BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25452_g2_i7 len=1716 path=[4909:0-78 4988:79-135 5045:136-314
5222:315-589 656:590-645 5551:646-730 1540:731-839 5744:840-855
5760:856-884 5788:885-922 5826:923-1054 5957:1055-1100
6002:1101-1105 230:1106-1196 6094:1197-1225 158:1226-1312
10093:1313-1320 10101:1321-1436 6328:1437-1441 6333:1442-1537
6428:1538-1566 6457:1567-1603 6494:1604-1715]

Length=1716
                                                                      Score     E

dbj|BAG80534.1|  putative glycosyltransferase                           558   0.0      Lycium barbarum [Duke of Argyll's teatree]
ref|XP_009613938.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       545   0.0      
ref|XP_009776895.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       544   0.0      
dbj|BAG80543.1|  UDP-glucose:glucosyltransferase                        541   0.0      Lycium barbarum [Duke of Argyll's teatree]
ref|XP_006342416.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       539   0.0      
ref|XP_004253028.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       525   6e-179   
ref|XP_003632087.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       524   1e-178   
ref|XP_006342417.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       523   3e-178   
ref|XP_004253027.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       514   2e-174   
ref|XP_010091337.1|  UDP-glycosyltransferase 74E2                       497   5e-168   
ref|XP_002529823.1|  UDP-glucosyltransferase, putative                  495   5e-167   Ricinus communis
emb|CDP08071.1|  unnamed protein product                                495   6e-167   
ref|XP_011037069.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       493   3e-166   
emb|CAN67249.1|  hypothetical protein VITISV_008684                     491   6e-166   Vitis vinifera
ref|XP_011037065.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       492   7e-166   
ref|XP_011002911.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    488   2e-164   
ref|XP_011002910.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    488   2e-164   
ref|XP_006370131.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    488   6e-164   
emb|CDP08068.1|  unnamed protein product                                485   2e-163   
gb|AIE12489.1|  UGT9                                                    485   3e-163   
emb|CBI24719.3|  unnamed protein product                                485   5e-163   
ref|XP_002275387.2|  PREDICTED: UDP-glycosyltransferase 74E1-like       484   7e-163   Vitis vinifera
ref|XP_009366994.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       483   2e-162   
ref|XP_002529825.1|  UDP-glucosyltransferase, putative                  483   4e-162   Ricinus communis
ref|XP_008338819.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       481   1e-161   
ref|XP_006388126.1|  hypothetical protein POPTR_0322s00200g             481   2e-161   
ref|XP_002309739.1|  putative glucosyltransferase family protein        480   5e-161   Populus trichocarpa [western balsam poplar]
ref|XP_006372897.1|  putative glucosyltransferase family protein        476   1e-159   
ref|XP_007033374.1|  Uridine diphosphate glycosyltransferase 74E2...    483   2e-159   
emb|CDP08069.1|  unnamed protein product                                474   3e-159   
ref|XP_009603219.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       474   9e-159   
ref|XP_011002951.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    474   4e-158   
ref|XP_010242476.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       472   4e-158   
ref|XP_007222137.1|  hypothetical protein PRUPE_ppa005722mg             471   5e-158   
ref|XP_011082054.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       471   2e-157   
ref|XP_008233915.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       467   3e-156   
ref|XP_010672483.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       467   5e-156   
ref|XP_008233916.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       466   6e-156   
ref|XP_002306205.2|  putative glucosyltransferase family protein        466   2e-155   Populus trichocarpa [western balsam poplar]
ref|XP_002275194.2|  PREDICTED: UDP-glycosyltransferase 74E2            471   7e-155   Vitis vinifera
emb|CBI24722.3|  unnamed protein product                                463   7e-155   
ref|XP_009782413.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       462   2e-154   
ref|XP_010242477.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       462   4e-154   
ref|XP_010242475.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       462   4e-154   
dbj|BAO51836.1|  UDP-glycosyltransferase 74Y1                           461   1e-153   
ref|XP_002529824.1|  UDP-glucosyltransferase, putative                  461   1e-153   Ricinus communis
ref|XP_006469358.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    460   4e-153   
ref|XP_007033375.1|  Uridine diphosphate glycosyltransferase 74E2...    458   5e-153   
gb|KDP35131.1|  hypothetical protein JCGZ_10665                         457   4e-152   
ref|XP_011079130.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       457   4e-152   
ref|XP_009786106.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       456   7e-152   
ref|XP_006469357.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       456   2e-151   
ref|XP_006447926.1|  hypothetical protein CICLE_v10015147mg             455   3e-151   
ref|XP_011047628.1|  PREDICTED: UDP-glycosyltransferase 74E1-like...    454   8e-151   
gb|EYU17621.1|  hypothetical protein MIMGU_mgv1a006158mg                451   6e-150   
ref|XP_009630995.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       451   9e-150   
ref|XP_004296695.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       451   1e-149   
ref|XP_006447928.1|  hypothetical protein CICLE_v10017682mg             451   1e-149   
ref|XP_002532442.1|  UDP-glucosyltransferase, putative                  450   2e-149   Ricinus communis
emb|CAN80193.1|  hypothetical protein VITISV_017236                     470   3e-149   Vitis vinifera
gb|KDP35129.1|  hypothetical protein JCGZ_10663                         449   3e-149   
ref|XP_010095580.1|  UDP-glycosyltransferase 74F2                       449   5e-149   
gb|KDP45201.1|  hypothetical protein JCGZ_15066                         449   6e-149   
ref|XP_010672479.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       446   8e-148   
ref|XP_004289758.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       446   1e-147   
emb|CDP13110.1|  unnamed protein product                                445   1e-147   
dbj|BAG80541.1|  UDP-glucose:glucosyltransferase                        444   3e-147   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_006469356.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       445   3e-147   
ref|XP_006447932.1|  hypothetical protein CICLE_v10015140mg             444   4e-147   
ref|XP_009590343.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       444   5e-147   
ref|XP_010069220.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       444   5e-147   
ref|XP_007033641.1|  Uridine diphosphate glycosyltransferase 74E2...    443   5e-147   
ref|XP_007199115.1|  hypothetical protein PRUPE_ppa020804mg             444   8e-147   
gb|KDP45199.1|  hypothetical protein JCGZ_15064                         444   8e-147   
ref|XP_009783229.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       443   1e-146   
ref|XP_007222164.1|  hypothetical protein PRUPE_ppa005780mg             442   2e-146   
ref|XP_009625439.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       442   2e-146   
emb|CAN68288.1|  hypothetical protein VITISV_017017                     462   2e-146   Vitis vinifera
ref|XP_009783231.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       441   4e-146   
gb|KDP35128.1|  hypothetical protein JCGZ_10662                         441   8e-146   
ref|XP_007049529.1|  UDP-xylose phenolic glycosyltransferase, put...    441   1e-145   
gb|KDO43525.1|  hypothetical protein CISIN_1g012194mg                   440   2e-145   
ref|XP_002529822.1|  UDP-glucosyltransferase, putative                  439   3e-145   Ricinus communis
ref|XP_007033645.1|  UDP-glucosyltransferase 74F2, putative             439   3e-145   
emb|CAN67248.1|  hypothetical protein VITISV_008683                     438   3e-145   Vitis vinifera
ref|XP_010069221.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       439   4e-145   
ref|XP_010095579.1|  UDP-glycosyltransferase 74E2                       439   4e-145   
gb|KCW57495.1|  hypothetical protein EUGRSUZ_H00261                     439   8e-145   
ref|XP_007049526.1|  UDP-xylose phenolic glycosyltransferase, put...    438   1e-144   
ref|XP_009783230.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       438   1e-144   
ref|XP_004289756.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       437   2e-144   
ref|XP_009111039.1|  PREDICTED: UDP-glycosyltransferase 74E2            436   4e-144   
emb|CAN68287.1|  hypothetical protein VITISV_017016                     436   5e-144   Vitis vinifera
