb|CBI27504.3|  unnamed protein product                                294   3e-94    
emb|CDX81650.1|  BnaC08g39510D                                          292   4e-94    
ref|NP_172906.1|  peroxidase 4                                          292   4e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006417000.1|  hypothetical protein EUTSA_v10008244mg             292   5e-94    
ref|XP_010496209.1|  PREDICTED: peroxidase 4-like                       292   6e-94    
ref|XP_009148834.1|  PREDICTED: peroxidase 4                            291   9e-94    
gb|KDP25489.1|  hypothetical protein JCGZ_20645                         291   1e-93    
ref|XP_004517147.1|  PREDICTED: lignin-forming anionic peroxidase...    287   2e-93    
gb|KFK43699.1|  hypothetical protein AALP_AA1G161500                    288   3e-93    
ref|XP_010476509.1|  PREDICTED: peroxidase 4-like                       288   2e-92    
ref|XP_006391633.1|  hypothetical protein EUTSA_v10023814mg             287   3e-92    
ref|XP_006848008.1|  hypothetical protein AMTR_s00029p00168370          287   5e-92    
ref|XP_006848024.1|  hypothetical protein AMTR_s00029p00176660          284   6e-92    
ref|XP_003607245.1|  Peroxidase                                         286   7e-92    
gb|KFK24955.1|  hypothetical protein AALP_AA8G047500                    286   1e-91    
ref|XP_010452439.1|  PREDICTED: peroxidase 52-like                      285   4e-91    
ref|XP_002892816.1|  hypothetical protein ARALYDRAFT_888837             284   9e-91    
ref|XP_002873207.1|  hypothetical protein ARALYDRAFT_908444             283   1e-90    
ref|XP_009614894.1|  PREDICTED: peroxidase P7-like                      283   2e-90    
gb|KGN45822.1|  hypothetical protein Csa_6G013940                       281   2e-90    
ref|XP_008456761.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      283   2e-90    
ref|XP_010423480.1|  PREDICTED: peroxidase 52                           283   2e-90    
emb|CCJ34831.1|  horseradish peroxidase isoenzyme HRP_1350              283   2e-90    
gb|KDP45728.1|  hypothetical protein JCGZ_17335                         283   2e-90    
ref|XP_004138400.1|  PREDICTED: peroxidase 52-like                      282   4e-90    
ref|NP_196153.1|  peroxidase 52                                         282   6e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CDY53543.1|  BnaA09g57020D                                          277   2e-89    
ref|XP_009395400.1|  PREDICTED: peroxidase P7-like                      280   2e-89    
ref|XP_009418659.1|  PREDICTED: lignin-forming anionic peroxidase...    280   5e-89    
dbj|BAA82306.1|  peroxidase                                             278   1e-88    Nicotiana tabacum [American tobacco]
ref|XP_009117893.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 4...    278   2e-88    
ref|XP_004239964.1|  PREDICTED: peroxidase P7-like                      276   6e-88    
ref|XP_008374580.1|  PREDICTED: peroxidase P7-like                      276   8e-88    
ref|XP_006349568.1|  PREDICTED: cationic peroxidase 1-like              276   9e-88    
ref|XP_002520835.1|  Peroxidase 52 precursor, putative                  275   2e-87    Ricinus communis
ref|XP_006848015.1|  hypothetical protein AMTR_s00029p00170340          276   2e-87    
emb|CAD67478.1|  peroxidase                                             275   2e-87    Asparagus officinalis
emb|CDY14118.1|  BnaC02g02350D                                          275   2e-87    
ref|XP_006365326.1|  PREDICTED: peroxidase 52-like                      275   3e-87    
gb|ACM47317.1|  peroxidase                                              275   3e-87    Capsicum annuum
ref|XP_008233851.1|  PREDICTED: peroxidase P7-like                      275   3e-87    
ref|XP_009125598.1|  PREDICTED: peroxidase P7                           275   3e-87    
emb|CDY04948.1|  BnaAnng01300D                                          275   3e-87    
ref|XP_010552918.1|  PREDICTED: peroxidase P7-like                      275   4e-87    
sp|P00434.3|PERP7_BRARR  RecName: Full=Peroxidase P7; AltName: Fu...    273   6e-87    Brassica rapa subsp. rapa
ref|XP_010256947.1|  PREDICTED: peroxidase 4-like                       274   7e-87    
ref|XP_002269301.2|  PREDICTED: lignin-forming anionic peroxidase...    270   9e-87    Vitis vinifera
ref|XP_010491069.1|  PREDICTED: peroxidase 52-like                      274   9e-87    
gb|KHN48387.1|  Peroxidase 52                                           271   1e-86    
ref|XP_010695731.1|  PREDICTED: peroxidase P7-like                      273   1e-86    
ref|XP_006288218.1|  hypothetical protein CARUB_v10001455mg             273   2e-86    
ref|XP_003602462.1|  Peroxidase                                         272   4e-86    
ref|XP_010264466.1|  PREDICTED: peroxidase 4-like                       271   5e-86    
ref|XP_010695722.1|  PREDICTED: peroxidase P7-like                      271   7e-86    
gb|KHN29529.1|  Cationic peroxidase 1                                   271   8e-86    
ref|XP_003523269.1|  PREDICTED: peroxidase 52-like isoform 1            271   8e-86    
ref|XP_006398996.1|  hypothetical protein EUTSA_v10014105mg             271   9e-86    
gb|ABK21858.1|  unknown                                                 271   1e-85    Picea sitchensis
ref|XP_004240055.1|  PREDICTED: cationic peroxidase 1-like              271   1e-85    
ref|XP_007137608.1|  hypothetical protein PHAVU_009G140700g             271   1e-85    
ref|XP_010543687.1|  PREDICTED: peroxidase 52                           270   2e-85    
ref|XP_010031113.1|  PREDICTED: peroxidase 4-like                       270   2e-85    
ref|XP_011095107.1|  PREDICTED: cationic peroxidase 1-like              270   2e-85    
ref|XP_010045399.1|  PREDICTED: peroxidase 4-like                       270   2e-85    
ref|XP_003534655.2|  PREDICTED: cationic peroxidase 1-like              271   2e-85    
dbj|BAJ97638.1|  predicted protein                                      270   3e-85    
gb|ACT35473.1|  peroxidase 52                                           269   3e-85    Brassica rapa
emb|CDX70158.1|  BnaA10g25070D                                          270   3e-85    
ref|XP_009410536.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    270   4e-85    
ref|XP_004502855.1|  PREDICTED: peroxidase 52-like                      270   4e-85    
dbj|BAK03677.1|  predicted protein                                      269   4e-85    
gb|KHG18057.1|  Peroxidase 52 -like protein                             269   5e-85    
ref|XP_009122142.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase P7      269   6e-85    
gb|AAP76387.1|  class III peroxidase                                    269   7e-85    Gossypium hirsutum [American cotton]
ref|XP_008465298.1|  PREDICTED: peroxidase 4-like                       268   1e-84    
emb|CDX98835.1|  BnaC09g50000D                                          268   1e-84    
ref|XP_002278996.1|  PREDICTED: peroxidase 4                            268   1e-84    Vitis vinifera
ref|XP_006353885.1|  PREDICTED: peroxidase 52-like                      267   2e-84    
ref|XP_002269918.1|  PREDICTED: peroxidase 4                            267   3e-84    Vitis vinifera
gb|EMS66985.1|  Peroxidase 4                                            267   3e-84    
ref|XP_006345522.1|  PREDICTED: cationic peroxidase 1-like              266   4e-84    
ref|XP_002281755.1|  PREDICTED: peroxidase P7                           266   4e-84    Vitis vinifera
gb|ACU17608.1|  unknown                                                 266   5e-84    Glycine max [soybeans]
ref|XP_009369255.1|  PREDICTED: peroxidase P7-like                      266   5e-84    
ref|XP_008782624.1|  PREDICTED: peroxidase 4-like                       266   5e-84    
ref|XP_003616748.1|  Peroxidase                                         267   5e-84    
ref|NP_001241914.1|  uncharacterized protein LOC100790279 precursor     266   5e-84    
gb|KDP21681.1|  hypothetical protein JCGZ_03352                         266   5e-84    
ref|XP_009785653.1|  PREDICTED: cationic peroxidase 1-like              266   6e-84    
ref|XP_006596457.1|  PREDICTED: cationic peroxidase 1-like              265   8e-84    
ref|XP_008810563.1|  PREDICTED: peroxidase 4-like                       266   9e-84    
ref|XP_009606349.1|  PREDICTED: peroxidase P7-like                      266   1e-83    
ref|XP_003623567.1|  Peroxidase                                         265   1e-83    
ref|XP_003552297.1|  PREDICTED: cationic peroxidase 1-like              266   1e-83    
ref|XP_004302590.1|  PREDICTED: cationic peroxidase 1-like              266   1e-83    
ref|XP_004500339.1|  PREDICTED: cationic peroxidase 1-like              266   1e-83    
ref|XP_011008654.1|  PREDICTED: peroxidase P7                           266   1e-83    
ref|XP_006376028.1|  hypothetical protein POPTR_0013s08130g             266   1e-83    
gb|KHN46100.1|  Cationic peroxidase 1                                   265   1e-83    
ref|XP_006345521.1|  PREDICTED: cationic peroxidase 1-like              265   1e-83    
gb|AAP42508.1|  anionic peroxidase swpb3                                265   1e-83    Ipomoea batatas [batate]
ref|XP_003519407.1|  PREDICTED: peroxidase 4-like                       265   2e-83    
sp|Q4W1I9.1|PER2_ZINVI  RecName: Full=Basic peroxidase; AltName: ...    265   2e-83    Zinnia violacea [garden zinnia]
gb|ABV24960.2|  putative secretory peroxidase                           265   2e-83    Catharanthus roseus [chatas]
ref|XP_007011229.1|  Peroxidase superfamily protein                     265   2e-83    
sp|Q4W1I8.1|PER1_ZINVI  RecName: Full=Basic peroxidase; AltName: ...    265   2e-83    Zinnia violacea [garden zinnia]
gb|KGN47222.1|  hypothetical protein Csa_6G216410                       264   2e-83    
ref|XP_004172441.1|  PREDICTED: peroxidase 4-like                       265   2e-83    
ref|XP_004149366.1|  PREDICTED: peroxidase 4-like                       265   2e-83    
gb|KHN40655.1|  Cationic peroxidase 1                                   265   3e-83    
gb|EYU41992.1|  hypothetical protein MIMGU_mgv1a010234mg                265   3e-83    
gb|EYU41994.1|  hypothetical protein MIMGU_mgv1a010221mg                265   3e-83    
gb|EMT02760.1|  Peroxidase 4                                            263   3e-83    
ref|XP_007146853.1|  hypothetical protein PHAVU_006G075600g             265   3e-83    
ref|XP_010045407.1|  PREDICTED: peroxidase 4-like                       265   3e-83    
gb|AAL93151.1|AF485265_1  class III peroxidase                          264   4e-83    Gossypium hirsutum [American cotton]
ref|XP_009790966.1|  PREDICTED: peroxidase P7-like                      264   5e-83    
ref|XP_010922691.1|  PREDICTED: peroxidase 4-like                       264   5e-83    
gb|EMT27943.1|  Peroxidase 1                                            263   6e-83    
ref|XP_004492538.1|  PREDICTED: cationic peroxidase 1-like              263   7e-83    
emb|CAN80051.1|  hypothetical protein VITISV_032434                     263   7e-83    Vitis vinifera
ref|XP_009786874.1|  PREDICTED: peroxidase P7                           263   7e-83    
ref|XP_009403860.1|  PREDICTED: peroxidase 4 {ECO:0000250|UniProt...    263   8e-83    
gb|EYU41993.1|  hypothetical protein MIMGU_mgv1a010225mg                263   8e-83    
emb|CAD67479.1|  peroxidase                                             263   1e-82    Asparagus officinalis
ref|XP_002450133.1|  hypothetical protein SORBIDRAFT_05g001010          263   1e-82    Sorghum bicolor [broomcorn]
ref|XP_009363847.1|  PREDICTED: peroxidase P7-like                      263   1e-82    
ref|XP_009593782.1|  PREDICTED: peroxidase P7-like                      263   1e-82    
gb|KDP25490.1|  hypothetical protein JCGZ_20646                         263   2e-82    
ref|XP_008369321.1|  PREDICTED: peroxidase P7-like                      263   2e-82    
ref|XP_011080738.1|  PREDICTED: peroxidase 4-like                       263   2e-82    
ref|XP_007142069.1|  hypothetical protein PHAVU_008G249900g             263   2e-82    
ref|XP_008650762.1|  PREDICTED: peroxidase 70 isoform X1                263   2e-82    
ref|XP_011076613.1|  PREDICTED: peroxidase P7                           263   2e-82    
gb|EMS57731.1|  Peroxidase 4                                            261   2e-82    
ref|XP_011021038.1|  PREDICTED: peroxidase 4-like                       263   2e-82    
gb|KHN48395.1|  Peroxidase 4                                            263   2e-82    
gb|ACU23223.1|  unknown                                                 263   2e-82    Glycine max [soybeans]
ref|XP_009404515.1|  PREDICTED: peroxidase P7-like                      262   2e-82    
ref|XP_002319967.2|  hypothetical protein POPTR_0013s15240g             262   2e-82    Populus trichocarpa [western balsam poplar]
ref|XP_009594465.1|  PREDICTED: cationic peroxidase 1-like              262   3e-82    
ref|XP_004234419.1|  PREDICTED: peroxidase P7-like                      262   3e-82    
ref|XP_010041552.1|  PREDICTED: peroxidase P7-like                      262   3e-82    
emb|CAA62597.1|  korean-radish isoperoxidase                            262   3e-82    Raphanus sativus
ref|XP_010045401.1|  PREDICTED: peroxidase 4-like                       262   3e-82    
ref|XP_010458956.1|  PREDICTED: peroxidase 5-like isoform X1            259   3e-82    
ref|XP_003577842.1|  PREDICTED: peroxidase 4                            262   3e-82    
ref|XP_004240883.1|  PREDICTED: peroxidase P7-like                      262   4e-82    
gb|KHN08835.1|  Peroxidase 4                                            262   4e-82    
ref|XP_003544922.1|  PREDICTED: peroxidase 4                            262   4e-82    
emb|CAD67477.1|  peroxidase                                             261   4e-82    Asparagus officinalis
gb|AAB48184.1|  peroxidase precursor                                    261   4e-82    Linum usitatissimum
gb|AFK43134.1|  unknown                                                 261   5e-82    
ref|XP_003551174.1|  PREDICTED: peroxidase 4-like                       261   5e-82    
gb|KHG09190.1|  Peroxidase 4                                            261   5e-82    
ref|XP_002319968.2|  peroxidase family protein                          261   5e-82    
ref|XP_006468162.1|  PREDICTED: peroxidase 4-like                       261   6e-82    
ref|XP_006361306.1|  PREDICTED: peroxidase 4-like                       261   6e-82    
gb|KHN08839.1|  Cationic peroxidase 1                                   259   7e-82    
ref|XP_010921101.1|  PREDICTED: peroxidase 4-like                       261   7e-82    
emb|CBI18066.3|  unnamed protein product                                259   8e-82    
emb|CDX80957.1|  BnaC03g02110D                                          261   8e-82    
ref|XP_007142064.1|  hypothetical protein PHAVU_008G249500g             261   9e-82    
ref|XP_010931330.1|  PREDICTED: peroxidase 4-like                       260   1e-81    
gb|AEX20390.1|  putative class III peroxidase                           258   1e-81    
ref|XP_011021015.1|  PREDICTED: cationic peroxidase 1-like              260   1e-81    
ref|XP_002319407.1|  peroxidase family protein                          259   1e-81    
ref|NP_001106040.1|  peroxidase 70 precursor                            260   1e-81    
gb|AHL39176.1|  class III peroxidase                                    259   2e-81    
gb|AAR31108.1|  peroxidase precursor                                    260   2e-81    
ref|XP_007141708.1|  hypothetical protein PHAVU_008G218500g             260   2e-81    
ref|XP_010041557.1|  PREDICTED: cationic peroxidase 1-like              260   2e-81    
ref|XP_009404514.1|  PREDICTED: peroxidase P7-like                      259   2e-81    
ref|XP_002450132.1|  hypothetical protein SORBIDRAFT_05g001000          260   2e-81    
ref|XP_010653358.1|  PREDICTED: cationic peroxidase 1-like              260   2e-81    
ref|XP_004150607.1|  PREDICTED: peroxidase 4-like                       260   2e-81    
gb|AAR31106.1|  peroxidase precursor                                    260   2e-81    
ref|XP_004978554.1|  PREDICTED: peroxidase 4-like                       260   3e-81    
ref|NP_001060629.1|  Os07g0677300                                       259   3e-81    
gb|ACN33662.1|  unknown                                                 259   3e-81    
ref|XP_008782619.1|  PREDICTED: cationic peroxidase 1-like              259   3e-81    
ref|XP_004294746.1|  PREDICTED: peroxidase 4-like                       259   3e-81    
gb|KGN47223.1|  hypothetical protein Csa_6G216420                       259   3e-81    
ref|NP_001131000.1|  uncharacterized protein LOC100192105 precursor     259   3e-81    
ref|XP_010066394.1|  PREDICTED: cationic peroxidase 1-like              259   4e-81    
ref|XP_009408894.1|  PREDICTED: peroxidase P7-like                      259   4e-81    
ref|XP_004983933.1|  PREDICTED: peroxidase 70-like                      259   4e-81    
gb|EYU46001.1|  hypothetical protein MIMGU_mgv1a018175mg                258   5e-81    
ref|XP_007205557.1|  hypothetical protein PRUPE_ppa008642mg             259   5e-81    
ref|XP_010041464.1|  PREDICTED: cationic peroxidase 1-like              259   5e-81    
ref|XP_010685963.1|  PREDICTED: cationic peroxidase 1-like              260   6e-81    
gb|AII99880.1|  peroxidase                                              258   6e-81    
ref|XP_002281731.1|  PREDICTED: peroxidase P7                           258   6e-81    
ref|XP_010653359.1|  PREDICTED: cationic peroxidase 1-like              259   6e-81    
ref|XP_010041648.1|  PREDICTED: cationic peroxidase 1-like              258   6e-81    
ref|XP_003602463.1|  Peroxidase                                         259   6e-81    
sp|A2YPX3.2|PER2_ORYSI  RecName: Full=Peroxidase 2; Flags: Precursor    258   7e-81    
ref|XP_004294750.1|  PREDICTED: cationic peroxidase 1-like              258   7e-81    
ref|XP_010035872.1|  PREDICTED: peroxidase P7-like                      258   7e-81    
gb|AFK46186.1|  unknown                                                 258   7e-81    
ref|XP_009130879.1|  PREDICTED: peroxidase 52-like                      258   8e-81    
ref|XP_003538328.1|  PREDICTED: peroxidase 4-like                       258   9e-81    
tpe|CAH69372.1|  TPA: class III peroxidase 130 precursor                258   9e-81    
gb|KHN46282.1|  Peroxidase 4                                            258   1e-80    
ref|XP_010685954.1|  PREDICTED: cationic peroxidase 1-like              258   1e-80    
ref|XP_006842420.1|  hypothetical protein AMTR_s00077p00014810          258   1e-80    
ref|XP_010264471.1|  PREDICTED: cationic peroxidase 1-like              258   1e-80    
ref|XP_003551179.1|  PREDICTED: cationic peroxidase 1-like              258   1e-80    
ref|XP_002489046.1|  hypothetical protein SORBIDRAFT_0246s002010        258   1e-80    
ref|XP_004951344.1|  PREDICTED: peroxidase 70-like                      258   1e-80    
ref|XP_003538325.1|  PREDICTED: cationic peroxidase 1-like              258   1e-80    
ref|XP_004307713.1|  PREDICTED: peroxidase 4-like                       258   1e-80    
ref|XP_006595847.1|  PREDICTED: peroxidase 4-like                       258   1e-80    
gb|AHD24479.1|  class III peroxidase 191                                258   2e-80    
ref|XP_003519284.1|  PREDICTED: peroxidase 4                            258   2e-80    
ref|XP_004977588.1|  PREDICTED: peroxidase 4-like                       258   2e-80    
gb|EAY79693.1|  hypothetical protein OsI_34840                          258   2e-80    
ref|XP_006658125.1|  PREDICTED: peroxidase 2-like                       257   2e-80    
ref|XP_009381205.1|  PREDICTED: peroxidase P7-like                      257   2e-80    
emb|CDP13933.1|  unnamed protein product                                257   3e-80    
ref|XP_007033589.1|  Peroxidase superfamily protein                     257   3e-80    
ref|XP_006350928.1|  PREDICTED: cationic peroxidase 1-like              256   3e-80    
emb|CDP04065.1|  unnamed protein product                                257   3e-80    
ref|XP_006843746.1|  hypothetical protein AMTR_s00007p00230210          257   3e-80    
gb|AAD43561.1|AF155124_1  bacterial-induced peroxidase precursor        257   3e-80    
ref|XP_009358287.1|  PREDICTED: cationic peroxidase 1-like              257   3e-80    
gb|KEH34419.1|  anionic peroxidase swpb3 protein                        257   3e-80    
gb|EYU46002.1|  hypothetical protein MIMGU_mgv1a009759mg                257   3e-80    
ref|XP_006843744.1|  hypothetical protein AMTR_s00007p00229000          256   4e-80    
gb|ACU23245.1|  unknown                                                 256   5e-80    
gb|AFK45898.1|  unknown                                                 256   5e-80    
ref|XP_002517727.1|  Cationic peroxidase 1 precursor, putative          254   6e-80    
gb|KHN44724.1|  Peroxidase 4                                            256   6e-80    
emb|CAN61440.1|  hypothetical protein VITISV_022439                     254   6e-80    
ref|XP_004242492.1|  PREDICTED: cationic peroxidase 1                   256   6e-80    
ref|XP_004492537.1|  PREDICTED: cationic peroxidase 1-like              256   6e-80    
ref|XP_010246464.1|  PREDICTED: peroxidase P7-like                      256   6e-80    
ref|XP_004500341.1|  PREDICTED: peroxidase 4-like                       256   6e-80    
ref|NP_001060628.1|  Os07g0677200                                       256   6e-80    
ref|XP_010921098.1|  PREDICTED: cationic peroxidase 1-like              256   7e-80    
gb|EYU20115.1|  hypothetical protein MIMGU_mgv1a025851mg                256   7e-80    
ref|XP_006486214.1|  PREDICTED: peroxidase 4-like                       256   8e-80    
ref|XP_009622973.1|  PREDICTED: cationic peroxidase 1-like              256   8e-80    
emb|CBI27500.3|  unnamed protein product                                256   8e-80    
ref|XP_002284007.1|  PREDICTED: cationic peroxidase 1 isoform X2        256   8e-80    
emb|CBI15847.3|  unnamed protein product                                254   8e-80    
gb|KEH29223.1|  class III peroxidase                                    256   9e-80    
ref|XP_008463814.1|  PREDICTED: peroxidase 4-like                       256   9e-80    
ref|XP_003577141.1|  PREDICTED: peroxidase 4-like                       256   9e-80    
ref|XP_008245160.1|  PREDICTED: cationic peroxidase 1-like              256   1e-79    
ref|XP_007205544.1|  hypothetical protein PRUPE_ppa008590mg             256   1e-79    
gb|AAO13838.1|AF405326_1  peroxidase 2                                  253   1e-79    
emb|CAN81400.1|  hypothetical protein VITISV_038539                     255   1e-79    
gb|ADN96691.1|  peroxidase 4                                            256   1e-79    
gb|EEE67815.1|  hypothetical protein OsJ_25569                          255   1e-79    
ref|NP_001065971.1|  Os12g0112000                                       255   1e-79    
dbj|BAA77389.1|  peroxidase 3                                           255   1e-79    
ref|XP_003615995.1|  Peroxidase                                         255   1e-79    
ref|XP_010664359.1|  PREDICTED: cationic peroxidase 1 isoform X3        255   1e-79    
ref|XP_007033588.1|  Peroxidase superfamily protein                     256   2e-79    
ref|XP_006468149.1|  PREDICTED: cationic peroxidase 1-like              254   2e-79    
gb|KHN33941.1|  Peroxidase 52                                           253   2e-79    
emb|CAA46916.1|  peroxidase                                             254   2e-79    
ref|XP_004958681.1|  PREDICTED: peroxidase 2-like                       254   2e-79    
ref|XP_010650833.1|  PREDICTED: cationic peroxidase 1-like              254   3e-79    
gb|EMT23346.1|  Peroxidase 2                                            254   3e-79    
dbj|BAJ91992.1|  predicted protein                                      254   3e-79    
ref|XP_011080818.1|  PREDICTED: uncharacterized protein LOC105163979    265   3e-79    
ref|XP_003623564.1|  Peroxidase                                         254   3e-79    
gb|EPS59568.1|  hypothetical protein M569_15235                         254   3e-79    
gb|KHG17773.1|  Peroxidase 52 -like protein                             254   4e-79    
gb|EMS57730.1|  Peroxidase 4                                            253   4e-79    
ref|XP_009803848.1|  PREDICTED: cationic peroxidase 1-like              254   4e-79    
ref|XP_008457311.1|  PREDICTED: cationic peroxidase 1-like              254   4e-79    
gb|AFW64595.1|  hypothetical protein ZEAMMB73_885092                    254   4e-79    
ref|XP_006658124.1|  PREDICTED: peroxidase 2-like                       253   5e-79    
gb|ABR18139.1|  unknown                                                 254   5e-79    
ref|XP_003634480.1|  PREDICTED: cationic peroxidase 1                   253   5e-79    
ref|XP_010093550.1|  Cationic peroxidase 1                              254   6e-79    
ref|XP_006470332.1|  PREDICTED: peroxidase 4-like                       253   6e-79    
ref|XP_008384729.1|  PREDICTED: peroxidase 4-like isoform X1            254   7e-79    
ref|XP_007017044.1|  Peroxidase 68                                      261   7e-79    
gb|ACF08087.1|  class III peroxidase                                    253   7e-79    
ref|XP_008384730.1|  PREDICTED: peroxidase 4-like isoform X2            253   7e-79    
ref|XP_010035985.1|  PREDICTED: cationic peroxidase 1-like              253   7e-79    
ref|XP_008370240.1|  PREDICTED: cationic peroxidase 1-like              253   7e-79    
gb|ACU24215.1|  unknown                                                 253   8e-79    
ref|XP_003527340.1|  PREDICTED: peroxidase 52-like                      253   8e-79    
ref|XP_008244444.1|  PREDICTED: peroxidase 4-like                       253   1e-78    
ref|XP_003562452.1|  PREDICTED: peroxidase 2-like                       253   1e-78    
ref|XP_004978553.1|  PREDICTED: peroxidase 4-like                       254   1e-78    
ref|XP_006662661.1|  PREDICTED: cationic peroxidase 1-like              250   1e-78    
gb|AAC49818.1|  peroxidase                                              253   1e-78    
ref|XP_010032327.1|  PREDICTED: peroxidase P7-like                      253   1e-78    
ref|XP_009373126.1|  PREDICTED: cationic peroxidase 1-like              253   1e-78    
ref|XP_007206416.1|  hypothetical protein PRUPE_ppa018664mg             252   1e-78    
emb|CBI22007.3|  unnamed protein product                                256   1e-78    
gb|EEE67819.1|  hypothetical protein OsJ_25574                          252   1e-78    
ref|XP_010098690.1|  Peroxidase 52                                      251   1e-78    
ref|NP_001060631.1|  Os07g0677500                                       252   1e-78    
ref|XP_002285723.1|  PREDICTED: cationic peroxidase 1 isoform X1        252   2e-78    
gb|AFK41406.1|  unknown                                                 253   2e-78    
ref|XP_006348978.1|  PREDICTED: peroxidase 52-like                      252   2e-78    
gb|AAX44001.2|  putative secretory peroxidase                           252   2e-78    
ref|XP_006662662.1|  PREDICTED: peroxidase 4-like                       253   2e-78    
ref|XP_010230071.1|  PREDICTED: peroxidase 70-like                      251   2e-78    
gb|EAZ05133.1|  hypothetical protein OsI_27326                          252   2e-78    
gb|AFR44628.1|  class III secretory peroxidase                          252   2e-78    
ref|XP_002531319.1|  Peroxidase 2 precursor, putative                   252   2e-78    
pdb|1SCH|A  Chain A, Peanut Peroxidase                                  251   2e-78    
ref|XP_006664870.1|  PREDICTED: peroxidase 4-like                       252   2e-78    
ref|XP_011019031.1|  PREDICTED: peroxidase 2-like                       252   3e-78    
ref|XP_010104414.1|  Peroxidase 52                                      252   3e-78    
emb|CAL25300.1|  properoxidase                                          251   3e-78    
ref|XP_002441703.1|  hypothetical protein SORBIDRAFT_08g000990          252   3e-78    
gb|ACD70388.1|  class III peroxidase                                    251   3e-78    
ref|XP_010263840.1|  PREDICTED: cationic peroxidase 1-like              251   3e-78    
ref|XP_009354386.1|  PREDICTED: peroxidase 4-like                       252   4e-78    
tpe|CAH69351.1|  TPA: class III peroxidase 109 precursor                251   4e-78    
gb|ACF08090.1|  class III peroxidase                                    251   4e-78    
ref|XP_010931328.1|  PREDICTED: cationic peroxidase 1-like              251   4e-78    
gb|KHN33229.1|  Cationic peroxidase 1                                   249   4e-78    
ref|XP_006664869.1|  PREDICTED: cationic peroxidase 1-like              251   5e-78    
ref|XP_008381199.1|  PREDICTED: peroxidase P7-like                      252   5e-78    
ref|XP_010066439.1|  PREDICTED: cationic peroxidase 1-like              251   5e-78    
sp|P22195.2|PER1_ARAHY  RecName: Full=Cationic peroxidase 1; AltN...    251   5e-78    
dbj|BAC83101.1|  putative peroxidase precursor                          251   5e-78    
ref|NP_001151940.1|  peroxidase 52 precursor                            251   5e-78    
ref|XP_010087166.1|  Peroxidase 4                                       251   6e-78    
gb|ADN96693.1|  peroxidase 6                                            251   6e-78    
dbj|BAK06463.1|  predicted protein                                      251   6e-78    
ref|XP_008354764.1|  PREDICTED: peroxidase 4-like                       251   6e-78    
ref|XP_002467656.1|  hypothetical protein SORBIDRAFT_01g031740          252   6e-78    
emb|CAH10840.1|  peroxidase                                             251   7e-78    
ref|XP_010264472.1|  PREDICTED: cationic peroxidase 1-like              251   7e-78    
gb|KDO63401.1|  hypothetical protein CISIN_1g020966mg                   251   7e-78    
ref|NP_001060626.1|  Os07g0676900                                       251   7e-78    
ref|XP_009795618.1|  PREDICTED: peroxidase 2-like                       251   8e-78    
ref|XP_009420366.1|  PREDICTED: peroxidase P7-like                      251   8e-78    
gb|AFW86738.1|  peroxidase 52 isoform 1                                 250   8e-78    
ref|XP_004965566.1|  PREDICTED: peroxidase 52-like                      252   8e-78    
dbj|BAM05634.1|  peroxidase 2                                           251   8e-78    
emb|CAH10839.1|  peroxidase                                             250   9e-78    
ref|XP_010087174.1|  Cationic peroxidase 1                              249   9e-78    
ref|NP_200648.1|  peroxidase                                            251   9e-78    
ref|NP_001147216.1|  LOC100280824 precursor                             250   1e-77    
dbj|BAM05635.1|  peroxidase 2                                           251   1e-77    
ref|XP_004978383.1|  PREDICTED: peroxidase 4-like                       249   1e-77    
ref|XP_009365290.1|  PREDICTED: peroxidase P7-like                      250   1e-77    
gb|KHN40654.1|  Cationic peroxidase 1                                   248   1e-77    
gb|EEC82680.1|  hypothetical protein OsI_27324                          250   1e-77    
gb|ABA91154.1|  Cationic peroxidase 1 precursor, putative, expressed    248   1e-77    
gb|ABK25962.1|  unknown                                                 250   1e-77    
ref|XP_011080739.1|  PREDICTED: peroxidase 4-like                       250   2e-77    
ref|XP_008229747.1|  PREDICTED: cationic peroxidase 1-like              250   2e-77    
gb|ACJ11762.1|  class III peroxidase                                    250   2e-77    
ref|XP_006468993.1|  PREDICTED: peroxidase 52-like                      249   2e-77    
ref|XP_010228647.1|  PREDICTED: peroxidase 2-like                       250   2e-77    
ref|XP_003602461.1|  Peroxidase                                         250   2e-77    
ref|XP_009775853.1|  PREDICTED: cationic peroxidase 1-like              247   2e-77    
ref|XP_011003590.1|  PREDICTED: peroxidase 2-like                       249   2e-77    
ref|XP_009371984.1|  PREDICTED: cationic peroxidase 1-like              249   2e-77    
gb|ACZ51443.1|  peroxidase protein                                      249   2e-77    
ref|XP_009775408.1|  PREDICTED: cationic peroxidase 1-like              247   2e-77    
ref|NP_001046400.2|  Os02g0240100                                       249   2e-77    
ref|XP_004958680.1|  PREDICTED: peroxidase 70-like                      249   2e-77    
gb|AAQ55292.1|  class III peroxidase GvPx2b                             247   3e-77    
ref|XP_006658122.1|  PREDICTED: peroxidase 70-like                      249   3e-77    
gb|ABR23054.1|  basic peroxidase swpb4                                  249   3e-77    
ref|XP_004510041.1|  PREDICTED: peroxidase 52-like                      249   3e-77    
ref|XP_010261061.1|  PREDICTED: cationic peroxidase 1-like              249   3e-77    
ref|XP_007134676.1|  hypothetical protein PHAVU_010G066600g             249   3e-77    
gb|ACF70710.1|  root peroxidase                                         249   3e-77    
gb|ACF70701.1|  root peroxidase                                         249   3e-77    



>ref|XP_004250402.1| PREDICTED: lignin-forming anionic peroxidase [Solanum lycopersicum]
Length=320

 Score =   391 bits (1004),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY +IE AK ELEK+CPGIVSCAD+L+VAARDAS  VGGPSWTVKLGRRDS TASHTLA
Sbjct  100  RGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPSWTVKLGRRDSATASHTLA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ETDLPGPFD LD+LIS FANKGL+TRDMVALSG+HS+GQAQCFLFRDRIY NGTDIDAGF
Sbjct  160  ETDLPGPFDPLDRLISGFANKGLSTRDMVALSGSHSIGQAQCFLFRDRIYSNGTDIDAGF  219

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCP++  NGNLAPLDLVTPN  DNNYYKNL+Q+KGLLQSDQVL SGG+TD+IV+
Sbjct  220  ASTRRRQCPQEDQNGNLAPLDLVTPNQLDNNYYKNLIQRKGLLQSDQVLLSGGSTDSIVT  279

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+ SPR F ADFA+AMIKM +I PLTGQNGIIR VCGA+N
Sbjct  280  EYSNSPRVFAADFAAAMIKMGDISPLTGQNGIIRTVCGAIN  320



>ref|XP_009608056.1| PREDICTED: lignin-forming anionic peroxidase [Nicotiana tomentosiformis]
Length=319

 Score =   390 bits (1002),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 207/221 (94%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ +IE AK E+EK CP +VSCAD+L+VAARDASAAVGGPSWTVKLGRRDSTTAS TLA
Sbjct  99   RGFGIIEDAKREVEKICPEVVSCADILTVAARDASAAVGGPSWTVKLGRRDSTTASKTLA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ETDLPGPFD L++LISSFA+KGL+TRDMVALSGAH++GQAQCFLFRDRIYGNGTDIDAGF
Sbjct  159  ETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHTIGQAQCFLFRDRIYGNGTDIDAGF  218

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTR+RQCP++  NGNLAPLDLVTPN FDNNY+KNL+QKKGLLQSDQVLF+GG+TDNIVS
Sbjct  219  ASTRKRQCPQEGENGNLAPLDLVTPNQFDNNYFKNLIQKKGLLQSDQVLFNGGSTDNIVS  278

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+ SPRAF +DFA+AMIKM +I PLTGQNGIIRKVCG++N
Sbjct  279  EYSNSPRAFSSDFAAAMIKMGDISPLTGQNGIIRKVCGSVN  319



>ref|XP_006351920.1| PREDICTED: lignin-forming anionic peroxidase-like [Solanum tuberosum]
Length=320

 Score =   389 bits (999),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 180/221 (81%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY +IE AK ELEK+CPGIVSCAD+L+VAARDAS  VGGPSWTVKLGRRDSTTASHTLA
Sbjct  100  RGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPSWTVKLGRRDSTTASHTLA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ETDLPGPFD LD++IS FANKGL+T+DMVALSGAHS+GQAQCFLFRDRIY NGTDIDAGF
Sbjct  160  ETDLPGPFDPLDRIISGFANKGLSTKDMVALSGAHSIGQAQCFLFRDRIYSNGTDIDAGF  219

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCP++  NGNLAPLDLVTPN  DNNYYKNL+Q+KGLLQSDQVL SGG+TD+IV+
Sbjct  220  ASTRRRQCPQEDQNGNLAPLDLVTPNQLDNNYYKNLIQRKGLLQSDQVLLSGGSTDSIVT  279

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+ +PR F +DFA+AMIKM +I PLTGQNGIIR VCGA+N
Sbjct  280  EYSNNPRTFASDFAAAMIKMGDISPLTGQNGIIRTVCGAIN  320



>ref|XP_009801852.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
sylvestris]
 ref|XP_009801853.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
sylvestris]
Length=324

 Score =   389 bits (998),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 182/221 (82%), Positives = 203/221 (92%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY +IE AK ELEK+CPGIVSCAD+L+VAARDAS  VGGP+W VKLGRRDSTTASHTLA
Sbjct  104  RGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPTWAVKLGRRDSTTASHTLA  163

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ETDLPGPFD L++LISSFA+KGL+TRDMVALSGAHS+GQAQCFLFRDRIYGNGTDIDAGF
Sbjct  164  ETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHSIGQAQCFLFRDRIYGNGTDIDAGF  223

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCPK+  NGNLAPLDLVTPN  DNNY+KNL Q+KGLLQSDQVL SGG+TD+IVS
Sbjct  224  ASTRRRQCPKEDQNGNLAPLDLVTPNQLDNNYFKNLRQRKGLLQSDQVLLSGGSTDDIVS  283

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+ SPRAF +DFA+AMI+M +I PLTGQNGIIR VCG+LN
Sbjct  284  EYSNSPRAFASDFAAAMIRMGDISPLTGQNGIIRTVCGSLN  324



>ref|XP_009620122.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
tomentosiformis]
Length=324

 Score =   388 bits (996),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 203/221 (92%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY +IE AK ELEK+CPGIVSCAD+L+VAARDAS  VGGP+W VKLGRRDSTTASHTLA
Sbjct  104  RGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPTWAVKLGRRDSTTASHTLA  163

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ETDLPGPFD L++LISSFA+KGL+TRDMVALSGAHS+GQAQCFLFRDRIYGNGTDIDAGF
Sbjct  164  ETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHSIGQAQCFLFRDRIYGNGTDIDAGF  223

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCPK+  NGNLAPLDLVTPN  DNNY+KNL Q+KGLLQSDQVL SGG+TD+IVS
Sbjct  224  ASTRRRQCPKEDQNGNLAPLDLVTPNQLDNNYFKNLRQRKGLLQSDQVLLSGGSTDSIVS  283

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+ SPRAF +DFA+AMI+M +I P+TGQNGIIR VCG+LN
Sbjct  284  EYSNSPRAFASDFAAAMIRMGDISPITGQNGIIRTVCGSLN  324



>ref|NP_001289531.1| lignin-forming anionic peroxidase precursor [Nicotiana sylvestris]
 sp|Q02200.1|PERX_NICSY RecName: Full=Lignin-forming anionic peroxidase; Flags: Precursor 
[Nicotiana sylvestris]
 gb|AAA34050.1| anionic peroxidase [Nicotiana sylvestris]
Length=322

 Score =   387 bits (995),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 181/221 (82%), Positives = 206/221 (93%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ +IE AK E+EK CPG+VSCAD+L+VAARDASAAVGGPSWTVKLGRRDSTTAS TLA
Sbjct  102  RGFGIIEDAKREVEKICPGVVSCADILTVAARDASAAVGGPSWTVKLGRRDSTTASKTLA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ETDLPGPFD L++LISSFA+KGL+TRDMVALSGAH++GQAQCFLFRDRIY NGTDIDAGF
Sbjct  162  ETDLPGPFDPLNRLISSFASKGLSTRDMVALSGAHTIGQAQCFLFRDRIYSNGTDIDAGF  221

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCP++  NGNLAPLDLVTPN FDNNY+KNL+QKKGLLQSDQVLF+GG+TDNIVS
Sbjct  222  ASTRRRQCPQEGENGNLAPLDLVTPNQFDNNYFKNLIQKKGLLQSDQVLFNGGSTDNIVS  281