ref|XP_006447931.1|  hypothetical protein CICLE_v10015145mg             436   5e-144   
gb|KDP35130.1|  hypothetical protein JCGZ_10664                         436   6e-144   
ref|XP_004244486.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       436   8e-144   
ref|XP_010025874.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       436   9e-144   
ref|XP_007033644.1|  Uridine diphosphate glycosyltransferase 74E2       438   1e-143   
ref|XP_002892308.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    435   1e-143   
ref|XP_010069226.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       436   1e-143   
ref|XP_009335348.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       435   2e-143   
ref|XP_004290110.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       435   2e-143   
ref|XP_010475277.1|  PREDICTED: UDP-glycosyltransferase 74E2            434   4e-143   
ref|XP_009630994.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       433   6e-143   
ref|XP_006447930.1|  hypothetical protein CICLE_v10015149mg             434   7e-143   
ref|XP_010321783.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       433   7e-143   
ref|XP_006357098.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       433   8e-143   
ref|XP_004289755.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       433   1e-142   
gb|KDP45202.1|  hypothetical protein JCGZ_15067                         432   1e-142   
gb|KEH25943.1|  UDP-glucosyltransferase family protein                  432   1e-142   
ref|NP_001274852.1|  UDP-glycosyltransferase 74E2-like                  432   1e-142   
ref|XP_004244487.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    432   2e-142   
ref|XP_002278455.1|  PREDICTED: UDP-glycosyltransferase 74F2            432   2e-142   Vitis vinifera
ref|XP_010069223.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       432   5e-142   
gb|KCW57498.1|  hypothetical protein EUGRSUZ_H00263                     432   6e-142   
ref|XP_006417998.1|  hypothetical protein EUTSA_v10007603mg             430   8e-142   
ref|XP_006357048.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       431   8e-142   
ref|XP_010672480.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       430   1e-141   
emb|CAN67246.1|  hypothetical protein VITISV_008681                     429   1e-141   Vitis vinifera
ref|NP_172059.1|  Uridine diphosphate glycosyltransferase 74E2          430   1e-141   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008235866.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       430   1e-141   
ref|XP_010037081.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       430   1e-141   
ref|XP_008236256.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       429   2e-141   
ref|XP_006447240.1|  hypothetical protein CICLE_v10015138mg             430   2e-141   
ref|XP_006344123.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       429   3e-141   
ref|XP_003548080.2|  PREDICTED: UDP-glycosyltransferase 74E2-like       430   3e-141   
ref|XP_010069222.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       429   4e-141   
ref|XP_007049534.1|  UDP-xylose phenolic glycosyltransferase, put...    429   4e-141   
ref|XP_011082055.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       429   5e-141   
gb|KFK42906.1|  hypothetical protein AALP_AA1G053600                    428   8e-141   
ref|XP_004244485.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       428   8e-141   
ref|XP_003632443.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       428   9e-141   
ref|XP_007045533.1|  UDP-xylose phenolic glycosyltransferase, put...    427   1e-140   
ref|XP_011073993.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       427   1e-140   
gb|ACM09899.2|  glycosyltransferase                                     427   1e-140   Withania somnifera [ashwagandha]
ref|XP_004287163.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       429   2e-140   
gb|AEZ01222.1|  UDP-glucosyltransferase                                 427   2e-140   
ref|XP_011100878.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       427   2e-140   
ref|XP_010679006.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       427   2e-140   
gb|KEH25945.1|  UDP-glucosyltransferase family protein                  427   2e-140   
ref|XP_002273866.1|  PREDICTED: UDP-glycosyltransferase 74E2            426   3e-140   Vitis vinifera
ref|XP_002532451.1|  UDP-glucosyltransferase, putative                  426   4e-140   Ricinus communis
ref|XP_010457662.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       426   4e-140   
ref|XP_010475278.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    426   5e-140   
ref|NP_001234680.1|  UDP-xylose phenolic glycosyltransferase            426   6e-140   
ref|XP_002320558.1|  putative glucosyltransferase family protein        426   6e-140   Populus trichocarpa [western balsam poplar]
ref|XP_010242509.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       426   6e-140   
ref|XP_009119126.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       425   7e-140   
ref|XP_008236257.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       425   1e-139   
ref|XP_004287162.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       426   1e-139   
ref|XP_010069225.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       425   2e-139   
ref|XP_010037078.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       424   3e-139   
emb|CDP06918.1|  unnamed protein product                                424   3e-139   
ref|XP_010037076.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       424   3e-139   
gb|EYU20869.1|  hypothetical protein MIMGU_mgv1a005301mg                425   3e-139   
ref|XP_006307470.1|  hypothetical protein CARUB_v10009096mg             424   3e-139   
ref|XP_010485192.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       424   3e-139   
gb|AEM42999.1|  UDP-glucosyltransferase                                 423   4e-139   
ref|XP_007201011.1|  hypothetical protein PRUPE_ppa005386mg             424   4e-139   
ref|XP_010069224.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       424   5e-139   
ref|XP_011082052.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       423   5e-139   
emb|CDP03995.1|  unnamed protein product                                423   5e-139   
gb|KCW57503.1|  hypothetical protein EUGRSUZ_H00275                     424   6e-139   
ref|XP_007201501.1|  hypothetical protein PRUPE_ppa016883mg             423   7e-139   
ref|XP_008237299.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       423   7e-139   
ref|XP_006357100.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       423   8e-139   
emb|CDY10139.1|  BnaC05g03820D                                          422   8e-139   
gb|KCW57502.1|  hypothetical protein EUGRSUZ_H00273                     423   1e-138   
gb|KEH25944.1|  UDP-glucosyltransferase family protein                  421   3e-138   
emb|CDP03926.1|  unnamed protein product                                421   3e-138   
ref|XP_009590532.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       421   3e-138   
emb|CBI24721.3|  unnamed protein product                                430   4e-138   
ref|NP_001184915.1|  UDP-Glycosyltransferase superfamily protein        421   4e-138   
ref|XP_010457690.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       421   5e-138   
gb|KDP35132.1|  hypothetical protein JCGZ_10666                         420   1e-137   
ref|XP_006357047.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       419   2e-137   
dbj|BAG80538.1|  UDP-glucose:glucosyltransferase                        419   2e-137   Lycium barbarum [Duke of Argyll's teatree]
ref|XP_006372895.1|  hypothetical protein POPTR_0017s06080g             415   2e-137   
ref|XP_008236255.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       419   3e-137   
ref|XP_009776061.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       419   3e-137   
ref|XP_007151915.1|  hypothetical protein PHAVU_004G086500g             418   7e-137   
ref|XP_007033647.1|  UDP-glycosyltransferase 74 F1, putative            417   9e-137   
ref|XP_010522243.1|  PREDICTED: UDP-glycosyltransferase 74E2            417   9e-137   
ref|XP_008235864.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       417   1e-136   
gb|AGR44631.1|  UDP-glucosyltransferase 74A1                            417   1e-136   
ref|XP_008235865.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       417   1e-136   
ref|XP_008788244.1|  PREDICTED: crocetin glucosyltransferase 2-li...    417   1e-136   
ref|XP_002269003.2|  PREDICTED: UDP-glycosyltransferase 74E2            417   1e-136   Vitis vinifera
ref|XP_004245060.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       417   2e-136   
ref|XP_004489724.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       416   2e-136   
ref|XP_010069228.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       417   3e-136   
ref|XP_010101352.1|  UDP-glycosyltransferase 74E2                       422   5e-136   
ref|XP_010069229.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    416   6e-136   
ref|XP_009599369.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    414   2e-135   
ref|XP_007208259.1|  hypothetical protein PRUPE_ppa016486mg             414   3e-135   
ref|XP_002532443.1|  UDP-glucosyltransferase, putative                  411   4e-135   Ricinus communis
ref|XP_009765329.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       413   4e-135   
emb|CDP03994.1|  unnamed protein product                                413   6e-135   
ref|XP_008788243.1|  PREDICTED: crocetin glucosyltransferase 2-li...    412   8e-135   
ref|XP_010908661.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       412   1e-134   
ref|XP_007201692.1|  hypothetical protein PRUPE_ppa016444mg             412   2e-134   
gb|AGI44003.1|  UDP-glucose glucosyltransferase                         410   3e-134   
ref|XP_006351615.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       410   6e-134   
gb|KCW48703.1|  hypothetical protein EUGRSUZ_K02355                     410   1e-133   
emb|CDY70064.1|  BnaC08g46320D                                          407   2e-133   
ref|XP_004144268.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       409   2e-133   
emb|CDY51326.1|  BnaA10g03470D                                          409   2e-133   
ref|XP_011047630.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       406   1e-132   
ref|XP_010037080.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       407   1e-132   
gb|KFK31187.1|  hypothetical protein AALP_AA6G079800                    407   1e-132   
gb|EPS69486.1|  glycosyltransferase                                     406   3e-132   
ref|XP_009141176.1|  PREDICTED: UDP-glycosyltransferase 74D1            406   3e-132   
ref|XP_008445485.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       406   3e-132   
ref|XP_010542772.1|  PREDICTED: UDP-glycosyltransferase 74D1            406   4e-132   
ref|XP_006304660.1|  hypothetical protein CARUB_v10011842mg             405   4e-132   
gb|AAM61249.1|  putative glucosyltransferase                            405   4e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294187.1|  hypothetical protein CARUB_v10023181mg             405   6e-132   
ref|NP_180734.1|  UDP-glucosyl transferase 74D1                         405   6e-132   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510162.1|  PREDICTED: UDP-glycosyltransferase 74D1-like       405   7e-132   
ref|XP_010037079.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       405   9e-132   
ref|XP_010414087.1|  PREDICTED: UDP-glycosyltransferase 74D1-like       404   1e-131   
ref|XP_011082053.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       404   1e-131   
ref|XP_010469679.1|  PREDICTED: UDP-glycosyltransferase 74D1            404   2e-131   
emb|CDY15551.1|  BnaA08g28350D                                          400   3e-131   
ref|XP_007199830.1|  hypothetical protein PRUPE_ppa005475mg             404   3e-131   
gb|EYU36667.1|  hypothetical protein MIMGU_mgv1a006023mg                403   4e-131   
gb|EYU41208.1|  hypothetical protein MIMGU_mgv1a025741mg                403   6e-131   
ref|XP_002879339.1|  hypothetical protein ARALYDRAFT_482098             402   9e-131   
ref|XP_007133505.1|  hypothetical protein PHAVU_011G184600g             402   1e-130   
ref|XP_004292062.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       402   1e-130   
gb|KEH25946.1|  UDP-glucosyltransferase family protein                  401   2e-130   
ref|XP_006342195.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       402   2e-130   
ref|XP_010557055.1|  PREDICTED: UDP-glycosyltransferase 74C1            401   2e-130   
ref|XP_006410305.1|  hypothetical protein EUTSA_v10016638mg             401   2e-130   
gb|ACR10263.1|  UDP-glucosyl transferase 74c1                           401   3e-130   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_009141182.1|  PREDICTED: UDP-glycosyltransferase 74C1-like       400   4e-130   
ref|XP_010679007.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       400   5e-130   
ref|XP_009366234.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       400   6e-130   
emb|CDY19104.1|  BnaA04g18440D                                          400   7e-130   
ref|XP_010679010.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    400   8e-130   
ref|XP_006447238.1|  hypothetical protein CICLE_v10018164mg             399   9e-130   
ref|XP_006442123.1|  hypothetical protein CICLE_v10020092mg             399   9e-130   
ref|XP_008384038.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       399   1e-129   
ref|XP_010475279.1|  PREDICTED: UDP-glycosyltransferase 74E2-like...    397   2e-129   
gb|AFJ52952.1|  UDP-glycosyltransferase 1                               397   5e-129   
ref|XP_003624250.1|  UDP-glucose glucosyltransferase                    398   5e-129   
ref|XP_003624251.1|  UDP-glucose glucosyltransferase                    397   7e-129   
emb|CAN70002.1|  hypothetical protein VITISV_033171                     397   7e-129   Vitis vinifera
ref|XP_003613351.1|  N-hydroxythioamide S-beta-glucosyltransferase      397   1e-128   
gb|AGZ84547.1|  glycosyltransferase KGT18                               396   2e-128   
emb|CDP13108.1|  unnamed protein product                                394   4e-128   
ref|XP_007044514.1|  UDP-glucosyl transferase 74B1                      395   5e-128   
gb|KEH25950.1|  UDP-glucosyltransferase family protein                  395   6e-128   
ref|XP_010101355.1|  UDP-glycosyltransferase 74F2                       396   6e-128   
ref|XP_006478555.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    395   7e-128   
gb|ABP49574.1|  UDP-glucose glucosyltransferase                         394   9e-128   Rhodiola sachalinensis
ref|XP_004238636.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       394   1e-127   
gb|AHK60847.1|  CrUGT9                                                  394   2e-127   
ref|XP_002321569.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    392   4e-127   Populus trichocarpa [western balsam poplar]
ref|XP_010101353.1|  UDP-glycosyltransferase 74F2                       392   4e-127   
ref|XP_010672476.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    392   4e-127   
ref|XP_003517852.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       393   5e-127   
gb|AES96307.2|  UDP-glucosyltransferase family protein                  394   6e-127   
gb|KCW57500.1|  hypothetical protein EUGRSUZ_H00268                     389   9e-127   
gb|AFJ52950.1|  UDP-glycosyltransferase 1                               392   1e-126   
gb|ABK96547.1|  unknown                                                 391   1e-126   Populus trichocarpa x Populus deltoides
ref|XP_009132814.1|  PREDICTED: UDP-glycosyltransferase 74D1            391   1e-126   
ref|XP_006478556.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    391   1e-126   
ref|XP_004493042.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       391   2e-126   
emb|CDX79437.1|  BnaC03g17730D                                          390   3e-126   
gb|KDO43524.1|  hypothetical protein CISIN_1g012277mg                   391   3e-126   
gb|AFK36738.1|  unknown                                                 390   4e-126   
ref|XP_010672475.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    390   5e-126   
gb|KDO43523.1|  hypothetical protein CISIN_1g012277mg                   390   5e-126   
emb|CDY64375.1|  BnaCnng43810D                                          390   6e-126   
gb|AIE12488.1|  UGT8                                                    389   7e-126   
ref|XP_006447933.1|  hypothetical protein CICLE_v10015155mg             390   7e-126   
ref|XP_004493041.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       389   7e-126   
ref|XP_009410732.1|  PREDICTED: crocetin glucosyltransferase 2-like     390   9e-126   
ref|XP_002309737.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    389   9e-126   
ref|XP_010069571.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       389   1e-125   
ref|XP_011085046.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       389   1e-125   
ref|XP_002529826.1|  UDP-glucosyltransferase, putative                  389   2e-125   
ref|XP_007151237.1|  hypothetical protein PHAVU_004G029500g             388   2e-125   
emb|CDY15370.1|  BnaC04g42530D                                          388   3e-125   
ref|XP_003613349.1|  UDP-glucose glucosyltransferase                    394   3e-125   
gb|KHN09954.1|  UDP-glycosyltransferase 74E1                            388   3e-125   
ref|XP_002280305.1|  PREDICTED: UDP-glycosyltransferase 74B1            387   4e-125   
ref|XP_006372900.1|  hypothetical protein POPTR_0017s061201g            382   4e-125   
gb|ACM09993.3|  UDP-glycosyltransferase BMGT1                           388   4e-125   
ref|XP_007036115.1|  UDP-glucosyl transferase 74B1, putative            387   4e-125   
ref|XP_004288732.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       384   6e-125   
ref|XP_006469355.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       387   9e-125   