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+ S RAF +DFA+AMIKM +I PL+GQNGIIRKVCG++N
Sbjct  282  EYSNSARAFSSDFAAAMIKMGDISPLSGQNGIIRKVCGSVN  322



>ref|XP_006361366.1| PREDICTED: lignin-forming anionic peroxidase-like [Solanum tuberosum]
Length=319

 Score =   384 bits (987),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/221 (81%), Positives = 201/221 (91%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ +IE AK E+EK+CPGIVSCAD+L+VAARDAS  VGGPSWTVKLGRRDSTTASHTLA
Sbjct  99   RGFGIIEDAKREVEKTCPGIVSCADILAVAARDASTLVGGPSWTVKLGRRDSTTASHTLA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ETDLPGPFD L +LIS FANKGL+TRDMVALSG+HS+GQAQCFLFRDRIYGNGTDIDAGF
Sbjct  159  ETDLPGPFDPLSRLISGFANKGLSTRDMVALSGSHSIGQAQCFLFRDRIYGNGTDIDAGF  218

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCP++  NGNLAPLDLVTPN  DNNY+KNL Q+KGLLQSDQVL SGG+TD+IV 
Sbjct  219  ASTRRRQCPQEDQNGNLAPLDLVTPNQLDNNYFKNLRQRKGLLQSDQVLLSGGSTDDIVL  278

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+ SPRAF +DFA+AMIKM +I PLTGQNGIIR VCGA+N
Sbjct  279  EYSNSPRAFASDFAAAMIKMGDISPLTGQNGIIRTVCGAIN  319



>ref|XP_006351919.1| PREDICTED: lignin-forming anionic peroxidase-like [Solanum tuberosum]
Length=319

 Score =   382 bits (982),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/221 (81%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ +IE AK E+EK+CPG+VSCAD+L+VAARDAS+ VGGPSWTVKLGRRDSTTASHTLA
Sbjct  99   RGFGIIEDAKREVEKTCPGVVSCADILAVAARDASSLVGGPSWTVKLGRRDSTTASHTLA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ETDLPGPFD L +LIS FANKGL+TRDMVALSG+HS+GQAQCFLFRDRIYGNGTDIDAGF
Sbjct  159  ETDLPGPFDPLSRLISGFANKGLSTRDMVALSGSHSIGQAQCFLFRDRIYGNGTDIDAGF  218

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR+CP++  NGNLAPLDLVTPN  DNNY+KNL Q+KGLLQSDQVL SGG+TD+IV 
Sbjct  219  ASTRRRRCPQEDQNGNLAPLDLVTPNQLDNNYFKNLRQRKGLLQSDQVLLSGGSTDDIVL  278

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+ SPRAF +DFA+AMIKM +I PLTGQNGIIR VCGA+N
Sbjct  279  EYSNSPRAFASDFAAAMIKMGDISPLTGQNGIIRTVCGAIN  319



>ref|XP_011070595.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   377 bits (969),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 204/221 (92%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+V+EAAKLE+E+ CPG+VSCAD+L++AARDAS AVGGPSW+VKLGRRDSTTAS +LA
Sbjct  102  RGYEVVEAAKLEVERICPGVVSCADILTLAARDASVAVGGPSWSVKLGRRDSTTASRSLA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLPGP  +LD LIS F NKGL+ RDMVALSGAH++GQAQCFLFRDRIY NGTDIDAGF
Sbjct  162  NSDLPGPSSSLDALISGFGNKGLSARDMVALSGAHTIGQAQCFLFRDRIYSNGTDIDAGF  221

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCP+++G+ NLAPLDLVTPNSFDNNY+KNL+Q+KGLLQSDQVLFSGG+TD+IVS
Sbjct  222  ASTRRRQCPQNSGDANLAPLDLVTPNSFDNNYFKNLMQRKGLLQSDQVLFSGGSTDSIVS  281

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P+ F +DFA+AMIKM EI+ LTGQNGIIR+VC A+N
Sbjct  282  EYSRTPQTFASDFANAMIKMGEIELLTGQNGIIRRVCSAIN  322



>gb|ABF48527.1| cell wall peroxidase [Capsicum annuum]
 gb|ABG73021.1| cell wall peroxidase [Capsicum annuum]
Length=322

 Score =   377 bits (969),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 177/221 (80%), Positives = 198/221 (90%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY +IE AK ELEK+CPGIVSCAD+L+VAARDAS  VGGPSWTVKLGRRDSTTASHTLA
Sbjct  102  RGYGIIEDAKRELEKTCPGIVSCADILAVAARDASTLVGGPSWTVKLGRRDSTTASHTLA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ETDLPGPFD L +LIS FA KGL+TRDMVALSG+HS+GQAQCFLFRDRIY NGTDIDAGF
Sbjct  162  ETDLPGPFDPLTRLISGFAKKGLSTRDMVALSGSHSIGQAQCFLFRDRIYSNGTDIDAGF  221

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR+CP++  NGNLAPLDLVTPN  DNNY+KNL Q+KGLLQSDQVL SGG+TD+IV 
Sbjct  222  ASTRRRRCPQEDQNGNLAPLDLVTPNQLDNNYFKNLRQRKGLLQSDQVLLSGGSTDDIVL  281

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+ SPRAF +DFA+AMI+M +I PLTG NGIIR VCGA+N
Sbjct  282  EYSNSPRAFASDFAAAMIRMGDISPLTGSNGIIRTVCGAIN  322



>ref|XP_011070596.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   375 bits (963),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 202/221 (91%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+V+EAAK E+E+ CPG+VSCAD+L++AARDAS AVGGPSW VKLGRRDSTTAS  LA
Sbjct  102  RGYEVVEAAKREVERICPGVVSCADILTLAARDASVAVGGPSWNVKLGRRDSTTASRALA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLPGP  +LD LIS F NKGL+ RDMVALSGAH++GQAQCFLFRDRIY NGTDIDAGF
Sbjct  162  NSDLPGPSSSLDALISGFGNKGLSARDMVALSGAHTIGQAQCFLFRDRIYSNGTDIDAGF  221

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCP+++G+GNLAPLDLVTPNSFDNNY+KNL+Q+KGLLQSDQVLFSGG+TD+IVS
Sbjct  222  ASTRRRQCPQNSGDGNLAPLDLVTPNSFDNNYFKNLMQRKGLLQSDQVLFSGGSTDSIVS  281

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P+ F +DFA+AMIKM EI+ LTGQNGIIR+VC A+N
Sbjct  282  EYSRTPQTFASDFANAMIKMGEIELLTGQNGIIRRVCSAIN  322



>ref|XP_011070600.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=304

 Score =   365 bits (938),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 171/221 (77%), Positives = 195/221 (88%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VIEAAK E+E+ CPG+VSCAD+L++AARDAS AVGGPSWTV+LGRRDSTTA+   A
Sbjct  84   RGFEVIEAAKREVERICPGVVSCADILTLAARDASVAVGGPSWTVRLGRRDSTTANRAQA  143

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLPGPF  LD LISSF NKGL  R+MVALSGAH+LGQAQCFLFR RIY NGTDID GF
Sbjct  144  NSDLPGPFSTLDGLISSFTNKGLIAREMVALSGAHTLGQAQCFLFRARIYSNGTDIDPGF  203

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCP+  G+ NLAPLDLVTPNSFDNNY+KNL Q+KGLLQSDQVLFSGG+TD+IVS
Sbjct  204  ASTRRRQCPQTGGDSNLAPLDLVTPNSFDNNYFKNLQQRKGLLQSDQVLFSGGSTDSIVS  263

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY RSP+ F  DFA+AMIKM EIQPLTGQ+GIIR+VC A+N
Sbjct  264  EYIRSPQTFARDFANAMIKMGEIQPLTGQSGIIRRVCNAIN  304



>ref|XP_009605441.1| PREDICTED: lignin-forming anionic peroxidase-like, partial [Nicotiana 
tomentosiformis]
Length=204

 Score =   359 bits (922),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 189/204 (93%), Gaps = 0/204 (0%)
 Frame = +2

Query  53   PGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLAETDLPGPFDNLDKLISS  232
            PGIVSCAD+L+VAARDAS  VGGP+W VKLGRRDSTTASHTLAETDLPGPFD L++LISS
Sbjct  1    PGIVSCADILAVAARDASTLVGGPTWAVKLGRRDSTTASHTLAETDLPGPFDPLNRLISS  60

Query  233  FANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGFASTRRRQCPKDTGNGNL  412
            FA+KGL+TRDMVALSGAHS+GQAQCFLFRDRIYGNGTDIDAGFASTRRRQCPK+  NGNL
Sbjct  61   FASKGLSTRDMVALSGAHSIGQAQCFLFRDRIYGNGTDIDAGFASTRRRQCPKEDQNGNL  120

Query  413  APLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVSEYARSPRAFQADFASAM  592
            APLDLVTPN  DNNY+KNL Q+KGLLQSDQVL SGG+TD+IVSEY+ SPRAF +DFA+AM
Sbjct  121  APLDLVTPNQLDNNYFKNLRQRKGLLQSDQVLLSGGSTDSIVSEYSNSPRAFASDFAAAM  180

Query  593  IKMSEIQPLTGQNGIIRKVCGALN  664
            I+M +I P+TGQNGIIR VCG+LN
Sbjct  181  IRMGDISPITGQNGIIRTVCGSLN  204



>ref|XP_011070599.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=321

 Score =   363 bits (932),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 198/221 (90%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VIEAAK E+E+ CPG+VSCADVL++AARDAS AVGGPSW VKLGRRDSTTAS + A
Sbjct  102  RGYEVIEAAKREVERVCPGVVSCADVLTLAARDASVAVGGPSWNVKLGRRDSTTASRSQA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TDLP PF  LD LIS+FANKGL+ RDMVALSGAH++GQAQCFLFR RIY NGTDIDAGF
Sbjct  162  NTDLPSPFAGLDTLISAFANKGLSARDMVALSGAHTIGQAQCFLFRGRIYSNGTDIDAGF  221

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCP++ G+GNLA LDLVTPNSFDNNY+KNL+Q+KGLLQSDQVLFSGG+TD+IVS
Sbjct  222  ASTRRRQCPQNGGDGNLAALDLVTPNSFDNNYFKNLMQRKGLLQSDQVLFSGGSTDSIVS  281

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+PR F +DFA+AMIKM EI P + QNGIIR+VC A+N
Sbjct  282  EYSRNPRIFASDFANAMIKMGEIPP-SQQNGIIRRVCSAIN  321



>emb|CDP08160.1| unnamed protein product [Coffea canephora]
Length=325

 Score =   360 bits (925),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/223 (75%), Positives = 199/223 (89%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VIEAAK E+EK CPG+VSCAD+LSVAARDAS AVGGP+W VKLGRRDSTTAS +LA
Sbjct  101  RGFEVIEAAKREVEKICPGVVSCADILSVAARDASVAVGGPTWQVKLGRRDSTTASFSLA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            +TDLP PF +L  LIS FA KGL+ R+MVALSG+H++GQAQCF+FR+RIY NGTDIDAGF
Sbjct  161  QTDLPSPFASLSDLISKFAAKGLSAREMVALSGSHTIGQAQCFVFRNRIYSNGTDIDAGF  220

Query  362  ASTRRRQCPKDTGNGN--LAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRRQCP   G G+  LAPLDLVTPNSFDNNY+KNL++KKGLL SDQVLFSGG+TD+I
Sbjct  221  ASTRRRQCPAANGVGDSKLAPLDLVTPNSFDNNYFKNLMRKKGLLISDQVLFSGGSTDSI  280

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+++PR F +DFASAM+KM +I+PLTGQNGIIRK+C A+N
Sbjct  281  VSEYSKNPRTFLSDFASAMVKMGDIEPLTGQNGIIRKICSAVN  323



>ref|XP_011070597.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   358 bits (919),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VIEAAK E+E+ CPG+VSCAD+L++AARDAS AVGGPSW VKLGRRDSTTAS + A
Sbjct  102  RGYQVIEAAKREVERVCPGVVSCADILTLAARDASVAVGGPSWNVKLGRRDSTTASRSQA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TDLP PF  +D LISSFANKGL+ RDMVALSGAH++GQAQCFLFR RI  NGTDIDA F
Sbjct  162  NTDLPSPFAGVDALISSFANKGLSARDMVALSGAHTIGQAQCFLFRSRINSNGTDIDARF  221

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            AS RRRQCP+  G+ NLAPLDLVTPNSFDNNY+KNL+Q+KGLLQSDQVLFSGG+TD+IVS
Sbjct  222  ASIRRRQCPQTGGDANLAPLDLVTPNSFDNNYFKNLMQRKGLLQSDQVLFSGGSTDSIVS  281

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+PR F +DF +AMIKM EIQPL  +NGIIR+ C A+N
Sbjct  282  EYSRNPRVFASDFGNAMIKMGEIQPLVRRNGIIRRTCSAIN  322



>emb|CDP16309.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   357 bits (917),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/223 (75%), Positives = 198/223 (89%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VIEAAKLE+EK CPG+VSCAD+LSVAARDAS AVGGP+W VKLGRRDSTTAS + A
Sbjct  100  RGFEVIEAAKLEVEKICPGVVSCADILSVAARDASVAVGGPTWQVKLGRRDSTTASRSAA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            +++LP PF NL  LI+ F NKGL+ RDMVALSG+H++GQAQCF+FR+R+Y NGTDIDAGF
Sbjct  160  DSNLPSPFANLGDLITKFQNKGLSPRDMVALSGSHTIGQAQCFVFRNRVYSNGTDIDAGF  219

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRRQCP   GNG  NLAPLDLVTPNSFDNNY+KNL++KKGLL SDQVLFSGG+TD+I
Sbjct  220  ASTRRRQCPSAIGNGDSNLAPLDLVTPNSFDNNYFKNLMRKKGLLISDQVLFSGGSTDSI  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+R+P  F ADFASAM+KM +I+PLTG +GIIRKVC A+N
Sbjct  280  VAEYSRNPGTFLADFASAMVKMGDIEPLTGTSGIIRKVCSAVN  322



>ref|XP_011070598.1| PREDICTED: lignin-forming anionic peroxidase-like [Sesamum indicum]
Length=322

 Score =   357 bits (917),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 165/221 (75%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VIEAAK E+E+ CPG+VSCAD+L++AA DAS AVGGPSW V+LGRRDSTTAS + A
Sbjct  102  RGYQVIEAAKREVERVCPGVVSCADILTLAALDASVAVGGPSWNVRLGRRDSTTASRSQA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TDLP PF  LD LISSFANKGL+ RDMVALSGAH++GQAQCFLFR RI  NGTDIDA F
Sbjct  162  NTDLPSPFAGLDALISSFANKGLSARDMVALSGAHTIGQAQCFLFRSRINSNGTDIDARF  221

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            AS RRRQCP+  G+ NLAPLDLVTPNSFDNNY+KNL+Q++GLLQSDQ+LFSGG+TD+IVS
Sbjct  222  ASIRRRQCPQSGGDANLAPLDLVTPNSFDNNYFKNLMQRRGLLQSDQILFSGGSTDSIVS  281

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+PR F +DF +AMIKM EIQPL G+NGIIR+ C A+N
Sbjct  282  EYSRNPRVFASDFGNAMIKMGEIQPLVGRNGIIRRTCSAVN  322



>ref|XP_007045348.1| Lignin-forming anionic peroxidase [Theobroma cacao]
 gb|EOY01180.1| Lignin-forming anionic peroxidase [Theobroma cacao]
Length=327

 Score =   345 bits (886),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 163/222 (73%), Positives = 190/222 (86%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK  +E  CPG+VSCAD+L+VAARDAS  VGGPSWTVKLGRRDSTTAS +LA
Sbjct  106  RGYEVIDQAKSAVENVCPGVVSCADILAVAARDASEYVGGPSWTVKLGRRDSTTASPSLA  165

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              DLP   D+L+ L+S F  KGL+ RDMVALSG+H++GQAQC  FRDRIY NG+DIDAGF
Sbjct  166  SRDLPRFTDSLESLLSLFGTKGLSARDMVALSGSHTIGQAQCVTFRDRIYSNGSDIDAGF  225

Query  362  ASTRRRQCPKDT-GNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIV  538
            ASTRRR CP    GNGNLAPLDLVTPNSFDNNY+KNLLQKKGLLQSDQVLFSGG+TD+IV
Sbjct  226  ASTRRRNCPTTANGNGNLAPLDLVTPNSFDNNYFKNLLQKKGLLQSDQVLFSGGSTDSIV  285

Query  539  SEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            SEY+R+P  F +DFASAMIKM +I+PLTG +GIIR++C A+N
Sbjct  286  SEYSRTPSTFSSDFASAMIKMGDIEPLTGSSGIIRRICSAVN  327



>ref|XP_004140450.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis sativus]
 ref|XP_004170186.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis sativus]
 gb|KGN50790.1| hypothetical protein Csa_5G262770 [Cucumis sativus]
Length=320

 Score =   345 bits (884),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 194/221 (88%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VI  AK E+EK CPG VSCAD+L+VAARDAS +VGGPSWTVKLGRRDST+AS TLA
Sbjct  101  RGYGVIHKAKTEVEKRCPGTVSCADILAVAARDASFSVGGPSWTVKLGRRDSTSASKTLA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E++LP   ++LD+LIS FANKGL+TRDMVALSG+H++GQ+QCFLFR+RIY N ++IDAGF
Sbjct  161  ESELPHFQESLDRLISIFANKGLSTRDMVALSGSHTIGQSQCFLFRNRIY-NQSNIDAGF  219

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A TR+R CP   GNGNLAPLDLVTPNSFDNNY+KNL+Q KGLL++DQVLFSGG+TDNIV+
Sbjct  220  ARTRQRNCPSSGGNGNLAPLDLVTPNSFDNNYFKNLIQMKGLLETDQVLFSGGSTDNIVT  279

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P  F++DFA+AMIKM +IQPLTG  G IR +CGA+N
Sbjct  280  EYSRNPSTFKSDFAAAMIKMGDIQPLTGLEGEIRNICGAVN  320



>ref|XP_008460239.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis melo]
Length=316

 Score =   344 bits (883),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/221 (74%), Positives = 192/221 (87%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VI  AK E+EK CPG+VSCAD+L+VAARDAS AVGGPSWTVKLGRRDSTTAS TLA
Sbjct  97   RGYGVIHKAKTEVEKICPGVVSCADILAVAARDASFAVGGPSWTVKLGRRDSTTASKTLA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E +LP     LD+LIS F+NKGL+TRDMVALSG+H++GQAQCFLFR+RIY N T+IDAGF
Sbjct  157  ENELPHFQAGLDRLISIFSNKGLSTRDMVALSGSHTIGQAQCFLFRNRIY-NQTNIDAGF  215

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR CP  +GNGNLAPLDLVTPNSFDNNY+KNL+Q+KGLL++DQVLF+GG+TD+IV+
Sbjct  216  ASTRRRNCPTSSGNGNLAPLDLVTPNSFDNNYFKNLVQRKGLLETDQVLFNGGSTDSIVT  275

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R P  F++DFA+AMIKM  IQPLTG  G IR +CG +N
Sbjct  276  EYSRDPTMFKSDFAAAMIKMGNIQPLTGLEGEIRNICGIVN  316



>ref|XP_002521867.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF40503.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=326

 Score =   344 bits (883),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 188/221 (85%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK E+EK CPG+VSCAD+LSVAARD+SA VGGPSWTV LGRRDSTTAS TLA
Sbjct  106  RGYEVIDKAKTEVEKICPGVVSCADILSVAARDSSAYVGGPSWTVMLGRRDSTTASRTLA  165

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             ++LP   D LD+LIS F +KGL+ RDMVALSGAH+LGQAQCF FRDRIY NGT+IDAGF
Sbjct  166  NSELPSFKDGLDRLISRFQSKGLSARDMVALSGAHTLGQAQCFTFRDRIYSNGTEIDAGF  225

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTR+R CP   G+ NLAPLDLVTPNSFDNNY+KNL+Q+KGLL+SDQ+L SGG+TD+IVS
Sbjct  226  ASTRKRSCPAVGGDANLAPLDLVTPNSFDNNYFKNLMQRKGLLESDQILLSGGSTDSIVS  285

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+RSP  F +DFASAMIKM  I PLTG  G IR++C A+N
Sbjct  286  GYSRSPSTFSSDFASAMIKMGNIDPLTGTAGQIRRICSAIN  326



>emb|CDP16312.1| unnamed protein product [Coffea canephora]
Length=261

 Score =   341 bits (874),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 163/223 (73%), Positives = 193/223 (87%), Gaps = 7/223 (3%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VIEAAK E+EK CPG+VSCAD+LSVAARDAS AVGGP+W VKLGRRDS TAS + A
Sbjct  44   RGFEVIEAAKREVEKICPGVVSCADILSVAARDASVAVGGPTWQVKLGRRDSITASRSAA  103

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E++LP PF NL  LIS+F NKGL+ RDMVALSG     QAQCF+FR+R+Y NGTDIDAGF
Sbjct  104  ESNLPSPFANLRDLISNFKNKGLSARDMVALSG-----QAQCFVFRNRVYSNGTDIDAGF  158

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRRQCP+  GNG  NLAPLDLVTPNSFDNNY+KNL++KKGLL SDQ LFSGG+TD+I
Sbjct  159  ASTRRRQCPQAVGNGDSNLAPLDLVTPNSFDNNYFKNLMRKKGLLISDQALFSGGSTDSI  218

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+PR F +DFASAM+KM +++PLTG +GIIRKVC A++
Sbjct  219  VSEYSRNPRTFLSDFASAMVKMGDLEPLTGASGIIRKVCSAVS  261



>gb|EYU30095.1| hypothetical protein MIMGU_mgv1a021792mg [Erythranthe guttata]
Length=320

 Score =   343 bits (879),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 189/221 (86%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VIEAAK E+E++CPG+VSCADVL++AARDAS AVGGPSW+V+LGRRDSTTAS + A
Sbjct  101  RGYEVIEAAKAEVERACPGVVSCADVLTLAARDASVAVGGPSWSVRLGRRDSTTASRSQA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              DLP PF  LD LIS+F  KGLN RDMVALSGAH+LGQAQCFLFR RIY NGTDIDA F
Sbjct  161  NIDLPSPFVGLDALISAFDIKGLNARDMVALSGAHTLGQAQCFLFRGRIYSNGTDIDANF  220

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A  +RR+CP+  G+ NLA LDLVTPNSFDNNYY+N++Q+KGLLQ+DQ+L S G+T  IV+
Sbjct  221  AKEKRRRCPQTGGDSNLAALDLVTPNSFDNNYYRNIVQRKGLLQTDQILLS-GSTSAIVT  279

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +Y+R+PR F ADFA AMIKMSEIQPL GQ GIIR+VC A+N
Sbjct  280  DYSRNPRTFAADFARAMIKMSEIQPLVGQAGIIRRVCSAIN  320



>ref|XP_010030093.1| PREDICTED: lignin-forming anionic peroxidase-like [Eucalyptus 
grandis]
Length=306

 Score =   341 bits (874),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK E+EK CPG+VSCAD+++VAARDAS AVG PSWTVKLGRRDSTTAS +LA
Sbjct  86   RGYEVIDDAKSEVEKICPGVVSCADIVAVAARDASVAVGSPSWTVKLGRRDSTTASPSLA  145

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP   D L++L+S FA KGL+ RDMVALSGAH+LGQAQCF FRDRIY NG++ID GF
Sbjct  146  SSDLPSFQDGLERLVSRFAGKGLSARDMVALSGAHTLGQAQCFTFRDRIYSNGSNIDTGF  205

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTR+R+CP   G+  LAPLDLVTPNSFDNNY+KNL+QKKGLL+SDQVLFSGG+TD+IVS
Sbjct  206  ASTRKRRCPASGGDATLAPLDLVTPNSFDNNYFKNLMQKKGLLESDQVLFSGGSTDSIVS  265

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +Y++ P +F++DFA+AMIKM +I PLTG +G IR++C ALN
Sbjct  266  DYSKKPASFKSDFAAAMIKMGDISPLTGSSGQIRRICSALN  306



>ref|XP_011024238.1| PREDICTED: peroxidase 5-like [Populus euphratica]
Length=365

 Score =   341 bits (874),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 189/221 (86%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK E+EK CPG+VSCAD+++VAARDASA VGGPSW VKLGRRDSTTAS TLA
Sbjct  146  RGYEVIDKAKSEVEKICPGVVSCADIIAVAARDASAYVGGPSWAVKLGRRDSTTASRTLA  205

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP  FD+LD+L+S F  KGL  RDMVALSG+H+LGQAQCF FRDRIY N ++IDAGF
Sbjct  206  NAELPAFFDSLDRLVSRFQKKGLTARDMVALSGSHTLGQAQCFTFRDRIY-NASNIDAGF  264

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTR+R+CP+  G  NLAPLDLVTPNSFDNNY+KNL++ KGLLQSDQVLF+GG+TD+IVS
Sbjct  265  ASTRKRRCPRTGGQANLAPLDLVTPNSFDNNYFKNLMRNKGLLQSDQVLFNGGSTDSIVS  324

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P  F++DFASAMIKM  I PLTG  G IR++C ALN
Sbjct  325  EYSRNPAKFRSDFASAMIKMGNIGPLTGSAGQIRRICSALN  365



>ref|XP_006387938.1| hypothetical protein POPTR_0466s00210g [Populus trichocarpa]
 gb|ERP46852.1| hypothetical protein POPTR_0466s00210g [Populus trichocarpa]
Length=316

 Score =   337 bits (865),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 188/221 (85%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK ++EK CPG+VSCAD+++VAARDASA VGGPSW VK GRRDSTTAS TLA
Sbjct  97   RGYEVIDKAKSKVEKICPGVVSCADIIAVAARDASAYVGGPSWAVKFGRRDSTTASRTLA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP  FD LD+LIS F  KGL  RDMVALSG+H+LGQAQCF FRDRIY N ++IDAGF
Sbjct  157  NAELPAFFDRLDRLISRFQKKGLTARDMVALSGSHTLGQAQCFTFRDRIY-NASNIDAGF  215

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTR+R+CP+  G  NLAPLDLVTPNSFDNNY+KNL++ KGLLQSDQVLF+GG+TD+IVS
Sbjct  216  ASTRKRRCPRAGGQANLAPLDLVTPNSFDNNYFKNLMRNKGLLQSDQVLFNGGSTDSIVS  275

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P  F +DFASAMIKM +I+PLTG  G IR++C A+N
Sbjct  276  EYSRNPAKFSSDFASAMIKMGDIRPLTGSAGQIRRICSAVN  316



>gb|EYU30092.1| hypothetical protein MIMGU_mgv1a010078mg [Erythranthe guttata]
Length=323

 Score =   337 bits (865),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 188/221 (85%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VIEAAKL +E++CPG+VSCADVL++AAR+AS AV GPSWTV+LGRRDSTTA+   A
Sbjct  104  RGYEVIEAAKLLVERACPGVVSCADVLTLAAREASVAVSGPSWTVRLGRRDSTTANRAQA  163

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP PF  L+ LISSFANKGLNTR+MVALSG+H+LGQAQCFLFR R+Y NGTDID  F
Sbjct  164  NSDLPSPFAGLNGLISSFANKGLNTREMVALSGSHTLGQAQCFLFRARVYSNGTDIDPNF  223

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            AS RRR CP+  GN NLAPLDLVTPNSFDNNY++N++ ++GLLQSDQ+L + GAT +IV+
Sbjct  224  ASERRRGCPQTGGNANLAPLDLVTPNSFDNNYFRNIVLRRGLLQSDQILLT-GATTSIVT  282

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+ +PR F  DFA+AMIKMSEI PL G  GIIR+VC A+N
Sbjct  283  EYSTNPRTFSTDFANAMIKMSEISPLLGSAGIIRRVCSAIN  323



>gb|AAQ55233.1| peroxidase, partial [Orobanche cernua var. cumana]
Length=248

 Score =   335 bits (858),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 184/221 (83%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVIEAAK  +E  CPG+VSCAD+L++AARDAS AVGGP+WTVKLGRRDSTTA+ T A
Sbjct  28   RGFDVIEAAKSAVEGICPGVVSCADILALAARDASVAVGGPTWTVKLGRRDSTTANRTQA  87

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TDLP PF NL  L+S+FANKGL+  DM ALSG+H+LGQAQCFLFR RIY NGTDID  F
Sbjct  88   NTDLPSPFANLQTLVSAFANKGLSQTDMAALSGSHTLGQAQCFLFRARIYSNGTDIDPTF  147

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            AS    QCP+  G+ NLAPLDLVTPN FDNNY+KNL+Q++GLLQSDQVLFSGG+T+  VS
Sbjct  148  ASNLTSQCPQSGGDSNLAPLDLVTPNFFDNNYFKNLIQRRGLLQSDQVLFSGGSTNTTVS  207

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +PR F ADFASAMI+MSEIQPL G +GIIR++C A N
Sbjct  208  RYSANPRMFAADFASAMIRMSEIQPLLGSSGIIRRICSATN  248



>ref|XP_006470943.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=323

 Score =   337 bits (865),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 192/221 (87%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI++ K +LE+ CPG+VSCAD+++VAARDAS AVGGPSWTVKLGRRDSTTAS +LA
Sbjct  104  RGFEVIDSVKSQLERVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASRSLA  163

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E +LP   D LDKLIS+FA KGLN RD+VALSGAH+LGQAQC  FRDRIY N ++IDAGF
Sbjct  164  E-NLPSFTDGLDKLISTFATKGLNARDLVALSGAHTLGQAQCAFFRDRIYSNQSNIDAGF  222

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCP + G+ NL+PLDLVTPNSFDNNY+KNL+QKKGLL SDQVLFSGG+TD+IV 
Sbjct  223  ASTRRRQCPANGGDSNLSPLDLVTPNSFDNNYFKNLIQKKGLLASDQVLFSGGSTDSIVD  282

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+++P  F++DFA+AMIKM++I PLTG  G IR+VC  +N
Sbjct  283  EYSKNPSKFKSDFAAAMIKMADISPLTGSAGEIRRVCNLVN  323



>ref|XP_009605266.1| PREDICTED: lignin-forming anionic peroxidase-like, partial [Nicotiana 
tomentosiformis]
Length=184

 Score =   332 bits (851),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/184 (84%), Positives = 174/184 (95%), Gaps = 0/184 (0%)
 Frame = +2

Query  113  VGGPSWTVKLGRRDSTTASHTLAETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSL  292
            VGGPSWTVKLGRRDSTTAS TLAETDLPGPFD L++LISSFA+KGL+ RDMVALSGAH++
Sbjct  1    VGGPSWTVKLGRRDSTTASKTLAETDLPGPFDPLNRLISSFASKGLSIRDMVALSGAHTI  60

Query  293  GQAQCFLFRDRIYGNGTDIDAGFASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLL  472
            GQAQCFLFRDRIYGNGTDIDAGFASTR+RQCP++  NGNLAPLDLVTPN FDNNY+KNL+
Sbjct  61   GQAQCFLFRDRIYGNGTDIDAGFASTRKRQCPQEGENGNLAPLDLVTPNQFDNNYFKNLI  120

Query  473  QKKGLLQSDQVLFSGGATDNIVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
            QKKGLLQSDQVLF+GG+TDNIVSEY+ SPRAF +DFA+AMIKM +I PLTGQNGIIRKVC
Sbjct  121  QKKGLLQSDQVLFNGGSTDNIVSEYSNSPRAFSSDFAAAMIKMGDISPLTGQNGIIRKVC  180

Query  653  GALN  664
            G++N
Sbjct  181  GSVN  184



>ref|XP_004140410.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis sativus]
 ref|XP_004140411.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis sativus]
 ref|XP_004170185.1| PREDICTED: lignin-forming anionic peroxidase-like [Cucumis sativus]
Length=316

 Score =   337 bits (863),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 190/221 (86%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VI  AK  +EK CPG+VSCAD+L+VAARDAS AVGGPSWTV+LGRRDSTTAS  LA
Sbjct  97   RGYGVIHNAKTAVEKICPGVVSCADILAVAARDASFAVGGPSWTVRLGRRDSTTASKALA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E +LP     LD+LIS F+NKGL+TRDMVALSG+H++GQAQCFLFR+RIY N T+IDAGF
Sbjct  157  ENELPHFQAGLDRLISIFSNKGLSTRDMVALSGSHTIGQAQCFLFRNRIY-NQTNIDAGF  215

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR CP  +GNGNLAPLDLVTPNSFDNNY+KNL+Q+KGLL++DQVLF+GG+TD+IV+
Sbjct  216  ASTRRRNCPTSSGNGNLAPLDLVTPNSFDNNYFKNLVQRKGLLETDQVLFNGGSTDSIVT  275

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY++ P  F++DFA+AMIKM  IQPLTG  G IR +CG +N
Sbjct  276  EYSKDPTMFKSDFAAAMIKMGNIQPLTGLEGEIRNICGIVN  316



>ref|XP_009603345.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
tomentosiformis]
Length=322

 Score =   336 bits (861),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 187/221 (85%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV+E AK ELEK CPG+VSCAD+L+VAARDAS AV GPSW VKLGRRDST A+ TLA
Sbjct  103  RGFDVVETAKRELEKICPGVVSCADILTVAARDASIAVCGPSWKVKLGRRDSTMANRTLA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              D+P PFDNLD LIS FA KGL+ ++MVALSGAH++GQ+QC  FR+RIY N +DIDA F
Sbjct  163  NIDIPRPFDNLDTLISRFAKKGLSAKEMVALSGAHTIGQSQCSSFRNRIY-NASDIDASF  221

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            AS RRRQCP++ GNG LAPLDLVT   FDNNY+KNL+QKKGLLQSDQVLFSGG  D+IVS
Sbjct  222  ASIRRRQCPRNGGNGTLAPLDLVTDKKFDNNYFKNLMQKKGLLQSDQVLFSGGLIDSIVS  281

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +Y+++  AF ADFA AM+KM++IQPLTG+NGIIR+VC  +N
Sbjct  282  KYSKTNSAFLADFAKAMVKMADIQPLTGRNGIIRRVCNNVN  322



>ref|XP_006470944.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=323

 Score =   336 bits (861),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 192/221 (87%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI++ K +LE+ CPG+VSCAD+++VAARDAS AVGGPSWTVKLGRRDSTTAS +LA
Sbjct  104  RGFEVIDSVKSQLERVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASRSLA  163

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E +LP   D LDKLIS+FA KGLN RD+VALSGAH++GQAQC  FRDRIY N ++IDAGF
Sbjct  164  E-NLPSFTDGLDKLISTFATKGLNARDLVALSGAHTIGQAQCAFFRDRIYNNQSNIDAGF  222

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCP + G+ NL+PLDLVTPNSFDNNY+KNL+QKKGLL SDQVLFSGG+TD+IV 
Sbjct  223  ASTRRRQCPANGGDSNLSPLDLVTPNSFDNNYFKNLIQKKGLLASDQVLFSGGSTDSIVD  282

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+++P  F++DFA+AMIKM++I PLTG  G IR+VC  +N
Sbjct  283  EYSKNPSKFKSDFAAAMIKMADISPLTGTAGQIRRVCNIVN  323



>ref|XP_009781728.1| PREDICTED: lignin-forming anionic peroxidase-like [Nicotiana 
sylvestris]
Length=313

 Score =   335 bits (858),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 185/221 (84%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV+EAAK ELEK CPG+VSCAD+L+VAARDAS AV GPSW VKLGRRDS TA+ TLA
Sbjct  94   RGFDVVEAAKRELEKICPGVVSCADILTVAARDASVAVCGPSWKVKLGRRDSRTANRTLA  153

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              D+P PFDNLD LIS FA KGL+ +DMV LSGAH++GQ+QC  FR+RIY N +DIDA F
Sbjct  154  NIDIPSPFDNLDTLISRFAKKGLSAKDMVVLSGAHTIGQSQCSSFRNRIY-NASDIDASF  212

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            AS  RRQCPK+ GNG LAPLDLVT   FDNNY+KNL+QKKGLLQSDQVLFSGG TD+IVS
Sbjct  213  ASITRRQCPKNGGNGTLAPLDLVTDKIFDNNYFKNLMQKKGLLQSDQVLFSGGLTDSIVS  272

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +Y+++   F  DFA AMIKM++IQPLTG+NGIIR+VC  +N
Sbjct  273  KYSKNNSVFFVDFAKAMIKMADIQPLTGRNGIIRRVCNTVN  313



>ref|XP_006378808.1| hypothetical protein POPTR_0010s24340g [Populus trichocarpa]
 ref|XP_006387937.1| Peroxidase 5 precursor family protein [Populus trichocarpa]
 gb|ERP46851.1| Peroxidase 5 precursor family protein [Populus trichocarpa]
 gb|ERP56605.1| hypothetical protein POPTR_0010s24340g [Populus trichocarpa]
 gb|AHL39167.1| class III peroxidase [Populus trichocarpa]
Length=317

 Score =   335 bits (858),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 189/221 (86%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK ++EK CPG+VSCAD+++VAARDASA VGGPSW VKLGRRDSTTAS  LA
Sbjct  98   RGYEVIDKAKSKVEKICPGVVSCADIIAVAARDASAYVGGPSWAVKLGRRDSTTASPALA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP  FD+L +LIS F  KGL  RDMVALSG+H+LGQAQCF FRDRIY N ++IDAGF
Sbjct  158  ITELPAFFDDLGRLISRFQQKGLTARDMVALSGSHTLGQAQCFTFRDRIY-NASNIDAGF  216

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTR+R+CP+  G  NLAPLDLVTPNSFDNNY+KNL++ KGLLQSDQVLF+GG+TD+IVS
Sbjct  217  ASTRKRRCPRAGGQANLAPLDLVTPNSFDNNYFKNLMRNKGLLQSDQVLFNGGSTDSIVS  276

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P  F +DFASAMIKM +I+PLTG  G IR++C A+N
Sbjct  277  EYSRNPAKFSSDFASAMIKMGDIRPLTGSAGQIRRICSAVN  317



>emb|CDP07980.1| unnamed protein product [Coffea canephora]
Length=321

 Score =   335 bits (858),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 185/221 (84%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VIE AK  +EK CPG+VSCAD+L+VAARD+SAAVGGPSWTVKLGRRDSTTAS +LA
Sbjct  101  RGFNVIEDAKTAVEKICPGVVSCADILAVAARDSSAAVGGPSWTVKLGRRDSTTASRSLA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ++DLP PF  L  LIS F+NKG   R+MVALSGAH++GQAQC  FR RIY NG DID GF
Sbjct  161  DSDLPAPFHQLSTLISLFSNKGFTPREMVALSGAHTVGQAQCRTFRGRIYSNGADIDTGF  220

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTR+RQCP   G+ NLAPLDLVTPN FDNNYYKNL+QKKGLL SDQ LF+G +TD  V+
Sbjct  221  ASTRQRQCPSTGGDSNLAPLDLVTPNQFDNNYYKNLVQKKGLLISDQTLFNGSSTDTFVT  280

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+++P+ F +DF +AM+KM ++ PLTGQ+GIIR+VC A+N
Sbjct  281  EYSQNPQTFSSDFGAAMVKMGDLSPLTGQDGIIRRVCSAIN  321



>gb|KDO57833.1| hypothetical protein CISIN_1g024722mg [Citrus sinensis]
Length=263

 Score =   332 bits (852),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 191/221 (86%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI++ K +LE+ CPG+VSCAD+++VAARDAS AVGGPSWTVKLGR+DSTTAS +LA
Sbjct  44   RGFEVIDSVKSQLERVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRKDSTTASRSLA  103

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E +LP   D LDKLIS+FA KGLN RD+VALSGAH++GQAQC  FRDRIY N ++IDAGF
Sbjct  104  E-NLPSFTDGLDKLISTFATKGLNARDLVALSGAHTIGQAQCAFFRDRIYNNQSNIDAGF  162

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCP + G+ NL+PLDLVTPNSFDNNY+KNL+QKKGLL SDQVLFSGG+TD IV 
Sbjct  163  ASTRRRQCPANGGDSNLSPLDLVTPNSFDNNYFKNLIQKKGLLASDQVLFSGGSTDYIVD  222

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+++P  F++DFA+AMIKM++I PLTG  G IR+VC  +N
Sbjct  223  EYSKNPSKFKSDFAAAMIKMADISPLTGTAGQIRRVCNIVN  263



>ref|XP_002509730.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF51117.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=323

 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 157/223 (70%), Positives = 188/223 (84%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ VI+ AK ++E  CPGIVSCAD+++VAARDAS AVGGPSWTVKLGRRDST+AS  LA
Sbjct  101  RGFQVIDNAKAQVESICPGIVSCADIVAVAARDASVAVGGPSWTVKLGRRDSTSASQRLA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            + +LPG  D+L+ LIS F  KGL+ RDMVALSGAH++GQA+C  FR RIY N +DIDAGF
Sbjct  161  DANLPGFTDSLESLISLFERKGLSARDMVALSGAHTIGQARCLTFRGRIYNNASDIDAGF  220