ref|XP_003541519.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       386   1e-124   
emb|CDP08078.1|  unnamed protein product                                385   1e-124   
gb|KCW48704.1|  hypothetical protein EUGRSUZ_K02355                     385   1e-124   
ref|XP_006858835.1|  hypothetical protein AMTR_s00066p00178850          386   2e-124   
ref|XP_010679009.1|  PREDICTED: UDP-glycosyltransferase 74F2-like...    386   2e-124   
gb|ABB88578.1|  UDP-glucosyltransferase                                 386   2e-124   
gb|KCW57501.1|  hypothetical protein EUGRSUZ_H00270                     385   2e-124   
ref|XP_003531287.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       386   2e-124   
ref|XP_010522253.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       385   3e-124   
ref|XP_007157504.1|  hypothetical protein PHAVU_002G075200g             385   3e-124   
ref|XP_004504205.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       385   5e-124   
ref|XP_006858827.1|  hypothetical protein AMTR_s00066p00177000          385   5e-124   
ref|XP_003554595.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       385   5e-124   
gb|KDP31143.1|  hypothetical protein JCGZ_11519                         384   8e-124   
ref|XP_006484310.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       386   1e-123   
ref|XP_008805997.1|  PREDICTED: indole-3-acetate beta-glucosyltra...    384   1e-123   
ref|XP_006296149.1|  hypothetical protein CARUB_v10025301mg             383   2e-123   
ref|XP_011047643.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       383   2e-123   
ref|XP_003543857.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       383   2e-123   
dbj|BAG80546.1|  UDP-glucose:glucosyltransferase                        384   2e-123   
ref|XP_010510154.1|  PREDICTED: UDP-glycosyltransferase 74C1-like       383   2e-123   
gb|KHN13207.1|  UDP-glycosyltransferase 74E1                            383   2e-123   
gb|ACU19612.1|  unknown                                                 383   3e-123   
ref|XP_010506287.1|  PREDICTED: UDP-glycosyltransferase 74F1 isof...    382   3e-123   
gb|KDP45197.1|  hypothetical protein JCGZ_15062                         383   3e-123   
ref|XP_006439748.1|  hypothetical protein CICLE_v10020081mg             383   3e-123   
gb|KDP21298.1|  hypothetical protein JCGZ_21769                         382   1e-122   
ref|XP_008449394.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       382   1e-122   
ref|XP_004144190.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       382   1e-122   
ref|XP_006438479.1|  hypothetical protein CICLE_v10031201mg             384   1e-122   
ref|XP_007203876.1|  hypothetical protein PRUPE_ppa005294mg             382   1e-122   
gb|KDO69768.1|  hypothetical protein CISIN_1g012645mg                   381   1e-122   
ref|XP_008455265.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    381   1e-122   
gb|KHG30812.1|  hypothetical protein F383_15387                         382   1e-122   
ref|XP_006476729.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       381   1e-122   
ref|XP_010508369.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       380   2e-122   
ref|XP_003554601.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       380   2e-122   
ref|XP_009797699.1|  PREDICTED: UDP-glycosyltransferase 74B1            380   3e-122   
ref|XP_010414084.1|  PREDICTED: UDP-glycosyltransferase 74C1            380   3e-122   
ref|XP_006858838.1|  hypothetical protein AMTR_s00066p00179760          380   3e-122   
ref|XP_006410308.1|  hypothetical protein EUTSA_v10016636mg             380   3e-122   
ref|XP_011028616.1|  PREDICTED: UDP-glycosyltransferase 74B1            380   3e-122   
ref|XP_006355935.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       379   6e-122   
emb|CDY34513.1|  BnaC04g12860D                                          379   9e-122   
gb|KDO41311.1|  hypothetical protein CISIN_1g038830mg                   374   1e-121   
ref|XP_008460408.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       379   2e-121   
ref|XP_008445481.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       379   2e-121   
ref|XP_006296254.1|  hypothetical protein CARUB_v10025420mg             377   5e-121   
ref|XP_010469678.1|  PREDICTED: UDP-glycosyltransferase 74C1-like       377   6e-121   
emb|CDY17908.1|  BnaC04g03110D                                          377   6e-121   
ref|XP_002879343.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    377   6e-121   
gb|KFK31183.1|  hypothetical protein AALP_AA6G079400                    377   7e-121   
ref|XP_008243111.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       377   8e-121   
ref|XP_006588331.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       376   1e-120   
ref|XP_010069572.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       376   1e-120   
ref|XP_010524193.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       376   1e-120   
gb|AFJ52954.1|  UDP-glycosyltransferase 1                               375   1e-120   
gb|KDO37942.1|  hypothetical protein CISIN_1g048393mg                   373   1e-120   
ref|XP_010695870.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       377   1e-120   
ref|XP_010043823.1|  PREDICTED: UDP-glycosyltransferase 74B1            376   2e-120   
ref|XP_007224980.1|  hypothetical protein PRUPE_ppa020679mg             375   2e-120   
ref|XP_007210590.1|  hypothetical protein PRUPE_ppa016463mg             375   3e-120   
ref|XP_011086491.1|  PREDICTED: UDP-glycosyltransferase 74B1            375   3e-120   
ref|XP_009144048.1|  PREDICTED: UDP-glycosyltransferase 74C1            375   4e-120   
ref|XP_007137294.1|  hypothetical protein PHAVU_009G115200g             375   4e-120   
ref|XP_011047632.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       375   4e-120   
ref|XP_010908641.1|  PREDICTED: crocetin glucosyltransferase 2-like     375   4e-120   
ref|XP_008243112.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       375   5e-120   
ref|XP_010506284.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       374   5e-120   
ref|XP_002310479.2|  putative glucosyltransferase family protein        374   7e-120   
ref|NP_181910.1|  UDP-glucosyltransferase 74F2                          374   7e-120   
ref|XP_010508370.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       374   1e-119   
ref|XP_009590752.1|  PREDICTED: UDP-glycosyltransferase 74B1            374   1e-119   
gb|AFJ52953.1|  UDP-glycosyltransferase 1                               374   1e-119   
ref|XP_004140240.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       374   2e-119   
gb|KGN43661.1|  hypothetical protein Csa_7G051410                       373   2e-119   
ref|XP_003543858.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       373   2e-119   
gb|KHN13206.1|  UDP-glycosyltransferase 74F1                            372   2e-119   
ref|XP_008449393.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       374   3e-119   
ref|NP_973682.1|  UDP-glycosyltransferase 74 F1                         372   3e-119   
ref|XP_007151254.1|  hypothetical protein PHAVU_004G031100g             372   4e-119   
gb|AAR06920.1|  UDP-glycosyltransferase 74G1                            372   4e-119   
ref|XP_009383146.1|  PREDICTED: crocetin glucosyltransferase 2-like     372   6e-119   
ref|XP_009142974.1|  PREDICTED: UDP-glycosyltransferase 74F2            371   6e-119   
gb|AGU14135.1|  UDP-glycosyltransferase                                 371   7e-119   
ref|XP_002880070.1|  UDP-glucosyltransferase 74F2                       371   7e-119   
ref|XP_007159561.1|  hypothetical protein PHAVU_002G247700g             370   2e-118   
ref|XP_010506285.1|  PREDICTED: UDP-glycosyltransferase 74F2            370   2e-118   
ref|XP_006397555.1|  hypothetical protein EUTSA_v10001440mg             370   2e-118   
emb|CDY16245.1|  BnaA09g29790D                                          371   2e-118   
ref|XP_006294206.1|  hypothetical protein CARUB_v10023202mg             370   2e-118   
ref|NP_180738.1|  UDP-glycosyltransferase 74C1                          370   2e-118   
ref|XP_010517963.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       370   2e-118   
ref|XP_002520220.1|  UDP-glucosyltransferase, putative                  371   2e-118   
ref|XP_003624252.1|  UDP-glucosyltransferase, putative                  370   2e-118   
ref|XP_003552471.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       370   2e-118   
ref|XP_010692817.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       371   3e-118   
ref|XP_006355936.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       370   3e-118   
ref|NP_181912.1|  UDP-glycosyltransferase 74 F1                         369   4e-118   
ref|XP_008239719.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       369   5e-118   
ref|XP_004162644.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       369   6e-118   
emb|CDX83455.1|  BnaA03g20510D                                          369   7e-118   
gb|AFK43317.1|  unknown                                                 369   7e-118   
emb|CDP21774.1|  unnamed protein product                                366   8e-118   
ref|XP_004144461.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       370   9e-118   
gb|KCW57957.1|  hypothetical protein EUGRSUZ_H00691                     368   1e-117   
ref|XP_010517962.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       368   1e-117   
ref|XP_003629941.1|  UDP-glucose glucosyltransferase                    368   1e-117   
gb|KHN40516.1|  UDP-glycosyltransferase 74E1                            368   2e-117   
ref|XP_003519432.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       368   2e-117   
ref|XP_010552632.1|  PREDICTED: UDP-glycosyltransferase 74B1            368   2e-117   
ref|XP_007151246.1|  hypothetical protein PHAVU_004G030400g             368   2e-117   
ref|XP_006397556.1|  hypothetical protein EUTSA_v10001441mg             367   2e-117   
emb|CAN74227.1|  hypothetical protein VITISV_041748                     367   3e-117   
emb|CDP20085.1|  unnamed protein product                                366   4e-117   
emb|CDY65158.1|  BnaC03g72710D                                          367   4e-117   
ref|XP_009115475.1|  PREDICTED: UDP-glycosyltransferase 74B1            367   5e-117   
ref|XP_010039151.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       367   5e-117   
gb|AFJ52955.1|  UDP-glycosyltransferase 1                               366   6e-117   
gb|KHN28671.1|  UDP-glycosyltransferase 74B1                            366   6e-117   
emb|CAN69453.1|  hypothetical protein VITISV_002845                     365   7e-117   
ref|XP_006858828.1|  hypothetical protein AMTR_s00066p00177320          367   7e-117   
ref|XP_004298592.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       366   9e-117   
emb|CDY64614.1|  BnaAnng19440D                                          366   9e-117   
ref|XP_006858837.1|  hypothetical protein AMTR_s00066p00179570          366   1e-116   
ref|XP_002267665.1|  PREDICTED: UDP-glycosyltransferase 74B1            366   1e-116   
ref|XP_004145722.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       366   1e-116   
gb|KFK37203.1|  hypothetical protein AALP_AA4G227600                    365   2e-116   
gb|AFJ52958.1|  UDP-glycosyltransferase 1                               365   2e-116   
gb|AAZ15016.1|  thiohydroximate S-glucosyltransferase                   365   2e-116   
gb|ACB59204.1|  glucosyltransferase                                     365   2e-116   
ref|XP_004297667.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       365   3e-116   
ref|XP_006858829.1|  hypothetical protein AMTR_s00066p00177490          365   3e-116   
ref|XP_007151178.1|  hypothetical protein PHAVU_004G024500g             365   3e-116   
gb|AAL09350.1|  thiohydroximate S-glucosyltransferase                   365   3e-116   
ref|XP_009133637.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       364   3e-116   
gb|KHN45525.1|  UDP-glycosyltransferase 74E2                            363   4e-116   
emb|CDY60796.1|  BnaC05g50780D                                          365   4e-116   
gb|KFK37204.1|  hypothetical protein AALP_AA4G227700                    364   5e-116   
ref|XP_010091051.1|  UDP-glycosyltransferase                            363   9e-116   
ref|XP_006858830.1|  hypothetical protein AMTR_s00066p00177790          363   1e-115   
ref|XP_004144399.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       363   1e-115   
emb|CDX83456.1|  BnaA03g20500D                                          363   1e-115   
ref|XP_006295749.1|  hypothetical protein CARUB_v10024869mg             362   1e-115   
gb|ADW54462.1|  UDP-glucose glucosyl transferase                        363   2e-115   
gb|ABR16243.1|  unknown                                                 363   2e-115   
emb|CDP00213.1|  unnamed protein product                                361   3e-115   
gb|KGN47941.1|  hypothetical protein Csa_6G418410                       363   4e-115   
emb|CDP08077.1|  unnamed protein product                                360   5e-115   
ref|XP_010684803.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       362   5e-115   
emb|CBI24715.3|  unnamed protein product                                359   6e-115   
ref|XP_002880071.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    361   7e-115   
ref|XP_008460407.1|  PREDICTED: UDP-glycosyltransferase 74E1-like       361   9e-115   
ref|XP_008450044.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       361   1e-114   
gb|KHN40518.1|  UDP-glycosyltransferase 74F1                            360   1e-114   
ref|XP_010498931.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       360   2e-114   
ref|XP_004140238.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       361   2e-114   
ref|XP_004144267.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       360   5e-114   
ref|XP_004166474.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       360   5e-114   
ref|XP_008445482.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       359   6e-114   
ref|XP_010477734.1|  PREDICTED: UDP-glycosyltransferase 74B1            359   6e-114   
gb|EYU17631.1|  hypothetical protein MIMGU_mgv1a006064mg                359   6e-114   
ref|XP_008449397.1|  PREDICTED: UDP-glycosyltransferase 74E2-like       359   1e-113   
ref|XP_010552631.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       358   1e-113   
ref|XP_008245156.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       358   1e-113   
ref|XP_002892307.1|  UDP-glucoronosyl/UDP-glucosyl transferase fa...    376   1e-113   
gb|EYU17628.1|  hypothetical protein MIMGU_mgv1a020645mg                358   2e-113   
gb|AAD30619.1|AC007153_11  similar to indole-3-acetate beta-gluco...    376   2e-113   
ref|XP_009133636.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       357   2e-113   
ref|XP_004957371.1|  PREDICTED: crocetin glucosyltransferase 2-like     358   2e-113   
ref|XP_010101354.1|  UDP-glycosyltransferase 74F2                       356   4e-113   
gb|AGD95005.1|  lignan glucosyltransferase                              357   5e-113   
ref|XP_006858826.1|  hypothetical protein AMTR_s00066p00176700          358   6e-113   
ref|XP_010069575.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       356   9e-113   
ref|XP_008455273.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       355   3e-112   
emb|CDY64613.1|  BnaAnng19430D                                          354   3e-112   
ref|XP_009133642.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       354   3e-112   
gb|EYU29695.1|  hypothetical protein MIMGU_mgv1a006214mg                354   4e-112   
gb|AFJ52956.1|  UDP-glycosyltransferase 1                               353   5e-112   
gb|KFK37205.1|  hypothetical protein AALP_AA4G227800                    353   6e-112   
ref|XP_006307446.1|  hypothetical protein CARUB_v10009070mg             353   7e-112   
ref|XP_002460531.1|  hypothetical protein SORBIDRAFT_02g030050          353   1e-111   
emb|CDP05435.1|  unnamed protein product                                358   1e-111   
ref|XP_004957373.1|  PREDICTED: UDP-glycosyltransferase 74F1-like       353   1e-111   
ref|XP_006416029.1|  hypothetical protein EUTSA_v10007574mg             352   2e-111   
ref|XP_002467184.1|  hypothetical protein SORBIDRAFT_01g021110          352   3e-111   
ref|XP_004137037.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       352   4e-111   
gb|ABR16264.1|  unknown                                                 352   6e-111   
ref|XP_004299583.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       351   6e-111   
sp|Q6X1C0.1|GLT2_CROSA  RecName: Full=Crocetin glucosyltransferase 2    351   7e-111   
dbj|BAD95102.1|  putative glucosyltransferase                           350   1e-110   
gb|AFJ52957.1|  UDP-glycosyltransferase 1                               350   1e-110   
ref|XP_004983225.1|  PREDICTED: crocetin glucosyltransferase 2-like     350   2e-110   
ref|XP_006442124.1|  hypothetical protein CICLE_v10023826mg             348   3e-110   
gb|KFK44473.1|  hypothetical protein AALP_AA1G261000                    349   4e-110   
gb|EYU17634.1|  hypothetical protein MIMGU_mgv1a006216mg                348   5e-110   
ref|XP_004957367.1|  PREDICTED: UDP-glycosyltransferase 74F2-like       348   9e-110   
gb|KGN58388.1|  hypothetical protein Csa_3G636370                       347   1e-109   
gb|KCW57958.1|  hypothetical protein EUGRSUZ_H00692                     347   2e-109   
emb|CBI33059.3|  unnamed protein product                                345   2e-109   
ref|XP_010460183.1|  PREDICTED: UDP-glycosyltransferase 74B1-like       347   3e-109   
ref|XP_002893325.1|  UDP-glucosyl transferase 74B1                      346   5e-109   
ref|XP_004166473.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyl...    343   6e-109   
gb|ABB88579.1|  UDP-glucosyltransferase                                 343   8e-109   
ref|XP_007151253.1|  hypothetical protein PHAVU_004G031000g             345   8e-109   
ref|XP_003624245.1|  UDP-glucosyltransferase, putative                  345   1e-108   
gb|ABB88580.1|  UDP-glucosyltransferase                                 343   1e-108   