Query  362  ASTRRRQCPKDTGN--GNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRRQCP + GN  GNLA LDLVTPNSFDNNY++NL+QKKGLLQSDQVLFSGG+TDNI
Sbjct  221  ASTRRRQCPANNGNGDGNLAALDLVTPNSFDNNYFRNLIQKKGLLQSDQVLFSGGSTDNI  280

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+RSP  F +DFASAM+KM +I+PLTG  G IR++C  +N
Sbjct  281  VNEYSRSPSTFSSDFASAMVKMGDIEPLTGSQGEIRRLCNVVN  323



>emb|CBI27501.3| unnamed protein product [Vitis vinifera]
Length=265

 Score =   331 bits (848),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 192/223 (86%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+  K ++E  CPG+VSCAD+++VAARDAS AV GP+WTVKLGRRDSTT+  +LA
Sbjct  44   RGYEVIDNIKSKVESICPGVVSCADIVAVAARDASVAVSGPTWTVKLGRRDSTTSGLSLA  103

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D+LDKL+S F +KGL+ RDMVALSG+H++GQA+C  FRDR+Y NGTDIDAGF
Sbjct  104  ATNLPSFRDSLDKLVSLFGSKGLSARDMVALSGSHTIGQARCVTFRDRVY-NGTDIDAGF  162

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D GNG  NLAPL+LVTPNSFDNNY+KNL+Q+KGLLQSDQVLFSGG+TD I
Sbjct  163  ASTRRRRCPADNGNGDANLAPLELVTPNSFDNNYFKNLIQRKGLLQSDQVLFSGGSTDTI  222

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY++SP+ F++DFASAM+KM +I+PLTG  G+IRK C  +N
Sbjct  223  VNEYSKSPKTFRSDFASAMVKMGDIEPLTGSAGVIRKFCNVIN  265



>gb|EYU30094.1| hypothetical protein MIMGU_mgv1a0094071mg, partial [Erythranthe 
guttata]
Length=326

 Score =   333 bits (853),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 156/216 (72%), Positives = 184/216 (85%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VIEAAK E+E++CPG+VSCADVL++AARDAS AVGGPSW+V+LGRRDSTTAS + A
Sbjct  101  RGYEVIEAAKAEVERACPGVVSCADVLTLAARDASVAVGGPSWSVRLGRRDSTTASRSQA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              DLP PF  LD LIS+F  KGL  RDMVALSGAH+LGQAQCFLFR RIY NGTDIDA F
Sbjct  161  NIDLPSPFVGLDALISAFDIKGLTARDMVALSGAHTLGQAQCFLFRGRIYSNGTDIDANF  220

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A  +RR+CP+  G+ NLA LDLVTPNSFDNNYY+N++Q+KGLLQ+DQ+L S G+T  IV+
Sbjct  221  AKEKRRRCPQTGGDSNLAALDLVTPNSFDNNYYRNIVQRKGLLQTDQILLS-GSTSAIVT  279

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKV  649
            +Y+R+PR F ADFA AMIKMSEIQPL GQ GIIR+V
Sbjct  280  DYSRNPRTFAADFARAMIKMSEIQPLVGQAGIIRRV  315



>ref|XP_011024237.1| PREDICTED: lignin-forming anionic peroxidase-like [Populus euphratica]
Length=316

 Score =   332 bits (850),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 186/221 (84%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK E+EK CPG+VSCAD+++VAARDASA VGGPSW VKLGRRDSTTAS  LA
Sbjct  97   RGYEVIDKAKSEVEKICPGVVSCADIIAVAARDASAYVGGPSWAVKLGRRDSTTASPALA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D+L  LIS F  KGL  RDMVALSG+H+LGQAQCF FRDRIY N ++IDAGF
Sbjct  157  ITELPAFSDDLGTLISRFQQKGLTARDMVALSGSHTLGQAQCFTFRDRIY-NASNIDAGF  215

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTR+R+CP+  G  NLAPLDLVTPNSFDNNY+KNL++ KGLLQSDQVLF+GG+TD+IVS
Sbjct  216  ASTRKRRCPRTGGQANLAPLDLVTPNSFDNNYFKNLMRNKGLLQSDQVLFNGGSTDSIVS  275

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P  F +DFASAMIKM +I PLTG  G IR++C A+N
Sbjct  276  EYSRNPAKFSSDFASAMIKMGDISPLTGSAGQIRRICSAVN  316



>ref|XP_003556178.1| PREDICTED: lignin-forming anionic peroxidase-like [Glycine max]
Length=323

 Score =   332 bits (851),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 188/224 (84%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY++I+ AK E+EK CPG+VSCAD+++VAARDAS AVGGPSWTVKLGRRDSTTAS + A
Sbjct  100  RGYNIIDQAKSEVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASKSSA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP   D+LD LIS F NKGL  RDMV LSGAH++GQAQCF FR RIY N +DIDAGF
Sbjct  160  TSDLPRFTDDLDTLISKFNNKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDAGF  219

Query  362  ASTRRRQCPK---DTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            ASTR+R CP    D  +  LA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLFSGG+TD+
Sbjct  220  ASTRQRGCPSVSNDDNDKKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDS  279

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            IVSEY+++P  F++DFA+AMIKM +I+PLTG  G+IRK+C ++N
Sbjct  280  IVSEYSKNPTTFKSDFAAAMIKMGDIEPLTGSAGMIRKICSSVN  323



>gb|KHN00767.1| Lignin-forming anionic peroxidase [Glycine soja]
Length=326

 Score =   332 bits (851),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 188/224 (84%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY++I+ AK E+EK CPG+VSCAD+++VAARDAS AVGGPSWTVKLGRRDSTTAS + A
Sbjct  103  RGYNIIDQAKSEVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASKSSA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP   D+LD LIS F NKGL  RDMV LSGAH++GQAQCF FR RIY N +DIDAGF
Sbjct  163  TSDLPRFTDDLDTLISKFNNKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDAGF  222

Query  362  ASTRRRQCP---KDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            ASTR+R CP    D  +  LA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLFSGG+TD+
Sbjct  223  ASTRQRGCPSVSNDDNDKKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDS  282

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            IVSEY+++P  F++DFA+AMIKM +I+PLTG  G+IRK+C ++N
Sbjct  283  IVSEYSKNPTTFKSDFAAAMIKMGDIEPLTGSAGMIRKICSSVN  326



>emb|CBI27502.3| unnamed protein product [Vitis vinifera]
Length=266

 Score =   329 bits (844),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 191/223 (86%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E  CPG+VSCAD+L+VAARDAS AVGGP+WT+KLGRRDSTT+  + A
Sbjct  44   RGFEVIDNVKSQVENICPGVVSCADILAVAARDASVAVGGPTWTLKLGRRDSTTSGLSQA  103

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D LD+L S F++KGL+TRDMVALSG+H++GQA+C  FRDRIYGNGT+IDAGF
Sbjct  104  ATNLPTFRDGLDRLTSLFSSKGLSTRDMVALSGSHTIGQARCVTFRDRIYGNGTNIDAGF  163

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D GNG  NLAPLDLVTPNSFDNNY+KNL+Q+KGLLQSDQVLF+GG+TD+I
Sbjct  164  ASTRRRRCPADNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTDSI  223

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY++SP  F +DF+SAM+KM +I+PL G  G+IRK C  +N
Sbjct  224  VTEYSKSPSTFSSDFSSAMVKMGDIEPLIGSAGVIRKFCNVIN  266



>ref|XP_006589469.1| PREDICTED: lignin-forming anionic peroxidase-like [Glycine max]
 gb|KHN17056.1| Lignin-forming anionic peroxidase [Glycine soja]
Length=323

 Score =   332 bits (850),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 185/224 (83%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY++I+ AK E+EK CPG+VSCAD+++VAARDAS AVGGPSWTVKLGRRDSTTAS + A
Sbjct  100  RGYNIIDQAKSEVEKLCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASKSSA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP   D+LD LIS F NKGL  RDMV LSGAH++GQAQCF FR RIY N +DIDAGF
Sbjct  160  TSDLPRFTDDLDTLISRFNNKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDAGF  219

Query  362  ASTRRRQCPK---DTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            ASTR+R CP    D  +  LA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLFSGG+TD+
Sbjct  220  ASTRQRGCPSVSNDDNDKKLASLDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDS  279

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            IVSEY+  P  F++DFA+AMIKM +IQPLT   GIIRK+C ++N
Sbjct  280  IVSEYSNKPTTFKSDFAAAMIKMGDIQPLTASAGIIRKICSSIN  323



>ref|XP_007131640.1| hypothetical protein PHAVU_011G030200g [Phaseolus vulgaris]
 gb|ESW03634.1| hypothetical protein PHAVU_011G030200g [Phaseolus vulgaris]
Length=324

 Score =   331 bits (848),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 186/224 (83%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGYDVI+ AK E+EK CPG+VSCAD+++VA+RDAS AVGGPSWTVKLGRRDSTTAS + A
Sbjct  101  RGYDVIDQAKTEVEKVCPGVVSCADIVAVASRDASFAVGGPSWTVKLGRRDSTTASKSEA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP   D+L+ LIS F+ KGL  RDMV LSGAH++GQAQCF FR RIY N +DIDAGF
Sbjct  161  TSDLPLFIDDLETLISRFSKKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDAGF  220

Query  362  ASTRRRQCP---KDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            ASTR+R CP    D  +  LA LDLVTPNSFDNNY+KNL+QKKGLL SDQVLFSGG+ D+
Sbjct  221  ASTRQRGCPSLNSDDNDKKLAALDLVTPNSFDNNYFKNLIQKKGLLHSDQVLFSGGSADS  280

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            IVSEY+++P  F++DFA+AMIKM +IQPLTG  GIIRK+C ++N
Sbjct  281  IVSEYSKNPTTFKSDFAAAMIKMGDIQPLTGSAGIIRKICSSIN  324



>ref|XP_002269266.1| PREDICTED: lignin-forming anionic peroxidase-like [Vitis vinifera]
Length=326

 Score =   330 bits (847),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 192/223 (86%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+  K ++E  CPG+VSCAD+++VAARDAS AV GP+WTVKLGRRDSTT+  +LA
Sbjct  105  RGYEVIDNIKSKVESICPGVVSCADIVAVAARDASVAVSGPTWTVKLGRRDSTTSGLSLA  164

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D+LDKL+S F +KGL+ RDMVALSG+H++GQA+C  FRDR+Y NGTDIDAGF
Sbjct  165  ATNLPSFRDSLDKLVSLFGSKGLSARDMVALSGSHTIGQARCVTFRDRVY-NGTDIDAGF  223

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D GNG  NLAPL+LVTPNSFDNNY+KNL+Q+KGLLQSDQVLFSGG+TD I
Sbjct  224  ASTRRRRCPADNGNGDANLAPLELVTPNSFDNNYFKNLIQRKGLLQSDQVLFSGGSTDTI  283

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY++SP+ F++DFASAM+KM +I+PLTG  G+IRK C  +N
Sbjct  284  VNEYSKSPKTFRSDFASAMVKMGDIEPLTGSAGVIRKFCNVIN  326



>gb|AAY89058.1| class III peroxidase [Orobanche ramosa]
Length=325

 Score =   330 bits (847),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGYDVIE AK E+E  CP  VSCAD++++AARDAS AVGGP+WTVKLGRRDSTTA+   A
Sbjct  105  RGYDVIETAKREVESICPRNVSCADIVALAARDASVAVGGPTWTVKLGRRDSTTANPNEA  164

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TDLP PF +L  LI++F +KGL+  DMVALSG+H++GQ++CFLFR RIY NGTDID  F
Sbjct  165  NTDLPSPFASLQTLITAFDDKGLSETDMVALSGSHTIGQSRCFLFRSRIYSNGTDIDPNF  224

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRRQCP+  G+ NLAPLDLVTPNSFDNNY++NL+Q+KGLL+SDQVLF+GG+T+ +V+
Sbjct  225  ASTRRRQCPQTGGDNNLAPLDLVTPNSFDNNYFRNLIQRKGLLESDQVLFNGGSTNALVT  284

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +PR F  DFASAM++MSEIQPL G NGIIR+VC  +N
Sbjct  285  SYSNNPRLFATDFASAMVRMSEIQPLLGSNGIIRRVCNVIN  325



>ref|XP_007045344.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY01176.1| Peroxidase superfamily protein [Theobroma cacao]
Length=319

 Score =   330 bits (845),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 188/223 (84%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +EK CPG+VSCAD+L+VAARDAS  VGGPSWTVKLGRRDSTTAS  LA
Sbjct  96   RGFEVIDQAKSAVEKVCPGVVSCADILAVAARDASVYVGGPSWTVKLGRRDSTTASPCLA  155

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP P D+L +LIS F  KGL+ RDMVALSGAH++GQAQCF F++RIY NG++IDAGF
Sbjct  156  CSDLPRPNDSLKRLISRFRAKGLSARDMVALSGAHTIGQAQCFTFQERIYSNGSNIDAGF  215

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            AS RR +CP   G+G  NLA LDLVTPNSFDNNY+KNLLQKKGLLQSDQVLFSGG+TD+I
Sbjct  216  ASKRRLRCPATPGDGKSNLAALDLVTPNSFDNNYFKNLLQKKGLLQSDQVLFSGGSTDDI  275

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+P  F++DFA+AMIKM  I+P TG  GIIRK+C  +N
Sbjct  276  VSEYSRNPCTFKSDFATAMIKMGNIKPPTGSAGIIRKICSQVN  318



>ref|XP_010270789.1| PREDICTED: lignin-forming anionic peroxidase-like [Nelumbo nucifera]
Length=325

 Score =   330 bits (845),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 188/222 (85%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK ++E  CPG+VSCAD+++VAARDAS AVGGPSWTVKLGRRDSTTAS  LA
Sbjct  104  RGYEVIDKAKAQVENICPGVVSCADIVAVAARDASVAVGGPSWTVKLGRRDSTTASPDLA  163

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP    +LD LI  FA KGL+ RDMVALSG+H++GQA C  FR RIY N +DIDAGF
Sbjct  164  NSDLPSFTASLDTLIGQFAKKGLSARDMVALSGSHTIGQASCLTFRGRIYDNSSDIDAGF  223

Query  362  ASTRRRQCPKD-TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIV  538
            ASTR+R+CP D +G+GNLAPLDLVTPNSFDNNY+KNL+Q+KGLL SDQVLFSGG+TD+IV
Sbjct  224  ASTRKRRCPTDASGDGNLAPLDLVTPNSFDNNYFKNLIQRKGLLHSDQVLFSGGSTDSIV  283

Query  539  SEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +EY++SP  F++DFASAMIKM +I PLTG  G IR++C A+N
Sbjct  284  TEYSKSPNTFKSDFASAMIKMGDINPLTGSLGEIRRLCSAVN  325



>gb|AAB97853.1| ferriprotein porphyrin-containing peroxidase [Striga asiatica]
Length=322

 Score =   330 bits (845),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 156/221 (71%), Positives = 184/221 (83%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGYDVIEAAK E+E+ CPG+VSCAD+L++AARDASA VGGPSW V+LGRRDSTTA+   A
Sbjct  102  RGYDVIEAAKREVERVCPGVVSCADILTLAARDASAYVGGPSWNVRLGRRDSTTANRDQA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TDLP PF  L+ LIS+F  KGLNTRDMVALSGAH++GQAQCFLFR RIY NGTDIDAGF
Sbjct  162  NTDLPSPFATLNNLISAFDTKGLNTRDMVALSGAHTIGQAQCFLFRARIYSNGTDIDAGF  221

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTR R+CP+   + NLAPLDLVTPNSFDNNY+KN +Q+KGL+QSDQVLF+GG+T  IVS
Sbjct  222  ASTRTRRCPQTGRDANLAPLDLVTPNSFDNNYFKNFVQRKGLVQSDQVLFNGGSTATIVS  281

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +Y+ +PR F +DFASAMIK+ EI      NGI + VC A+N
Sbjct  282  QYSNNPRLFASDFASAMIKIGEIAMHGRPNGIYKVVCSAIN  322



>gb|EYU30097.1| hypothetical protein MIMGU_mgv1a010056mg [Erythranthe guttata]
Length=324

 Score =   330 bits (845),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 187/222 (84%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VIEAAK  +E+ CPG+VSCAD+L++AARDAS AVGGP+W V+LGRRDSTTA+   A
Sbjct  103  RGYEVIEAAKTLVERLCPGVVSCADILTLAARDASVAVGGPTWNVRLGRRDSTTANRDQA  162

Query  182  ETDLPGPFDNLDKLISSFANKG-LNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
              DLPGP   L +LI SF  K  L  RDMVALSGAH+LG AQC  FR RIY NGT+ID G
Sbjct  163  NRDLPGPDSTLQRLIDSFGIKNNLTPRDMVALSGAHTLGLAQCSSFRTRIYSNGTNIDPG  222

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIV  538
            FA+TRRR CP+  G+GNLAPLDLVTPNSFDNNY++NL+Q++GLLQSDQVL SGG+TD+IV
Sbjct  223  FATTRRRTCPQTGGDGNLAPLDLVTPNSFDNNYFRNLVQRRGLLQSDQVLLSGGSTDSIV  282

Query  539  SEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +EY+ +PR F ADFA+AMIKMSEI+P+TGQ+GIIR++C A+N
Sbjct  283  TEYSTTPRTFAADFATAMIKMSEIEPVTGQSGIIRRICTAIN  324



>gb|KDP38219.1| hypothetical protein JCGZ_04862 [Jatropha curcas]
Length=566

 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 186/221 (84%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGYD+IE AK E+EK+CPG+VSCAD+L+VAA++AS+ VGGPSWTV LGRRDSTTAS TLA
Sbjct  98   RGYDIIEKAKAEVEKTCPGVVSCADILAVAAKEASSYVGGPSWTVLLGRRDSTTASRTLA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   + LD LIS F +KGL  RDMVALSG+H++GQAQCF FRDRIY NGTDIDAGF
Sbjct  158  NTELPSFKEGLDSLISRFQSKGLGARDMVALSGSHTIGQAQCFTFRDRIYNNGTDIDAGF  217

Query  362  ASTRRRQCPKD--TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR CP     G+ NLA LDLVTPNSFDNNY+KNL+QKKGLL+SDQVLFSGG+TD+I
Sbjct  218  ASTRRRSCPAAGLGGDANLAALDLVTPNSFDNNYFKNLMQKKGLLESDQVLFSGGSTDSI  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGA  658
            VSEY+RSP  F ADFASAM+KM  I PLTG  G IR++C A
Sbjct  278  VSEYSRSPATFSADFASAMVKMGNIDPLTGTAGQIRRICTA  318


 Score =   337 bits (865),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 186/221 (84%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK E EK CPG+VSCAD+L+VAARDASA VGGPSWTV LGRRDSTTAS +LA
Sbjct  346  RGYEVIDKAKSEAEKICPGVVSCADILAVAARDASAYVGGPSWTVLLGRRDSTTASRSLA  405

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             ++LP   D LD LIS F  KGL+ RDMVALSG+H++GQAQCF FRDRIY NGT+IDAGF
Sbjct  406  NSELPSFKDGLDSLISRFQGKGLSVRDMVALSGSHTIGQAQCFTFRDRIYNNGTNIDAGF  465

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR CP   G+  LAPLDLVTPNSFDNNY+KNL+Q+KGLL+SDQVLFSGG+TD+IVS
Sbjct  466  ASTRRRTCPTIGGDARLAPLDLVTPNSFDNNYFKNLIQRKGLLESDQVLFSGGSTDSIVS  525

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+   F +DFASAMIKM  I PLTG  G IR++CGA+N
Sbjct  526  EYSRNRATFSSDFASAMIKMGNIDPLTGNAGQIRRICGAVN  566



>ref|XP_002269169.1| PREDICTED: lignin-forming anionic peroxidase [Vitis vinifera]
Length=331

 Score =   329 bits (844),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 191/223 (86%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E  CPG+VSCAD+L+VAARDAS AVGGP+WT+KLGRRDSTT+  + A
Sbjct  109  RGFEVIDNVKSQVENICPGVVSCADILAVAARDASVAVGGPTWTLKLGRRDSTTSGLSQA  168

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D LD+L S F++KGL+TRDMVALSG+H++GQA+C  FRDRIYGNGT+IDAGF
Sbjct  169  ATNLPTFRDGLDRLTSLFSSKGLSTRDMVALSGSHTIGQARCVTFRDRIYGNGTNIDAGF  228

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D GNG  NLAPLDLVTPNSFDNNY+KNL+Q+KGLLQSDQVLF+GG+TD+I
Sbjct  229  ASTRRRRCPADNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTDSI  288

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY++SP  F +DF+SAM+KM +I+PL G  G+IRK C  +N
Sbjct  289  VTEYSKSPSTFSSDFSSAMVKMGDIEPLIGSAGVIRKFCNVIN  331



>emb|CBI27506.3| unnamed protein product [Vitis vinifera]
Length=266

 Score =   327 bits (837),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 191/223 (86%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E  CPG+VSCAD+L+VAARD+S AVGGP+WTVKLGRRDSTT+  + A
Sbjct  44   RGFEVIDNVKSQVESICPGVVSCADILAVAARDSSVAVGGPTWTVKLGRRDSTTSGLSQA  103

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP   D LDKL+S F++KGLNTR+MVALSG+H++GQA+C  FRDRI+ NGT+IDAGF
Sbjct  104  AANLPSFRDGLDKLVSLFSSKGLNTREMVALSGSHTIGQARCVTFRDRIHDNGTNIDAGF  163

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D GNG  NLAPLDLVTPNSFDNNY+KNL+Q+KGLLQSDQVLF+GG+TD+I
Sbjct  164  ASTRRRRCPVDNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTDSI  223

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY++S   F +DFA+AM+KM +I PLTG NG IRK+C A+N
Sbjct  224  VTEYSKSRSTFSSDFAAAMVKMGDIDPLTGSNGEIRKLCNAIN  266



>ref|XP_010270786.1| PREDICTED: lignin-forming anionic peroxidase-like isoform X1 
[Nelumbo nucifera]
Length=315

 Score =   328 bits (842),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 188/222 (85%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VI+ AK ++E  CPG+VSCAD+L+VAARDAS AVGGPSWTVKLGR+DSTTAS  LA
Sbjct  94   RGYQVIDRAKAQVESICPGVVSCADILAVAARDASVAVGGPSWTVKLGRKDSTTASPDLA  153

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP    +LD LI  FA KGL+ RDMVALSG+H++GQA+C  FR RIY N +DIDAGF
Sbjct  154  NSDLPSFTASLDTLIDRFAKKGLSARDMVALSGSHTIGQARCLAFRGRIYDNSSDIDAGF  213

Query  362  ASTRRRQCPKD-TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIV  538
            ASTRRR+CP D +G+GNLAPLDLVTPNSFDNNY+KNL+Q+KGLL SDQVLFSGG+TD+IV
Sbjct  214  ASTRRRRCPTDASGDGNLAPLDLVTPNSFDNNYFKNLIQRKGLLHSDQVLFSGGSTDSIV  273

Query  539  SEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +EY+++P  F++DFASAMIKM +I PLTG  G IR++C A+N
Sbjct  274  TEYSKNPNTFKSDFASAMIKMGDINPLTGSLGEIRRLCSAVN  315



>ref|XP_010270787.1| PREDICTED: lignin-forming anionic peroxidase-like isoform X2 
[Nelumbo nucifera]
Length=312

 Score =   328 bits (841),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 155/222 (70%), Positives = 188/222 (85%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VI+ AK ++E  CPG+VSCAD+L+VAARDAS AVGGPSWTVKLGR+DSTTAS  LA
Sbjct  91   RGYQVIDRAKAQVESICPGVVSCADILAVAARDASVAVGGPSWTVKLGRKDSTTASPDLA  150

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP    +LD LI  FA KGL+ RDMVALSG+H++GQA+C  FR RIY N +DIDAGF
Sbjct  151  NSDLPSFTASLDTLIDRFAKKGLSARDMVALSGSHTIGQARCLAFRGRIYDNSSDIDAGF  210

Query  362  ASTRRRQCPKD-TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIV  538
            ASTRRR+CP D +G+GNLAPLDLVTPNSFDNNY+KNL+Q+KGLL SDQVLFSGG+TD+IV
Sbjct  211  ASTRRRRCPTDASGDGNLAPLDLVTPNSFDNNYFKNLIQRKGLLHSDQVLFSGGSTDSIV  270

Query  539  SEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +EY+++P  F++DFASAMIKM +I PLTG  G IR++C A+N
Sbjct  271  TEYSKNPNTFKSDFASAMIKMGDINPLTGSLGEIRRLCSAVN  312



>gb|AHL39166.1| class III peroxidase [Populus trichocarpa]
Length=316

 Score =   328 bits (840),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 185/221 (84%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK E+EK CPG+VSCAD+++VAARDASA VGGPSW VKLGRRDSTTAS TLA
Sbjct  97   RGYEVIDKAKAEVEKICPGVVSCADIIAVAARDASAYVGGPSWAVKLGRRDSTTASPTLA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D+L +LIS F  KGL  RDMVALSG+HSLGQAQCF FRDRI+ +  +IDAGF
Sbjct  157  ITELPAFSDDLGRLISRFQQKGLTARDMVALSGSHSLGQAQCFTFRDRIHSDN-NIDAGF  215

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTR+R+CP    +  LAPLDLVTPNSFDNNY+KNL+QKKGLLQSDQ LFSGG+TD+IVS
Sbjct  216  ASTRKRRCPLVGSDSTLAPLDLVTPNSFDNNYFKNLMQKKGLLQSDQELFSGGSTDSIVS  275

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P  F +DFASAMIKM +I PLTG  G IR++C A+N
Sbjct  276  EYSRNPAKFSSDFASAMIKMGDISPLTGSAGQIRRICSAVN  316



>gb|KHN32283.1| Lignin-forming anionic peroxidase [Glycine soja]
Length=267

 Score =   326 bits (835),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 188/224 (84%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK E+EK C G+VSCAD+++VAARDAS AVGGPSWTVKLGRRDSTTAS +LA
Sbjct  44   RGFNVIDQAKTEVEKVCSGVVSCADIMAVAARDASFAVGGPSWTVKLGRRDSTTASKSLA  103

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP   D+LD LIS F +KGL  RDMV LSGAH++GQAQCF FR RIY N +DIDAGF
Sbjct  104  SSDLPLFTDDLDTLISRFNSKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDAGF  163

Query  362  ASTRRRQCPK---DTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            ASTRRR CP    +  N  LA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVL+SGG+TD+
Sbjct  164  ASTRRRGCPSLNNNDNNKKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLYSGGSTDS  223

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            IVSEY+++P  F++DFA+AMIKM +I+PLTG  G+IRK+C ++N
Sbjct  224  IVSEYSKNPTTFKSDFAAAMIKMGDIEPLTGSAGMIRKICSSIN  267



>ref|XP_006378807.1| hypothetical protein POPTR_0010s24330g [Populus trichocarpa]
 gb|ERP56604.1| hypothetical protein POPTR_0010s24330g [Populus trichocarpa]
Length=316

 Score =   327 bits (839),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 185/221 (84%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK E+EK CPG+VSCAD+++VAARDASA VGGPSW VKLGRRDSTTAS TLA
Sbjct  97   RGYEVIDKAKAEVEKICPGVVSCADIIAVAARDASAYVGGPSWAVKLGRRDSTTASPTLA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D+L +LIS F  KGL  RDMVALSG+HSLGQAQCF FRDRI+ +  +IDAGF
Sbjct  157  ITELPAFSDDLGRLISRFQQKGLTARDMVALSGSHSLGQAQCFTFRDRIHSDN-NIDAGF  215

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTR+R+CP    +  LAPLDLVTPNSFDNNY+KNL+QKKGLLQSDQ LFSGG+TD+IVS
Sbjct  216  ASTRKRRCPLVGSDSTLAPLDLVTPNSFDNNYFKNLMQKKGLLQSDQELFSGGSTDSIVS  275

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P  F +DFASAMIKM +I PLTG  G IR++C A+N
Sbjct  276  EYSRNPAKFSSDFASAMIKMGDISPLTGTAGQIRRICSAVN  316



>ref|XP_004305595.1| PREDICTED: lignin-forming anionic peroxidase-like [Fragaria vesca 
subsp. vesca]
Length=326

 Score =   328 bits (840),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 179/223 (80%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK  +EK CPG+VSCAD+++VAARDAS AVGGPSW VKLGRRDSTTAS TLA
Sbjct  103  RGYEVIDDAKAAVEKLCPGVVSCADIVAVAARDASVAVGGPSWAVKLGRRDSTTASKTLA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E+ LP   DNL+ L + FA  GLN RD+VALSGAHS+GQAQCF FRDRIY   +DIDA F
Sbjct  163  ESSLPSFLDNLESLTNRFAGLGLNVRDLVALSGAHSIGQAQCFTFRDRIYNKTSDIDANF  222

Query  362  ASTRRRQCPKD--TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTR+  CP +   GN NLA LDLVTPN  DNNYYKNL+QKKGLL SDQVL+SGG+TD+I
Sbjct  223  ASTRKSSCPAEANVGNANLAALDLVTPNQLDNNYYKNLIQKKGLLASDQVLYSGGSTDSI  282

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+  P  F ADFA+AMIKM  I PLTG NG IR++C ALN
Sbjct  283  VSEYSSKPAKFIADFATAMIKMGNINPLTGSNGQIRRICSALN  325



>ref|XP_010270788.1| PREDICTED: lignin-forming anionic peroxidase-like [Nelumbo nucifera]
Length=325

 Score =   328 bits (840),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/222 (70%), Positives = 187/222 (84%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VI+ AK ++E  CPG+VSCAD+L+VAARDAS AVGGPSWTVKLGRRDSTTAS  LA
Sbjct  104  RGYQVIDRAKSQVESICPGVVSCADILAVAARDASIAVGGPSWTVKLGRRDSTTASPDLA  163

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP    +LD LI  FA KGL+ RDMVALSG+H++GQA C  FR RIY N +DIDAGF
Sbjct  164  NSDLPSFTASLDTLIGQFAKKGLSARDMVALSGSHTIGQASCLTFRGRIYDNSSDIDAGF  223

Query  362  ASTRRRQCPKD-TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIV  538
            ASTR+R+CP D +G+GNLAPLDLVTPNSFDNNY+KNL+Q+KGLL SDQVLFSGG+TD+IV
Sbjct  224  ASTRKRRCPTDASGDGNLAPLDLVTPNSFDNNYFKNLIQRKGLLHSDQVLFSGGSTDSIV  283

Query  539  SEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +EY++SP  F++DFASAMIKM +I PLTG  G IR++C A+N
Sbjct  284  TEYSKSPNTFKSDFASAMIKMGDINPLTGSLGEIRRLCSAVN  325



>emb|CAN80097.1| hypothetical protein VITISV_011206 [Vitis vinifera]
Length=331

 Score =   328 bits (840),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 190/223 (85%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E  CPG+VSCAD+L+VAARDAS AVGGP+WT+KLGRRDSTT+  + A
Sbjct  109  RGFEVIDNVKSQVENICPGVVSCADILAVAARDASVAVGGPTWTLKLGRRDSTTSGLSQA  168

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D LD+L S F++KGL+TRDMVALSG+H++GQA+C  FRDRIYGNGT+IDAGF
Sbjct  169  ATNLPTFRDGLDRLTSLFSSKGLSTRDMVALSGSHTIGQARCVTFRDRIYGNGTNIDAGF  228

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D GNG  NLAPLDLVTPNSFDNNY+KNL+Q+KGLLQSDQVLF+GG+TD+I
Sbjct  229  ASTRRRRCPADNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTDSI  288

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY++SP  F +DF+SAM+KM +I+PL G  G IRK C  +N
Sbjct  289  VTEYSKSPSTFSSDFSSAMVKMGDIEPLIGSAGXIRKFCNVIN  331



>ref|XP_007045349.1| Lignin-forming anionic peroxidase [Theobroma cacao]
 gb|EOY01181.1| Lignin-forming anionic peroxidase [Theobroma cacao]
Length=330

 Score =   328 bits (840),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 189/223 (85%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK ++E  CPG+VSCAD+L+VAARDAS  VGGPSWTVKLGRRDSTTAS +LA
Sbjct  108  RGYEVIDKAKSDVENICPGVVSCADILAVAARDASEYVGGPSWTVKLGRRDSTTASVSLA  167

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             ++LP    +L+ LI  F +KGL+ RDMVALSG+H++GQAQC  FR+RIY N +DIDAGF
Sbjct  168  TSELPRFTASLESLIDLFRSKGLSARDMVALSGSHTIGQAQCVTFRNRIYNNASDIDAGF  227

Query  362  ASTRRRQCPKDTGN--GNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP   GN  GNLA LDLVTPNSFDNNY+KNL+QKKGLL+SDQVLFSGG+TDNI
Sbjct  228  ASTRRRRCPATLGNGDGNLAALDLVTPNSFDNNYFKNLMQKKGLLESDQVLFSGGSTDNI  287

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+P  F++DFA+AMIKM +I+PLTG  GIIR++C  ++
Sbjct  288  VSEYSRNPSTFKSDFAAAMIKMGDIEPLTGSAGIIRRICSRVD  330



>ref|XP_002269145.1| PREDICTED: lignin-forming anionic peroxidase [Vitis vinifera]
Length=331

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 190/223 (85%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E  CPG+VSCAD+L+VAARDAS AVGGP+WT+KLGRRDSTT+  + A
Sbjct  109  RGFEVIDNVKSQVENICPGVVSCADILAVAARDASVAVGGPTWTLKLGRRDSTTSGLSQA  168

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D LD+L S F++KGL+TRDMVALSG+H++GQA+C  FRDRIYGNGT+IDAGF
Sbjct  169  ATNLPTFRDGLDRLTSLFSSKGLSTRDMVALSGSHTIGQARCVTFRDRIYGNGTNIDAGF  228

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D GNG  NLAPLDLVTPNSFDNNY+KNL+Q+KGLLQSDQVLF+GG+TD+I
Sbjct  229  ASTRRRRCPADNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTDSI  288

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY++SP  F +DF+SAM+KM +I+PL G  G IRK C  +N
Sbjct  289  VTEYSKSPSTFSSDFSSAMVKMGDIEPLIGSAGEIRKFCNVIN  331



>ref|XP_003538964.1| PREDICTED: lignin-forming anionic peroxidase-like [Glycine max]
Length=323

 Score =   327 bits (838),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 188/224 (84%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK E+EK C G+VSCAD+++VAARDAS AVGGPSWTVKLGRRDSTTAS +LA
Sbjct  100  RGFNVIDQAKTEVEKVCSGVVSCADIMAVAARDASFAVGGPSWTVKLGRRDSTTASKSLA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP   D+LD LIS F +KGL  RDMV LSGAH++GQAQCF FR RIY N +DIDAGF
Sbjct  160  SSDLPLFTDDLDTLISRFNSKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDAGF  219

Query  362  ASTRRRQCPK---DTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            ASTRRR CP    +  N  LA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVL+SGG+TD+
Sbjct  220  ASTRRRGCPSLNNNDNNKKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLYSGGSTDS  279

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            IVSEY+++P  F++DFA+AMIKM +I+PLTG  G+IRK+C ++N
Sbjct  280  IVSEYSKNPTTFKSDFAAAMIKMGDIEPLTGSAGMIRKICSSIN  323



>ref|XP_006387287.1| hypothetical protein POPTR_1332s00200g [Populus trichocarpa]
 gb|ERP46201.1| hypothetical protein POPTR_1332s00200g [Populus trichocarpa]
Length=267

 Score =   324 bits (831),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 187/221 (85%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK E+EK CPG+VSCAD+++VAARDASA VGGPS+ VKLGRRDSTTAS TLA
Sbjct  48   RGYNVIDKAKTEVEKICPGVVSCADIIAVAARDASAYVGGPSYAVKLGRRDSTTASRTLA  107

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP  F++L+ LIS F  KGL  RDMVALSG+H+LGQAQCF FR+RIY N ++IDAGF
Sbjct  108  NAELPAFFESLESLISRFQKKGLTARDMVALSGSHTLGQAQCFTFRERIY-NHSNIDAGF  166

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR+CP+   +  LAPLDLVTPNSFDNNY+KNL+Q KGLLQSDQVLF+GG+TD+IVS
Sbjct  167  ASTRRRRCPRVGSDATLAPLDLVTPNSFDNNYFKNLMQNKGLLQSDQVLFNGGSTDSIVS  226

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P  F++DF SAMIKM +I  LTG +G IR++C A+N
Sbjct  227  EYSRNPARFRSDFGSAMIKMGDIGLLTGSSGQIRRICSAVN  267



>dbj|BAA77388.1| peroxidase 2 [Scutellaria baicalensis]
Length=325

 Score =   326 bits (836),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 186/223 (83%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ VI+AAK  +E+ CPG+VSCAD+L++AARDAS AVGGPSWTV+LGRRDSTTA+   A
Sbjct  103  RGFQVIDAAKTAVERLCPGVVSCADILTLAARDASVAVGGPSWTVRLGRRDSTTANRAQA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TDLPGP   L +LI+ F  KGLN R+MVALSGAH+LGQ+QC  FR RIY NG+DI+A F
Sbjct  163  NTDLPGPTSTLTQLITRFDAKGLNAREMVALSGAHTLGQSQCGNFRARIYSNGSDIEANF  222

Query  362  ASTRRRQCPKD-TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIV  538
            ASTRRRQCP+D +G+ NLAPLDLVTPNSFDNNYY+NL+ ++GLLQSDQVL SGG TD IV
Sbjct  223  ASTRRRQCPQDGSGDSNLAPLDLVTPNSFDNNYYRNLVARRGLLQSDQVLLSGGETDAIV  282

Query  539  SEYARSPRAFQADFASAMIKMSEIQPLT-GQNGIIRKVCGALN  664
            + Y+ +P  F +DFA+AMIKM EIQPL  GQNGIIR+ CGA+N
Sbjct  283  TSYSSNPATFASDFANAMIKMGEIQPLQLGQNGIIRRTCGAVN  325



>ref|XP_002311022.2| hypothetical protein POPTR_0008s02340g [Populus trichocarpa]
 gb|EEE88389.2| hypothetical protein POPTR_0008s02340g [Populus trichocarpa]
Length=319

 Score =   326 bits (835),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 186/221 (84%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK E+EK CPG+VSCAD+++VAARDASA VGGPS+ VKLGRRDSTTAS TLA
Sbjct  99   RGYNVIDKAKTEVEKICPGVVSCADIIAVAARDASAYVGGPSYAVKLGRRDSTTASRTLA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP  F++L+ LIS F  KGL  RDMVALSG+H+LGQAQCF FR+RIY N ++IDAGF
Sbjct  159  NAELPAFFESLESLISRFQKKGLTARDMVALSGSHTLGQAQCFTFRERIY-NHSNIDAGF  217

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR+CP+   N  LAPLDLVTPNSFDNNY+KNL+Q KGLLQSDQVLF+GG+TD+IVS
Sbjct  218  ASTRRRRCPRVGSNSTLAPLDLVTPNSFDNNYFKNLMQNKGLLQSDQVLFNGGSTDSIVS  277

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P  F++DF SAMIKM +I  LTG  G IR++C A+N
Sbjct  278  EYSRNPARFKSDFGSAMIKMGDIGLLTGSAGQIRRICSAVN  318



>emb|CBI27505.3| unnamed protein product [Vitis vinifera]
Length=302

 Score =   325 bits (834),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 186/223 (83%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGYDVI+  K E+E  CPGIVSCAD+L+VAARDAS AV GP+WTV LGRRDSTT+  + A
Sbjct  80   RGYDVIDDVKSEVESICPGIVSCADILAVAARDASVAVSGPTWTVNLGRRDSTTSGLSQA  139

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D LD+LIS F +KGL+ RDMVALSG+H++GQA+C  FRDRIY NGTDIDAGF
Sbjct  140  ATNLPNFSDGLDRLISLFGSKGLSERDMVALSGSHTIGQARCVTFRDRIYDNGTDIDAGF  199

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP  +G+G  N+A LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLFSGG+TD+I
Sbjct  200  ASTRRRRCPATSGDGDDNIAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDSI  259

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+ Y++SP  F +DFASAM+KM  I+PLTG  G IRK+C A+N
Sbjct  260  VTGYSKSPSTFSSDFASAMVKMGNIEPLTGSAGEIRKLCSAIN  302



>ref|XP_010654887.1| PREDICTED: lignin-forming anionic peroxidase-like [Vitis vinifera]
Length=331

 Score =   326 bits (836),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 191/223 (86%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E  CPG+VSCAD+L+VAARD+S AVGGP+WTVKLGRRDSTT+  + A
Sbjct  109  RGFEVIDNVKSQVESICPGVVSCADILAVAARDSSVAVGGPTWTVKLGRRDSTTSGLSQA  168