>dbj|BAG80534.1| putative glycosyltransferase [Lycium barbarum]
Length=447

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/449 (60%), Positives = 336/449 (75%), Gaps = 3/449 (1%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVE  1331
             M E+   SHVLV+P+P+ GHI PMVQ SKRLASRGV VT+IT  S S  + + S+ I++E
Sbjct  1     MEEIPNKSHVLVLPFPVQGHINPMVQFSKRLASRGVKVTLITIDSISKSMPMESNSIKIE  60

Query  1330  SIPDGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
             SIP    P   +D   +W   LVS NL +I+ K+      +  +VYDSI  W  DL HQL
Sbjct  61    SIPHNDSPPDSYDNFLEWFHVLVSKNLTQIVEKLYDLEYPVKVIVYDSITTWAIDLAHQL  120

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPT-EGSTVSLPSMPPLGLNDLPSFVRNKSSYS  974
             GL+ AAF +QSC++  +Y+H D E  +  + EGS V LPS+P L   DLPSFV     Y 
Sbjct  121   GLKGAAFFTQSCSLSVIYYHMDPEKESKVSFEGSAVCLPSLPLLEKQDLPSFVCQSDLYP  180

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVR  794
             SL + V SRN+N +KADWLLFN+FD LEKEV+ W+ SQ+ +K   IGP++PSMYLDKR++
Sbjct  181   SLAKLVFSRNINFKKADWLLFNSFDVLEKEVINWLRSQYRIK--TIGPIIPSMYLDKRLK  238

Query  793   DDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             DD  YGLSLFKPN+  CM+WLDS+E GSVVYVSFGSLANL ++QM E+A GL+ S C FL
Sbjct  239   DDKEYGLSLFKPNSETCMKWLDSREFGSVVYVSFGSLANLGEQQMEELATGLMMSNCYFL  298

Query  613   WVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGV  434
             WVVR++E++KL   F    S  G+I NWCPQLDVL+HQAVGCF THCGWNSTLEALSLGV
Sbjct  299   WVVRATEENKLSEEFMSKLSKKGLIVNWCPQLDVLAHQAVGCFFTHCGWNSTLEALSLGV  358

Query  433   PVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKEN  254
             P+VAMPQW+DQPTNAK++ DVW  G+RV AGENG++TR+EV   + EVM+ E+GVMLK+N
Sbjct  359   PMVAMPQWSDQPTNAKFISDVWQTGLRVKAGENGVITRDEVASSIREVMEEEKGVMLKKN  418

Query  253   AAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             A KWKQLAKEAVD GGSSDKNI+EF+S +
Sbjct  419   AIKWKQLAKEAVDVGGSSDKNIEEFLSNL  447



>ref|XP_009613938.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana tomentosiformis]
Length=453

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/447 (59%), Positives = 332/447 (74%), Gaps = 3/447 (1%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVE  1331
             M E+++ SHVLV+P+P+ GHI PMVQ SKRL SRGV VT+IT  S S  I   S+ I++E
Sbjct  1     MEEITSKSHVLVLPFPVQGHINPMVQFSKRLVSRGVKVTLITIDSISKSIPKDSNSIKIE  60

Query  1330  SIPDGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
             SIP    P +  D   +W   L+SNNL EI+ K++ S   +  +V+DS+  W  DL H+L
Sbjct  61    SIPHDESPPNSIDIFLEWFFTLISNNLREIVKKLSDSEYPVKVLVFDSVATWAIDLAHEL  120

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             G++ AAF +QSC++ A+Y+H D E      +GS VSLPS+P L   DLPSFV    SY +
Sbjct  121   GIKGAAFFTQSCSLSAIYYHLDPEISKITLDGSAVSLPSLPLLEKEDLPSFVYQSESYPA  180

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
             L+R V S+N+N +KADWL FNTFD LE EV++WM +Q+P+K   IGP +PSMYLDKR++D
Sbjct  181   LVRLVFSQNINFKKADWLFFNTFDVLE-EVVDWMRTQYPIK--TIGPTIPSMYLDKRLKD  237