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP   D LDKL+S F++KGLNTR+MVALSG+H++GQA+C  FRDRI+ NGT+IDAGF
Sbjct  169  AANLPSFRDGLDKLVSLFSSKGLNTREMVALSGSHTIGQARCVTFRDRIHDNGTNIDAGF  228

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D GNG  NLAPLDLVTPNSFDNNY+KNL+Q+KGLLQSDQVLF+GG+TD+I
Sbjct  229  ASTRRRRCPVDNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTDSI  288

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY++S   F +DFA+AM+KM +I PLTG NG IRK+C A+N
Sbjct  289  VTEYSKSRSTFSSDFAAAMVKMGDIDPLTGSNGEIRKLCNAIN  331



>gb|AES90060.2| lignin-forming anionic peroxidase [Medicago truncatula]
Length=324

 Score =   326 bits (835),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 184/225 (82%), Gaps = 4/225 (2%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +EK CPG+VSCAD+++VAARDAS AVGGPSWTVKLGRRDST AS + A
Sbjct  100  RGFEVIDKAKANVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTVASKSQA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP   D+L  LI+ F NKGL  +DMV LSGAH++GQAQCF FRDRIY N +DIDAGF
Sbjct  160  NSDLPKFTDDLTTLIAHFTNKGLTLKDMVTLSGAHTIGQAQCFTFRDRIYNNASDIDAGF  219

Query  362  ASTRRRQCP---KDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATD  529
            ASTRRR CP     T N  LA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLF  GG+TD
Sbjct  220  ASTRRRGCPSLSSTTNNQKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFGGGGSTD  279

Query  530  NIVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +IVSEY+++P  F++DFA+AMIKM +IQPLTG  GIIR +C A+N
Sbjct  280  SIVSEYSKNPTTFKSDFAAAMIKMGDIQPLTGSAGIIRSICSAIN  324



>ref|XP_002269058.1| PREDICTED: lignin-forming anionic peroxidase-like [Vitis vinifera]
Length=319

 Score =   325 bits (834),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 186/223 (83%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGYDVI+  K E+E  CPGIVSCAD+L+VAARDAS AV GP+WTV LGRRDSTT+  + A
Sbjct  97   RGYDVIDDVKSEVESICPGIVSCADILAVAARDASVAVSGPTWTVNLGRRDSTTSGLSQA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D LD+LIS F +KGL+ RDMVALSG+H++GQA+C  FRDRIY NGTDIDAGF
Sbjct  157  ATNLPNFSDGLDRLISLFGSKGLSERDMVALSGSHTIGQARCVTFRDRIYDNGTDIDAGF  216

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP  +G+G  N+A LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLFSGG+TD+I
Sbjct  217  ASTRRRRCPATSGDGDDNIAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDSI  276

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+ Y++SP  F +DFASAM+KM  I+PLTG  G IRK+C A+N
Sbjct  277  VTGYSKSPSTFSSDFASAMVKMGNIEPLTGSAGEIRKLCSAIN  319



>ref|XP_002521868.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF40504.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=323

 Score =   325 bits (834),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 181/221 (82%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VI  AK E+EK CPG+VSCAD+L+VAARDASA VGGPSWTV LGR+DSTTAS TLA
Sbjct  105  RGYGVIGKAKSEVEKICPGVVSCADILAVAARDASAYVGGPSWTVMLGRKDSTTASRTLA  164

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D LD+LISSF  KGL+ RDMVALSGAH+LGQAQCF FRDRIY NG DIDAGF
Sbjct  165  NTELPSFKDGLDRLISSFQIKGLSARDMVALSGAHTLGQAQCFTFRDRIYSNGPDIDAGF  224

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR CP    + NLA LDLVTPNSFDNNY+KNL+QKKGLL+SDQ+LFSGG+TD+IV 
Sbjct  225  ASTRRRGCPAIGDDANLAALDLVTPNSFDNNYFKNLIQKKGLLESDQILFSGGSTDSIVL  284

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+RSP  F +DFASAMIKM  I  L    G IRK+C A+N
Sbjct  285  EYSRSPATFNSDFASAMIKMGNI--LNANAGQIRKICSAVN  323



>ref|XP_004505715.1| PREDICTED: lignin-forming anionic peroxidase-like [Cicer arietinum]
Length=316

 Score =   325 bits (833),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 184/224 (82%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+++I+ AK  +EK CPG+VSCAD+++VAARDAS AVGGPSWTVKLGRRDSTTAS + A
Sbjct  93   RGFEIIDKAKAAVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASKSSA  152

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TDLP   D+L  LIS F NKGL  RDMV LSGAH++GQAQCF FR RIY N +DIDAGF
Sbjct  153  NTDLPLFTDDLQTLISRFNNKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDAGF  212

Query  362  ASTRRRQCPKDTGNGN---LAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            +STR+R CP  +   N   LA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLFSGG+TD+
Sbjct  213  SSTRQRGCPLSSSTTNDQKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDS  272

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            IVSEY+++P  F++DFA+AMIKM +IQPLT   G+IR +C A+N
Sbjct  273  IVSEYSKNPTTFKSDFAAAMIKMGDIQPLTASAGVIRSICSAVN  316



>ref|XP_003607863.1| Peroxidase [Medicago truncatula]
Length=321

 Score =   325 bits (834),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 184/225 (82%), Gaps = 4/225 (2%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +EK CPG+VSCAD+++VAARDAS AVGGPSWTVKLGRRDST AS + A
Sbjct  97   RGFEVIDKAKANVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTVASKSQA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP   D+L  LI+ F NKGL  +DMV LSGAH++GQAQCF FRDRIY N +DIDAGF
Sbjct  157  NSDLPKFTDDLTTLIAHFTNKGLTLKDMVTLSGAHTIGQAQCFTFRDRIYNNASDIDAGF  216

Query  362  ASTRRRQCP---KDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATD  529
            ASTRRR CP     T N  LA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLF  GG+TD
Sbjct  217  ASTRRRGCPSLSSTTNNQKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFGGGGSTD  276

Query  530  NIVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +IVSEY+++P  F++DFA+AMIKM +IQPLTG  GIIR +C A+N
Sbjct  277  SIVSEYSKNPTTFKSDFAAAMIKMGDIQPLTGSAGIIRSICSAIN  321



>ref|XP_007131639.1| hypothetical protein PHAVU_011G030100g [Phaseolus vulgaris]
 gb|ESW03633.1| hypothetical protein PHAVU_011G030100g [Phaseolus vulgaris]
Length=323

 Score =   325 bits (834),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 184/224 (82%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGYDVI+ AK E+EK CPG+VSCAD+++VAARDAS AVGGPSWTVK+GRRDSTTAS + A
Sbjct  100  RGYDVIDQAKTEVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKVGRRDSTTASKSEA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP   D++D LIS F  KGL  RDMV LSGAH++GQAQC  FR RIY N +DIDAGF
Sbjct  160  TSDLPRFTDDVDILISRFDKKGLTARDMVTLSGAHTIGQAQCSTFRGRIYNNASDIDAGF  219

Query  362  ASTRRRQCP---KDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            ASTR+R CP    D  +  LA LDLVTPNSFDNNY+KNL+QKKGLL SDQVLFSGG+TD+
Sbjct  220  ASTRQRGCPSLNSDENDKKLAALDLVTPNSFDNNYFKNLIQKKGLLHSDQVLFSGGSTDS  279

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            IVSEY+ +P  F++DFA+AMIKM +IQPLTG  GIIRK+C ++N
Sbjct  280  IVSEYSNNPTTFKSDFAAAMIKMGDIQPLTGSAGIIRKICSSVN  323



>ref|XP_004505714.1| PREDICTED: lignin-forming anionic peroxidase-like [Cicer arietinum]
Length=311

 Score =   325 bits (832),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 184/224 (82%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+++I+ AK  +EK CPG+VSCAD+++VAARDAS AVGGPSWTVKLGRRDSTTAS + A
Sbjct  88   RGFEIIDKAKAAVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASKSSA  147

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TDLP   D+L  LIS F NKGL  RDMV LSGAH++GQAQCF FR RIY N +DIDAGF
Sbjct  148  NTDLPLFTDDLQTLISRFNNKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDAGF  207

Query  362  ASTRRRQCPKDTGNGN---LAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            +STR+R CP  +   N   LA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLFSGG+TD+
Sbjct  208  SSTRQRGCPLSSSTTNDQKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDS  267

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            IVSEY+++P  F++DFA+AM+KM +IQPLT   GIIR +C A+N
Sbjct  268  IVSEYSKNPTTFKSDFAAAMVKMGDIQPLTASAGIIRSICSAVN  311



>ref|XP_008220986.1| PREDICTED: lignin-forming anionic peroxidase-like [Prunus mume]
Length=327

 Score =   325 bits (834),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 186/223 (83%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK ++EK CPG+VSCAD+L+VAARDAS AV GPSWTVKLGRRD+T AS   A
Sbjct  105  RGFEVIDDAKAQVEKICPGVVSCADILAVAARDASVAVSGPSWTVKLGRRDATRASQAQA  164

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E+DLP   D+LD+LIS F ++GL+ RD+VALSGAH++GQAQCF FRDRIY NG+DID+ F
Sbjct  165  ESDLPLFTDSLDRLISRFGDRGLSPRDLVALSGAHTIGQAQCFTFRDRIYSNGSDIDSNF  224

Query  362  ASTRRRQCP--KDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TRRR+CP     GN NLAPLDLVTPNSFD NY+KNL+QKKGLL+SDQVLFSGG+TD+I
Sbjct  225  ATTRRRRCPAAAPNGNANLAPLDLVTPNSFDYNYFKNLIQKKGLLESDQVLFSGGSTDSI  284

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+  P  F++DF  AMIKM ++ PLTG  G IR++C ALN
Sbjct  285  VSEYSSKPATFRSDFGIAMIKMGDVSPLTGSAGEIRRICTALN  327



>gb|KDP25492.1| hypothetical protein JCGZ_20648 [Jatropha curcas]
Length=320

 Score =   325 bits (833),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 158/223 (71%), Positives = 189/223 (85%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK ++E  CPGIVSCAD+L+VAARDAS AVGGPSWTVKLGRRDSTTAS TLA
Sbjct  98   RGYEVIDDAKAQVESVCPGIVSCADILAVAARDASVAVGGPSWTVKLGRRDSTTASRTLA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP    +L+ LIS F NKGL+ RDMVALSGAH++GQAQC  FR+RIY NG+DIDAGF
Sbjct  158  NANLPSFTASLESLISQFRNKGLSERDMVALSGAHTIGQAQCLTFRNRIYSNGSDIDAGF  217

Query  362  ASTRRRQCPKD--TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+ RRR+CP D  TGNGNLAPLDLVTPNSFDNNY++NLLQ+KGLL SDQVLFSGG+TD+I
Sbjct  218  ATIRRRRCPADPNTGNGNLAPLDLVTPNSFDNNYFRNLLQRKGLLHSDQVLFSGGSTDSI  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+ SP  F +DFASAM++M +I+PLTG  G IR++C  +N
Sbjct  278  VNEYSSSPSTFSSDFASAMVRMGDIEPLTGSQGQIRRLCRVVN  320



>ref|XP_006379469.1| hypothetical protein POPTR_0008s02330g [Populus trichocarpa]
 gb|ERP57266.1| hypothetical protein POPTR_0008s02330g [Populus trichocarpa]
 gb|AHL39157.1| class III peroxidase [Populus trichocarpa]
Length=319

 Score =   325 bits (832),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 186/221 (84%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK E+EK CPG+VSCAD+++VAARDASA VGGPS+ VKLGRRDSTTAS TLA
Sbjct  99   RGYNVIDKAKTEVEKICPGVVSCADIIAVAARDASAYVGGPSYAVKLGRRDSTTASRTLA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP  F++L+ LIS F  KGL  RDMVALSG+H+LGQAQCF FR+RIY N ++IDAGF
Sbjct  159  NAELPAFFESLESLISRFQKKGLTARDMVALSGSHTLGQAQCFTFRERIY-NHSNIDAGF  217

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR+CP+   N  LAPLDLVTPNSFDNNY+KNL+Q KGLLQSDQVLF+GG+TD+IVS
Sbjct  218  ASTRRRRCPRVGSNSTLAPLDLVTPNSFDNNYFKNLMQNKGLLQSDQVLFNGGSTDSIVS  277

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P  F++DF SAMIKM +I  LTG  G IR++C A+N
Sbjct  278  EYSRNPARFRSDFGSAMIKMGDIGLLTGSAGQIRRICSAVN  318



>ref|XP_002274693.1| PREDICTED: lignin-forming anionic peroxidase-like [Vitis vinifera]
Length=324

 Score =   325 bits (833),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 188/223 (84%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI   K ++E  CPGIVSCAD+L+VAARDAS AVGGP+WTVKLGRRDSTT+  +  
Sbjct  102  RGYEVIHDVKSQVESICPGIVSCADILAVAARDASVAVGGPTWTVKLGRRDSTTSGLSQV  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             ++LP   D+LD+LIS F +KGL+TRDMVALSG+H++GQA+C  FRDRIY NGTDIDAGF
Sbjct  162  SSNLPSFRDSLDRLISLFGSKGLSTRDMVALSGSHTIGQARCVTFRDRIYDNGTDIDAGF  221

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D G+G  NLA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLFSGG+TD+I
Sbjct  222  ASTRRRRCPADNGDGDDNLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+++ + F +DFA AM+KM +I+PLTG  G IR+ C A+N
Sbjct  282  VSEYSKNRKTFSSDFALAMVKMGDIEPLTGAAGEIREFCNAIN  324



>gb|KDP25488.1| hypothetical protein JCGZ_20644 [Jatropha curcas]
Length=320

 Score =   325 bits (832),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 185/223 (83%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E  CPGIVSCAD+++VAARDAS A GGPSWTV LGRRDSTTAS TLA
Sbjct  98   RGFNVIDNIKSQVESRCPGIVSCADIVAVAARDASVAAGGPSWTVNLGRRDSTTASKTLA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            + +LP   D LDKL S F++KGL+ RDMVALSGAH++GQA+C  FR RIY NG+DIDAGF
Sbjct  158  DNNLPAFTDTLDKLTSLFSSKGLSQRDMVALSGAHTIGQARCLTFRSRIYSNGSDIDAGF  217

Query  362  ASTRRRQCPKDTGN--GNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R CP D+GN  GNLAPLDLVTPN+FDNNYY+NL+ KKGLLQSDQVLFSGGATD+I
Sbjct  218  ANTRKRNCPSDSGNGDGNLAPLDLVTPNNFDNNYYRNLISKKGLLQSDQVLFSGGATDSI  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V++Y++    F++DFASAM+KM  I PLTG  G IR+VC  +N
Sbjct  278  VNQYSKDGSIFRSDFASAMVKMGNISPLTGSQGEIRRVCNVVN  320



>ref|XP_006470885.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=317

 Score =   324 bits (831),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 188/221 (85%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI++ K +LE  CPG+VSCAD+++VAARDAS AVGGPSWTVKLGRRDSTTAS +LA
Sbjct  98   RGFEVIDSVKSQLESVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASRSLA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E +LP   D LD+LIS+FA KG + RD+VALSGAH++GQAQC  FRDRIY N +DIDAGF
Sbjct  158  E-NLPSFTDGLDRLISTFATKGFSARDLVALSGAHTIGQAQCAFFRDRIYSNQSDIDAGF  216

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR+CP   G+ NL+PLDLVTP+SFDNNY+KNL+QKKGLL SDQVLFSGG+TD+IV 
Sbjct  217  ASTRRRECPASGGDSNLSPLDLVTPDSFDNNYFKNLVQKKGLLASDQVLFSGGSTDSIVD  276

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+++   F++DFA+AMIKM++I PLTG  G IR+VC  +N
Sbjct  277  EYSKNRSKFKSDFAAAMIKMADISPLTGTAGQIRRVCNLVN  317



>ref|XP_007045351.1| Lignin-forming anionic peroxidase [Theobroma cacao]
 gb|EOY01183.1| Lignin-forming anionic peroxidase [Theobroma cacao]
Length=330

 Score =   325 bits (832),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 186/223 (83%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK ++E  CPG+VSCAD+L+VAARDAS  VGGPSW VKLGRRDSTTAS +LA
Sbjct  108  RGYEVIDKAKSDVEHICPGVVSCADILAVAARDASEYVGGPSWRVKLGRRDSTTASVSLA  167

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             + LP    +L+ LI  F +KGL+ RDMVALSG+H++GQAQC  FR+RIY N +DIDAGF
Sbjct  168  TSQLPRFTASLESLIDLFRSKGLSARDMVALSGSHTIGQAQCVTFRNRIYNNASDIDAGF  227

Query  362  ASTRRRQCPKDTGN--GNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP   GN  GNLA LDLVTPNSFDNNY+KNL+QKKGLL+SDQVLFSGG TDNI
Sbjct  228  ASTRRRRCPATLGNGDGNLAALDLVTPNSFDNNYFKNLMQKKGLLESDQVLFSGGFTDNI  287

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+P  F++DFA+AMIKM +I+PLTG  GI R++C A+N
Sbjct  288  VSEYSRNPSTFKSDFATAMIKMGDIEPLTGSAGIARRICSAIN  330



>ref|XP_002521852.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF40488.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=325

 Score =   325 bits (832),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 182/221 (82%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VI+ AK  +EK CPGIVSCAD+L+VAARDASA VGGPSWTV LGR+DSTTAS TLA
Sbjct  107  RGYGVIDKAKSAVEKICPGIVSCADILAVAARDASAYVGGPSWTVMLGRKDSTTASRTLA  166

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             ++LP   D LD+LI  F +KGL+ RDMVALSG+H+LGQAQCF FRDRIY N T IDAGF
Sbjct  167  NSELPSFKDGLDRLIYRFQSKGLSARDMVALSGSHTLGQAQCFTFRDRIYTNSTSIDAGF  226

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR CP   G+  LA LDLVTPNSFDNNY+KNL+QKKGLL+SDQVLFSGG+TD+IVS
Sbjct  227  ASTRRRGCPAVGGDAKLAALDLVTPNSFDNNYFKNLIQKKGLLESDQVLFSGGSTDSIVS  286

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+RSP AF +DFASAMIKM  I  + G  G IRK+C A+N
Sbjct  287  EYSRSPAAFSSDFASAMIKMGNI--INGNAGQIRKICSAVN  325



>ref|XP_010654860.1| PREDICTED: lignin-forming anionic peroxidase-like [Vitis vinifera]
Length=331

 Score =   325 bits (832),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 190/223 (85%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+  K ++E  CPG+VSCAD+++VAARDAS AV GP+WTV+LGRRDSTT+  + A
Sbjct  109  RGYEVIDNIKSKVESLCPGVVSCADIVAVAARDASVAVSGPTWTVRLGRRDSTTSGLSQA  168

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D+LDKL+S F +KGL+ RDMVALSG+H++GQA+C  FRDRIY NGTDIDAGF
Sbjct  169  ATNLPSFRDSLDKLVSLFGSKGLSARDMVALSGSHTIGQARCVTFRDRIYDNGTDIDAGF  228

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP + GNG  NLAPL+LVTPNSFDNNY+KNL+++KGLLQSDQVLFSGG+TD I
Sbjct  229  ASTRRRRCPANNGNGDDNLAPLELVTPNSFDNNYFKNLIRRKGLLQSDQVLFSGGSTDTI  288

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY++SP+ F++DFASAM+KM +I+ LTG  G+IRK C  +N
Sbjct  289  VNEYSKSPKTFRSDFASAMVKMGDIEALTGSAGVIRKFCNVIN  331



>gb|AAB97854.1| ferriprotein porphyrin-containing peroxidase [Striga asiatica]
Length=321

 Score =   323 bits (829),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 182/221 (82%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVIEAAK ++E+ CPG+VSCAD+L+VAARDAS AV GPSW V+LGRRDSTTA+   A
Sbjct  101  RGFDVIEAAKRDVERLCPGVVSCADILAVAARDASVAVRGPSWNVRLGRRDSTTANRDAA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LPGPF  LD LI+SF NKGL+ RDMVALSG+H++GQAQCFLFR RIY NGTDID   
Sbjct  161  NRELPGPFSTLDGLITSFKNKGLSERDMVALSGSHTIGQAQCFLFRSRIYSNGTDIDPFK  220

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A  RR+ CP+  G GNL+PLDLVTPN  DNNY+KNL Q++GLL+SDQVLFSGG+TD++V 
Sbjct  221  ARLRRQSCPQTVGIGNLSPLDLVTPNRLDNNYFKNLRQRRGLLESDQVLFSGGSTDSLVF  280

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +P  F +DFA+AM+KMSEIQPL G NGIIR+VC A N
Sbjct  281  SYSINPHLFASDFANAMLKMSEIQPLLGSNGIIRRVCNATN  321



>ref|XP_006470886.1| PREDICTED: lignin-forming anionic peroxidase-like [Citrus sinensis]
Length=317

 Score =   323 bits (828),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 186/221 (84%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI++ K +LE  CPG+VSCAD+++VAARDAS AVGGPSW VKLGRRDSTTAS +LA
Sbjct  98   RGFEVIDSVKSQLESVCPGVVSCADIVAVAARDASFAVGGPSWAVKLGRRDSTTASRSLA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E +LP   D LDKLIS+FA KG   RD+VALSGAH++GQAQC  FRDRIY N +DIDAGF
Sbjct  158  E-NLPSFTDGLDKLISTFATKGFTARDLVALSGAHTIGQAQCAFFRDRIYSNQSDIDAGF  216

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            AS+RRRQCP   G+ NL+PLDLVTP+SFDNNY+KNL+QKKGLL SDQVLFSGG+TD+IV 
Sbjct  217  ASSRRRQCPASGGDSNLSPLDLVTPDSFDNNYFKNLVQKKGLLASDQVLFSGGSTDSIVD  276

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+++   F++DFA+AMIKM++I PLTG  G IR+VC  +N
Sbjct  277  EYSKNRSKFKSDFAAAMIKMADISPLTGTAGQIRRVCNLVN  317



>ref|XP_008350979.1| PREDICTED: lignin-forming anionic peroxidase-like [Malus domestica]
Length=328

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 183/223 (82%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK E+EK CPG+VSCAD+L+VAARDAS AV GPSWTVKLGRRDSTTAS  LA
Sbjct  106  RGFEVIDKAKAEVEKVCPGVVSCADILAVAARDASVAVSGPSWTVKLGRRDSTTASQXLA  165

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E+ LP   D+LD L   F + GLN RD+VALSGAH++GQA+C  FR RIY N +DID+ F
Sbjct  166  ESSLPLFTDSLDXLRERFGDLGLNARDLVALSGAHTIGQARCVTFRGRIYNNASDIDSNF  225

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R+CP D  NG  NLAPL+LVTPNSFDNNYYKNL+QKKGLL+SDQVLFSGG+TD+I
Sbjct  226  ATTRKRRCPADANNGDANLAPLELVTPNSFDNNYYKNLIQKKGLLESDQVLFSGGSTDSI  285

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+  P  F+ADF +AMIKM +I PLTG  G +R++C ALN
Sbjct  286  VSEYSSKPATFKADFITAMIKMGDINPLTGSAGEVRRICSALN  328



>ref|XP_007226601.1| hypothetical protein PRUPE_ppa023604mg [Prunus persica]
 gb|EMJ27800.1| hypothetical protein PRUPE_ppa023604mg [Prunus persica]
Length=304

 Score =   323 bits (827),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 186/223 (83%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK ++EK CPG+VSCAD+L+VAARDAS AV GPSWTVKLGRRD+T AS   A
Sbjct  82   RGFEVIDDAKAQVEKICPGVVSCADILAVAARDASVAVSGPSWTVKLGRRDATRASQAQA  141

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E+DLP   D+LD+LIS F ++GL+ RD+VALSGAH++GQAQCF FRDRIY NG+DID+ F
Sbjct  142  ESDLPLFTDSLDRLISRFGDRGLSPRDLVALSGAHTIGQAQCFTFRDRIYNNGSDIDSNF  201

Query  362  ASTRRRQCP--KDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TRRR+CP     GN NLAPLDLVTPNSFD NY+KNL+QKKGLL+SDQVLFSGG+TD+I
Sbjct  202  ATTRRRRCPAAAPNGNTNLAPLDLVTPNSFDYNYFKNLIQKKGLLESDQVLFSGGSTDSI  261

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+  P  F++DF  AMIKM ++ PLTG  G IR++C A+N
Sbjct  262  VSEYSSKPATFRSDFGIAMIKMGDVSPLTGSAGEIRRICTAVN  304



>emb|CBI27503.3| unnamed protein product [Vitis vinifera]
Length=357

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/219 (69%), Positives = 188/219 (86%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E  CPG+VSCAD+L+VAARDAS AVGGP+WT+KLGRRDSTT+  + A
Sbjct  109  RGFEVIDNVKSQVENICPGVVSCADILAVAARDASVAVGGPTWTLKLGRRDSTTSGLSQA  168

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D LD+L S F++KGL+TRDMVALSG+H++GQA+C  FRDRIYGNGT+IDAGF
Sbjct  169  ATNLPTFRDGLDRLTSLFSSKGLSTRDMVALSGSHTIGQARCVTFRDRIYGNGTNIDAGF  228

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D GNG  NLAPLDLVTPNSFDNNY+KNL+Q+KGLLQSDQVLF+GG+TD+I
Sbjct  229  ASTRRRRCPADNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTDSI  288

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
            V+EY++SP  F +DF+SAM+KM +I+PL G  G IRK C
Sbjct  289  VTEYSKSPSTFSSDFSSAMVKMGDIEPLIGSAGEIRKFC  327



>ref|XP_004298191.1| PREDICTED: lignin-forming anionic peroxidase-like [Fragaria vesca 
subsp. vesca]
Length=325

 Score =   320 bits (821),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 178/223 (80%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VI+ AK  +EK CPG+VSCAD+++VAARDAS AVGGP W VKLGRRDSTTAS TLA
Sbjct  103  RGYGVIDNAKAAVEKLCPGVVSCADIVAVAARDASVAVGGPDWAVKLGRRDSTTASKTLA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E+ LP   D+L+ L +  A  GLN RD+VALSGAHS+GQAQCF FRDRIY   +DIDA F
Sbjct  163  ESSLPSFLDSLESLTNRLAGLGLNVRDLVALSGAHSIGQAQCFTFRDRIYNETSDIDANF  222

Query  362  ASTRRRQCP--KDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR R+CP   + GN NLAPLDLVTPN  DNNY+KNL+QKKGLL SDQVLFSGG+TD++
Sbjct  223  ARTRGRRCPAAANDGNANLAPLDLVTPNQLDNNYFKNLIQKKGLLASDQVLFSGGSTDSV  282

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+  P  F+ADFA+AMIKM  I PLTG NG IR++C ALN
Sbjct  283  VSEYSSKPAKFKADFATAMIKMGNINPLTGSNGQIRRICSALN  325



>ref|XP_008350978.1| PREDICTED: LOW QUALITY PROTEIN: lignin-forming anionic peroxidase-like, 
partial [Malus domestica]
Length=255

 Score =   318 bits (814),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 183/223 (82%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK E+EK CPG+VSCAD+L+VAARDAS AV GPSWTVKLGRRDSTTAS  LA
Sbjct  34   RGFEVIDKAKAEVEKVCPGVVSCADILAVAARDASVAVSGPSWTVKLGRRDSTTASQXLA  93

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E+ LP   D+LD L   F + GLN RD+VALSGAH++GQA+C  FR RIY N +DID+ F
Sbjct  94   ESSLPLFTDSLDSLRERFGDLGLNARDLVALSGAHTIGQARCVTFRGRIY-NASDIDSNF  152

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R+CP D  NG  NLAPL+LVTPNSFDNNYYKNL+QKKGLL+SDQVLFSGG+TD+I
Sbjct  153  ATTRKRRCPADANNGDANLAPLELVTPNSFDNNYYKNLIQKKGLLESDQVLFSGGSTDSI  212

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+  P  F+ADF +AMIKM +I PLTG  G +R++C ALN
Sbjct  213  VSEYSSKPATFKADFITAMIKMGDINPLTGSAGEVRRICSALN  255



>gb|AHL39158.1| class III peroxidase [Populus trichocarpa]
Length=319

 Score =   320 bits (820),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 185/221 (84%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK E+EK CPG+VSCAD+++VAARDASA VGGPS+ VKLGRRDSTTAS TLA
Sbjct  99   RGYNVIDKAKNEVEKICPGVVSCADIIAVAARDASAYVGGPSYAVKLGRRDSTTASRTLA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP  F++L+ LIS F  KGL  RDMVALSG+H+LGQAQCF FR+RIY N ++IDAGF
Sbjct  159  NAELPAFFESLESLISRFQKKGLTARDMVALSGSHTLGQAQCFTFRERIY-NHSNIDAGF  217

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR+CP+   +  LAPLDLVTPNSFDNNY+KNL+Q KGLLQSDQVLF+GG+TD+IVS
Sbjct  218  ASTRRRRCPRVGSDATLAPLDLVTPNSFDNNYFKNLMQNKGLLQSDQVLFNGGSTDSIVS  277

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R    F++DF SAMIKM +I  LTG +G IR++C A+N
Sbjct  278  EYSRDRARFKSDFGSAMIKMGDIGLLTGSSGQIRRICSAVN  318



>ref|XP_011032836.1| PREDICTED: lignin-forming anionic peroxidase-like [Populus euphratica]
Length=318

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 184/221 (83%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VIE AK E+EK CPG+VSCAD+++VAARDAS+ VGGPS+ VKLGRRDSTTAS TLA
Sbjct  99   RGYNVIEKAKTEVEKICPGVVSCADIIAVAARDASSYVGGPSYAVKLGRRDSTTASRTLA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP  F++L+ LIS F  KGL  RDMVALSG+H+LGQAQCF FR+RIY N ++IDAGF
Sbjct  159  NAELPAFFESLESLISRFQKKGLTARDMVALSGSHTLGQAQCFTFRERIY-NDSNIDAGF  217

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR+CP+   +  LAPLDLVTPNSFDNNY+KNL++ KGLLQSDQVLF+GG+TD+IVS
Sbjct  218  ASTRRRRCPRVGSDATLAPLDLVTPNSFDNNYFKNLMRNKGLLQSDQVLFNGGSTDSIVS  277

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+R+P  F++DF SAMIKM +I  LTG  G IR+ C  +N
Sbjct  278  EYSRNPARFKSDFGSAMIKMGDIGLLTGSAGQIRRTCSVVN  318



>ref|XP_002509738.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF51125.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=320

 Score =   318 bits (814),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 182/223 (82%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K +LE  CPGIVSCAD+++VAARDAS A  GPSW+V LGRRDSTTAS +LA
Sbjct  98   RGFDVIDNIKSQLESRCPGIVSCADIVAVAARDASVAASGPSWSVNLGRRDSTTASRSLA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            +++LP   D+LD+L S F +KGL+ RDMVALSGAH++GQAQC  FR RIY N +DIDAGF
Sbjct  158  DSNLPAFTDSLDRLTSLFGSKGLSQRDMVALSGAHTIGQAQCVTFRGRIYNNASDIDAGF  217

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TRR QCP  +G+G  NLAPLDLVTPN FDNNY++NL+QKKGLLQSDQVLFSGGATD+I
Sbjct  218  AATRRSQCPAASGSGDSNLAPLDLVTPNIFDNNYFRNLIQKKGLLQSDQVLFSGGATDSI  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V++Y+R    F +DFASAM+KM  I PLTG  G IR+VC  +N
Sbjct  278  VNQYSRDSSVFSSDFASAMVKMGNISPLTGSQGQIRRVCNVVN  320



>ref|XP_002521866.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF40502.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=325

 Score =   318 bits (814),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 183/222 (82%), Gaps = 4/222 (2%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK  +EK CPG+VSCAD+L+VAARDASA VGGPSWTV+LGRRDS TAS TLA
Sbjct  106  RGYEVIDTAKSAVEKICPGVVSCADILAVAARDASAYVGGPSWTVRLGRRDSKTASRTLA  165

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              DLP   D LD+LIS F +KGL+ RDMVALSG+H+LGQAQCF FR+RIY NGT I+AGF
Sbjct  166  NRDLPSFRDGLDRLISRFRSKGLSARDMVALSGSHTLGQAQCFTFRERIYSNGTKIEAGF  225

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR+CP   G+ NLA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLFSGG+TD+IV 
Sbjct  226  ASTRRRRCPAIGGDANLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDSIVL  285

Query  542  EYARSPRAFQADFASAMIKMSE-IQPLTGQNGIIRKVCGALN  664
            EY+++   F +DFA+AM+KM   I P  G+   IR++C A+N
Sbjct  286  EYSKNRETFNSDFATAMVKMGNLINPSRGE---IRRICSAVN  324



>ref|XP_002890062.1| hypothetical protein ARALYDRAFT_312453 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66321.1| hypothetical protein ARALYDRAFT_312453 [Arabidopsis lyrata subsp. 
lyrata]
Length=321

 Score =   317 bits (813),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 184/223 (83%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK E+EK CPGIVSCAD+++VAARDAS  VGGP W VK+GRRDSTTA   LA
Sbjct  99   RGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTTAFKALA  158

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             + +LPG  DNLD+L   F+ KGLNTRD+VALSGAH++GQ+QCFLFRDR+Y N +DIDAG
Sbjct  159  NSGELPGFKDNLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDIDAG  218

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            FASTR+R+CP    +GNLA LDLVTPNSFDNNYYKNL+QKKGLL +DQVLF SG +TD I
Sbjct  219  FASTRKRRCPTVGSDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGASTDGI  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+   F ADFA+AMIKM +I+PLTG  G IRK+C  +N
Sbjct  279  VSEYSRNRSKFAADFATAMIKMGDIEPLTGSTGEIRKICSFVN  321



>gb|AAF43956.1|AC012188_33 Strong similarity to an Anionic Peroxidase Precursor from Nicotiana 
sylvestris gi|1076611 and contains a Peroxidase PF|00141 
domain [Arabidopsis thaliana]
Length=310

 Score =   316 bits (810),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 183/223 (82%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK E+EK CPGIVSCAD+++VAARDAS  VGGP W VK+GRRDST A   LA
Sbjct  88   RGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTAAFKALA  147

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             + +LPG  D LD+L   F+ KGLNTRD+VALSGAH++GQ+QCFLFRDR+Y N +DIDAG
Sbjct  148  NSGELPGFKDTLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDIDAG  207

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            FASTR+R+CP   G+GNLA LDLVTPNSFDNNYYKNL+QKKGLL +DQVLF SG +TD I
Sbjct  208  FASTRKRRCPTVGGDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGASTDGI  267

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+++   F ADFA+AMIKM  I+PLTG NG IRK+C  +N
Sbjct  268  VSEYSKNRSKFAADFATAMIKMGNIEPLTGSNGEIRKICSFVN  310



>ref|NP_172907.1| peroxidase 5 [Arabidopsis thaliana]
 sp|Q9M9Q9.2|PER5_ARATH RecName: Full=Peroxidase 5; Short=Atperox P5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE29180.1| peroxidase 5 [Arabidopsis thaliana]
Length=321

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 183/223 (82%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK E+EK CPGIVSCAD+++VAARDAS  VGGP W VK+GRRDST A   LA
Sbjct  99   RGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTAAFKALA  158

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             + +LPG  D LD+L   F+ KGLNTRD+VALSGAH++GQ+QCFLFRDR+Y N +DIDAG
Sbjct  159  NSGELPGFKDTLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDIDAG  218

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            FASTR+R+CP   G+GNLA LDLVTPNSFDNNYYKNL+QKKGLL +DQVLF SG +TD I
Sbjct  219  FASTRKRRCPTVGGDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGASTDGI  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+++   F ADFA+AMIKM  I+PLTG NG IRK+C  +N
Sbjct  279  VSEYSKNRSKFAADFATAMIKMGNIEPLTGSNGEIRKICSFVN  321



>ref|XP_002521851.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF40487.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=325

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/222 (68%), Positives = 182/222 (82%), Gaps = 4/222 (2%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+ AK  +EK CPG+VSCAD+L+VAARDASA VGGPSWTV+LGRRDS TAS TLA
Sbjct  106  RGYEVIDKAKSAVEKICPGVVSCADILAVAARDASAYVGGPSWTVRLGRRDSKTASRTLA  165

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              DLP   D LD+LIS F +KGL+ RDMVALSG+H+LGQAQCF FR+RIY NGT I+ GF
Sbjct  166  NRDLPSFRDGLDRLISRFRSKGLSARDMVALSGSHTLGQAQCFTFRERIYSNGTKIEGGF  225

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR+CP   G+ NLA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLFSGG+TD+IV 
Sbjct  226  ASTRRRRCPAVGGDANLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDSIVL  285

Query  542  EYARSPRAFQADFASAMIKMSE-IQPLTGQNGIIRKVCGALN  664
            EY+++   F +DFA+AM+KM   I P  G+   IR++C A+N
Sbjct  286  EYSKNRETFNSDFATAMVKMGNLINPSRGE---IRRICSAVN  324



>ref|XP_004297785.1| PREDICTED: lignin-forming anionic peroxidase-like [Fragaria vesca 
subsp. vesca]
Length=327

 Score =   315 bits (808),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 179/223 (80%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VI+ AK E+EK CPG+VSCAD+++VAARDAS AVGGP W+VKLGRRDSTTAS +LA
Sbjct  105  RGYGVIDNAKSEVEKLCPGVVSCADIVAVAARDASVAVGGPDWSVKLGRRDSTTASKSLA  164

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             + LP   D+L+ L + FA  GLN RD+VALSGAHS+GQAQCF FR RIY N +DIDA F
Sbjct  165  GSSLPSFLDSLESLTNRFAGLGLNARDLVALSGAHSIGQAQCFTFRGRIYSNTSDIDANF  224

Query  362  ASTRRRQCP--KDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR R CP   + G+ NLA LDLVTPN  DNNY+KNL+QKKGLL SDQVLFSGG+TD+I
Sbjct  225  ARTRGRTCPAAANDGDANLAALDLVTPNQLDNNYFKNLIQKKGLLASDQVLFSGGSTDSI  284

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+  P  F+ADFA+AMIKM +I PLTG NG IR++C ALN
Sbjct  285  VSEYSSKPANFKADFAAAMIKMGDINPLTGSNGQIRRICSALN  327



>ref|XP_010088521.1| Lignin-forming anionic peroxidase [Morus notabilis]
 gb|EXB36438.1| Lignin-forming anionic peroxidase [Morus notabilis]
Length=323

 Score =   315 bits (807),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 180/223 (81%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+V+E AK  +E  CPG+VSCAD+L+VAARDAS  VGGPSWTVKLGRRDSTTAS + A
Sbjct  101  RGYEVVEEAKSAVESICPGVVSCADILAVAARDASVVVGGPSWTVKLGRRDSTTASLSQA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ++DLP   D+L  LI+ F  KGL+TRDMVALSG+H++GQA+C  FR R+  N +DIDAGF
Sbjct  161  QSDLPNFTDDLQTLINLFNRKGLSTRDMVALSGSHTIGQARCLTFRGRVNSNTSDIDAGF  220

Query  362  ASTRRRQCPKDTG--NGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D    N  LAPLDLVTPN  DNNY+KNL+QKKGLLQSDQ+L+SG  T +I
Sbjct  221  ASTRRRRCPADVTKENSTLAPLDLVTPNQLDNNYFKNLIQKKGLLQSDQILYSGAPTKDI  280

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY++SP  F +DFASAMIKM +I+PLTG  G IRK+C A+N
Sbjct  281  VTEYSKSPSIFSSDFASAMIKMGDIEPLTGSAGEIRKICKAVN  323



>ref|XP_002299006.2| hypothetical protein POPTR_0001s46290g [Populus trichocarpa]
 gb|EEE83811.2| hypothetical protein POPTR_0001s46290g [Populus trichocarpa]
 gb|AHL39117.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 185/223 (83%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++V++ AK ++E  CPG+VSCAD+ +VAARDAS AVGGPSWTV+LGRRDSTTAS +LA
Sbjct  100  RGFEVVDDAKAQVESICPGVVSCADIAAVAARDASVAVGGPSWTVRLGRRDSTTASRSLA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ++D+P    +L  LI  F  KGL+ RDMVALSG+H++GQA+C  FR RIY N +DIDAGF
Sbjct  160  DSDIPRATTSLVNLIGMFNGKGLSERDMVALSGSHTIGQARCVTFRGRIYDNSSDIDAGF  219

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR CP  +GNG  NLAPLDLVTPNSFDNNY++NL+Q++GLLQSDQVLFSG +TD+I
Sbjct  220  ASTRRRNCPSASGNGNNNLAPLDLVTPNSFDNNYFRNLIQRRGLLQSDQVLFSGQSTDSI  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+R+P  F +DFA+AM++M +I+PLTG  G IR+VC  +N
Sbjct  280  VTEYSRNPSLFSSDFAAAMLRMGDIEPLTGSQGEIRRVCSVVN  322



>gb|AAZ42168.1| lignin peroxidase-like [Cucumis sativus]
Length=237

 Score =   311 bits (797),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 177/202 (88%), Gaps = 1/202 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY VI  AK  +EK CPG+VSCAD+L+VAARDAS AVGGPSWTV+LGRRDSTTAS  LA
Sbjct  37   RGYGVIHNAKTAVEKICPGVVSCADILAVAARDASFAVGGPSWTVRLGRRDSTTASKALA  96

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E +LP     LD+LIS F+NKGL+TRDMVALSG+H++GQAQCFLFR+RIY N T+IDAGF
Sbjct  97   ENELPHFQAGLDRLISIFSNKGLSTRDMVALSGSHTIGQAQCFLFRNRIY-NQTNIDAGF  155

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTRRR CP  +GNGNLAPLDLVTPNSFDNNY+KNL+Q+KGLL++DQVLF+GG+TD+IV+
Sbjct  156  ASTRRRNCPTSSGNGNLAPLDLVTPNSFDNNYFKNLVQRKGLLETDQVLFNGGSTDSIVT  215

Query  542  EYARSPRAFQADFASAMIKMSE  607
            EY++ P  F++DFA+AMIKM +
Sbjct  216  EYSKDPTMFKSDFAAAMIKMGK  237



>ref|XP_010476510.1| PREDICTED: peroxidase 5 [Camelina sativa]
Length=321

 Score =   314 bits (805),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 183/223 (82%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK E+EK CPGIVSCAD+++VAARDAS  VGGP W VK+GRRDST A   LA
Sbjct  99   RGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTAAFKALA  158

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             + +LPG  DNLD+L   F+ KGLNTRD+VALSGAH++GQ+QCFLFRDR+Y N +DIDAG
Sbjct  159  NSGELPGFKDNLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDIDAG  218

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            FASTR+R+CP    +GNLA LDLVTPNSFDNNYYKNL+QKKGLL +DQVLF SG +TD I
Sbjct  219  FASTRKRRCPTVGSDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGASTDGI  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+   F ADFA+AMIKM +I+PLTG  G IRK+C  +N
Sbjct  279  VSEYSRNRSKFAADFATAMIKMGDIEPLTGSTGEIRKLCSFVN  321



>ref|XP_011013621.1| PREDICTED: lignin-forming anionic peroxidase-like [Populus euphratica]
Length=322

 Score =   313 bits (802),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/223 (65%), Positives = 184/223 (83%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E  CPG+VSCAD+ +VAARDAS AVGGPSWTV+LGRRDSTTAS +LA
Sbjct  100  RGFEVIDEAKARVESICPGVVSCADIAAVAARDASVAVGGPSWTVRLGRRDSTTASQSLA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ++D+P    +L  LI  F  KGL+ RDMVALSG+H++GQA+C  FR RIY N +DIDAGF
Sbjct  160  DSDIPRTTTSLVNLIDMFNGKGLSERDMVALSGSHTIGQARCVTFRGRIYDNSSDIDAGF  219

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR CP  +G+G  NLAPLDLVTPNSFDNNY++NL+Q++GLLQSDQVLFSG +TD+I
Sbjct  220  ASTRRRNCPSASGDGNNNLAPLDLVTPNSFDNNYFRNLIQRRGLLQSDQVLFSGQSTDSI  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+R+P  F +DFA+AM++M +I+PLTG  G IR+VC  +N
Sbjct  280  VTEYSRNPSLFSSDFAAAMLRMGDIEPLTGSQGEIRRVCSVVN  322



>ref|XP_010458957.1| PREDICTED: peroxidase 5-like isoform X2 [Camelina sativa]
Length=321

 Score =   313 bits (801),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 183/223 (82%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK E+EK CPGIVSCAD+++VAARDAS  VGGP W VK+GRRDSTTA   LA
Sbjct  99   RGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTTAFKALA  158

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             + ++PG  DNLD+L   F+ KGLNTRD+VALSGAH++GQ+QCFLFRDR+Y N +DIDAG
Sbjct  159  NSGEVPGFKDNLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDIDAG  218

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            FASTR+R+CP    +GNLA LDLVTPNSFDNNYYKNL+QKKGLL +DQVLF SG +TD I
Sbjct  219  FASTRKRRCPTVGSDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGASTDGI  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+   F ADFA+AMIKM +I+PLT   G IR++C  +N
Sbjct  279  VSEYSRNRSKFAADFATAMIKMGDIEPLTASTGEIRRICSFVN  321



>ref|XP_006306491.1| hypothetical protein CARUB_v10012474mg [Capsella rubella]
 gb|EOA39389.1| hypothetical protein CARUB_v10012474mg [Capsella rubella]
Length=321

 Score =   311 bits (796),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 182/223 (82%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK E+EK CPGIVSCAD+L+VAARDAS  VGGP WTV+LGRRDST A   LA
Sbjct  99   RGFEVIDKAKSEVEKVCPGIVSCADILAVAARDASEYVGGPRWTVRLGRRDSTDAFKALA  158

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             + +LPG  D+LD+L   F+ KGLNTRD+VALSGAH++GQ+QCFLFRDR+Y N +DIDAG
Sbjct  159  NSGELPGFKDSLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDIDAG  218

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            FA TR+R CP    +GNLA LDLVTPNSFDNNYYKNL+QKKGLL +DQVLF SG +TD I
Sbjct  219  FARTRKRGCPTVGSDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGASTDGI  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+   F ADFA+AMIKM +I+PLTG  G IR++C  +N
Sbjct  279  VSEYSRNRLKFAADFATAMIKMGDIEPLTGSTGEIRRICSFVN  321



>ref|XP_006370761.1| Peroxidase 4 precursor family protein [Populus trichocarpa]
 gb|ERP67330.1| Peroxidase 4 precursor family protein [Populus trichocarpa]
 gb|AHL39118.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score =   310 bits (793),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 144/223 (65%), Positives = 183/223 (82%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK ++E  CPG+VSCAD+ +VAARDAS AVGGPSWTV+LGRRDSTTAS +LA
Sbjct  100  RGFEVIDDAKAQVESICPGVVSCADIAAVAARDASVAVGGPSWTVRLGRRDSTTASRSLA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ++D+P    +L  LI  F  KGL+ RDMVALSG+H++GQA+C  FR RIY N +DIDAGF
Sbjct  160  DSDIPRATTSLVNLIGMFNGKGLSERDMVALSGSHTIGQARCVTFRGRIYDNSSDIDAGF  219

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR CP  +GNG  NLAPLDLVTPNSFDNNY++NL+Q++GLLQSDQ LFSG +TD+I
Sbjct  220  ASTRRRNCPSASGNGNNNLAPLDLVTPNSFDNNYFRNLIQRRGLLQSDQELFSGQSTDSI  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+R+   F +DFA+AM++M +I+PLTG  G IR+VC  +N
Sbjct  280  VTEYSRNASLFSSDFAAAMLRMGDIEPLTGSQGEIRRVCSVVN  322



>ref|XP_010496213.1| PREDICTED: peroxidase 5-like [Camelina sativa]
Length=321

 Score =   307 bits (787),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 148/223 (66%), Positives = 180/223 (81%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK E+EK CPGIVSCAD+++VAARDAS  VGGP W VK+GRRDST A   LA
Sbjct  99   RGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDASEYVGGPKWAVKVGRRDSTAAFKALA  158

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             + +LPG  DNLD+L   F+ KGLNTRD+VALSGAH++GQ+QCFLFRDR+Y N +DIDA 
Sbjct  159  NSGELPGFKDNLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDIDAR  218

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            FASTR+R+CP    +GNLA LDLVTPNSFDNNYYKNL+QKKG L +DQVL  SG +TD I
Sbjct  219  FASTRKRRCPTVGSDGNLAALDLVTPNSFDNNYYKNLMQKKGFLVTDQVLVGSGASTDAI  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+   F ADFA+AMIKM +I+PLTG  G IR++C  +N
Sbjct  279  VSEYSRNRSKFAADFATAMIKMGDIEPLTGSTGEIRRICSFVN  321



>gb|KEH30580.1| lignin-forming anionic peroxidase [Medicago truncatula]
Length=308

 Score =   305 bits (780),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 176/225 (78%), Gaps = 17/225 (8%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ VI+ AK ++EK CPG+VSCAD++++AARDAS AVGGPSWTVKLGRRDST A     
Sbjct  97   RGFQVIDKAKADVEKVCPGVVSCADIVAIAARDASFAVGGPSWTVKLGRRDSTIA-----  151

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
                    ++L  LIS F NKGL  +DMV LSGAH++GQAQCF FRDRIY N +DID GF
Sbjct  152  --------NDLTTLISHFTNKGLTLKDMVTLSGAHTIGQAQCFTFRDRIYNNASDIDVGF  203

Query  362  ASTRRRQCPKD---TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATD  529
            ASTR+R CP     T N  LA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLF  GG+TD
Sbjct  204  ASTRQRGCPSSSTTTNNQKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFGGGGSTD  263

Query  530  NIVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +IVSEY+++P  F++DFA+AMIKM +IQPLTG  GIIR +C A+N
Sbjct  264  SIVSEYSKNPTTFKSDFAAAMIKMGDIQPLTGSAGIIRSICSAIN  308



>ref|XP_011038117.1| PREDICTED: lignin-forming anionic peroxidase-like [Populus euphratica]
Length=323

 Score =   302 bits (774),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 181/224 (81%), Gaps = 3/224 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E  CPG+VSCAD+ +VAARDAS AVGGPSWTV+LGRRDSTTAS +LA
Sbjct  100  RGFEVIDEAKARVESICPGVVSCADIAAVAARDASVAVGGPSWTVRLGRRDSTTASRSLA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            ++D+P     L  LI  F  KGL+ RDMVALSG+H++GQA+C  FR RIY N +DIDAGF
Sbjct  160  DSDIPRATTGLVNLIDMFNGKGLSERDMVALSGSHTIGQARCVTFRGRIYDNSSDIDAGF  219

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR CP  +G+G  NLAPLDLVTPNSFDNNY++NL+Q++GLLQSDQVLFSG +TD+I
Sbjct  220  ASTRRRNCPSASGDGNNNLAPLDLVTPNSFDNNYFRNLIQRRGLLQSDQVLFSGQSTDSI  279

Query  536  VSEYARSPRAFQADFASAMIKMS-EIQPLTGQNGIIRKVCGALN  664
            V+EY+R+P  F +DFA+AM++   +I+PLTG    IR+VC  +N
Sbjct  280  VTEYSRNPSLFSSDFAAAMLRTQGDIEPLTGSQVEIRRVCSVVN  323



>emb|CAN80096.1| hypothetical protein VITISV_011205 [Vitis vinifera]
Length=272

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 140/199 (70%), Positives = 174/199 (87%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E  CPG+VSCAD+L+VAARDAS AVGGP+WT+KLGRRDSTT+  + A
Sbjct  44   RGFEVIDNVKSQVENICPGVVSCADILAVAARDASVAVGGPTWTLKLGRRDSTTSGLSQA  103

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LP   D LD+L S F++KGL+TRDMVALSG+H++GQA+C  FRDRIYGNGT+IDAGF
Sbjct  104  ATNLPTFRDGLDRLTSLFSSKGLSTRDMVALSGSHTIGQARCVTFRDRIYGNGTNIDAGF  163

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D GNG  NLAPLDLVTPNSFDNNY+KNL+Q+KGLLQSDQVLF+GG+TD+I
Sbjct  164  ASTRRRRCPADNGNGDDNLAPLDLVTPNSFDNNYFKNLIQRKGLLQSDQVLFNGGSTDSI  223

Query  536  VSEYARSPRAFQADFASAM  592
            V+EY++SP  F +DF+SAM
Sbjct  224  VTEYSKSPSTFSSDFSSAM  242



>ref|XP_002509737.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF51124.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=322

 Score =   299 bits (766),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 179/221 (81%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG +VI+ AK ++E  CPGIVSCAD+L+VAARDAS A GGPSWTV LGRRDSTTAS   A
Sbjct  102  RGENVIDDAKAQVESICPGIVSCADILAVAARDASVAAGGPSWTVNLGRRDSTTASLAQA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLPG  D L++LIS F++KGLN RDMVALSGAH++GQAQC  FRDRIY N +DID  F
Sbjct  162  NSDLPGFSDPLNRLISLFSDKGLNERDMVALSGAHTIGQAQCVTFRDRIYNNASDIDPDF  221

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A+TRR  CP+  GNGNLAPLDLVTPN+FDNNYY NL+ K+GLL SDQ+LFSGG+TD+IV+
Sbjct  222  AATRRGNCPQTGGNGNLAPLDLVTPNNFDNNYYSNLIAKRGLLASDQILFSGGSTDSIVN  281

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+    +F +DFA+AM+KM  I PLTG  G IR++C A+N
Sbjct  282  EYSTDSSSFDSDFAAAMVKMGNISPLTGTQGEIRRICSAVN  322



>ref|XP_002509733.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
 gb|EEF51120.1| Lignin-forming anionic peroxidase precursor, putative [Ricinus 
communis]
Length=321

 Score =   298 bits (764),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 179/221 (81%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG +VI+ AK ++E  CPGIVSCAD+L+VAARDAS A GGPSWTV LGRRDSTTAS   A
Sbjct  101  RGENVIDDAKAQVESICPGIVSCADILAVAARDASVAAGGPSWTVNLGRRDSTTASLAQA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLPG  D L++LIS F++KGLN RDMVALSGAH++GQAQC  FRDRIY N +DID  F
Sbjct  161  NSDLPGFSDPLNRLISLFSDKGLNERDMVALSGAHTIGQAQCVTFRDRIYNNASDIDPDF  220

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A+TRR  CP+  GNGNLAPLDLVTPN+FDNNYY NL+ K+GLL SDQ+LFSGG+TD+IV+
Sbjct  221  AATRRGNCPQTGGNGNLAPLDLVTPNNFDNNYYSNLMAKRGLLASDQILFSGGSTDSIVN  280

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+    +F +DFA+AM+KM  I PLTG  G IR++C A+N
Sbjct  281  EYSTDSSSFDSDFAAAMVKMGNISPLTGTQGEIRRLCSAVN  321



>ref|XP_010527854.1| PREDICTED: peroxidase 5-like [Tarenaya hassleriana]
Length=321

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 181/223 (81%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VIE AK +++K CPG+VSCAD+L+VAARDAS  VGGP WTVKLGRRDST A   LA
Sbjct  99   RGYEVIEKAKSQVDKICPGVVSCADILTVAARDASEYVGGPKWTVKLGRRDSTRAFKALA  158

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            +  +LP   D+LD+L   F+ KGL+TRD VALSGAH++G+AQCFLFR+R+Y N +DID G
Sbjct  159  DGGELPSFKDSLDQLTRLFSRKGLDTRDFVALSGAHTIGKAQCFLFRERLYDNSSDIDRG  218

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            FA+TR+ +CP   G+ N+  LD+VTP+SFDNNYY+NL+QKKGLL +DQVLF  G ATD++
Sbjct  219  FAATRKTRCPAAGGDRNMEDLDMVTPDSFDNNYYRNLMQKKGLLATDQVLFGRGAATDSV  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+P  F +DFA+AM+KM++I PLTG  G IR++C A+N
Sbjct  279  VSEYSRNPSKFASDFAAAMVKMADIDPLTGSAGQIRRICSAVN  321



>gb|AAF63165.1|AC010657_1 T5E21.5 [Arabidopsis thaliana]
Length=315

 Score =   298 bits (762),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 146/223 (65%), Positives = 179/223 (80%), Gaps = 8/223 (4%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK E+EK CPGIVSCAD+++VAARDAS       + +K+GRRDST A   LA
Sbjct  99   RGFEVIDKAKSEVEKVCPGIVSCADIIAVAARDAS------EYVLKVGRRDSTAAFKALA  152

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             + +LPG  D LD+L   F+ KGLNTRD+VALSGAH++GQ+QCFLFRDR+Y N +DIDAG
Sbjct  153  NSGELPGFKDTLDQLSGLFSKKGLNTRDLVALSGAHTIGQSQCFLFRDRLYENSSDIDAG  212

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            FASTR+R+CP   G+GNLA LDLVTPNSFDNNYYKNL+QKKGLL +DQVLF SG +TD I
Sbjct  213  FASTRKRRCPTVGGDGNLAALDLVTPNSFDNNYYKNLMQKKGLLVTDQVLFGSGASTDGI  272

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+++   F ADFA+AMIKM  I+PLTG NG IRK+C  +N
Sbjct  273  VSEYSKNRSKFAADFATAMIKMGNIEPLTGSNGEIRKICSFVN  315



>emb|CDY66455.1| BnaAnng22270D [Brassica napus]
Length=317

 Score =   297 bits (761),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 180/223 (81%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VIE AK  +E+ CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDST A   +A
Sbjct  95   RGFEVIEQAKSAVERVCPGVVSCADIIAVAARDASEYVGGPKYAVKVGRRDSTAAFRAIA  154

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +LD+L   F  KGLNTRD+VALSGAH+LGQAQC  F++R+Y N +DIDAG
Sbjct  155  DSGDLPSFRASLDELSDLFLRKGLNTRDLVALSGAHTLGQAQCVTFKERLYDNSSDIDAG  214

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGA-TDNI  535
            F+STR+R+CP + G+ NLAPLDLVTPNSFDNNYY+NL+QKKGLL SDQVLF  GA TD+I
Sbjct  215  FSSTRKRRCPVNGGDTNLAPLDLVTPNSFDNNYYRNLMQKKGLLASDQVLFGAGASTDSI  274

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+P  F +DF +AMIKM +IQ LTG  G IR++C A+N
Sbjct  275  VSEYSRNPSRFASDFGAAMIKMGDIQTLTGSAGQIRRICTAVN  317



>emb|CDY65372.1| BnaC05g49640D [Brassica napus]
Length=317

 Score =   295 bits (756),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 180/223 (81%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E+ CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDST A   +A
Sbjct  95   RGFEVIDQAKSAVERVCPGVVSCADIIAVAARDASEYVGGPRYEVKVGRRDSTAAFRAIA  154

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +LD+L   F  KGLNTRD+VALSGAH+LGQAQC  F++R+Y N +DIDAG
Sbjct  155  DSGDLPSFRASLDELSDLFLRKGLNTRDLVALSGAHTLGQAQCVTFKERLYDNSSDIDAG  214

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGA-TDNI  535
            F+STR+R+CP + G+ NLAPLD VTPNSFDNNYY+NL+QKKGLL SDQVLF  GA TD+I
Sbjct  215  FSSTRKRRCPVNGGDTNLAPLDQVTPNSFDNNYYRNLMQKKGLLASDQVLFGAGASTDSI  274

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+P  F +DFA+AMIKM +IQ LTG  G IR++C A+N
Sbjct  275  VSEYSRNPSRFASDFAAAMIKMGDIQTLTGSAGQIRRICTAVN  317



>ref|XP_006848019.1| hypothetical protein AMTR_s00029p00173440 [Amborella trichopoda]
 gb|ERN09600.1| hypothetical protein AMTR_s00029p00173440 [Amborella trichopoda]
Length=318

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 175/221 (79%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+A K ++E  CPG+VSCAD+L+VAARD+S A+GGP+WTVKLGRRDS TAS T A
Sbjct  99   RGFEVIDAVKSKVESICPGVVSCADILAVAARDSSKAMGGPTWTVKLGRRDSATASETDA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP   DNLD+LIS F+ KGLNT+D+VALSG+H++GQAQC  FRDRI+ N  +ID+GF
Sbjct  159  NANLPSFTDNLDELISLFSRKGLNTQDLVALSGSHTIGQAQCSTFRDRIH-NEANIDSGF  217

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            ASTR+R CP    + NLAPLDLVTP SFDNNY+KNLLQ KGLL SDQVLF+ G+TD +V 
Sbjct  218  ASTRQRGCPTSGSDTNLAPLDLVTPTSFDNNYFKNLLQLKGLLHSDQVLFNNGSTDGLVR  277

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ S   F +DFASAM+KM +I PLTG +G IR  CG  N
Sbjct  278  TYSESRSTFYSDFASAMVKMGDIGPLTGSSGQIRTNCGVPN  318



>ref|XP_006305840.1| hypothetical protein CARUB_v10010887mg [Capsella rubella]
 gb|EOA38738.1| hypothetical protein CARUB_v10010887mg [Capsella rubella]
Length=316

 Score =   294 bits (752),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 179/223 (80%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E  CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDST A   +A
Sbjct  94   RGFEVIDQAKSTVESICPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTAAFRAIA  153

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +LD L   F  KGLNTRD+VALSGAH+LGQAQCF FRDR+Y N +DIDAG
Sbjct  154  DSGDLPSFSASLDTLSELFLRKGLNTRDLVALSGAHTLGQAQCFTFRDRLYDNSSDIDAG  213

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            F+STR+R+CP + G+   APLD VTPNSFDNNYY+NL+QKKGLL SDQVLF +G +TD+I
Sbjct  214  FSSTRKRRCPVNGGDTTGAPLDQVTPNSFDNNYYRNLMQKKGLLASDQVLFGTGASTDSI  273

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+R+P  F +DFA+AMIKM +IQ LTG +G IR++C A+N
Sbjct  274  VTEYSRNPSRFASDFAAAMIKMGDIQTLTGSDGQIRRICSAVN  316



>ref|XP_010458955.1| PREDICTED: peroxidase 4 [Camelina sativa]
Length=316

 Score =   293 bits (750),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 178/223 (80%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E  CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDST A   +A
Sbjct  94   RGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTAAFRAIA  153

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +LD L   F  KGLNTRD+VALSGAH+LGQAQC  FRDR+Y N +DID G
Sbjct  154  DSGDLPSFSASLDTLSDLFLRKGLNTRDLVALSGAHTLGQAQCSTFRDRLYDNSSDIDVG  213

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            F+STR+R+CP + G+  LAPLD VTPNSFDNNYY+NL+QKKGLL SDQVLF +G +TD+I
Sbjct  214  FSSTRKRRCPANGGDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLTSDQVLFGTGASTDSI  273

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+R+P  F +DFA+AMIKM +IQ LTG +G IR++C A+N
Sbjct  274  VTEYSRNPSRFASDFAAAMIKMGDIQTLTGSDGQIRRICSAVN  316



>ref|XP_006848018.1| hypothetical protein AMTR_s00029p00173190 [Amborella trichopoda]
 gb|ERN09599.1| hypothetical protein AMTR_s00029p00173190 [Amborella trichopoda]
Length=321

 Score =   293 bits (749),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/221 (64%), Positives = 171/221 (77%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ VIE AK  +E  CPG+VSCAD+L+VAARD+S  +GGPSWTVKLGRRDS TAS + A
Sbjct  102  RGFQVIEKAKSRVESICPGVVSCADILAVAARDSSVKLGGPSWTVKLGRRDSATASKSEA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E +LP     LD LIS F  KGL+ +D+VALSGAH++GQAQCF FRDRIY N T+ID+GF
Sbjct  162  ERELPLFTTPLDSLISRFRRKGLSAKDLVALSGAHTIGQAQCFTFRDRIY-NHTNIDSGF  220

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A  RR +CP + G+  LAPLDLVTP SFDNNY+K L+QKKGLL+SDQVLF+GG+TD IV 
Sbjct  221  ARKRRNRCPSNGGDSKLAPLDLVTPTSFDNNYFKILMQKKGLLESDQVLFNGGSTDEIVR  280

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y++S  AF +DFA AM+KM +I+PLTG  G IR  C   N
Sbjct  281  SYSKSRSAFYSDFAEAMVKMGDIEPLTGSAGQIRARCSVPN  321



>emb|CBI27504.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 170/199 (85%), Gaps = 2/199 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI   K ++E  CPGIVSCAD+L+VAARDAS AVGGP+WTVKLGRRDSTT+  +  
Sbjct  102  RGYEVIHDVKSQVESICPGIVSCADILAVAARDASVAVGGPTWTVKLGRRDSTTSGLSQV  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             ++LP   D+LD+LIS F +KGL+TRDMVALSG+H++GQA+C  FRDRIY NGTDIDAGF
Sbjct  162  SSNLPSFRDSLDRLISLFGSKGLSTRDMVALSGSHTIGQARCVTFRDRIYDNGTDIDAGF  221

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D G+G  NLA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLFSGG+TD+I
Sbjct  222  ASTRRRRCPADNGDGDDNLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAM  592
            VSEY+++ + F +DFA AM
Sbjct  282  VSEYSKNRKTFSSDFALAM  300



>emb|CDX81650.1| BnaC08g39510D [Brassica napus]
Length=316

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 179/223 (80%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E  CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDSTTA   +A
Sbjct  94   RGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTTAFRAIA  153

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +LD L   F  KGLNTRD+VALSGAH+LGQA C  F++R+Y N +DIDAG
Sbjct  154  DSGDLPSFRASLDDLSDLFLRKGLNTRDLVALSGAHTLGQATCVTFKERLYDNSSDIDAG  213

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            F+STR+R+CP + G+ NLAPLD VTPNSFDNNYY+NL+QKKGLL SDQVLF SG +TD+I
Sbjct  214  FSSTRKRRCPVNGGDTNLAPLDQVTPNSFDNNYYRNLMQKKGLLASDQVLFGSGASTDSI  273

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+P  F +D+A+AMIKM +IQ LTG  G IR++C A+N
Sbjct  274  VSEYSRNPSRFASDYAAAMIKMGDIQTLTGSAGQIRRICTAVN  316



>ref|NP_172906.1| peroxidase 4 [Arabidopsis thaliana]
 sp|Q9LE15.1|PER4_ARATH RecName: Full=Peroxidase 4; Short=Atperox P4; AltName: Full=ATP46; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAF43954.1|AC012188_31 Strong similarity to an Anionic Peroxidase Precursor from Nicotiana 
sylvestris gi|1076611 and contains a Peroxidase PF|00141 
domain. EST gb|AI996783 comes from this gene [Arabidopsis 
thaliana]
 gb|AAF63178.1|AC010657_14 T5E21.4 [Arabidopsis thaliana]
 gb|AEE29178.1| peroxidase 4 [Arabidopsis thaliana]
Length=315

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 178/222 (80%), Gaps = 1/222 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E  CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDST A   +A
Sbjct  94   RGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYDVKVGRRDSTNAFRAIA  153

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            + DLP    +L+ L   F  KGLNTRD+VALSGAH+LGQAQC  F+ R+Y N +DIDAGF
Sbjct  154  DRDLPNFRASLNDLSELFLRKGLNTRDLVALSGAHTLGQAQCLTFKGRLYDNSSDIDAGF  213

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNIV  538
            +STR+R+CP + G+  LAPLD VTPNSFDNNYY+NL+QKKGLL+SDQVLF +G +TD+IV
Sbjct  214  SSTRKRRCPVNGGDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLESDQVLFGTGASTDSIV  273

Query  539  SEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +EY+R+P  F +DF++AMIKM +IQ LTG +G IR++C A+N
Sbjct  274  TEYSRNPSRFASDFSAAMIKMGDIQTLTGSDGQIRRICSAVN  315



>ref|XP_006417000.1| hypothetical protein EUTSA_v10008244mg [Eutrema salsugineum]
 gb|ESQ35353.1| hypothetical protein EUTSA_v10008244mg [Eutrema salsugineum]
Length=316

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 179/223 (80%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E+ CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDST A   +A
Sbjct  94   RGFEVIDQAKSAVERVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTAAFRAIA  153

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +LD+L   F  KGLNTRD+VALSGAH+LGQAQC  F+ R+Y N +DIDAG
Sbjct  154  DSGDLPNFTASLDELSDLFLRKGLNTRDLVALSGAHTLGQAQCVTFKQRLYDNSSDIDAG  213

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            F+STR+R+CP + G+  LAPLD VTPNSFDNNYY+NL+QKKGLL +DQVLF +G +TDNI
Sbjct  214  FSSTRKRRCPVEGGDMTLAPLDQVTPNSFDNNYYRNLMQKKGLLATDQVLFGTGASTDNI  273

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+P  F +D+A+AMIKM +IQ LTG  G IR++C A+N
Sbjct  274  VSEYSRNPARFASDYAAAMIKMGDIQTLTGSAGQIRRICTAVN  316



>ref|XP_010496209.1| PREDICTED: peroxidase 4-like [Camelina sativa]
Length=317

 Score =   292 bits (747),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 178/223 (80%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E  CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDST A   +A
Sbjct  95   RGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTAAFRAIA  154

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +LD L   F  KGLNTRD+VALSGAH+LGQAQC  FRDR+Y N +DID G
Sbjct  155  DSGDLPSFSASLDTLSDLFLRKGLNTRDLVALSGAHTLGQAQCSTFRDRLYDNSSDIDVG  214

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            F+STR+R+CP + G+  LAPLD VTPNSFDNNYY+NL+QKKGLL SDQVLF +G +T++I
Sbjct  215  FSSTRKRRCPANGGDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLTSDQVLFGTGASTESI  274

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+R+P  F +DFA+AMIKM +IQ LTG +G IR++C A+N
Sbjct  275  VTEYSRNPSRFTSDFAAAMIKMGDIQALTGSDGQIRRICSAVN  317



>ref|XP_009148834.1| PREDICTED: peroxidase 4 [Brassica rapa]
Length=317

 Score =   291 bits (746),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 140/223 (63%), Positives = 179/223 (80%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E+ CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDST A   +A
Sbjct  95   RGFEVIDQAKSAVERVCPGVVSCADIIAVAARDASEYVGGPKYAVKVGRRDSTAAFRAIA  154

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +LD+L   F  KGLNTRD+VALSGAH+LGQAQC  F++R+Y N +DIDAG
Sbjct  155  DSGDLPSFRASLDELSDLFLRKGLNTRDLVALSGAHTLGQAQCVTFKERLYDNSSDIDAG  214

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGA-TDNI  535
            F+STR+R+CP + G+ NLAPLD VTPNSFDNNYY++L+QKKGLL SDQVLF  GA TD+I
Sbjct  215  FSSTRKRRCPVNGGDTNLAPLDQVTPNSFDNNYYRSLMQKKGLLASDQVLFGAGASTDSI  274

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+P  F +DF +AMIKM +IQ LTG  G IR++C A+N
Sbjct  275  VSEYSRNPSRFASDFGAAMIKMGDIQTLTGSAGQIRRICTAVN  317



>gb|KDP25489.1| hypothetical protein JCGZ_20645 [Jatropha curcas]
Length=309

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/223 (64%), Positives = 178/223 (80%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ VI+ AK ++E  CPG+ SCAD+++VAARDAS A  GPSWTV LGRRDSTTAS + A
Sbjct  87   RGFSVIDDAKSQIESICPGVFSCADIVAVAARDASVAASGPSWTVNLGRRDSTTASLSEA  146

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLPG  D+L +LIS F  KGL+ RDMVALSGAH+LGQA+C  FR RIY NG+DID  F
Sbjct  147  NSDLPGFTDSLTRLISLFGEKGLSERDMVALSGAHTLGQARCLTFRARIYSNGSDIDPDF  206

Query  362  ASTRRRQCPKDT--GNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+  CP DT  G+GNLAPLDLVTPN+FDNNYY N++ ++GLLQSDQVLFSGG+TD+I
Sbjct  207  ATTRQGNCPSDTNSGSGNLAPLDLVTPNTFDNNYYSNIIARRGLLQSDQVLFSGGSTDSI  266

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+    +F +DFA+AM++M  I PLTG  G IR++C A+N
Sbjct  267  VNEYSSDGSSFSSDFAAAMVRMGNIDPLTGTQGEIRRICTAIN  309



>ref|XP_004517147.1| PREDICTED: lignin-forming anionic peroxidase-like, partial [Cicer 
arietinum]
Length=225

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 164/198 (83%), Gaps = 3/198 (2%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+++I+ AK  +EK CPG+VSCAD+++VAARDAS AVGGPSWTVKLGRRDSTTAS + A
Sbjct  28   RGFEIIDKAKAAVEKVCPGVVSCADIVAVAARDASFAVGGPSWTVKLGRRDSTTASKSSA  87

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TDLP   D+L  LIS F NKGL  RDMV LSGAH++GQAQCF FR RIY N +DIDAGF
Sbjct  88   NTDLPLFTDDLQTLISRFNNKGLTARDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDAGF  147

Query  362  ASTRRRQCPKDTGNGN---LAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            +STR+R CP  +   N   LA LDLVTPNSFDNNY+KNL+QKKGLLQSDQVLFSGG+TD+
Sbjct  148  SSTRQRGCPLSSSTTNDQKLAALDLVTPNSFDNNYFKNLIQKKGLLQSDQVLFSGGSTDS  207

Query  533  IVSEYARSPRAFQADFAS  586
            IVSEY+++P  F++DFA+
Sbjct  208  IVSEYSKNPTTFKSDFAA  225



>gb|KFK43699.1| hypothetical protein AALP_AA1G161500 [Arabis alpina]
Length=266

 Score =   288 bits (738),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 179/223 (80%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+++I+ AK E+E+ CPG+VSCAD+++VAARDAS  VGGP + V++GRRDST A   +A
Sbjct  44   RGFEIIDQAKTEVERVCPGVVSCADIIAVAARDASEYVGGPRYEVEVGRRDSTEAFRAIA  103

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +L+ L   F  KGLNTRD+VALSGAH+LGQAQC  F++R+Y N +DIDAG
Sbjct  104  DSGDLPSFRASLNDLSDLFLRKGLNTRDLVALSGAHTLGQAQCLTFKERLYDNSSDIDAG  163

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            F+STR+R+CP   G+  LAPLD VTPNSFDNNYY+NL+QKKGLL SDQVLF SG ++D+I
Sbjct  164  FSSTRKRRCPVSGGDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLASDQVLFGSGASSDSI  223

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+R+P  F +D+A+AMIKM +IQ LTG  G IR++C A+N
Sbjct  224  VTEYSRNPSRFASDYAAAMIKMGDIQTLTGSAGQIRRICSAVN  266



>ref|XP_010476509.1| PREDICTED: peroxidase 4-like [Camelina sativa]
Length=316

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 175/223 (78%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG +VI+ AK  +E  CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDST A   +A
Sbjct  94   RGLEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTAAFRAIA  153

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +LD L   F  KGLNTRD+VALSGAH+LGQA+C  FRDR+Y N +DID G
Sbjct  154  DSGDLPSFSASLDTLTDLFLRKGLNTRDLVALSGAHTLGQAKCSTFRDRLYDNSSDIDVG  213

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGA-TDNI  535
            F+STR+R+CP + G+  LAPLD VTPNSFDNNYY+NL+QKKGLL SDQVLF  GA TD+I
Sbjct  214  FSSTRKRRCPANGGDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLTSDQVLFGTGAPTDSI  273

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+R+P  F +DF +AMIKM +IQ LTG +G IR++C A+N
Sbjct  274  VTEYSRNPSRFASDFGAAMIKMGDIQTLTGSDGQIRRICSAVN  316



>ref|XP_006391633.1| hypothetical protein EUTSA_v10023814mg [Eutrema salsugineum]
 gb|ESQ28919.1| hypothetical protein EUTSA_v10023814mg [Eutrema salsugineum]
Length=316

 Score =   287 bits (735),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 178/223 (80%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E+ CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDST A   +A
Sbjct  94   RGFEVIDQAKSAVERVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTAAFRAIA  153

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +L++L   F  KGLNTRD+VALSGAH+LGQAQC  F+ R+Y N +DIDAG
Sbjct  154  DSGDLPNFTASLNELSDLFLRKGLNTRDLVALSGAHTLGQAQCVTFKQRLYDNSSDIDAG  213

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            F+STR+R+CP + G+  LAPLD VTPNSFDNNYY+NL+QKKGLL +DQVLF +G +TDNI
Sbjct  214  FSSTRKRRCPVEGGDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLATDQVLFGTGASTDNI  273

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+   F +D+A+AMIKM +IQ LTG  G IR++C A+N
Sbjct  274  VSEYSRNTARFASDYAAAMIKMGDIQTLTGSAGQIRRICTAVN  316



>ref|XP_006848008.1| hypothetical protein AMTR_s00029p00168370 [Amborella trichopoda]
 gb|ERN09589.1| hypothetical protein AMTR_s00029p00168370 [Amborella trichopoda]
Length=324

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ VIE AK  +E  CPG+VSC+D+L+VAARD+S A+GGPSWTV LGRRDS TAS   A
Sbjct  105  RGFHVIENAKSRVESICPGVVSCSDILAVAARDSSVAMGGPSWTVNLGRRDSATASKDEA  164

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E +LP     LD LIS F  KGL+ +DMVALSGAH++GQAQCF FRDRIY N T+IDAGF
Sbjct  165  ERELPLFTAPLDDLISLFGRKGLSAKDMVALSGAHTIGQAQCFTFRDRIY-NHTNIDAGF  223

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A  RR  CP   G+ NLA LDLVTP SFDNNY+K L+QKKGLL+SDQVLF+GG+TD+IV 
Sbjct  224  ARKRRGNCPSTGGDSNLAALDLVTPTSFDNNYFKILMQKKGLLESDQVLFNGGSTDDIVR  283

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ S  AF +DFA+AM+KM +I+PLTG  G IR  C   N
Sbjct  284  SYSNSRSAFYSDFAAAMVKMGDIEPLTGSAGQIRARCSVPN  324



>ref|XP_006848024.1| hypothetical protein AMTR_s00029p00176660 [Amborella trichopoda]
 gb|ERN09605.1| hypothetical protein AMTR_s00029p00176660 [Amborella trichopoda]
Length=248

 Score =   284 bits (727),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 173/221 (78%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K E+E  CPG+VSCAD+L+VAARD+S A+GGP+WTVKLGRRDS TAS + A
Sbjct  29   RGFEVIDEVKSEVESICPGVVSCADILAVAARDSSEAMGGPTWTVKLGRRDSATASESAA  88

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP   DNL++LIS F+ KGL+ +DMVALSGAH++GQAQCF FR+RIY N  +ID+GF
Sbjct  89   NDNLPTFRDNLEELISLFSRKGLDRQDMVALSGAHTIGQAQCFTFRERIY-NEANIDSGF  147

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            +STR+  CP D  +  LAPLDLVTP SFDNNY+KNL++ KGLL SDQVLFS G+TD +V+
Sbjct  148  SSTRQSDCPTDDDDDELAPLDLVTPRSFDNNYFKNLVELKGLLHSDQVLFSNGSTDGLVT  207

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ S   F  DFASAM+KM +I+PLTG +G IR  C   N
Sbjct  208  TYSNSQSTFFTDFASAMVKMGDIEPLTGSSGQIRANCRVPN  248



>ref|XP_003607245.1| Peroxidase [Medicago truncatula]
 gb|AES89442.1| lignin-forming anionic peroxidase [Medicago truncatula]
Length=305

 Score =   286 bits (732),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 141/224 (63%), Positives = 168/224 (75%), Gaps = 18/224 (8%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+++I+ AK E+EK CPG+VSCAD+L+VAARDAS AVGGPSWTVKLGRRDSTTAS +LA
Sbjct  97   RGFEIIDKAKSEVEKICPGVVSCADILAVAARDASFAVGGPSWTVKLGRRDSTTASKSLA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TDLP   D+L  LIS F  K L  RDMV LSGAH++GQAQCF FR RIY N +DIDAGF
Sbjct  157  NTDLPLFTDDLTTLISHFNKKNLTPRDMVTLSGAHTIGQAQCFTFRGRIYNNASDIDAGF  216

Query  362  ASTRRRQCPKDTGNGN---LAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            A+TR+R CP      N   LA LDLVTPNSFDNNY+KNL+QKK               D+
Sbjct  217  ANTRQRGCPSSRTTSNDQKLAALDLVTPNSFDNNYFKNLIQKK---------------DS  261

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            IVSEY+ +P  F++DFA+AMIKM +I+PLTG  GIIR +C A+N
Sbjct  262  IVSEYSNNPTTFKSDFAAAMIKMGDIEPLTGSAGIIRSICSAVN  305



>gb|KFK24955.1| hypothetical protein AALP_AA8G047500 [Arabis alpina]
Length=324

 Score =   286 bits (732),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 178/223 (80%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCADVL++AARD+  A+GGP+W VK+GRRD+ TAS   A
Sbjct  103  RGFNVIDNIKAAVEKACPGVVSCADVLAIAARDSVVALGGPNWNVKVGRRDARTASQAAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR RIY N T+I+A F
Sbjct  163  NSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRTRIY-NETNINAAF  221

Query  362  ASTRRRQCPKDT--GNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R CP+ T  G+GNLAPLD+ TP SFDNNY+KNLL +KGLL SDQ LF+GG+TD+I
Sbjct  222  ATTRQRTCPRATGSGDGNLAPLDVATPASFDNNYFKNLLTQKGLLHSDQELFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y  + R+F +DF +AMIKM +I PLTG +G IRKVCG+ N
Sbjct  282  VRGYNNNARSFNSDFTAAMIKMGDISPLTGSSGEIRKVCGSTN  324