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D  YG SL KPN   CM+WLD +E GSVVYVSFGSLA+L ++QM E+A GLI S   FLW
Sbjct  238   DKEYGSSLIKPNGETCMKWLDLKEIGSVVYVSFGSLASLGEKQMEELALGLIMSNSYFLW  297

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
              VR +E++KLP+ F    S  G+I NW PQLDVL+H++VGCF THCGWNSTLEALSLGVP
Sbjct  298   AVRDTEENKLPNEFKSKASEKGLIVNWSPQLDVLAHKSVGCFFTHCGWNSTLEALSLGVP  357

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             +V MPQWTDQPTNAK++ DVW  GIRV AG++G++TREEV   + EVM+ E+GVMLKENA
Sbjct  358   MVCMPQWTDQPTNAKFISDVWRTGIRVKAGKDGVITREEVASSIKEVMEEEKGVMLKENA  417

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVSA  170
              KWK LAKEAVDEGGSSDKNI+EF+S 
Sbjct  418   IKWKTLAKEAVDEGGSSDKNIEEFLST  444



>ref|XP_009776895.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana sylvestris]
Length=445

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/448 (58%), Positives = 334/448 (75%), Gaps = 3/448 (1%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVE  1331
             M E+++ SHVLV+P+P+ GHI PMVQ SKRL SRGV VT++T  S S  + + S  +++E
Sbjct  1     MEEITSKSHVLVLPFPVQGHINPMVQFSKRLVSRGVKVTLVTIDSISKSMPMESCSVKIE  60

Query  1330  SIPDGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
             SIP    P    D   +W   L+SNNL +I+ K+  S   +  +V+DS+  W  DL H+L
Sbjct  61    SIPHDESPPKSIDIFLEWFFVLISNNLKKIVEKLFDSEYPVKVLVFDSVTAWAIDLAHEL  120

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             G++ AAF +QSC++ A+Y+H D E      +GS VSLPS+P L   DLPSFV    SY S
Sbjct  121   GIKGAAFFTQSCSLSAIYYHLDPEIRKIILDGSAVSLPSLPLLEKEDLPSFVYEGDSYPS  180

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
             L+R V S+N+N +KADWL FNTFD LE EV++WM +Q+P+K   IGP +PSMYLDKR++D
Sbjct  181   LVRLVFSQNINFKKADWLFFNTFDVLE-EVVDWMRTQYPIK--TIGPTIPSMYLDKRLKD  237

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D  YG SL KPN   CM+WLD +E GSVVYVSFGSLA+L ++QM E+A GLI S   FLW
Sbjct  238   DKEYGSSLIKPNGETCMKWLDLKEIGSVVYVSFGSLASLGEKQMEELAFGLIMSNSYFLW  297

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             VVR +E++KLP++F    S  G+I NW PQLDVL+H++VGCF THCGWNSTLEALSLGVP
Sbjct  298   VVRDTEENKLPNDFMSKVSEKGLIVNWSPQLDVLAHKSVGCFFTHCGWNSTLEALSLGVP  357

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             +V MPQWTDQPTNAK++ DVW  GIRV AG++G++TREEV   + EVM+GE+GVMLKENA
Sbjct  358   MVCMPQWTDQPTNAKFISDVWRTGIRVKAGKDGVITREEVASSIREVMEGEKGVMLKENA  417

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              KWK LAKEAVDEGGSSDKNI+EF+S +
Sbjct  418   IKWKNLAKEAVDEGGSSDKNIEEFLSNL  445



>dbj|BAG80543.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=445

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/448 (57%), Positives = 336/448 (75%), Gaps = 3/448 (1%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVE  1331
             M E++  +HVL++PYP+ GHI PMVQ SKRLASRGV VT++T  + S  +   S  I++E
Sbjct  1     MEEITNKAHVLLLPYPLQGHINPMVQFSKRLASRGVKVTLVTIDNVSKNMPKESGSIKIE  60

Query  1330  SIPDGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
             SIP    P    D   +W  +L+S NL  I+ K++ S   +  +V+DSI  W  DL HQL
Sbjct  61    SIPHDEAPPQSVDESLEWYFNLISKNLGAIVEKLSNSEFPVKVLVFDSIGSWALDLAHQL  120

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             GL+ AAF +Q C++ A+++H D E    P +GS V+LPS+P L   DLP+F+ +   Y S
Sbjct  121   GLKGAAFFTQPCSLSAIFYHMDPETSKVPFDGSVVTLPSLPLLEKKDLPTFIYD-DLYPS  179

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
             L + + S+N++ +KADWLLFNTFD LEKEV+ W+ +Q+P+K   IGP +PSMYLDKR+++
Sbjct  180   LAKLIFSQNIHFKKADWLLFNTFDVLEKEVVNWLRTQYPIK--TIGPTIPSMYLDKRLKE  237

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D  YGLSLFKPN   C++WLDS+E GSVVYVSFG+LA+L ++QM E+A GL+ S C FLW
Sbjct  238   DKEYGLSLFKPNGETCVKWLDSREIGSVVYVSFGTLASLGEQQMEELAWGLMTSNCHFLW  297

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             VVR+SE++KLP+ F    S  G+I NWCPQLDVL+HQ+VGCF THCGWNSTLEAL LGVP
Sbjct  298   VVRTSEENKLPNEFMSKLSEKGLIVNWCPQLDVLAHQSVGCFFTHCGWNSTLEALCLGVP  357

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             +VAMPQW+DQPTNAK++ DVW  GIRV AGE+G+V R+E+   + EVM+ E+G+MLKENA
Sbjct  358   MVAMPQWSDQPTNAKFISDVWQTGIRVKAGEDGVVNRDEIASSIREVMEEEKGIMLKENA  417

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              KWKQLAK A+DEGGSSDKNI+EF+S +
Sbjct  418   IKWKQLAKAAIDEGGSSDKNIEEFLSNL  445



>ref|XP_006342416.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=448

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/450 (57%), Positives = 332/450 (74%), Gaps = 4/450 (1%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVG-VTVITPTSTSACIQVSSSLIRV  1334
             M E S  SH+LV+P P+ GHI PMVQ SKRLAS+GV  VT++T  S S  +   S LI +
Sbjct  1     MEEKSNKSHILVLPIPVQGHINPMVQFSKRLASKGVNKVTLVTIYSISKNMPKESGLINI  60

Query  1333  ESIP-DGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             ESIP D   P    D + +W   LVS NL +I+ K++     +  +V+DS+  W  DL H
Sbjct  61    ESIPHDDESPPQNIDPMLEWFHLLVSKNLTKIVEKLSDPEYPVKVLVFDSMATWAIDLAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSY  977
             QLGL+ AAF +QSC++ A+Y+H D E      +GS VSLPS+P L   DLPS + +   Y
Sbjct  121   QLGLKGAAFFTQSCSLSAIYYHMDLETTKVSLDGSDVSLPSLPLLAKEDLPSIIYDTDLY  180

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
              +L   + S+N+N +KADWL FNTF+ LEKEV++W+  ++P+K   IGP +PSMYLDKR+
Sbjct  181   PTLRGLIFSQNINFKKADWLFFNTFNALEKEVVDWIRPRYPIK--TIGPTIPSMYLDKRL  238

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
             +DD  YGLSLFKPN+  CM+WLDS+E GSVVYVSFGSLA+L ++QM E+A GLI SKC F
Sbjct  239   KDDKEYGLSLFKPNSETCMKWLDSKEIGSVVYVSFGSLASLDEQQMEELALGLIMSKCYF  298