>ref|XP_010452439.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   285 bits (729),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 179/223 (80%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCAD+L++AARD+  A+GGP+W VK+GRRD+ TAS   A
Sbjct  103  RGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVKVGRRDARTASQAAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++PGP  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR RIY N T+I+A F
Sbjct  163  NSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSFRARIY-NETNINAAF  221

Query  362  ASTRRRQCPKDT--GNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R CP+ T  G+GNLAPLD+ T  SFDNNY+KNL+ +KGLL SDQVLF+GG+TD+I
Sbjct  222  ATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLHSDQVLFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F +DF +AMIKM +I PLTG +G IRK+CG  N
Sbjct  282  VRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>ref|XP_002892816.1| hypothetical protein ARALYDRAFT_888837 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69075.1| hypothetical protein ARALYDRAFT_888837 [Arabidopsis lyrata subsp. 
lyrata]
Length=316

 Score =   284 bits (726),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 177/223 (79%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E  CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDST A   +A
Sbjct  94   RGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYNVKVGRRDSTNAFRAIA  153

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +L+ L   F  KGLNTRD+VALSGAH+LGQ+QC  F+ R+Y N +DIDAG
Sbjct  154  DSGDLPNFRASLNDLSELFLKKGLNTRDLVALSGAHTLGQSQCLTFKGRLYDNSSDIDAG  213

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            F+STR+R+CP + G+  LAPLD VTPNSFDNNYY+NL+QKKGLL++DQVLF +G +TD+I
Sbjct  214  FSSTRKRRCPVNGGDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLETDQVLFGTGASTDSI  273

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY+R+P  F +DF +AMIKM +IQ L G +G IR++C A+N
Sbjct  274  VTEYSRNPSRFASDFGAAMIKMGDIQTLIGSDGQIRRICSAVN  316



>ref|XP_002873207.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49466.1| hypothetical protein ARALYDRAFT_908444 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 178/223 (80%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCAD+L++AARD+   +GGP+W VK+GRRD+ TAS   A
Sbjct  103  RGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNVKVGRRDARTASQAAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR RIY N T+I+A F
Sbjct  163  NSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRARIY-NETNINAAF  221

Query  362  ASTRRRQCPKDT--GNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R CP+ T  G+GNLAPLD+ T  SFDNNY+KNL+ ++GLL SDQVLF+GG+TD+I
Sbjct  222  ATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLHSDQVLFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F +DFA+AMIKM +I PLTG +G IRKVCG  N
Sbjct  282  VRGYSNNPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>ref|XP_009614894.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=321

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 172/223 (77%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK CPG+VSCAD+L+V ARD+   +GGP+W VKLGRRD+ TAS   A
Sbjct  99   RGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWNVKLGRRDARTASQAAA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LISSF+  GL+T+DMVALSGAH++GQA+C  FR RIY    ++DA F
Sbjct  159  NRSIPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTTFRARIYNETNNLDASF  218

Query  362  ASTRRRQCPKDTGNGN--LAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP+ +G+G+  LAPLDL TPN FDNNY+KNL+ KKGLL SDQ LF+GG+ D+I
Sbjct  219  ARTRQSNCPRSSGSGDNSLAPLDLQTPNKFDNNYFKNLVNKKGLLHSDQQLFNGGSADSI  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+ Y+ +PR+F +DF +AMIKM +I+PLTG NG IRK CG +N
Sbjct  279  VTSYSNNPRSFSSDFVTAMIKMGDIRPLTGSNGEIRKNCGRIN  321



>gb|KGN45822.1| hypothetical protein Csa_6G013940 [Cucumis sativus]
Length=265

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 171/223 (77%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K  +EK+CPG+VSCAD+L++AARD+   +GGPSW VKLGRRDSTTAS + A
Sbjct  44   RGFDVIDNIKTAVEKACPGVVSCADILAIAARDSVVLLGGPSWNVKLGRRDSTTASQSQA  103

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              D+PGP  +L +L S F+  GL++ D+VALSG H++GQA+C  FR RIY N ++I++ F
Sbjct  104  NNDIPGPTSSLSQLSSRFSALGLSSTDLVALSGGHTIGQARCTTFRSRIYSNSSNIESSF  163

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP  +G G  NLAPLD  TP SFDNNYYKNL+Q KGLLQSDQVLF+GG+TD++
Sbjct  164  ARTRQSNCPNTSGTGDNNLAPLDF-TPTSFDNNYYKNLVQNKGLLQSDQVLFNGGSTDSV  222

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  YA +P  F +DFA+AM+KM +I PLTG NG IRK C  +N
Sbjct  223  VQNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRKNCRMVN  265



>ref|XP_008456761.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Cucumis melo]
Length=323

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 172/223 (77%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K  +E +CPG+VSCAD+L++AARD+   +GGPSW VKLGRRDSTTAS + A
Sbjct  101  RGFDVIDNIKTAVENACPGVVSCADILAIAARDSVVFLGGPSWNVKLGRRDSTTASQSQA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              D+PGP  +L +L S F+  GL+  D+VALSG H++GQA+C  FR RIY N ++I++ F
Sbjct  161  NNDIPGPNSSLSQLSSRFSALGLSNTDLVALSGGHTIGQARCTTFRSRIYSNSSNIESLF  220

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP  +G+G  NLAPLDL TPNSFDNNY+KNL+Q KGLLQSDQVLF+GG+TD++
Sbjct  221  ARTRQSNCPNTSGSGDNNLAPLDLQTPNSFDNNYFKNLVQNKGLLQSDQVLFNGGSTDSV  280

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  YA +P  F +DFA+AM+KM +I PLTG NG IRK C  +N
Sbjct  281  VRNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRKNCRRVN  323



>ref|XP_010423480.1| PREDICTED: peroxidase 52 [Camelina sativa]
Length=324

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 178/223 (80%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCAD+L++AARD+  A+GGP+W VK+GRRD+ TAS   A
Sbjct  103  RGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVKVGRRDARTASQAAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR RIY N T+I+A F
Sbjct  163  NSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSFRARIY-NETNINAAF  221

Query  362  ASTRRRQCPKDT--GNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R CP+ T  G+GNLAPLD+ T  SFDNNY+KNL+ +KGLL SDQVLF+GG+TD+I
Sbjct  222  ATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLHSDQVLFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F +DF +AMIKM +I PLTG +G IRK+CG  N
Sbjct  282  VRGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>emb|CCJ34831.1| horseradish peroxidase isoenzyme HRP_1350 [Armoracia rusticana]
Length=324

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 178/223 (80%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCAD+L++AARD+   +GGP+WTVK+GRRD+ TAS   A
Sbjct  103  RGFNVIDNIKAAVEKACPGVVSCADILAIAARDSVVVLGGPNWTVKVGRRDARTASQAAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR RIY N T+I+A F
Sbjct  163  NSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSFRTRIY-NETNINAAF  221

Query  362  ASTRRRQCPKD--TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R CP+   +G+GNLAPLD+ T  SFDNNY+KNL+ ++GLL SDQ LF+GG+TD+I
Sbjct  222  ATTRQRTCPRTSGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLHSDQELFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F +DFA+AMIKM +I PLTG +G IRKVCG  N
Sbjct  282  VRGYSNNPSSFSSDFAAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>gb|KDP45728.1| hypothetical protein JCGZ_17335 [Jatropha curcas]
Length=328

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 176/224 (79%), Gaps = 4/224 (2%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI   K ++EK CPG+VSCAD+L++AARD++  +GGP+W VKLGRRDS TAS + A
Sbjct  106  RGFNVINNIKAKVEKVCPGVVSCADILAIAARDSTVTLGGPNWAVKLGRRDSKTASFSAA  165

Query  182  ETD-LPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             +  +P P   L  LI+ F  KGL+ RDMVALSGAH++GQA+C +FR+RIY N T+ID+ 
Sbjct  166  NSGVIPPPTSTLSNLINRFKAKGLSARDMVALSGAHTIGQARCVIFRNRIY-NETNIDSS  224

Query  359  FASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            FASTR+R CP+ TG+G  NLAPLD+ TPN+FDNNY+KNLL +KGLL SDQVLF+GG+TD+
Sbjct  225  FASTRQRNCPRATGSGDNNLAPLDVQTPNAFDNNYFKNLLNQKGLLHSDQVLFNGGSTDS  284

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +V  Y+ +P+ F +DF SAMIKM +I PLTG +G IRK C  +N
Sbjct  285  LVRTYSNNPKTFNSDFVSAMIKMGDIDPLTGSSGEIRKKCNRVN  328



>ref|XP_004138400.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
 ref|XP_004160737.1| PREDICTED: peroxidase 52-like [Cucumis sativus]
Length=322

 Score =   282 bits (722),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 171/223 (77%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K  +EK+CPG+VSCAD+L++AARD+   +GGPSW VKLGRRDSTTAS + A
Sbjct  101  RGFDVIDNIKTAVEKACPGVVSCADILAIAARDSVVLLGGPSWNVKLGRRDSTTASQSQA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              D+PGP  +L +L S F+  GL++ D+VALSG H++GQA+C  FR RIY N ++I++ F
Sbjct  161  NNDIPGPTSSLSQLSSRFSALGLSSTDLVALSGGHTIGQARCTTFRSRIYSNSSNIESSF  220

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP  +G G  NLAPLD  TP SFDNNYYKNL+Q KGLLQSDQVLF+GG+TD++
Sbjct  221  ARTRQSNCPNTSGTGDNNLAPLDF-TPTSFDNNYYKNLVQNKGLLQSDQVLFNGGSTDSV  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  YA +P  F +DFA+AM+KM +I PLTG NG IRK C  +N
Sbjct  280  VQNYANAPARFLSDFAAAMVKMGDIAPLTGSNGQIRKNCRMVN  322



>ref|NP_196153.1| peroxidase 52 [Arabidopsis thaliana]
 sp|Q9FLC0.1|PER52_ARATH RecName: Full=Peroxidase 52; Short=Atperox P52; AltName: Full=ATP49; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09977.1| peroxidase [Arabidopsis thaliana]
 gb|AAL38746.1| putative peroxidase [Arabidopsis thaliana]
 gb|AED90861.1| peroxidase 52 [Arabidopsis thaliana]
Length=324

 Score =   282 bits (721),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 178/223 (80%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCAD+L++AARD+  A+GGP+W VK+GRRD+ TAS   A
Sbjct  103  RGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVKVGRRDARTASQAAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR RIY N T+I+A F
Sbjct  163  NSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRARIY-NETNINAAF  221

Query  362  ASTRRRQCPK--DTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R CP+   +G+GNLAPLD+ T  SFDNNY+KNL+ ++GLL SDQVLF+GG+TD+I
Sbjct  222  ATTRQRTCPRASGSGDGNLAPLDVTTAASFDNNYFKNLMTQRGLLHSDQVLFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F +DF +AMIKM +I PLTG +G IRKVCG  N
Sbjct  282  VRGYSNNPSSFNSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  324



>emb|CDY53543.1| BnaA09g57020D [Brassica napus]
Length=235

 Score =   277 bits (709),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 168/207 (81%), Gaps = 2/207 (1%)
 Frame = +2

Query  50   CPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLAET-DLPGPFDNLDKLI  226
            CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDSTTA   +A++ DLP    +LD L 
Sbjct  29   CPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTTAFRAIADSGDLPSFRASLDDLS  88

Query  227  SSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGFASTRRRQCPKDTGNG  406
              F  KGLNTRD+VALSGAH+LGQA C  F++R+Y N +DIDAGF+STR+R+CP + G+ 
Sbjct  89   DLFLRKGLNTRDLVALSGAHTLGQATCVTFKERLYDNSSDIDAGFSSTRKRRCPVNGGDT  148

Query  407  NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNIVSEYARSPRAFQADFA  583
            NLAPLD VTPNSFDNNYY+NL+QKKGLL SDQVLF SG +TD+IVSEY+R+P  F +D+A
Sbjct  149  NLAPLDQVTPNSFDNNYYRNLMQKKGLLASDQVLFGSGASTDSIVSEYSRNPSRFASDYA  208

Query  584  SAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +AMIKM +IQ LTG  G IR++C A+N
Sbjct  209  AAMIKMGDIQTLTGSAGQIRRICTAVN  235



>ref|XP_009395400.1| PREDICTED: peroxidase P7-like [Musa acuminata subsp. malaccensis]
Length=323

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 174/223 (78%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+  K  +EK CPG+VSCAD+L++ ARD+S  VGGPSW VKLGRRDSTTAS  LA
Sbjct  102  RGYEVIDGIKSAVEKVCPGVVSCADILAIVARDSSVYVGGPSWKVKLGRRDSTTASKDLA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E +LP  FD+LD L S FA +GL+ +DMV LSG+H++G AQC  FR RIY N T+IDAGF
Sbjct  162  EQNLPIAFDDLDTLTSVFARQGLSLKDMVVLSGSHTIGLAQCATFRGRIY-NETNIDAGF  220

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A  R+R+CP   GNG  NLAPLDLVTP SFDNNYYKNLL+KKGLL SDQ+LF+GG+TD  
Sbjct  221  ARMRQRRCPPTAGNGDTNLAPLDLVTPGSFDNNYYKNLLRKKGLLHSDQLLFNGGSTDAT  280

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+ Y++   AF ADFA+AM+KM +I PLTG  G +RKVC  +N
Sbjct  281  VAAYSKDQAAFFADFAAAMVKMGDISPLTGSAGEVRKVCSVVN  323



>ref|XP_009418659.1| PREDICTED: lignin-forming anionic peroxidase-like [Musa acuminata 
subsp. malaccensis]
Length=326

 Score =   280 bits (715),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 178/224 (79%), Gaps = 4/224 (2%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHT-L  178
            RG++VI++ K  +EK CPG+VSCAD+L+VAARD+S  VGGP+W VKLGRRDSTTA++  L
Sbjct  104  RGFEVIDSIKWAVEKVCPGVVSCADILAVAARDSSEYVGGPTWKVKLGRRDSTTAANKDL  163

Query  179  AETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             + DLP  FDNLD+LISSFA +GL+ +DMVALSG+H++GQAQC  FR+RIY N  +ID G
Sbjct  164  VQRDLPVAFDNLDELISSFARQGLSIKDMVALSGSHTIGQAQCATFRNRIY-NEPNIDHG  222

Query  359  FASTRRRQCPKDT--GNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            FA+ RRR+CP     GN  LAPLDLVTPNSFDNNYYKNLLQKKGLL SDQVL S G T +
Sbjct  223  FAALRRRRCPSSQVLGNSTLAPLDLVTPNSFDNNYYKNLLQKKGLLHSDQVLLSHGPTGD  282

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +V  Y+++  AF ADFA+AM+KM +I PLTG  G +R+ C A+N
Sbjct  283  MVKYYSKNQAAFFADFAAAMVKMGDIAPLTGSAGEVRRTCSAIN  326



>dbj|BAA82306.1| peroxidase [Nicotiana tabacum]
Length=321

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 171/223 (77%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK CPG+VSCAD+L+V ARD+   +GGP+W VKLGRRDS TAS + A
Sbjct  99   RGFEVIDNIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWNVKLGRRDSRTASQSAA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             + +P    NL++LISSF+  GL+T+DMVALSGAH++GQA+C  FR RIY    ++DA F
Sbjct  159  NSGIPPATSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTSFRARIYNETNNLDASF  218

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP+ +G+G  NLAPLDL TPN FDNNY+KNL+ KKGLL SDQ LF+GG+ D+I
Sbjct  219  ARTRQSNCPRSSGSGDNNLAPLDLQTPNKFDNNYFKNLVDKKGLLHSDQQLFNGGSADSI  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+ Y+ +P +F +DF +AMIKM +I+PLTG NG IRK C  LN
Sbjct  279  VTSYSNNPSSFSSDFVTAMIKMGDIRPLTGSNGEIRKNCRRLN  321



>ref|XP_009117893.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 4-like [Brassica rapa]
Length=326

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/233 (60%), Positives = 176/233 (76%), Gaps = 12/233 (5%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+ AK  +E  CPG+VSCAD+++VAARDAS  VGGP + VK+GRRDSTTA   +A
Sbjct  94   RGFEVIDEAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYAVKVGRRDSTTAFRAIA  153

Query  182  ET-DLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
            ++ DLP    +LD L   F  KGLNTRD+VALSGAH+LGQA C  F++R+Y N +DIDAG
Sbjct  154  DSGDLPSFRASLDDLSDLFLRKGLNTRDLVALSGAHTLGQATCVTFKERLYDNSSDIDAG  213

Query  359  FASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNI  535
            F+STR+R+CP + G+ NLAPLD VTPNSFDNNYY+NL+QKKGLL SDQVLF SG +TD+I
Sbjct  214  FSSTRKRRCPANGGDTNLAPLDQVTPNSFDNNYYRNLMQKKGLLASDQVLFGSGASTDSI  273

Query  536  VSEYARSPRAFQADFA----------SAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VSEY+R+P  F    +          +AMIKM +IQ LTG  G IR++C A+N
Sbjct  274  VSEYSRNPSRFGHGISQSQHXIRVXLTAMIKMGDIQTLTGSAGQIRRICTAVN  326



>ref|XP_004239964.1| PREDICTED: peroxidase P7-like [Solanum lycopersicum]
Length=322

 Score =   276 bits (707),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 169/219 (77%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPGIVSCAD+L+V ARD+   +GGP+W VKLGRRD+ TAS   A
Sbjct  100  RGFEVIDNIKSAVEKACPGIVSCADILAVTARDSVVILGGPNWNVKLGRRDARTASQGAA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             + +P P  NL++LISSF+  GL+T+DMVALSGAH++GQA+C  FR RIY    +ID+ F
Sbjct  160  NSSIPAPTFNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTTFRARIYNETNNIDSTF  219

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP+++G+G  NLAPLDL TP+ FDNNY+KNL+ KKGLL SDQ LF+GG+ D+I
Sbjct  220  ARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFKNLVNKKGLLHSDQQLFNGGSADSI  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
            V  Y  +P +F +DF +AMIKM +I+PLTG NG IRK C
Sbjct  280  VRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGEIRKNC  318



>ref|XP_008374580.1| PREDICTED: peroxidase P7-like [Malus domestica]
 ref|XP_008354170.1| PREDICTED: peroxidase P7-like [Malus domestica]
Length=319

 Score =   276 bits (706),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 171/223 (77%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K  +E  CPG+VSCAD+L++AARD+   +GGPSW VKLGRRD+ TAS   A
Sbjct  98   RGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVVTLGGPSWNVKLGRRDARTASQAAA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  NL++LIS+F+  GL+TRD+VALSG+H++GQA+C  FR RIY N T++D+  
Sbjct  158  NNNIPPPTRNLNQLISTFSAVGLSTRDLVALSGSHTIGQARCTSFRPRIY-NETNLDSSL  216

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TRR  CP+ +G+G  NLAPLDL TP SFDNNY+KNL+Q KGLL SDQ LF+GG+TD+I
Sbjct  217  AQTRRSNCPRTSGSGDNNLAPLDLQTPTSFDNNYFKNLIQNKGLLHSDQQLFNGGSTDSI  276

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ S  AF +DFASAMIKM +I+PLTG +G IRK C   N
Sbjct  277  VRAYSNSYNAFSSDFASAMIKMGDIKPLTGSSGEIRKNCRKTN  319



>ref|XP_006349568.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=316

 Score =   276 bits (706),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K ++E SC GIVSCAD+L+VAARD+   +GGPSWTV LGRRDSTTAS + A
Sbjct  97   RGFDVIDTIKTQVESSCAGIVSCADILAVAARDSVVKLGGPSWTVLLGRRDSTTASLSAA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             ++LPGP  +L  LISSF+NKGL  R+MVALSG+H++GQA+C  FR R+Y N  +I+A F
Sbjct  157  NSNLPGPTSSLSALISSFSNKGLTAREMVALSGSHTIGQARCTTFRTRLY-NEANINASF  215

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A+T +  CP+  G+ NL+PLD+ +P SFDN YYKNL  +KGLL SDQVLF+GG+TD+IV+
Sbjct  216  ATTVKANCPQSGGDNNLSPLDITSPTSFDNAYYKNLQIQKGLLHSDQVLFNGGSTDSIVN  275

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +   F  DFA+AM+KM  + PLTG NG IRK C   N
Sbjct  276  TYSSNSATFSTDFANAMVKMGNLSPLTGTNGQIRKNCRKTN  316



>ref|XP_002520835.1| Peroxidase 52 precursor, putative [Ricinus communis]
 gb|EEF41544.1| Peroxidase 52 precursor, putative [Ricinus communis]
Length=318

 Score =   275 bits (704),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI++ K  +EK+CPG+VSCAD+L++AARD++A +GGPSW VKLGRRD+ TAS + A
Sbjct  99   RGFEVIDSIKSAVEKACPGVVSCADILAIAARDSTAILGGPSWNVKLGRRDARTASLSAA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LIS F+  GL+TRD+VALSGAH++GQA+C  FR RIY N T+ID+ F
Sbjct  159  NNGIPAPTSNLNQLISRFSALGLSTRDLVALSGAHTIGQARCTNFRTRIY-NDTNIDSSF  217

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A TRR  CP   G+ NLAPLDL TP SFDNNY+KNLL +KGLL SDQ LF+ G+TD+IV 
Sbjct  218  AQTRRSNCPSTGGDNNLAPLDLQTPTSFDNNYFKNLLVQKGLLHSDQELFNNGSTDSIVR  277

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+     F +DF + MIKM +I PLTG  G IRK CG +N
Sbjct  278  TYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRKNCGKVN  318



>ref|XP_006848015.1| hypothetical protein AMTR_s00029p00170340 [Amborella trichopoda]
 gb|ERN09596.1| hypothetical protein AMTR_s00029p00170340 [Amborella trichopoda]
Length=346

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 170/246 (69%), Gaps = 26/246 (11%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDAS-------------------------  106
            RG+ VIE AK  +E  CPG+VSCAD+L+VAARD+S                         
Sbjct  102  RGFQVIEKAKSRVESICPGVVSCADILAVAARDSSVKDFSLVFLDKKSNREIKTDVEINS  161

Query  107  AAVGGPSWTVKLGRRDSTTASHTLAETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAH  286
            A +GGPSWTVKLGRRDS TAS + AE +LP     LD LIS F  KGL+ +D+VALSGAH
Sbjct  162  AQLGGPSWTVKLGRRDSATASKSEAERELPLFTAPLDSLISLFRRKGLSAKDLVALSGAH  221

Query  287  SLGQAQCFLFRDRIYGNGTDIDAGFASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKN  466
            ++GQAQCF FRDRIY N T+ID+GFA  RR  CP + G+  LAPLDLVTPNSFDNNY+K 
Sbjct  222  TIGQAQCFTFRDRIY-NHTNIDSGFARKRRNHCPSNGGDSKLAPLDLVTPNSFDNNYFKI  280

Query  467  LLQKKGLLQSDQVLFSGGATDNIVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRK  646
            L++KKGLL+SDQVLF+GG+TD IV  Y++S  AF  DFA AM+KM +I+PLTG    IR 
Sbjct  281  LMEKKGLLESDQVLFNGGSTDEIVRSYSKSRSAFYLDFAEAMVKMGDIEPLTGSARQIRA  340

Query  647  VCGALN  664
             C   N
Sbjct  341  RCSVPN  346



>emb|CAD67478.1| peroxidase [Asparagus officinalis]
Length=301

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/223 (59%), Positives = 167/223 (75%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ VI+  K  +E +CPG+VSCAD+L+VAARD+   +GGP W VKLGRRD+ TAS TLA
Sbjct  80   RGFKVIDKIKTAVENACPGVVSCADILAVAARDSVVILGGPDWKVKLGRRDARTASATLA  139

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  +L  LIS FA +GL+T+DMVALSGAH++GQA+C  FR  IY N  DIDA F
Sbjct  140  NNNIPPPTSSLSNLISKFAAQGLSTKDMVALSGAHTIGQARCTSFRGHIY-NDADIDASF  198

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            AS R++ CP+ +G+G  NLAPLDL TP +FDNNYYKNL+ KKGLL SDQ LF+ GATD++
Sbjct  199  ASLRQKICPRKSGSGDTNLAPLDLQTPTAFDNNYYKNLINKKGLLHSDQELFNNGATDSL  258

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ S  +F +DF  AMIKM +I PLTG  G IRK+C  +N
Sbjct  259  VKSYSNSEGSFNSDFVKAMIKMGDISPLTGSKGEIRKICSKIN  301



>emb|CDY14118.1| BnaC02g02350D [Brassica napus]
Length=324

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ VI+  K  +EK+CPG+VSCAD+L++AARD+   +GGP+W VK+GRRD+ TAS   A
Sbjct  103  RGFTVIDNIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVKVGRRDAKTASQAAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR R+Y N T+I+A F
Sbjct  163  NSNIPAPNMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFRARVY-NETNINAAF  221

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+ R+R CP+  G+G  NLAPLD+ +  SFDN+Y+KNL+ ++GLL SDQVLF+GG+TD+I
Sbjct  222  ATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLHSDQVLFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ SP +F +DFASAMIKM +I PLTG +G IRKVCG  N
Sbjct  282  VRGYSNSPSSFNSDFASAMIKMGDISPLTGSSGEIRKVCGKTN  324



>ref|XP_006365326.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=322

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 168/219 (77%), Gaps = 2/219 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCAD+L+V ARD+   +GGP+W VKLGRRD+ TAS   A
Sbjct  100  RGFEVIDNIKSAVEKACPGVVSCADILAVTARDSVVILGGPNWNVKLGRRDARTASQGAA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             + +P P  NL++LISSF+  GL+T+DMVALSG+H++GQA+C  FR RIY     ID+ F
Sbjct  160  NSSIPAPTFNLNRLISSFSAVGLSTKDMVALSGSHTIGQARCTTFRARIYNETNSIDSSF  219

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP+++G+G  NLAPLDL TP+ FDNNY+KNL+ KKGLL SDQ LF+GG+ D+I
Sbjct  220  ARTRQNSCPRNSGSGDNNLAPLDLQTPSKFDNNYFKNLVNKKGLLHSDQQLFNGGSADSI  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
            V  Y  +P +F +DF +AMIKM +I+PLTG NG IRK C
Sbjct  280  VRSYINNPSSFNSDFVTAMIKMGDIRPLTGSNGEIRKNC  318



>gb|ACM47317.1| peroxidase [Capsicum annuum]
Length=324

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 171/223 (77%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCAD+L++ ARD+   +GGP+W VKLGRRD+ TAS   A
Sbjct  102  RGFEVIDNIKSAVEKACPGVVSCADILAITARDSVVILGGPNWNVKLGRRDARTASQGAA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             + +P P  NL++LISSF+  GL+T DMVALSGAH++GQA+C  FR RIY    +ID+ F
Sbjct  162  NSSIPPPTSNLNQLISSFSAVGLSTTDMVALSGAHTIGQARCTSFRARIYNETNNIDSSF  221

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R CP+++G+G  NLAPLDL TP  FDNNY+KNL+ K+GLL SDQ LF+GG+ D+I
Sbjct  222  ATTRQRNCPRNSGSGDNNLAPLDLQTPTKFDNNYFKNLVSKRGLLHSDQQLFNGGSADSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+ Y+ +P +F +DF +AMIKM + +PLTG NG IRK C   N
Sbjct  282  VTSYSNNPSSFSSDFVTAMIKMGDNRPLTGSNGEIRKNCRTRN  324



>ref|XP_008233851.1| PREDICTED: peroxidase P7-like [Prunus mume]
Length=319

 Score =   275 bits (702),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 169/219 (77%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K  +E  CPG+VSCAD+L++AARD+ A +GGPSW VKLGRRD+ TAS   A
Sbjct  98   RGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVAILGGPSWNVKLGRRDARTASQAAA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  NL++LIS F   GL+TRD+VALSG+H++GQ++C  FR RIY N T++D+ F
Sbjct  158  NNNIPPPTSNLNQLISRFNALGLSTRDLVALSGSHTIGQSRCIQFRPRIY-NETNLDSSF  216

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TRR  CP+ +G+G  NLAPLDL TP +FDNNY+KNL+QKKGLL SDQ LF+GG+TD+I
Sbjct  217  AQTRRSNCPRASGSGDNNLAPLDLQTPTAFDNNYFKNLIQKKGLLHSDQQLFNGGSTDSI  276

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
            V  Y+ S   F +DF SA+IKM +I+PLTG NG IRK C
Sbjct  277  VRTYSNSYNTFSSDFVSAIIKMGDIKPLTGSNGEIRKNC  315



>ref|XP_009125598.1| PREDICTED: peroxidase P7 [Brassica rapa]
Length=324

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ VI+  K  +EK+CPG+VSCAD+L++AARD+   +GGP+W VK+GRRD+ TAS   A
Sbjct  103  RGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVKVGRRDAKTASQAAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR R+Y N T+I+A F
Sbjct  163  NSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFRARVY-NETNINAAF  221

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+ R+R CP+  G+G  NLAPLD+ +  SFDN+Y+KNL+ ++GLL SDQVLF+GG+TD+I
Sbjct  222  ATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLHSDQVLFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ SP +F +DFA+AMIKM +I PLTG +G IRKVCG  N
Sbjct  282  VRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  324



>emb|CDY04948.1| BnaAnng01300D [Brassica napus]
Length=324

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ VI+  K  +EK+CPG+VSCAD+L++AARD+   +GGP+W VK+GRRD+ TAS   A
Sbjct  103  RGFTVIDTIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVKVGRRDAKTASQAAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR R+Y N T+I+A F
Sbjct  163  NSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFRARVY-NETNINAAF  221

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+ R+R CP+  G+G  NLAPLD+ +  SFDN+Y+KNL+ ++GLL SDQVLF+GG+TD+I
Sbjct  222  ATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLHSDQVLFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ SP +F +DFA+AMIKM +I PLTG +G IRKVCG  N
Sbjct  282  VRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  324



>ref|XP_010552918.1| PREDICTED: peroxidase P7-like [Tarenaya hassleriana]
Length=319

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 168/223 (75%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K   EK+CPGIVSCAD+L++AARD    +GGPSW VKLGRRDS TAS + A
Sbjct  98   RGFDVIDNIKTAAEKACPGIVSCADILAIAARDGVVLLGGPSWEVKLGRRDSRTASQSAA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              D+P P  NL +L+SSF+N GL+ RDMVALSG H++GQA+C  FR RIY N  +I++ F
Sbjct  158  NRDIPAPTFNLSRLVSSFSNVGLSARDMVALSGGHTIGQARCTTFRARIY-NEKNINSAF  216

Query  362  ASTRRRQCPKD--TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R CP+   +G+GNLAPLD+ TP  FDNNY+KNL+ +KGLL SDQ LF+GG+TD+I
Sbjct  217  AATRQRNCPRTNGSGDGNLAPLDIQTPTKFDNNYFKNLMVQKGLLHSDQELFNGGSTDSI  276

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y   P  F +DF +AMI+M +I PLTG+ G IR+ C  +N
Sbjct  277  VRTYGTKPATFSSDFTAAMIRMGDISPLTGKKGEIRRNCRRVN  319



>sp|P00434.3|PERP7_BRARR RecName: Full=Peroxidase P7; AltName: Full=TP7 [Brassica rapa 
subsp. rapa]
Length=296

 Score =   273 bits (698),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 174/223 (78%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ VI   K  +EK+CPG+VSCAD+L++AARD+   +GGP+W VK+GRRD+ TAS   A
Sbjct  75   RGFTVINDIKSAVEKACPGVVSCADILAIAARDSVVQLGGPNWNVKVGRRDAKTASQAAA  134

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR R+Y N T+I+A F
Sbjct  135  NSNIPAPSMSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCVNFRARVY-NETNINAAF  193

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+ R+R CP+  G+G  NLAPLD+ +  SFDN+Y+KNL+ ++GLL SDQVLF+GG+TD+I
Sbjct  194  ATLRQRSCPRAAGSGDANLAPLDINSATSFDNSYFKNLMAQRGLLHSDQVLFNGGSTDSI  253

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ SP +F +DFA+AMIKM +I PLTG +G IRKVCG  N
Sbjct  254  VRGYSNSPSSFNSDFAAAMIKMGDISPLTGSSGEIRKVCGKTN  296



>ref|XP_010256947.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=321

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 172/223 (77%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K ++EK CPG+VSCAD+L++AARD+   +GG SW VKLGRRDS TAS + A
Sbjct  100  RGFDVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGTSWNVKLGRRDSKTASQSAA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  NL+ LISSF +KGL+T+DMVALSG H++GQA+C  FR RIY N ++I++ F
Sbjct  160  NNNIPPPTSNLNNLISSFQSKGLSTKDMVALSGGHTIGQARCTNFRARIY-NESNIESSF  218

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+ +CP  +G+G  NLAPLDL TP +FDNNY+KNL+ +KGLL SDQ LF+GG+TD+ 
Sbjct  219  AKTRQGRCPSSSGSGDNNLAPLDLQTPTAFDNNYFKNLINQKGLLHSDQQLFNGGSTDSQ  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P  F +DFA+AMIKM +I PLTG NG IRK C  +N
Sbjct  279  VRTYSNNPSTFNSDFAAAMIKMGDISPLTGSNGEIRKNCRRVN  321



>ref|XP_002269301.2| PREDICTED: lignin-forming anionic peroxidase-like [Vitis vinifera]
Length=223

 Score =   270 bits (690),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 159/186 (85%), Gaps = 3/186 (2%)
 Frame = +2

Query  113  VGGPSWTVKLGRRDSTTASHTLAETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSL  292
            V GP+WTVKLGRRDSTT+  +LA T+LP   D+LDKLIS F +KGL+ RDMVALSG+H++
Sbjct  39   VSGPTWTVKLGRRDSTTSGLSLAATNLPSFRDSLDKLISLFGSKGLSARDMVALSGSHTI  98

Query  293  GQAQCFLFRDRIYGNGTDIDAGFASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKN  466
            GQ +C  FRDRIY NGTDIDAGFASTRRR+CP D GNG  NLAPL+LVTPNSFDNNY+KN
Sbjct  99   GQGRCVTFRDRIY-NGTDIDAGFASTRRRRCPADNGNGDANLAPLELVTPNSFDNNYFKN  157

Query  467  LLQKKGLLQSDQVLFSGGATDNIVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRK  646
            L+Q+KGLLQSDQVLFSGG+TD+IV+EY++SP+ F++DFASAM+KM +I+PLT   G+IRK
Sbjct  158  LIQRKGLLQSDQVLFSGGSTDSIVNEYSKSPKTFRSDFASAMLKMGDIEPLTRSAGVIRK  217

Query  647  VCGALN  664
                +N
Sbjct  218  FYNVIN  223



>ref|XP_010491069.1| PREDICTED: peroxidase 52-like [Camelina sativa]
Length=324

 Score =   274 bits (700),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 178/223 (80%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCAD+L++AARD+  A+GGP+W VK+GRRD+ TAS   A
Sbjct  103  RGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVALGGPNWNVKVGRRDARTASQAAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++PGP  +L +LISSF+  GL+TRDMVALSGAH++GQA+C  FR RIY N T+I+A F
Sbjct  163  NSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQARCTSFRARIY-NETNINAAF  221

Query  362  ASTRRRQCPKDT--GNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R CP+ T  G+GNLAPLD+ T  SFDNNY+KNL+ +KGLL SDQ LF+GG+TD+I
Sbjct  222  ATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQKGLLHSDQELFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ SP +F +DF +AMIKM +I PLTG +G IRK+CG  N
Sbjct  282  VRGYSNSPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>gb|KHN48387.1| Peroxidase 52 [Glycine soja]
Length=265

 Score =   271 bits (694),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 172/223 (77%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+  K  +EK+CPG+VSCAD+L++AARD+   +GGPSW VK+GRRD+ TAS + A
Sbjct  44   RGYEVIDNIKSAVEKACPGVVSCADILAIAARDSVQILGGPSWNVKVGRRDARTASQSAA  103

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LIS F+  GL+T+D+VALSG H++GQA+C  FR RIY N ++ID  F
Sbjct  104  NNGIPPPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNFRARIY-NESNIDTAF  162

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR++ CP+ +G+G  NLAPLDL TP  FDN Y+KNL+QKKGLL SDQ LF+GG+TD+I
Sbjct  163  ARTRQQSCPRTSGSGDNNLAPLDLQTPTEFDNYYFKNLVQKKGLLHSDQQLFNGGSTDSI  222

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F +DFA+AMIKM +I PLTG NG IRK C  +N
Sbjct  223  VRGYSTNPSSFSSDFAAAMIKMGDISPLTGSNGEIRKNCRRIN  265



>ref|XP_010695731.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=322

 Score =   273 bits (699),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 171/223 (77%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCAD+L++ ARD+   +GGP+W VKLGRRD+ TAS T A
Sbjct  101  RGFEVIDQIKSAVEKACPGVVSCADILTITARDSVVILGGPTWNVKLGRRDARTASRTAA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  +L +L+SSF+N+GL+T DMVAL+G H++GQA+C  FR RIY N ++IDA F
Sbjct  161  NNNIPQPNFSLSQLMSSFSNQGLSTTDMVALAGGHTIGQARCTSFRTRIY-NESNIDASF  219

Query  362  ASTRRRQCPK--DTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP+  ++G+ NLAPLDL TPNSFDN YYKNL+ +KGLL SDQ LFSGG+T+++
Sbjct  220  AKTRQANCPRSSNSGSNNLAPLDLQTPNSFDNKYYKNLVSQKGLLHSDQQLFSGGSTNSL  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y  +P  F ADF +AMIKM +I+PLTG NG +RK C   N
Sbjct  280  VQTYGSNPSRFNADFIAAMIKMGDIKPLTGSNGEVRKNCRKTN  322



>ref|XP_006288218.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
 gb|EOA21116.1| hypothetical protein CARUB_v10001455mg [Capsella rubella]
Length=324

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 178/223 (80%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCAD+L++AARD+   +GGP+W VK+GRRD+ TAS   A
Sbjct  103  RGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVVLGGPNWNVKVGRRDARTASQAAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++PGP  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR RIY N T+I+A F
Sbjct  163  NSNIPGPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTSFRARIY-NETNINAAF  221

Query  362  ASTRRRQCPKDT--GNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+R CP+ T  G+GNLAPLD+ T  SFDNNY+KNL+ ++GLL SDQVLF+GG+TD+I
Sbjct  222  ATTRQRTCPRATGSGDGNLAPLDVTTAASFDNNYFKNLVAQRGLLHSDQVLFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F +DF +AMIKM +I PLTG +G IRK+CG  N
Sbjct  282  VRGYSSNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKMCGRTN  324



>ref|XP_003602462.1| Peroxidase [Medicago truncatula]
 gb|AES72713.1| class III peroxidase [Medicago truncatula]
Length=322

 Score =   272 bits (695),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 169/219 (77%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K  +E  CPG+VSCAD+L++AA D+ A +GGP+W VKLGRRD+TTAS + A
Sbjct  101  RGFDVIDNIKTAVENVCPGVVSCADILAIAATDSVAILGGPTWNVKLGRRDATTASQSDA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T +P P  NL+ L S F N GL+T+D+VALSGAH++GQA+C  FR RIY N T+ID  F
Sbjct  161  NTAIPRPTSNLNILTSMFKNVGLSTKDLVALSGAHTIGQARCTTFRVRIY-NETNIDTSF  219

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTR+  CPK +G+G  NLAPLDL TP SFDN YY+NL+Q KGLL SDQ LF+GG+T++I
Sbjct  220  ASTRQSNCPKTSGSGDNNLAPLDLHTPTSFDNCYYRNLVQNKGLLHSDQQLFNGGSTNSI  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
            VS Y  +  +F +DFA+AMIKM +I+PLTG NG IRK C
Sbjct  280  VSGYFNNQNSFFSDFATAMIKMGDIKPLTGSNGEIRKNC  318



>ref|XP_010264466.1| PREDICTED: peroxidase 4-like [Nelumbo nucifera]
Length=320

 Score =   271 bits (694),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 169/223 (76%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++V++  K ++EK CPG+VSCAD+L++AARD+   +GGPSW VKLGRRD+ TAS   A
Sbjct  99   RGFNVVDDIKSKVEKVCPGVVSCADILAIAARDSVVILGGPSWKVKLGRRDARTASQAAA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T +P P  +L  LISSF +KGL+T+DMVALSG+H++GQA+C  FR RIY N ++ID  F
Sbjct  159  NTSIPPPTSSLSNLISSFQSKGLSTKDMVALSGSHTIGQARCTSFRTRIY-NESNIDGSF  217

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A  R+R+CP  +G+G  NLAPLDL TP +FDNNY+KNL+  KGLL SDQ LF+GG+TD++
Sbjct  218  AKARQRKCPATSGSGDNNLAPLDLQTPTAFDNNYFKNLINNKGLLHSDQQLFNGGSTDSL  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+  P  F +DF++AMIKM +I PLTG NG IR  C  +N
Sbjct  278  VRSYSSKPSTFISDFSAAMIKMGDITPLTGSNGEIRNNCRRVN  320



>ref|XP_010695722.1| PREDICTED: peroxidase P7-like [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   271 bits (694),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 168/223 (75%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K  +EK+CPG+VSCAD+L+++ARD+   +GGP+W VKLGRRD+TTAS + A
Sbjct  102  RGFDVVDQIKTAVEKACPGVVSCADILAISARDSVVILGGPTWNVKLGRRDATTASQSAA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T++P P  +L  LI SF+++GL+T DMVALSGAH++GQA+C  FR RIY N ++IDA F
Sbjct  162  NTNIPAPTASLSALIKSFSDQGLSTTDMVALSGAHTIGQARCTTFRTRIY-NESNIDASF  220

Query  362  ASTRRRQCP--KDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP    +G+ NLAPLD+ TPN+FDN YY NL+ +KGLL SDQ LFSGG+T+ +
Sbjct  221  AKTRQANCPSASTSGSNNLAPLDIQTPNTFDNKYYNNLVNQKGLLHSDQQLFSGGSTNAL  280

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P  F  DF +AMI M +++PLTG NG IRK C   N
Sbjct  281  VQTYSSNPSRFNTDFVAAMINMGDVKPLTGSNGQIRKNCRKTN  323



>gb|KHN29529.1| Cationic peroxidase 1 [Glycine soja]
Length=314

 Score =   271 bits (693),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K ++E  CPG+VSCAD+L+VAARD+  A+GG +WTV+LGRRDSTTAS + A
Sbjct  95   RGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWTVQLGRRDSTTASLSSA  154

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLPGP  +L  LISSF+NKG +++++VALSG+H++GQAQC  FR RIY N T+ID+ F
Sbjct  155  NSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFRTRIY-NDTNIDSSF  213

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A + +  CP   G+ NLAPLD  +PN+FDN Y+KNL  KKGLL SDQ LF+GG+TD+ V+
Sbjct  214  AKSLQGNCPSTGGDSNLAPLDTTSPNTFDNAYFKNLQSKKGLLHSDQELFNGGSTDSQVN  273

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +P +FQ DFA+AMIKM  + PLTG +G IR  C   N
Sbjct  274  SYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  314



>ref|XP_003523269.1| PREDICTED: peroxidase 52-like isoform 1 [Glycine max]
Length=320

 Score =   271 bits (693),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 171/223 (77%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK CPG+VSCAD+L++AARD+   +GGP+W VKLGRRD+ TAS + A
Sbjct  99   RGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGPTWNVKLGRRDARTASQSAA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LIS F+  GL+T+D+VALSG H++GQA+C  FR RIY N T+I+  F
Sbjct  159  NNGIPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNFRARIY-NETNIETAF  217

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR++ CP+ +G+G  NLAPLDL TP SFDN Y+KNL+QKKGLL SDQ LF+GG+TD+I
Sbjct  218  ARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLHSDQQLFNGGSTDSI  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P  F +DFA+AMIKM +I PLTG NG IRK C  +N
Sbjct  278  VRGYSTNPGTFSSDFAAAMIKMGDISPLTGSNGEIRKNCRRIN  320



>ref|XP_006398996.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
 gb|ESQ40449.1| hypothetical protein EUTSA_v10014105mg [Eutrema salsugineum]
Length=324

 Score =   271 bits (693),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 176/223 (79%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCAD+L++AARD+   +GGP+W VKLGRRD+ TAS   A
Sbjct  103  RGFNVIDNIKSAVEKACPGVVSCADILAIAARDSVVILGGPNWNVKLGRRDARTASQAAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR R+Y N T+I+A F
Sbjct  163  NSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRARVY-NETNINAAF  221

Query  362  ASTRRRQCPKD--TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+ R+R CP+   +G+GNLAPLD+ +  SFDN+Y+KNL+ ++GLL SDQ LF+GG+TD+I
Sbjct  222  ATLRQRSCPRTAGSGDGNLAPLDVNSAASFDNSYFKNLMAQRGLLHSDQELFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F +DFA+AMIKM +I PLTG +G IRK+CG  N
Sbjct  282  VRGYSNTPSSFSSDFAAAMIKMGDISPLTGTSGEIRKLCGRTN  324



>gb|ABK21858.1| unknown [Picea sitchensis]
Length=326

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 168/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+A K ++E +CPG+VSCAD++++AARDA   +GGP+W V LGRRDSTTAS + A
Sbjct  107  RGFEVIDAIKTQVEAACPGVVSCADIVAIAARDAVVQLGGPTWLVLLGRRDSTTASLSAA  166

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             ++LP P  NL  LISSF + GL+ RD+VALSG+H++GQA+C  FR+RI+   ++ID  F
Sbjct  167  NSNLPPPASNLSALISSFQSHGLSIRDLVALSGSHTIGQARCTNFRNRIHSE-SNIDLSF  225

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A  R+  CP   G+ NLAPLDL+TP +FDNNYYKNL +++GLL SDQ LF+GG+TDN+VS
Sbjct  226  ARARQANCPSTGGDDNLAPLDLLTPTTFDNNYYKNLERRRGLLHSDQQLFNGGSTDNLVS  285

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y   P AF  DFA AM+KM  I+PLTG NG IRK C  +N
Sbjct  286  FYTTYPIAFSIDFAVAMVKMGSIEPLTGNNGEIRKNCRKIN  326



>ref|XP_004240055.1| PREDICTED: cationic peroxidase 1-like [Solanum lycopersicum]
Length=317

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K ++E SC G+VSCAD+L+VAARD+   +GGPSWTV LGRRDSTTAS + A
Sbjct  98   RGFDVIDTIKTQIESSCAGVVSCADILAVAARDSVVKLGGPSWTVLLGRRDSTTASLSNA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +D+P P  NL  LISSF+NKG NTR+MVALSG+H++GQA+C  FRDR++ N TDI+A F
Sbjct  158  NSDIPAPTLNLSSLISSFSNKGFNTREMVALSGSHTIGQARCTTFRDRLH-NETDINASF  216

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A++ + +CP+   + N++PLD  +P +FDN YYKNL  +KGLL SDQ L SGG+TD+IV+
Sbjct  217  ATSIKSKCPQSGSDNNVSPLDTTSPTTFDNIYYKNLRIQKGLLHSDQQLSSGGSTDSIVN  276

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +   F ADFA AM+KM  + PLTG NG IRK C   N
Sbjct  277  TYSSNSATFLADFAKAMVKMGNLSPLTGTNGQIRKNCRKTN  317



>ref|XP_007137608.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
 gb|ESW09602.1| hypothetical protein PHAVU_009G140700g [Phaseolus vulgaris]
Length=320

 Score =   271 bits (692),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 171/223 (77%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI++ K  +EK CPG+VSCAD+L++AARD+   +GGP+W VKLGRRD+ TAS + A
Sbjct  99   RGYEVIDSIKSAVEKVCPGVVSCADILAIAARDSVGILGGPTWDVKLGRRDARTASQSAA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             + +P P  NL++LIS F+  GL+T+DMVALSG H++GQ++C  FR RIY N ++ID  F
Sbjct  159  NSAIPPPTSNLNQLISKFSAVGLSTKDMVALSGGHTIGQSRCTSFRARIY-NESNIDTSF  217

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP+ +G+G  NLAPLDL TP SFDN Y+KNL+QKKGLL SDQ LF+GG+TD+I
Sbjct  218  ARTRQSSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGLLHSDQQLFNGGSTDSI  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F +DF +AMIKM +I PLTG  G +RK C  +N
Sbjct  278  VRGYSTNPSSFSSDFVTAMIKMGDITPLTGSKGEVRKNCRRIN  320



>ref|XP_010543687.1| PREDICTED: peroxidase 52 [Tarenaya hassleriana]
Length=324

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 174/223 (78%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K  +E++CPG+VSCAD+L+VAARD    +GGP+W VKLGRRD+ TAS + A
Sbjct  103  RGFDVIDNIKTAVERACPGVVSCADILAVAARDGVVLLGGPNWNVKLGRRDARTASQSGA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++P P  +L +LISSF N GL+TRDMVALSG H++GQA+C  FR RIY N T+I++ F
Sbjct  163  NSNIPAPTSSLSQLISSFGNVGLSTRDMVALSGGHTIGQARCTSFRTRIY-NETNINSAF  221

Query  362  ASTRRRQCPKD--TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR++ CP+   +G+GNLAPLD+ TP +F+N+Y+KNL+ ++GLL SDQ LF+GG+TD+I
Sbjct  222  ATTRQQTCPRTAGSGDGNLAPLDIQTPANFNNDYFKNLMAQRGLLHSDQELFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P  F +DF +AMIKM +I PLTG +G IR+ C  LN
Sbjct  282  VRTYSSNPATFNSDFVAAMIKMGDISPLTGNSGEIRRNCRRLN  324



>ref|XP_010031113.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=331

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 165/223 (74%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K  +EK CPG+VSCAD+L++ ARD++  +GGPSW VK+GRRD+ TAS   A
Sbjct  110  RGFDVVDNIKSAVEKVCPGVVSCADLLAITARDSTVILGGPSWNVKVGRRDARTASQAAA  169

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL+ LIS F N GL+TRDMVALSG+H++GQA+C  FR RIY N T++D+  
Sbjct  170  NNSIPPPTSNLNNLISFFQNVGLSTRDMVALSGSHTIGQARCTNFRTRIY-NETNLDSSL  228

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP+  G+G  NLAPLDL TP  FDNNYYKNLLQ KGLL SDQ LF+GG+TD++
Sbjct  229  AKTRQSNCPRTVGSGDNNLAPLDLQTPTKFDNNYYKNLLQNKGLLHSDQQLFNGGSTDSL  288

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y  +P  F +DF + MIKM +I+PLTG +G IRK C  +N
Sbjct  289  VRTYGSNPSTFTSDFVAGMIKMGDIKPLTGSSGEIRKNCRKIN  331



>ref|XP_011095107.1| PREDICTED: cationic peroxidase 1-like [Sesamum indicum]
Length=321

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K ++E SCPGIVSCAD+LSVAARD   A+ GPSW V LGRRDSTTAS + A
Sbjct  102  RGFDVIDTIKTQVESSCPGIVSCADILSVAARDGVVALNGPSWAVALGRRDSTTASLSAA  161

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             + +PGP  NL+ LI+SF+NKG   R+MVALSG+H++GQA+C  FR+RIY N  +I+A F
Sbjct  162  NSQIPGPNLNLNALITSFSNKGFTAREMVALSGSHTIGQARCTTFRNRIY-NEANINASF  220

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A++ R  CP+  GN NL+PLD+V+PN F+N+Y++NLL  +GLL SDQ LFS G+TD  V 
Sbjct  221  AASVRANCPQSGGNNNLSPLDVVSPNVFNNDYFRNLLSLRGLLHSDQQLFSNGSTDAQVR  280

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
             Y+ +  AF  DFASAM+KMS + PLTG NG IR+ C
Sbjct  281  AYSTNSAAFFNDFASAMVKMSNLSPLTGTNGQIRRNC  317



>ref|XP_010045399.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 171/224 (76%), Gaps = 4/224 (2%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+  K ++E +CPG+VSCAD++++AARD+   +GGPSW VKLGRRD+ TAS +LA
Sbjct  101  RGYNVIDRIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWEVKLGRRDARTASFSLA  160

Query  182  ETD-LPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             +  LP P   L  L S F  +GL+TRDMVALSG+H++GQA+C  FR RIY N ++ID+ 
Sbjct  161  NSGALPPPTSTLSNLTSLFQAQGLSTRDMVALSGSHTIGQARCISFRSRIY-NDSNIDSS  219

Query  359  FASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            F+ TR+R+CP   G+G  NLAPLDL +P +FDN Y+KNLL  KGLL SDQ LF+GG+TD+
Sbjct  220  FSKTRQRKCPSTVGSGDQNLAPLDLQSPTAFDNAYFKNLLSNKGLLHSDQELFNGGSTDS  279

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +V  Y+ +P+ F +DFASAMIKM +I+PLTG  G IRK+C  +N
Sbjct  280  LVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRKICSKVN  323



>ref|XP_003534655.2| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=342

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 169/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K ++E  CPG+VSCAD+L+VAARD+  A+GG +WTV+LGRRDSTTAS + A
Sbjct  123  RGFDVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGTTWTVQLGRRDSTTASLSSA  182

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLPGP  +L  LISSF+NKG +++++VALSG+H++GQAQC  FR RIY N T+ID+ F
Sbjct  183  NSDLPGPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFRTRIY-NDTNIDSSF  241

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A + +  CP   G+ NLAPLD  +PN+FDN Y+KNL  KKGLL SDQ LF+GG+TD+ V+
Sbjct  242  AKSLQGNCPSTGGDSNLAPLDTTSPNTFDNAYFKNLQSKKGLLHSDQELFNGGSTDSQVN  301

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +P +FQ DFA+AMIKM  + PLTG +G IR  C   N
Sbjct  302  SYSSNPASFQTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  342



>dbj|BAJ97638.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=320

 Score =   270 bits (690),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 168/223 (75%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+A K+ +EK CPG+VSCADVL++AARD+  A+GGP+W VK+GRRDSTTAS + A
Sbjct  99   RGFEVIDAIKVAVEKICPGVVSCADVLAIAARDSVVALGGPNWAVKVGRRDSTTASFSGA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P   L  L S FA +GL+ +DMVALSG+H++GQA+C  FR  +Y N T+ID+GF
Sbjct  159  NNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQARCTNFRAHVY-NETNIDSGF  217

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TRR  CP ++G+G  NLAPLDL TP +F+NNYYKNL+ KKGL+ SDQ LF+GGATD +
Sbjct  218  AGTRRSGCPPNSGSGDNNLAPLDLQTPTAFENNYYKNLVAKKGLMHSDQELFNGGATDPL  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y  S  AF ADF   MIKM +I PLTG NG +RK C  +N
Sbjct  278  VQYYVSSQSAFFADFVEGMIKMGDISPLTGNNGEVRKNCRKIN  320



>gb|ACT35473.1| peroxidase 52, partial [Brassica rapa]
Length=306

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +E +CPG+VSCAD+L++AARD+   +GGP+W VK+GRRD+ TAS   A
Sbjct  85   RGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNVKVGRRDARTASQAAA  144

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR R+Y N T+I+A F
Sbjct  145  NNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRTRVY-NETNINAAF  203

Query  362  ASTRRRQCPK--DTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+ R+R CP+   +G+GNLAPLD+ + N+FDN+Y+KNL+ ++GLL SDQ LF+GG+TD+I
Sbjct  204  ATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGLLHSDQELFNGGSTDSI  263

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+ Y+ +P +F +DF +AMIKM +I PLTG +G IRKVCG  N
Sbjct  264  VTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  306



>emb|CDX70158.1| BnaA10g25070D [Brassica napus]
Length=325

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +E +CPG+VSCAD+L++AARD+   +GGP+W VK+GRRD+ TAS   A
Sbjct  104  RGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNVKVGRRDARTASQAAA  163

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR R+Y N T+I+A F
Sbjct  164  NNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRTRVY-NETNINAAF  222

Query  362  ASTRRRQCPK--DTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+ R+R CP+   +G+GNLAPLD+ + N+FDN+Y+KNL+ ++GLL SDQ LF+GG+TD+I
Sbjct  223  ATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGLLHSDQELFNGGSTDSI  282

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+ Y+ +P +F +DF +AMIKM +I PLTG +G IRKVCG  N
Sbjct  283  VTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  325



>ref|XP_009410536.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=321

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 171/223 (77%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K  +EK CPG+VSCAD+L++AARD+ A +GG SW VKLGRRDSTTAS + A
Sbjct  100  RGFDVVDDIKTAVEKVCPGVVSCADILAIAARDSVATLGGRSWNVKLGRRDSTTASLSAA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  +L  LIS F+++GL+T+D+VALSGAH++GQA+C  FR  IY + T+ID+GF
Sbjct  160  NNNIPPPSSSLSNLISKFSDQGLSTKDLVALSGAHTIGQARCISFRAHIYTD-TNIDSGF  218

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+  CP   G+G  NLAPLDL TP +FDNNYYKNL+  KGLL SDQ L++GG+TD+ 
Sbjct  219  ANTRQSNCPSTAGSGDNNLAPLDLQTPTTFDNNYYKNLISTKGLLHSDQELYNGGSTDSQ  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ S  +F +DFA+AMIKM +I PLTG +G IRK C  +N
Sbjct  279  VKAYSNSSGSFYSDFAAAMIKMGDISPLTGSSGEIRKNCRKIN  321



>ref|XP_004502855.1| PREDICTED: peroxidase 52-like [Cicer arietinum]
Length=322

 Score =   270 bits (689),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 169/219 (77%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK CPGIVSCAD+L++AA+D+   +GGP+W VK+GRRD+ TAS + A
Sbjct  101  RGFEVIDNIKTAVEKVCPGIVSCADILAIAAKDSVEILGGPTWNVKVGRRDAKTASQSAA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T +P P  +L +L S F+  GL+T+D+VALSGAH++GQA+C  FR RIY N T+ID  F
Sbjct  161  NTGIPAPSSSLTQLTSRFSALGLSTKDLVALSGAHTIGQARCTNFRARIY-NETNIDTSF  219

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+  CP  +G+G  NLAPLDL TP SFDNNY+KNL+QKKGLL SDQ LF+GG+ D+I
Sbjct  220  ATTRKSSCPSTSGSGDNNLAPLDLQTPTSFDNNYFKNLIQKKGLLHSDQQLFNGGSADSI  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
            V+ Y+ +P +F + F++AMIKM +I PLTG NG IRK C
Sbjct  280  VTGYSTNPTSFSSAFSAAMIKMGDISPLTGSNGEIRKNC  318



>dbj|BAK03677.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   269 bits (688),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 163/221 (74%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI++ K ++E  C   VSCAD+L+VAARD+  A+GGPSWTV LGRRDSTTA+  LA
Sbjct  92   RGFDVIDSIKAQVEAVCRQTVSCADILAVAARDSVVALGGPSWTVPLGRRDSTTANAGLA  151

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLPGP  +  +L ++F  KGLNT DMVALSGAH++G+AQC  FR RIYG  T+I+A +
Sbjct  152  NSDLPGPGSSRAQLEAAFLKKGLNTVDMVALSGAHTIGRAQCSSFRSRIYGGDTNINAAY  211

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A++ R  CP+  GNGNLA LD  TPN+FDN YYK+LL +KGL+ SDQVLF+G  TDN V 
Sbjct  212  AASLRANCPQSGGNGNLASLDTTTPNTFDNAYYKDLLSQKGLMHSDQVLFNGDTTDNTVR  271

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             +A +P AF + F +AMIKM  I PLTG  G +R  C  +N
Sbjct  272  NFASNPAAFTSAFTTAMIKMGNIAPLTGTQGQVRLTCSKVN  312



>gb|KHG18057.1| Peroxidase 52 -like protein [Gossypium arboreum]
Length=322

 Score =   269 bits (688),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 166/223 (74%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K  +E  CPG+VSCAD+L++ ARD+   +GGP W VKLGRRD+ +AS + A
Sbjct  101  RGFDVVDNIKSAVENVCPGVVSCADILAITARDSVEILGGPKWAVKLGRRDARSASQSAA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++L S F   GL+TRD+VALSGAH++GQA+C  FR RIY N ++IDA F
Sbjct  161  NNGIPAPTSNLNQLTSRFNALGLSTRDLVALSGAHTIGQARCTSFRARIY-NESNIDASF  219

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+R CP+ TG+G  NLAPLD+ TP SFDNNY+KNL+ ++GLL SDQ LF+GG+TD+I
Sbjct  220  AQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLVSRRGLLHSDQQLFNGGSTDSI  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y  SP +F +DF SAMIKM +I PLTG  G IRK C  +N
Sbjct  280  VRGYGNSPSSFNSDFVSAMIKMGDISPLTGSRGEIRKNCRRVN  322



>ref|XP_009122142.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase P7 [Brassica rapa]
Length=325

 Score =   269 bits (687),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 174/223 (78%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +E +CPG+VSCAD+L++AARD+   +GGP+W VK+GRRD+ TAS   A
Sbjct  104  RGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNVKVGRRDARTASQAAA  163

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR R+Y N T+I+A F
Sbjct  164  NNNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRTRVY-NETNINAAF  222

Query  362  ASTRRRQCPK--DTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+ R+R CP+   +G+GNLAPLD+ + N+FDN+Y+KNL+ ++GLL SDQ LF+GG TD+I
Sbjct  223  ATLRQRSCPRAAGSGDGNLAPLDVNSANTFDNSYFKNLVAQRGLLHSDQELFNGGXTDSI  282

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+ Y+ +P +F +DF +AMIKM +I PLTG +G IRKVCG  N
Sbjct  283  VTGYSNNPSSFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  325



>gb|AAP76387.1| class III peroxidase [Gossypium hirsutum]
Length=330

 Score =   269 bits (688),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 167/223 (75%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K  +E  CPG+VSCAD+L++AARD+   +GGP W VKLGRRD+ +AS + A
Sbjct  109  RGFDVVDNIKSAVENVCPGVVSCADILAIAARDSVEILGGPKWAVKLGRRDARSASQSAA  168

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++L S F   GL+TRD+VALSGAH++GQA+C  FR RIY N ++IDA F
Sbjct  169  NNGIPPPTSNLNRLTSRFNALGLSTRDLVALSGAHTIGQARCTSFRARIY-NESNIDASF  227

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+R CP+ TG+G  NLAPLD+ TP SFDNNY+KNL+ ++GLL SDQ LF+GG+TD+I
Sbjct  228  AQTRQRNCPRTTGSGDNNLAPLDIQTPTSFDNNYFKNLISQRGLLHSDQQLFNGGSTDSI  287

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y  SP +F +DF +AMIKM +I PLTG  G IRK C  +N
Sbjct  288  VRGYGNSPSSFNSDFVAAMIKMGDISPLTGSRGEIRKNCRRVN  330



>ref|XP_008465298.1| PREDICTED: peroxidase 4-like [Cucumis melo]
Length=324

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 163/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVIE+ K  +EK CPG+VSCAD+L+++ARDA   +GGPSW VKLGRRDS TAS +  
Sbjct  105  RGFDVIESIKKNVEKICPGVVSCADILTLSARDAVVVLGGPSWKVKLGRRDSKTASFSDV  164

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P   LD LI+ F  KGL+ RD+VALSGAH++GQA+C  F++RIY N T+ID  F
Sbjct  165  TGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQARCLFFKNRIY-NETNIDESF  223

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A  R+R CP + G+ N APLDL TP  FDN YYKNLL+KK LL+SDQVL +GG+TD++V 
Sbjct  224  AEERQRICPTNGGDDNRAPLDLRTPKLFDNYYYKNLLEKKALLRSDQVLHNGGSTDSLVE  283

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+    AF+ DF +AMIKM +IQPLTG  G IRK+C   N
Sbjct  284  LYSDDSDAFEHDFVTAMIKMGDIQPLTGSQGEIRKICSRPN  324



>emb|CDX98835.1| BnaC09g50000D [Brassica napus]
Length=325

 Score =   268 bits (686),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 175/223 (78%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +E +CPG+VSCAD+L++AARD+   +GGP+W VK+GRRD+ TAS   A
Sbjct  104  RGFNVIDNIKTAVEAACPGVVSCADILAIAARDSVVLLGGPNWNVKVGRRDARTASQAAA  163

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +++P P  +L +LISSF+  GL+TRDMVALSGAH++GQ++C  FR R+Y N T+I+A F
Sbjct  164  NSNIPAPTSSLSQLISSFSAVGLSTRDMVALSGAHTIGQSRCTNFRTRVY-NETNINAAF  222

Query  362  ASTRRRQCPK--DTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+ R+R CP+   +G+GNLAPLD+ + N FDN+Y+KNL+ ++GLL SDQ LF+GG+TD+I
Sbjct  223  ATLRQRSCPRAAGSGDGNLAPLDVNSANFFDNSYFKNLVAQRGLLHSDQELFNGGSTDSI  282

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+ Y+ +P +F +DF +AMIKM +I PLTG +G IRKVCG  N
Sbjct  283  VTGYSNNPASFSSDFTAAMIKMGDISPLTGSSGEIRKVCGRTN  325



>ref|XP_002278996.1| PREDICTED: peroxidase 4 [Vitis vinifera]
Length=321

 Score =   268 bits (685),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 168/223 (75%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K ++E +CPG+VSCADVL++AARD+   +GGPSW VKLGRRD+ TAS   A
Sbjct  100  RGFDVVDDIKSKVETACPGVVSCADVLAIAARDSVVILGGPSWNVKLGRRDARTASQAAA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LIS F   GL+TRD+VAL+G+H++GQA+C  FR RIY N T+ID  F
Sbjct  160  NNSIPPPTSNLNQLISRFQALGLSTRDLVALAGSHTIGQARCTSFRARIY-NETNIDNSF  218

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP+ +G+G  NLAPLDL TP +F+NNYYKNL++KKGLL SDQ LF+GG+TD+I
Sbjct  219  AKTRQSNCPRASGSGDNNLAPLDLQTPTAFENNYYKNLIKKKGLLHSDQQLFNGGSTDSI  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V +Y+ S   F A F + MIKM +I PLTG NG IRK C  +N
Sbjct  279  VRKYSNSRSNFNAHFVAGMIKMGDISPLTGSNGEIRKNCRRVN  321



>ref|XP_006353885.1| PREDICTED: peroxidase 52-like [Solanum tuberosum]
Length=319

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+  K ++E +CP +VSCAD+L++AAR  +  +GGPSW V LGRRD+ TAS + A
Sbjct  100  RGYEVIDTIKAQVESACPNVVSCADILALAARQGTVLLGGPSWAVPLGRRDARTASQSAA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T +P PF +L  L+S F+ KGLN RDM ALSG+H++GQA+C  FR+RIY N T+ID  F
Sbjct  160  NTQIPAPFSSLSTLLSMFSAKGLNARDMTALSGSHTIGQARCTTFRNRIY-NDTNIDTQF  218

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A+TRR  CP   G+ NLAPLD+ TPN FDN+YY+NL+ ++GLL SDQ LF+GG+ D +V 
Sbjct  219  AATRRATCPASGGDANLAPLDIQTPNRFDNDYYQNLVVRRGLLHSDQELFNGGSQDALVR  278

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +  +F++DFA+AM+KM  I PLTG NG IR  C A+N
Sbjct  279  SYSNNVASFRSDFAAAMVKMGNISPLTGTNGEIRTNCRAIN  319



>ref|XP_002269918.1| PREDICTED: peroxidase 4 [Vitis vinifera]
 sp|A7NY33.1|PER4_VITVI RecName: Full=Peroxidase 4; Flags: Precursor [Vitis vinifera]
 emb|CBI15844.3| unnamed protein product [Vitis vinifera]
Length=321

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 165/223 (74%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG +VI+  K ++E  CPG+VSCAD++++AARD+   +GGP W VKLGRRDS TAS + A
Sbjct  100  RGLNVIDNIKSQVESVCPGVVSCADIIAIAARDSVVILGGPDWDVKLGRRDSKTASLSGA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  +L  LIS F  +GL+TRDMVALSGAH++GQA+C  FR RIY N T+ID+ F
Sbjct  160  NNNIPPPTSSLSNLISKFQAQGLSTRDMVALSGAHTIGQARCTSFRARIY-NETNIDSSF  218

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP  +G+G  NLAPLDL TP +FDN YYKNL+ +KGLL SDQVL++GG+TD+ 
Sbjct  219  AKTRQASCPSASGSGDNNLAPLDLQTPTTFDNYYYKNLINQKGLLHSDQVLYNGGSTDST  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y  +P+ F +DF + MIKM +I PLTG  G IRK CG +N
Sbjct  279  VKTYVNNPKTFTSDFVAGMIKMGDITPLTGSEGEIRKSCGKVN  321



>gb|EMS66985.1| Peroxidase 4 [Triticum urartu]
Length=321

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 166/219 (76%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+A K+ +E  CPG+VSCADVL++AARD+  A+GGP+W VK+GRRDSTTAS + A
Sbjct  100  RGFEVIDAIKVAVENICPGVVSCADVLAIAARDSVVALGGPNWAVKVGRRDSTTASFSGA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P   L  L S FA +GL+ +DMVALSG+H++GQA+C  FR  IY N TDID+GF
Sbjct  160  NNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQARCTNFRAHIY-NETDIDSGF  218

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP ++G+G  NLAPLDL TP +F+NNYYKNL+ KKGLL SDQ LF+GGATD +
Sbjct  219  AGTRQSGCPPNSGSGDNNLAPLDLQTPIAFENNYYKNLVAKKGLLHSDQELFNGGATDPL  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
            V  YA S  AF ADF + MIKM +I PL G NG IRK C
Sbjct  279  VQYYASSQSAFFADFVAGMIKMGDISPLIGNNGEIRKNC  317



>ref|XP_006345522.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K ++E SC G+VSCAD+L+VAARD+   +GGPSWTV LGRRDSTTAS + A
Sbjct  98   RGFDVIDTIKTQVESSCAGVVSCADILAVAARDSVVKLGGPSWTVLLGRRDSTTASLSTA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +D+P P  NL  LISSF+NKG N R+MVALSG+H++GQA+C  FRDR+Y N TDI+  F
Sbjct  158  NSDIPAPTLNLSGLISSFSNKGFNAREMVALSGSHTIGQARCTTFRDRLY-NETDINDSF  216

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A++ + +CP+   + N++PLD  + N+FDN YYKNL  +KGLL SDQ L SGG+TD+IV+
Sbjct  217  ATSVKSKCPQSGSDNNISPLDTTSANTFDNIYYKNLRIQKGLLHSDQQLSSGGSTDSIVN  276

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +   F ADFA AM+KM  + PLTG NG IRK C   N
Sbjct  277  TYSSNSATFFADFAKAMVKMGNLSPLTGTNGQIRKNCRKTN  317



>ref|XP_002281755.1| PREDICTED: peroxidase P7 [Vitis vinifera]
Length=317

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 158/221 (71%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +E +C   VSCAD+L++AARD    +GGPSWTV LGRRD+ TA+ + A
Sbjct  98   RGFEVIDTIKTRVEAACKATVSCADILALAARDGVVLLGGPSWTVPLGRRDARTANQSAA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              DLP PF NL  LIS FA KGLN  DM ALSG+H++GQAQCF FR RIY N T+ID  F
Sbjct  158  NNDLPAPFANLSALISGFAAKGLNADDMTALSGSHTIGQAQCFTFRSRIY-NDTNIDPNF  216

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A+TRR  CP   GN NLAPLD+ T N FDNNYY+NL+ ++GLL SDQ LF+GG+ D +V 
Sbjct  217  AATRRSTCPVSGGNSNLAPLDIQTMNKFDNNYYQNLMTQRGLLHSDQELFNGGSQDALVR  276

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +   F  DFA+AM+KMS I PLTG NG IR  C  +N
Sbjct  277  TYSANNALFFGDFAAAMVKMSNISPLTGTNGEIRSNCRVVN  317



>gb|ACU17608.1| unknown [Glycine max]
Length=320

 Score =   266 bits (681),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 169/223 (76%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK CPG+VSCAD+L++AARD+   +GGP+W VKLGRRD+ TAS + A
Sbjct  99   RGFEVIDNIKSAVEKVCPGVVSCADILAIAARDSVQILGGPTWNVKLGRRDARTASQSAA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LIS F+  GL+T+D+VALSG H++GQA+C  FR RIY N T+I   F
Sbjct  159  NNGIPAPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNFRARIY-NETNIGTAF  217

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR++ CP+ +G+G  NLAPLDL TP SFDN Y+KNL+QKKG L SDQ LF+GG+TD+I
Sbjct  218  ARTRQQSCPRTSGSGDNNLAPLDLQTPTSFDNYYFKNLVQKKGFLHSDQQLFNGGSTDSI  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P  F +DFA+AMIKM +I PLTG NG +RK C  +N
Sbjct  278  VRGYSTNPGTFPSDFAAAMIKMGDISPLTGSNGEVRKNCRRIN  320



>ref|XP_009369255.1| PREDICTED: peroxidase P7-like [Pyrus x bretschneideri]
Length=319

 Score =   266 bits (681),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 166/219 (76%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++V++  K  +E  CPG+VSCAD+L++AARD+   +GGPSW VKLGRRD+ TAS   A
Sbjct  98   RGFNVVDKIKSAVENVCPGVVSCADILAIAARDSVTILGGPSWDVKLGRRDTRTASQAAA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LIS+F   GL+TRD+VALSG+H++GQA+C  FR RIY N T++D+  
Sbjct  158  NNSIPPPTRNLNQLISTFNALGLSTRDLVALSGSHTIGQARCTTFRPRIY-NETNLDSSL  216

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP+ +G+G  NLAPLDL +P SFDN+Y+KNL+QKKGLL SDQ LF+GG+TD+I
Sbjct  217  AQTRQSNCPRTSGSGDNNLAPLDLKSPTSFDNSYFKNLIQKKGLLHSDQQLFNGGSTDSI  276

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
            V  Y  S   F +DFA AMIKM +I+PLTG NG IRK C
Sbjct  277  VRAYRNSYSTFSSDFAKAMIKMGDIKPLTGSNGEIRKNC  315



>ref|XP_008782624.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=320

 Score =   266 bits (681),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 167/223 (75%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K  +EK+CPG+VSCAD+L+++ARD+   +GGP+W VKLGRRD+ TAS + A
Sbjct  99   RGFDVIDKIKAAVEKACPGVVSCADILAISARDSVVLLGGPNWNVKLGRRDARTASLSGA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  +L  LIS F+ +GL+  +MVALSGAH++GQA+C  FR RIY N T+ID  F
Sbjct  159  NNNIPPPTSSLSNLISKFSAQGLSANEMVALSGAHTIGQARCTSFRARIY-NDTNIDGSF  217

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TRR  CP  +GNG  NLAPLDL TP SFDN+Y+KNL+ +KGLL SDQ LF+ G+TD++
Sbjct  218  AKTRRSNCPSTSGNGDNNLAPLDLQTPTSFDNDYFKNLVNQKGLLHSDQQLFNKGSTDSL  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VS Y+ +P  F +DF +AMIKM +I PLTG  G IRK C  +N
Sbjct  278  VSTYSTNPSKFSSDFVAAMIKMGDISPLTGSQGEIRKNCRKIN  320



>ref|XP_003616748.1| Peroxidase [Medicago truncatula]
 gb|AES99706.1| class III peroxidase [Medicago truncatula]
Length=325

 Score =   267 bits (682),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 167/223 (75%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK CPG VSCAD+L++ ARD+   +GGP+W VKLGRRD+ TAS + A
Sbjct  104  RGFEVIDKIKSAVEKVCPGAVSCADILTITARDSVEILGGPTWDVKLGRRDARTASKSAA  163

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              D+P P  +L++LIS F   GL+T+D+VALSG H++GQA+C  FR  IY N ++ID  F
Sbjct  164  NNDIPAPTSSLNQLISRFNALGLSTKDLVALSGGHTIGQARCTTFRAHIY-NDSNIDTSF  222

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CPK +G+G  NLAPLDL TP SFDN+Y+KNL+  KGLL SDQ LF+GG+TD+I
Sbjct  223  ARTRQSGCPKTSGSGDNNLAPLDLATPTSFDNHYFKNLVDSKGLLHSDQQLFNGGSTDSI  282

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V EY+  P +F +DF +AMIKM +I PLTG NG IRK C ++N
Sbjct  283  VHEYSLYPSSFSSDFVTAMIKMGDISPLTGSNGEIRKQCRSVN  325



>ref|NP_001241914.1| uncharacterized protein LOC100790279 precursor [Glycine max]
 gb|ACU17865.1| unknown [Glycine max]
Length=320

 Score =   266 bits (681),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 170/223 (76%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+  K  +EK+CPG+VSCAD+L++AARD+   +GGPSW VK+GRRD+ TAS + A
Sbjct  99   RGYEVIDNIKSAVEKACPGVVSCADILAIAARDSVQILGGPSWNVKVGRRDARTASQSAA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LIS F+  GL+T+D+VALSG H++GQA+C  FR RIY N ++ID  F
Sbjct  159  NNGIPPPTSNLNQLISRFSALGLSTKDLVALSGGHTIGQARCTNFRARIY-NESNIDTAF  217

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A  R++ CP+ +G+G  NLA LDL TP  FDN Y+KNL+QKKGLL SDQ LF+GG+TD+I
Sbjct  218  ARARQQSCPRTSGSGDNNLATLDLQTPTEFDNYYFKNLVQKKGLLHSDQQLFNGGSTDSI  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F +DFA+AMIKM +I PLTG NG IRK C  +N
Sbjct  278  VRGYSTNPSSFSSDFAAAMIKMGDISPLTGSNGEIRKNCRRIN  320



>gb|KDP21681.1| hypothetical protein JCGZ_03352 [Jatropha curcas]
Length=325

 Score =   266 bits (681),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 166/223 (74%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI++ K  +EK+CPG+VSCAD+L+VAARD++  +GGP+W VKLGRRD+ TAS + A
Sbjct  104  RGFEVIDSIKSAVEKACPGVVSCADILAVAARDSTVILGGPTWNVKLGRRDARTASLSAA  163

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LIS F   GL+TRD+VAL+G+H++GQA+C  FR RIY N T+ID  F
Sbjct  164  NNGIPPPTSNLNQLISRFNALGLSTRDLVALTGSHTIGQARCTSFRARIY-NETNIDNSF  222

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TRR  CP+  G G  NLAPLDL TP SFDNNY+KNLL +KGLL SDQ LF+GG+TD+I
Sbjct  223  AQTRRSNCPRTNGTGDNNLAPLDLQTPTSFDNNYFKNLLNQKGLLHSDQQLFNGGSTDSI  282

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+     F +DF + MIKM +I PLTG  G IRK C  +N
Sbjct  283  VRTYSNGQSTFFSDFVAGMIKMGDISPLTGSQGEIRKNCRRMN  325



>ref|XP_009785653.1| PREDICTED: cationic peroxidase 1-like [Nicotiana sylvestris]
Length=314

 Score =   266 bits (680),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 166/221 (75%), Gaps = 2/221 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K ++E +C G+VSCAD+L+VAARD+   +GGPSW V LGRRDSTTAS + A
Sbjct  96   RGFDVIDTIKTQVESTCAGVVSCADILAVAARDSVVKLGGPSWNVLLGRRDSTTASLSAA  155

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              D+P P  NL  LISSF+NKG N+R+MVALSG+H++GQA+C  FRDR+Y N T+I++ F
Sbjct  156  NNDIPAPTLNLSSLISSFSNKGFNSREMVALSGSHTIGQARCTTFRDRLY-NETNINSSF  214

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
             +T +  CP++ G+ NL+PLD  +P SFDN YYKNL  +KG+L SDQ LF+GG+TD+IV+
Sbjct  215  GTTIKANCPQNGGDNNLSPLD-TSPTSFDNVYYKNLQSQKGILHSDQQLFNGGSTDSIVN  273

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +   F  DFA AM+KM  + PLTG NG IRK C  +N
Sbjct  274  TYSSNSATFFTDFAMAMVKMGNLSPLTGTNGQIRKNCRKIN  314



>ref|XP_006596457.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=301

 Score =   265 bits (678),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E +CPG+VSCAD+L++AARD+  A+GGPSW V LGRRDSTTAS   A
Sbjct  82   RGFEVIDDIKTKVEAACPGVVSCADILAIAARDSVVALGGPSWNVGLGRRDSTTASKDSA  141

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TD+P P  +L  LISSF+ KG NT++MVALSGAH+ GQA+C LFR R+Y N + I++ F
Sbjct  142  TTDIPSPLMDLSALISSFSKKGFNTKEMVALSGAHTTGQARCQLFRGRVY-NESSIESNF  200

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A++ +  CP   G+ NL+PLD+ T   FD  Y+KNL+ KKGLL SDQ LFSGG+TD+ V+
Sbjct  201  ATSLKSNCPSTGGDSNLSPLDVTTSVLFDTAYFKNLINKKGLLHSDQQLFSGGSTDSQVT  260

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+  P AF ADFASAM+KM  + PLTG++G IR  C  +N
Sbjct  261  AYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRTNCRKVN  301



>ref|XP_008810563.1| PREDICTED: peroxidase 4-like [Phoenix dactylifera]
Length=319

 Score =   266 bits (679),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 164/223 (74%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV+++ K  +EK CPG+VSCAD+L++ ARD+   +GGP+W VKLGRRDSTTAS + A
Sbjct  98   RGFDVVDSIKAAVEKVCPGVVSCADILAITARDSVVILGGPNWNVKLGRRDSTTASFSGA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  +L  LIS F+ +GL+T+DMVALSG H++GQA+C  FR  +Y N TDID+ F
Sbjct  158  NNNIPPPNSSLSNLISKFSAQGLSTKDMVALSGGHTIGQARCTNFRAHVY-NDTDIDSSF  216

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP   G+G  NLAPLDL TP  FDNNYYKNL+ KKGLL SDQ LF+GG+TD+ 
Sbjct  217  AKTRQMNCPSTAGSGDNNLAPLDLQTPTCFDNNYYKNLINKKGLLHSDQELFNGGSTDSQ  276

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+ Y+ +P  F +DF + MI M +I PLTG  G IRK C  +N
Sbjct  277  VTTYSNNPSTFNSDFVTGMINMGDINPLTGTRGEIRKNCRRVN  319



>ref|XP_009606349.1| PREDICTED: peroxidase P7-like [Nicotiana tomentosiformis]
Length=319

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 166/223 (74%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK CPG+VSCAD+L+V ARD+   +GGP+W VKLGRRD+ TAS   A
Sbjct  97   RGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWDVKLGRRDARTASQAAA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             + +P P  NL++LISSF   GL+T+DMVALSGAH++GQA+C  FR RIY    ++D+  
Sbjct  157  NSSIPPPTSNLNRLISSFTAVGLSTKDMVALSGAHTIGQARCTSFRARIYNETNNLDSSL  216

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP+++G+G  NLAPLDL TP  FDN+Y+ NL+ KKGLL SDQ LF+GG+ D+I
Sbjct  217  AKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYFINLVSKKGLLHSDQQLFNGGSADSI  276

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F ADF +AMIKM +I+PLTG  G IRK C  +N
Sbjct  277  VKSYSDNPNSFAADFVTAMIKMGDIRPLTGSKGEIRKNCRRIN  319



>ref|XP_003623567.1| Peroxidase [Medicago truncatula]
 gb|AES79785.1| class III peroxidase [Medicago truncatula]
Length=312

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K ELE  CP  VSCAD+LSVAARD+  A+GGPSWTV+LGRRDS TAS +LA
Sbjct  93   RGFDVIDTIKTELESLCPNTVSCADILSVAARDSVVALGGPSWTVQLGRRDSITASLSLA  152

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLPGP  +L  LI+SF NKG   ++MVALSG+H++GQA C  FR RIY N  +ID+ F
Sbjct  153  NSDLPGPGSDLSGLITSFDNKGFTPKEMVALSGSHTIGQASCRFFRTRIY-NDDNIDSSF  211

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A++ +  CP   G+ NL+PLD  TPN+FDN+Y++NL  +KGL  SDQ LF+GG+TD+ V 
Sbjct  212  ATSLQANCPTTGGDDNLSPLDTTTPNTFDNSYFQNLQSQKGLFSSDQALFNGGSTDSDVD  271

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            EY+    +F  DFA+AM+KM  + P+TG NG IR  C  +N
Sbjct  272  EYSSDSSSFATDFANAMVKMGNLNPITGSNGQIRTNCRVIN  312



>ref|XP_003552297.1| PREDICTED: cationic peroxidase 1-like [Glycine max]
Length=316

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E  CPG+VSCAD+L+VAARD+  A+GGP+WTV+LGRRDSTTAS + A
Sbjct  97   RGFNVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGPTWTVQLGRRDSTTASLSSA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP P  +L  LISSF+NKG +++++VALSG+H++GQAQC  FR RIY N T+ID+ F
Sbjct  157  NSDLPAPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFRTRIY-NDTNIDSSF  215

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A + +  CP   G   LAPLD  +PN+FDN Y+KNL  KKGLL SDQ LF+GG+TD+ V+
Sbjct  216  AKSLQGNCPSTGGGSTLAPLDTTSPNTFDNAYFKNLQSKKGLLHSDQELFNGGSTDSQVN  275

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +P +F+ DFA+AMIKM  + PLTG +G IR  C   N
Sbjct  276  SYSSNPASFKTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  316



>ref|XP_004302590.1| PREDICTED: cationic peroxidase 1-like [Fragaria vesca subsp. 
vesca]
Length=317

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K +LE  CPG+ SC+D+L+VAARD+  A+GGPSWTV+LGRRDSTTAS + A
Sbjct  98   RGFDVVDTIKSQLESLCPGVFSCSDILAVAARDSVVALGGPSWTVQLGRRDSTTASLSAA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T++P P  NL  L++SF+NKG N +++VALSG+H++GQA+C  FR R+Y N  +ID+ F
Sbjct  158  NTNIPAPTLNLSALLTSFSNKGFNAKELVALSGSHTIGQARCTTFRARLY-NEANIDSSF  216

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A++ +  CP   G+ NL+PLD+ TPN FDN Y+KNL+ +KGLL SDQ LFSGG+T+  V+
Sbjct  217  ATSLKANCPSSGGDANLSPLDVTTPNKFDNAYFKNLVSQKGLLHSDQQLFSGGSTNAQVN  276

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y  +P  F  DFA AM+KM  + PLTG NG IR  C  +N
Sbjct  277  AYVSNPGTFSTDFAKAMVKMGNLSPLTGTNGQIRTDCKKVN  317



>ref|XP_004500339.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=318

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 161/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K +LE +CPGIVSCAD+++VAARD+  A+GGPSW+V LGRRDSTTAS   A
Sbjct  99   RGFEVIDDIKTQLETACPGIVSCADIVAVAARDSVKALGGPSWSVGLGRRDSTTASKDAA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              D+P P  +L  LIS+F+NKG  T +MV LSGAH+ GQA+C LFR RIY N T ID+ F
Sbjct  159  TNDIPSPLMDLSDLISAFSNKGFTTNEMVVLSGAHTTGQARCQLFRGRIY-NETTIDSNF  217

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A++ +  CP   G+ NL  LD+ T   FDN Y+KNL+ KKGLL SDQ LFSGG+TD+ V+
Sbjct  218  ATSVKSNCPSTGGDSNLTSLDVTTNVLFDNAYFKNLVNKKGLLHSDQQLFSGGSTDSQVT  277

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ SP  F ADFASAM+KM  + PLTG NG IR  C  +N
Sbjct  278  TYSTSPSTFNADFASAMVKMGNLSPLTGNNGQIRTNCHKVN  318



>ref|XP_011008654.1| PREDICTED: peroxidase P7 [Populus euphratica]
Length=322

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 166/223 (74%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCADVL++AARD++  +GGP W VKLGRRD+ TAS   A
Sbjct  101  RGFEVIDNIKSAVEKACPGVVSCADVLAIAARDSTVILGGPQWNVKLGRRDARTASQAAA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LIS F   GL+TRDMVALSG+H++GQA+C  FR RIY N T ID+  
Sbjct  161  NNSIPPPTSNLNQLISRFNALGLSTRDMVALSGSHTIGQARCTNFRARIY-NETTIDSSL  219

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TRR  CP+ +G+G  NLAPLDL TP  F+NNYYKNL+ ++GLL SDQ LF+GG+TD+I
Sbjct  220  AQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYKNLVNRRGLLHSDQQLFNGGSTDSI  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +   F++DF + MIKM +I+PLTG  G IRK C  +N
Sbjct  280  VRTYSYNENTFRSDFVAGMIKMGDIRPLTGSRGEIRKNCRRIN  322



>ref|XP_006376028.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|ERP53825.1| hypothetical protein POPTR_0013s08130g [Populus trichocarpa]
 gb|AHL39175.1| class III peroxidase [Populus trichocarpa]
Length=322

 Score =   266 bits (679),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 166/223 (74%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK+CPG+VSCAD+L++AARD++  +GGP W VKLGRRD+ TAS   A
Sbjct  101  RGFEVIDNIKSAVEKACPGVVSCADILAIAARDSTVILGGPEWDVKLGRRDARTASQAAA  160

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LIS F   GL+TRDMVALSG+H++GQA+C  FR RIY N T ID+  
Sbjct  161  NNSIPRPTSNLNQLISRFNALGLSTRDMVALSGSHTIGQARCTNFRARIY-NETTIDSSL  219

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TRR  CP+ +G+G  NLAPLDL TP  F+NNYYKNL+ ++GLL SDQ LF+GG+TD+I
Sbjct  220  AQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYKNLINRRGLLHSDQQLFNGGSTDSI  279

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            VS Y+ +   F++DF + MIKM +I+PLTG  G IR  C  +N
Sbjct  280  VSTYSSNENTFRSDFVAGMIKMGDIRPLTGSRGEIRNNCRRIN  322



>gb|KHN46100.1| Cationic peroxidase 1 [Glycine soja]
Length=300

 Score =   265 bits (676),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 166/222 (75%), Gaps = 2/222 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E +CPG+VSCAD+L++AARD+   +GGPSW V LGRRDSTTAS   A
Sbjct  80   RGFEVIDDIKTKVEAACPGVVSCADILAIAARDSVVTLGGPSWNVGLGRRDSTTASKDAA  139

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TD+P P  +L  LISSF+NKG NT++MVALSGAH+ GQA+C LFR R+Y N + I++ F
Sbjct  140  TTDIPSPLMDLSALISSFSNKGFNTKEMVALSGAHTTGQARCQLFRGRVY-NESSIESNF  198

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLF-SGGATDNIV  538
            A++ +  CP   G+ NL+PLD+ T   FDN Y+KNL+ KKGLL SDQ LF SGG+TD+ V
Sbjct  199  ATSLKSNCPSTGGDSNLSPLDVTTNVVFDNAYFKNLINKKGLLHSDQQLFNSGGSTDSQV  258

Query  539  SEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            + Y+  P AF ADFASAM+KM  + PLTG++G IR  C  +N
Sbjct  259  TAYSNDPSAFYADFASAMVKMGNLSPLTGKSGQIRTNCHKVN  300



>ref|XP_006345521.1| PREDICTED: cationic peroxidase 1-like [Solanum tuberosum]
Length=317

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K ++E SC GIVSCAD+L+VAARD+   +GG SWTV LGRRDSTTAS + A
Sbjct  98   RGFDVIDTIKTQVESSCAGIVSCADILAVAARDSVVKLGGRSWTVLLGRRDSTTASLSTA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +D+P P  NL  LISSF+NKG N+R+MVALSG+H++GQA+C  FRDR+Y N TDI+A F
Sbjct  158  NSDIPAPTLNLSGLISSFSNKGFNSREMVALSGSHTIGQARCTTFRDRLY-NETDINATF  216

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A++ +  CP+   + N++PLD  +P +FDN YYKNL  +KGLL SDQ L SGG+TD+IV+
Sbjct  217  ATSLKSNCPQSGSDNNISPLDTTSPTTFDNIYYKNLRIQKGLLHSDQQLSSGGSTDSIVN  276

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +   F  DFA+AM+KM  + PLTG NG IRK C   N
Sbjct  277  TYSSNSATFFTDFANAMVKMGNLSPLTGTNGQIRKNCRKTN  317



>gb|AAP42508.1| anionic peroxidase swpb3 [Ipomoea batatas]
Length=320

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 167/219 (76%), Gaps = 3/219 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK CPG+VSCAD+L++A+RD++  +GGPSW VKLGRRD+ TAS   A
Sbjct  99   RGFEVIDQIKSAVEKVCPGVVSCADILAIASRDSTVTLGGPSWNVKLGRRDARTASQAAA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LISSF+  GL+T DMV LSG+H++GQA+C  FR RIY N ++ID+ F
Sbjct  159  NNSIPAPTSNLNRLISSFSAVGLSTNDMVVLSGSHTIGQARCTNFRARIY-NESNIDSSF  217

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A +R+  CP+ +G+G  NLAPLDL TP  FDNNYY NL+ KKGLL SDQ LF+G +TD+ 
Sbjct  218  AQSRKGNCPRASGSGDNNLAPLDLQTPIKFDNNYYVNLVNKKGLLHSDQQLFNGVSTDST  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
            V  Y+ +P  F++DFA+AMIKM +I+PLTG NG IRK C
Sbjct  278  VRGYSTNPSKFKSDFAAAMIKMGDIKPLTGNNGEIRKNC  316



>ref|XP_003519407.1| PREDICTED: peroxidase 4-like [Glycine max]
 gb|KHN38568.1| Peroxidase 4 [Glycine soja]
Length=324

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 170/223 (76%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK CPG+VSCAD+L++AARD+   +GGP+W VKLGRRDS TAS + A
Sbjct  103  RGFEVIDQIKSAVEKVCPGVVSCADILAIAARDSVEILGGPTWDVKLGRRDSRTASQSAA  162

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              D+P P  NL++LIS F   GL+T+D+VALSG H++GQA+C  FR RIY N T+ID+ F
Sbjct  163  NNDIPRPTSNLNQLISRFNALGLSTKDLVALSGGHTIGQARCTTFRARIY-NETNIDSSF  221

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A  R+ +CP+ +G+G  NLAP+D  TP  FDN+Y+KNL+QKKGL+ SDQ LF+GG+TD+I
Sbjct  222  ARMRQSRCPRTSGSGDNNLAPIDFATPRFFDNHYFKNLIQKKGLIHSDQQLFNGGSTDSI  281

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F ADF++AMI+M +I PLTG  G IR+ C  +N
Sbjct  282  VRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN  324



>sp|Q4W1I9.1|PER2_ZINVI RecName: Full=Basic peroxidase; AltName: Full=ZePrx33.44; AltName: 
Full=ZePrx34.70; Flags: Precursor [Zinnia violacea]
 emb|CAI54299.1| putative peroxidase [Zinnia violacea]
 emb|CAI54301.1| putative peroxidase [Zinnia violacea]
Length=321

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 168/217 (77%), Gaps = 0/217 (0%)
 Frame = +2

Query  5    GYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLAE  184
            GY+VI+AAK  +E+ CPG+VSCAD+L+VAARDAS AVGGPSWTV+LGRRDSTT++   A 
Sbjct  102  GYEVIDAAKAAVERVCPGVVSCADILAVAARDASVAVGGPSWTVRLGRRDSTTSNAAQAA  161

Query  185  TDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGFA  364
            TDLP     L +LIS+FANKGLNTR+MVALSG+H+LGQA+C  FR RIY +   I+  F 
Sbjct  162  TDLPRGNMVLSQLISNFANKGLNTREMVALSGSHTLGQARCIRFRGRIYNSTLRIEPNFN  221

Query  365  STRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVSE  544
             +  + CP    +  L PLDLVTPNSFDNNYY+NL+  +GLL SDQVLF+  +TD+IV+E
Sbjct  222  RSLSQACPPTGNDATLRPLDLVTPNSFDNNYYRNLVTSRGLLISDQVLFNADSTDSIVTE  281

Query  545  YARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCG  655
            Y  +P  F ADFA+AM+KMSEI  +TG +GI+R +CG
Sbjct  282  YVNNPATFAADFAAAMVKMSEIGVVTGTSGIVRTLCG  318



>gb|ABV24960.2| putative secretory peroxidase [Catharanthus roseus]
Length=330

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 170/223 (76%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K ++EK CPG+VSCAD+L++AARD+  A+GGPSW VK+GRRDS TAS + A
Sbjct  109  RGFDVVDNIKSDVEKVCPGVVSCADILAIAARDSVVALGGPSWKVKVGRRDSKTASLSGA  168

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             + +P P  NL  LISSF   GL+ +DMV LSG+H++GQA+C +FR RIY N ++I+  F
Sbjct  169  NSRIPPPTSNLRNLISSFQAVGLSAKDMVVLSGSHTIGQARCTVFRARIY-NESNIETSF  227

Query  362  ASTRRRQCPKDTGNGN--LAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP  TGNG+  LAPLDL +PN FD NYYKNL+ KKGLL SDQ L++GG+T+++
Sbjct  228  ARTRQGNCPLPTGNGDNSLAPLDLQSPNGFDINYYKNLINKKGLLHSDQELYNGGSTNSL  287

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y++  +AF +DFA+AMIKM +I PLTG NG +RK C  +N
Sbjct  288  VEAYSKDTKAFYSDFAAAMIKMGDISPLTGSNGEVRKNCRRVN  330



>ref|XP_007011229.1| Peroxidase superfamily protein [Theobroma cacao]
 gb|EOY20039.1| Peroxidase superfamily protein [Theobroma cacao]
Length=321

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 167/223 (75%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K  +E  CPG+VSCAD+L++AARD+ A +GGP+W VKLGRRD+ TAS   A
Sbjct  100  RGFDVVDNIKSAVEDVCPGVVSCADILTIAARDSVAILGGPNWDVKLGRRDARTASQAAA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P  NL++LIS F   GL+TRDMVALSG+H++G A+C  FR RIY N ++ID+ F
Sbjct  160  NNSIPPPTSNLNRLISRFNALGLSTRDMVALSGSHTIGLARCTSFRPRIY-NESNIDSSF  218

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+R CP+ TG+G  NLAPLD+ TP  FDNNY+KNL+ ++GLL SDQ LF+GG+TD+I
Sbjct  219  AQTRQRNCPRTTGSGDNNLAPLDIQTPTFFDNNYFKNLINRRGLLHSDQQLFNGGSTDSI  278

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P +F +DF + MIKM +I PLTG  G IRK C  +N
Sbjct  279  VRGYSNNPSSFSSDFVTGMIKMGDISPLTGSRGEIRKNCRRVN  321



>sp|Q4W1I8.1|PER1_ZINVI RecName: Full=Basic peroxidase; AltName: Full=ZePrx33.44; AltName: 
Full=ZePrx34.70; Flags: Precursor [Zinnia violacea]
 emb|CAI54300.1| putative peroxidase [Zinnia violacea]
 emb|CAI54302.1| putative peroxidase [Zinnia violacea]
Length=321

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 168/217 (77%), Gaps = 0/217 (0%)
 Frame = +2

Query  5    GYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLAE  184
            GY+VI+AAK  +E+ CPG+VSCAD+L+VAARDAS AVGGPSWTV+LGRRDSTT++   A 
Sbjct  102  GYEVIDAAKAAVERVCPGVVSCADILAVAARDASVAVGGPSWTVRLGRRDSTTSNAAQAA  161

Query  185  TDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGFA  364
            TDLP     L +LIS+FANKGLNTR+MVALSG+H+LGQA+C  FR RIY +   I+  F 
Sbjct  162  TDLPRGNMVLSQLISNFANKGLNTREMVALSGSHTLGQARCIRFRGRIYNSTLRIEPNFN  221

Query  365  STRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVSE  544
             +  + CP    +  L PLDLVTPNSFDNNYY+NL+  +GLL SDQVLF+  +TD+IV+E
Sbjct  222  RSLSQACPPTGNDATLRPLDLVTPNSFDNNYYRNLVTSRGLLISDQVLFNADSTDSIVTE  281

Query  545  YARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCG  655
            Y  +P  F ADFA+AM+KMSEI  +TG +GI+R +CG
Sbjct  282  YVNNPATFAADFAAAMVKMSEIGVVTGTSGIVRTLCG  318



>gb|KGN47222.1| hypothetical protein Csa_6G216410 [Cucumis sativus]
Length=302

 Score =   264 bits (675),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVIE+ K  +EK CPG+VSCAD+L+++ARD+   +GGPSW VKLGRRDS TAS +  
Sbjct  83   RGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGPSWKVKLGRRDSKTASFSDV  142

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P   LD LI+ F  KGL+ RD+VALSGAH++GQA+C  F++RIY N T+ID  F
Sbjct  143  TGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQARCLFFKNRIY-NETNIDESF  201

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A  R+R CP + G+ N APLD  TP  FDN YYKNLL+KK LL+SDQVL  GG+TD++V 
Sbjct  202  AEERQRTCPTNGGDDNRAPLDFRTPKLFDNYYYKNLLEKKALLRSDQVLHDGGSTDSLVE  261

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+     F+ DF +AMIKM +IQPLTG  G IRK+C   N
Sbjct  262  LYSDDSDTFEHDFVTAMIKMGDIQPLTGSQGEIRKICSRPN  302



>ref|XP_004172441.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=313

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVIE+ K  +EK CPG+VSCAD+L+++ARD+   +GGPSW VKLGRRDS TAS +  
Sbjct  94   RGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGPSWKVKLGRRDSKTASFSDV  153

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P   LD LI+ F  KGL+ RD+VALSGAH++GQA+C  F++RIY N T+ID  F
Sbjct  154  TGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQARCLFFKNRIY-NETNIDESF  212

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A  R+R CP + G+ N APLD  TP  FDN YYKNLL+KK LL+SDQVL  GG+TD++V 
Sbjct  213  AEERQRTCPTNGGDDNRAPLDFKTPKLFDNYYYKNLLEKKALLRSDQVLHDGGSTDSLVE  272

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+     F+ DF +AMIKM +IQPLTG  G IRK+C   N
Sbjct  273  LYSDDSDTFEHDFVTAMIKMGDIQPLTGSQGEIRKICSRPN  313



>ref|XP_004149366.1| PREDICTED: peroxidase 4-like [Cucumis sativus]
Length=313

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 160/221 (72%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVIE+ K  +EK CPG+VSCAD+L+++ARD+   +GGPSW VKLGRRDS TAS +  
Sbjct  94   RGFDVIESIKKNVEKICPGVVSCADILTLSARDSVVVLGGPSWKVKLGRRDSKTASFSDV  153

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               +P P   LD LI+ F  KGL+ RD+VALSGAH++GQA+C  F++RIY N T+ID  F
Sbjct  154  TGAIPPPTSTLDTLINRFNTKGLSPRDLVALSGAHTIGQARCLFFKNRIY-NETNIDESF  212

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A  R+R CP + G+ N APLD  TP  FDN YYKNLL+KK LL+SDQVL  GG+TD++V 
Sbjct  213  AEERQRTCPTNGGDDNRAPLDFRTPKLFDNYYYKNLLEKKALLRSDQVLHDGGSTDSLVE  272

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+     F+ DF +AMIKM +IQPLTG  G IRK+C   N
Sbjct  273  LYSDDSDTFEHDFVTAMIKMGDIQPLTGSQGEIRKICSRPN  313



>gb|KHN40655.1| Cationic peroxidase 1 [Glycine soja]
Length=334

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/221 (57%), Positives = 167/221 (76%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E  CPG+VSCAD+L+VAARD+  A+GGP+WTV+LGRRDSTTAS + A
Sbjct  115  RGFNVIDTIKSKVESLCPGVVSCADILAVAARDSVVALGGPTWTVQLGRRDSTTASLSSA  174

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLP P  +L  LISSF+NKG +++++VALSG+H++GQAQC  FR RIY N T+ID+ F
Sbjct  175  NSDLPAPTSSLSALISSFSNKGFSSKELVALSGSHTIGQAQCSSFRTRIY-NDTNIDSSF  233

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A + +  CP   G   LAPLD  +PN+FDN Y+KNL  KKGLL SDQ LF+GG+TD+ V+
Sbjct  234  AKSLQGNCPSTGGGSTLAPLDTTSPNTFDNAYFKNLQSKKGLLHSDQELFNGGSTDSQVN  293

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +P +F+ DFA+AMIKM  + PLTG +G IR  C   N
Sbjct  294  SYSSNPASFKTDFANAMIKMGNLSPLTGSSGQIRTNCRKTN  334



>gb|EYU41992.1| hypothetical protein MIMGU_mgv1a010234mg [Erythranthe guttata]
Length=318

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 162/217 (75%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K  +E +CPGIVSCAD+L++AARD + AV GPSW + LGRRDSTTAS   A
Sbjct  99   RGFDVIDTIKTRVEAACPGIVSCADILTIAARDGTVAVSGPSWALSLGRRDSTTASLNGA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             + LPGP  +L+ LI+SFANKG  TR+MVALSG+H++G A+C  FR+RIY N  +ID  F
Sbjct  159  NSQLPGPGSSLNNLITSFANKGFTTREMVALSGSHTIGLARCSTFRNRIY-NAANIDPAF  217

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A+ RR  CP+  G+ NLAPLD V+ N+F+N+YY NL+ ++GLL SDQVLF+ G TD  V 
Sbjct  218  ATARRANCPRTGGDNNLAPLDTVSSNTFNNDYYTNLVSRRGLLTSDQVLFNNGTTDAQVR  277

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
             Y+ +  +F  DFA+AM+KMS + PLTG NG IR+ C
Sbjct  278  AYSTNSASFFNDFAAAMVKMSNLSPLTGTNGQIRRNC  314



>gb|EYU41994.1| hypothetical protein MIMGU_mgv1a010221mg [Erythranthe guttata]
Length=318

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 161/217 (74%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K ++E +CPGIVSCAD+L+VAARD + A  GPSW + LGRRDSTTAS T A
Sbjct  99   RGFDVIDTIKTQVEAACPGIVSCADILTVAARDGTVARSGPSWALSLGRRDSTTASLTGA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               LPGP  +L+ LI+SF+NKG  TR+MVALSG+H++G A+C  FR+RIY N  +ID  F
Sbjct  159  NGQLPGPGSSLNNLITSFSNKGFTTREMVALSGSHTIGLARCSTFRNRIY-NAANIDPAF  217

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A+TRR  CP   GN NLAPLD V+P +F+N+YY NL+  +GLL SDQVLF+ G TD  V 
Sbjct  218  ATTRRANCPPTGGNNNLAPLDTVSPTTFNNDYYTNLVNLRGLLNSDQVLFNNGTTDAQVR  277

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
             Y+ +  +F  DFA+AM+KMS + PLTG NG IR+ C
Sbjct  278  AYSTNSASFFNDFAAAMVKMSNLTPLTGTNGQIRRNC  314



>gb|EMT02760.1| Peroxidase 4 [Aegilops tauschii]
Length=283

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 164/223 (74%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+A K  +EK CPG+VSCAD+L++AA ++   +GGPSW VK+GRRDSTTAS   A
Sbjct  62   RGFDVIDAIKTAVEKECPGVVSCADILAIAAEESVVLLGGPSWEVKMGRRDSTTASFNGA  121

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
            E ++P P   L  L S FA +GL+ +DMVALSGAH++GQA+C  FRD IY N T+ID+GF
Sbjct  122  ENNIPPPTSGLANLTSLFAAQGLSQKDMVALSGAHTIGQARCTFFRDHIY-NDTNIDSGF  180

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A +R+  CP+  G+G  NLAPLDL TP +F+N+YYKNL+QK+G+L SDQ LF+GGA D +
Sbjct  181  ARSRQSGCPRTAGSGDNNLAPLDLQTPTTFENDYYKNLVQKRGILHSDQELFNGGAADAL  240

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V +Y  S   F  DF   M+KM +I PLTG NG IRK C  +N
Sbjct  241  VRQYIGSQSTFFQDFVVGMVKMGDITPLTGSNGQIRKNCRRIN  283



>ref|XP_007146853.1| hypothetical protein PHAVU_006G075600g [Phaseolus vulgaris]
 gb|ESW18847.1| hypothetical protein PHAVU_006G075600g [Phaseolus vulgaris]
Length=318

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 165/221 (75%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K +LE  CPGIVSCAD+L+VAARD+  ++GG SWTV LGRRDSTTAS   A
Sbjct  99   RGFDVIDDIKSQLETDCPGIVSCADILAVAARDSVVSLGGSSWTVGLGRRDSTTASKDAA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             TD+P P  +L  LI++F+NKG  T++MV LSGAH+ GQA+C  FR RIY N T+ID+ F
Sbjct  159  TTDIPSPQLDLSDLITAFSNKGFTTKEMVVLSGAHTTGQAKCQFFRGRIY-NETNIDSDF  217

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A++ +  CP   G+ NL+PLD+ T   FDN+Y+KNL+ KKGLL SDQ LFSGG+TD+ V+
Sbjct  218  ATSTQSNCPSTDGDSNLSPLDVTTNVLFDNSYFKNLVNKKGLLHSDQQLFSGGSTDSQVT  277

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ S  +F ADF+SAM+KM  + PLTG +G IR  C A+N
Sbjct  278  AYSTSSSSFYADFSSAMVKMGNLSPLTGSSGQIRTNCRAVN  318



>ref|XP_010045407.1| PREDICTED: peroxidase 4-like [Eucalyptus grandis]
Length=323

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 170/224 (76%), Gaps = 4/224 (2%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RGY+VI+  K ++E +CPG+VSCAD++++AARD+   +GGPSW VKLGRRD+ TAS + A
Sbjct  101  RGYNVIDQIKSKVESACPGVVSCADIVAIAARDSVVLLGGPSWEVKLGRRDARTASLSRA  160

Query  182  ETD-LPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             +  +P P   L  LIS F  +GL+TRDMVALSG+H++GQA+C  FR RIY N ++ID+ 
Sbjct  161  NSGVIPPPTSTLSNLISRFKAQGLSTRDMVALSGSHTIGQARCISFRPRIY-NDSNIDSS  219

Query  359  FASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            F+ TR+ +CP+  G+G  NL+PLDL +P +FDN Y+KNLL  KGLL SDQ LF+GG TD+
Sbjct  220  FSKTRQGKCPRTAGSGDNNLSPLDLQSPTAFDNAYFKNLLSNKGLLHSDQELFNGGTTDS  279

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +V  Y+ +P+ F +DFASAMIKM +I+PLTG  G IRK+C  +N
Sbjct  280  LVKTYSNNPKTFNSDFASAMIKMGDIKPLTGSKGEIRKICSKIN  323



>gb|AAL93151.1|AF485265_1 class III peroxidase [Gossypium hirsutum]
Length=320

 Score =   264 bits (675),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 170/224 (76%), Gaps = 4/224 (2%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++V++  K ++EK CPG+VSCAD+L++AARD+   +GGP W VKLGRRDS TAS + A
Sbjct  98   RGFEVVDEIKAKVEKVCPGVVSCADILAIAARDSVVILGGPDWDVKLGRRDSKTASFSDA  157

Query  182  ETD-LPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAG  358
             +  LP    NL +LIS F  +GL+T+DMVALSGAH++G+A+C +FR+RIY N T ID  
Sbjct  158  NSGVLPLGSANLSQLISLFQAQGLSTKDMVALSGAHTIGKARCLVFRNRIY-NDTIIDTS  216

Query  359  FASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDN  532
            FA TRR  CP+  G+G  NLAPLDL TPNSFD+ Y++NLL KKGLL SDQ LF+GG+TD+
Sbjct  217  FAKTRRSSCPRTRGSGDNNLAPLDLATPNSFDSKYFENLLNKKGLLHSDQELFNGGSTDS  276

Query  533  IVSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            +V  Y+ + + F +DF +AMIKM +I+PLTG NG IRK CG  N
Sbjct  277  LVKTYSSNVKKFYSDFIAAMIKMGDIKPLTGSNGEIRKNCGKPN  320



>ref|XP_009790966.1| PREDICTED: peroxidase P7-like [Nicotiana sylvestris]
Length=319

 Score =   264 bits (674),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 122/221 (55%), Positives = 164/221 (74%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E +CP  VSCAD+L++AAR+    +GGPSW V LGRRD+ TAS + A
Sbjct  100  RGFEVIDTIKTQVEAACPNAVSCADILALAAREGVVLLGGPSWAVPLGRRDARTASQSAA  159

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T +P P  +L  L+S F+ KGLN RDM ALSG H++GQA+C  FR RIY N T+IDA F
Sbjct  160  NTQIPAPTSSLSTLLSMFSAKGLNARDMTALSGGHTIGQARCTTFRTRIY-NDTNIDAQF  218

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A+TRR  CP  +G+ NLAPLD+ TPN FDN+YY+NL+ ++GLL SDQ LF+GG+ D +V 
Sbjct  219  AATRRATCPSSSGDANLAPLDIQTPNRFDNDYYQNLVARRGLLHSDQELFNGGSQDALVR  278

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+ +  AF++DFA+AM++M  I PLTG NG IR+ C A+N
Sbjct  279  SYSTNDAAFRSDFAAAMVRMGNISPLTGTNGEIRRNCRAIN  319



>ref|XP_010922691.1| PREDICTED: peroxidase 4-like [Elaeis guineensis]
Length=320

 Score =   264 bits (674),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 164/223 (74%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DV++  K  +EK CPG+VSCAD+L++ +RD+   +GGP+W VKLGRRDSTTAS + A
Sbjct  99   RGFDVVDNIKAAVEKVCPGVVSCADILAITSRDSVVILGGPNWDVKLGRRDSTTASFSGA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  +L  LIS FA +GL+T+DMVALSG H++GQA+C  FR  IY N TDID+ F
Sbjct  159  NNNIPPPNSSLSNLISKFAAQGLSTKDMVALSGGHTIGQARCLNFRAHIY-NDTDIDSSF  217

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP  +G+G  NLAPLDL TP  FDN+YYKNL+ KKGLL SDQ LF+GG+TD+ 
Sbjct  218  AKTRQMNCPSTSGSGDNNLAPLDLQTPTCFDNDYYKNLINKKGLLHSDQELFNGGSTDSQ  277

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P  F +DF + MI M +I PLTG +G IRK C  +N
Sbjct  278  VMTYSNNPSTFNSDFVTGMINMGDITPLTGSSGQIRKNCRKVN  320



>gb|EMT27943.1| Peroxidase 1 [Aegilops tauschii]
Length=291

 Score =   263 bits (671),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 158/221 (71%), Gaps = 0/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+ VI+  K ++E  C   VSCAD+L+VAARD+  A+GGPSWTV LGRRDST A+  LA
Sbjct  70   RGFGVIDGIKAQVEAVCKQTVSCADILAVAARDSVVALGGPSWTVPLGRRDSTGANAGLA  129

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             +DLPGP  +  +L ++F  KGL+T DMVALSGAH++GQAQC  FR RIYG  T+I+A +
Sbjct  130  NSDLPGPGSSRAQLEAAFLKKGLDTVDMVALSGAHTIGQAQCSSFRSRIYGGDTNINAAY  189

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A++ R  CP+  GNGNLAPLD  TPN FDN YY +LL +KGL+ SDQVLF+G  TDN V 
Sbjct  190  AASLRANCPQSGGNGNLAPLDTTTPNVFDNAYYTDLLSQKGLMHSDQVLFNGDTTDNTVR  249

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             +A +P AF   F +AMIKM  I PLTG  G IR  C  +N
Sbjct  250  NFASNPAAFSNAFTTAMIKMGNIAPLTGAQGQIRLSCSKVN  290



>ref|XP_004492538.1| PREDICTED: cationic peroxidase 1-like [Cicer arietinum]
Length=317

 Score =   263 bits (673),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 162/221 (73%), Gaps = 1/221 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K E+E  CP +VSCAD+LSVAARD+  A+GGPSWTV+LGRRDSTTAS   A
Sbjct  98   RGFDVIDTIKSEVESLCPNVVSCADILSVAARDSVVALGGPSWTVQLGRRDSTTASLDSA  157

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             T+LPGP  +L  LI++F  KG  T++MVALSG+H++GQA C  FR RIY N  +ID  F
Sbjct  158  NTNLPGPTSDLTNLITAFDKKGFTTQEMVALSGSHTIGQASCRFFRSRIY-NEDNIDPTF  216

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A++ +  CP   G+ NL+PLD  TP++FDN+YY NL  + GL  SDQ LF+ G+TD+IV 
Sbjct  217  AASLQANCPTSGGDNNLSPLDTTTPDTFDNSYYTNLQSQMGLFHSDQELFNQGSTDSIVD  276

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
             Y+  P +F+ DFA+AM+KM  + PLTG +G IR  CGA+N
Sbjct  277  GYSSDPSSFETDFANAMLKMGNLSPLTGSSGQIRTTCGAIN  317



>emb|CAN80051.1| hypothetical protein VITISV_032434 [Vitis vinifera]
Length=306

 Score =   263 bits (672),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 166/223 (74%), Gaps = 27/223 (12%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K ++E  CPG+VSCAD+L+VAARD+S AVGGP+WTVKLGRRDSTT+  + A
Sbjct  109  RGFEVIDNVKSQVESICPGVVSCADILAVAARDSSVAVGGPTWTVKLGRRDSTTSGLSQA  168

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              +LP   D LDKL+S F++KGLNTR+MVALSG+H++GQA+C  FRDRI+ NGT+IDAGF
Sbjct  169  AANLPSFRDGLDKLVSLFSSKGLNTREMVALSGSHTIGQARCVTFRDRIHDNGTNIDAGF  228

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            ASTRRR+CP D GNG  NLAPLDL                         VLF+GG+TD+I
Sbjct  229  ASTRRRRCPVDNGNGDDNLAPLDL-------------------------VLFNGGSTDSI  263

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V+EY++S   F ++FA+AM+KM +I PLTG NG IRK+C A+N
Sbjct  264  VTEYSKSRSTFSSBFAAAMVKMGDIDPLTGSNGEIRKLCNAIN  306



>ref|XP_009786874.1| PREDICTED: peroxidase P7 [Nicotiana sylvestris]
Length=319

 Score =   263 bits (673),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 124/223 (56%), Positives = 165/223 (74%), Gaps = 2/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG++VI+  K  +EK CPG+VSCAD+L+V ARD+   +GGP+W VKLGRRD+ TAS   A
Sbjct  97   RGFEVIDDIKSAVEKVCPGVVSCADILAVTARDSVVILGGPNWDVKLGRRDARTASQAAA  156

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
             + +P P  NL++LISSF+  GL+T+DMVALSGAH++GQA+C  FR RIY    ++D+  
Sbjct  157  NSSIPPPTSNLNRLISSFSAVGLSTKDMVALSGAHTIGQARCTSFRARIYNETNNLDSSL  216

Query  362  ASTRRRQCPKDTGNG--NLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A TR+  CP+++G+G  NLAPLDL TP  FDN+Y+ NL+ KKGLL SDQ LF+GG+ D+I
Sbjct  217  AKTRQNNCPRNSGSGDNNLAPLDLQTPTYFDNHYFINLVSKKGLLHSDQQLFNGGSADSI  276

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ +P  F  DF +AMIKM +I+PLTG  G IRK C  +N
Sbjct  277  VKSYSDNPSIFATDFVTAMIKMGDIRPLTGSKGEIRKNCRRIN  319



>ref|XP_009403860.1| PREDICTED: peroxidase 4 {ECO:0000250|UniProtKB:Q42578}-like [Musa 
acuminata subsp. malaccensis]
Length=316

 Score =   263 bits (673),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 167/223 (75%), Gaps = 3/223 (1%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K  +EK+CPG+VSCAD+L++ ARDA A +GGP+W VKLGRRD+ TAS + A
Sbjct  95   RGFDVIDKIKTAVEKACPGVVSCADILAITARDAVAILGGPNWDVKLGRRDAKTASLSGA  154

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
              ++P P  +L  LIS F+ +GL+ +DMVAL+GAH++GQA+C  FR RIY N T+ID+  
Sbjct  155  NNNIPPPSSSLSNLISKFSAQGLSRQDMVALAGAHTIGQARCISFRSRIY-NDTNIDSSL  213

Query  362  ASTRRRQCPKD--TGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNI  535
            A+TR+  CP    +G+GNLAPLDL TP +FDN+Y+KNL+  KGLL SDQ LFS G+TD++
Sbjct  214  ATTRQSNCPSTSGSGDGNLAPLDLQTPTTFDNDYFKNLVNLKGLLHSDQQLFSNGSTDSL  273

Query  536  VSEYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVCGALN  664
            V  Y+ SP  F +DFA+AMIKM +I PLTG  G IR  C  +N
Sbjct  274  VKTYSASPSKFASDFAAAMIKMGDISPLTGSQGEIRNNCRMVN  316



>gb|EYU41993.1| hypothetical protein MIMGU_mgv1a010225mg [Erythranthe guttata]
Length=318

 Score =   263 bits (673),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 161/217 (74%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    RGYDVIEAAKLELEKSCPGIVSCADVLSVAARDASAAVGGPSWTVKLGRRDSTTASHTLA  181
            RG+DVI+  K ++E +CPGIVSCAD+L+VAARD + A  GPSW + LGRRDSTTAS T A
Sbjct  99   RGFDVIDTIKTQVEAACPGIVSCADILTVAARDGTVARSGPSWALSLGRRDSTTASLTGA  158

Query  182  ETDLPGPFDNLDKLISSFANKGLNTRDMVALSGAHSLGQAQCFLFRDRIYGNGTDIDAGF  361
               LPGP  +L+ LI+SF+NKG  TR+MVALSG+H++G A+C  FR+RIY N  +ID  F
Sbjct  159  NGQLPGPGSSLNNLITSFSNKGFTTREMVALSGSHTIGLARCSTFRNRIY-NAANIDPAF  217

Query  362  ASTRRRQCPKDTGNGNLAPLDLVTPNSFDNNYYKNLLQKKGLLQSDQVLFSGGATDNIVS  541
            A+TRR  CP   GN NLAPLD ++P +F+N+YY NL+  +GLL SDQVLF+ G TD  V 
Sbjct  218  ATTRRANCPPTGGNNNLAPLDTLSPTTFNNDYYTNLVNLRGLLNSDQVLFNNGTTDAQVR  277

Query  542  EYARSPRAFQADFASAMIKMSEIQPLTGQNGIIRKVC  652
             Y+ +  +F  DFA+AM+KMS + PLTG NG IR+ C
Sbjct  278  AYSTNSASFFNDFAAAMVKMSNLTPLTGTNGQIRRNC  314



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1639611019956