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR++E++KLP  F    S  G++ NWCPQLDVL+H+A+GCF TH GWNSTLEALSLG
Sbjct  299   LWVVRATEENKLPEEFMSKLSEKGLMVNWCPQLDVLAHRAIGCFFTHSGWNSTLEALSLG  358

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP+V MPQW+DQPTNAK++ DVW  G+RV  GENG+V R+E+   + EVM+ E+G+MLKE
Sbjct  359   VPMVTMPQWSDQPTNAKFISDVWQTGVRVKVGENGVVNRDEIASSIREVMEEEKGIMLKE  418

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA KWK+LAKEAVDEGGSSDKNI+EF+S +
Sbjct  419   NAMKWKKLAKEAVDEGGSSDKNIEEFLSNL  448



>ref|XP_004253028.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum lycopersicum]
Length=448

 Score =   525 bits (1352),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 254/450 (56%), Positives = 326/450 (72%), Gaps = 4/450 (1%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVG-VTVITPTSTSACIQVSSSLIRV  1334
             M E S  SH+LV+P P+ GHI PMVQ SKRLAS+GV  VTV+T  S S  +   S LI +
Sbjct  1     MEEKSNKSHILVLPIPVQGHINPMVQFSKRLASKGVNKVTVVTIYSISKNMPKESGLINI  60

Query  1333  ESIP-DGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             ESIP D   P    D + +W   LVS NL +I+ K++ S   +  +V+DS+  W  DL H
Sbjct  61    ESIPHDDKSPPQNIDPMLEWFHLLVSKNLRKIVEKLSDSVYPVKVLVFDSVATWAIDLAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSY  977
             +LGL+ AAF +Q C + A+Y+H D E      +GS VSLPS+P L   DLPS + +   Y
Sbjct  121   KLGLKGAAFFTQPCCLSAIYYHMDPETTKVSFDGSDVSLPSLPLLTKEDLPSIIYDTDLY  180

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
              +L   V S+N+N +KADWL FNTFD LEKE++EW+  ++P+K   +GP +PSMYLDKR+
Sbjct  181   PTLRGLVFSQNINFKKADWLFFNTFDALEKEIVEWIRPRYPIK--TVGPTIPSMYLDKRL  238

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              +D  YGLSLFKPN+  CM+WLDS+E  SVVYVSFGSLA+L ++QM E+A GLI +KC F
Sbjct  239   MEDKEYGLSLFKPNSEICMKWLDSKEIDSVVYVSFGSLASLDEQQMEELAFGLILTKCYF  298

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR++E++KLP  F       G++ NWCPQLDVL+H++VGCF TH GWNSTLEALSLG
Sbjct  299   LWVVRATEENKLPEEFMSKLFEKGLMVNWCPQLDVLAHRSVGCFFTHSGWNSTLEALSLG  358

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP+V MPQW+DQPTNAK++ DVW  G+RV  GENG+V R+E+   + EVM+ E+G MLKE
Sbjct  359   VPMVTMPQWSDQPTNAKFISDVWQTGVRVKVGENGVVNRDEIASSIREVMEEEKGTMLKE  418

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA KWK LAKEAVDEGGSSDKNI+EF+S +
Sbjct  419   NAMKWKNLAKEAVDEGGSSDKNIEEFLSNL  448



>ref|XP_003632087.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Vitis vinifera]
Length=452

 Score =   524 bits (1350),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 251/444 (57%), Positives = 339/444 (76%), Gaps = 7/444 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +HVLVIPYP+ GHI PM+Q SKRLAS+G+ VT+IT T T+   Q  SS I +E IP G++
Sbjct  10    THVLVIPYPVQGHINPMLQFSKRLASKGLKVTLITTTPTNKSKQPQSSSINMEHIPVGLQ  69

Query  1309  PDSGFDAISDWL---KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
              +   +++ D+L   K +VS++L E++ +  GS   +  +VYDS+M W  D+V +L +  
Sbjct  70    GEE--ESLDDYLERFKLIVSSSLVELIGRYNGSEYPVRVLVYDSVMSWAQDIVERLSVDG  127

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             A F +QSCAV  +Y+H +Q     P EG TVS+PSMP LG+NDLPSF+ + SSY +L   
Sbjct  128   APFFTQSCAVSTIYYHVNQGAFKIPLEGPTVSIPSMPILGVNDLPSFINDTSSYPTLWSL  187

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNY  779
             V ++  N +K +W+ FNTF ELE EV++W+AS+ P+K   IGP +PSMYLD+R+ DD++Y
Sbjct  188   VKTQFSNFEKVNWVFFNTFCELEDEVVKWLASKRPIK--TIGPTIPSMYLDRRIDDDEDY  245

Query  778   GLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRS  599
             GLSLFKPN + C+ WLD+++T SVVYVSFGSLA+L +EQM E+A GL +S  +FLWVVR 
Sbjct  246   GLSLFKPNADACITWLDTKDTVSVVYVSFGSLASLGEEQMEELAWGLKRSNSQFLWVVRE  305

Query  598   SEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAM  419
              E+ KLPSNF  + S  G++ +WCPQL+VL+H+AVGCF+THCGWNSTLEALSLGVP+VAM
Sbjct  306   LEKKKLPSNFVEETSEKGLVVSWCPQLEVLAHKAVGCFMTHCGWNSTLEALSLGVPMVAM  365

Query  418   PQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWK  239
             PQWTDQ TNAK++ DVW VG+RV  GENG+V REE++ C+ EVM+GERG +++ NA +WK
Sbjct  366   PQWTDQTTNAKFIEDVWGVGVRVKVGENGIVKREEIKECIREVMEGERGNVMQRNAQRWK  425

Query  238   QLAKEAVDEGGSSDKNIKEFVSAI  167
             +LAKEAV+EGGSSD NI+EFV+ +
Sbjct  426   ELAKEAVNEGGSSDNNIEEFVARL  449



>ref|XP_006342417.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=451

 Score =   523 bits (1348),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 257/451 (57%), Positives = 326/451 (72%), Gaps = 5/451 (1%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRL-ASRGVGVTVITPTSTSACIQV-SSSLIR  1337
             M E +  SHVLV+P+P+ GHI PMVQ SKRL A   V VT+IT  S +  + +  S  I+
Sbjct  1     MEEKNNKSHVLVLPFPVQGHINPMVQFSKRLTAKESVKVTLITIDSVTKSMPILESGSIK  60

Query  1336  VESIP-DGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLV  1160
             + SIP +   P   +D   +W   LVS NL +I+ +++ S   +  +V+DSI  W  DL 
Sbjct  61    IHSIPHNDETPPQSYDLFLEWFHVLVSKNLTKIVEELSDSEYPVKVLVFDSITTWAIDLT  120

Query  1159  HQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSS  980
             H+LGL+ AAF +QSCA+  VY+H D E         +V LPS+P L   DLPSFV     
Sbjct  121   HELGLKGAAFFTQSCALSVVYYHMDPEKNKVCVFDDSVCLPSLPLLQKQDLPSFVCQSDL  180

Query  979   YSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKR  800
             Y SL + V SRN+N +KADWLLFN+FD LEKEV++W+ +Q  +K   IGP++PSMYLDKR
Sbjct  181   YPSLRKLVFSRNINFKKADWLLFNSFDVLEKEVIDWLRTQCRIK--TIGPIIPSMYLDKR  238

Query  799   VRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCK  620
             ++DD  YGLSLFKPN+  CM+WLDS+E GSVVYVSFGSLANL ++QM E+A GL+ S   
Sbjct  239   LKDDKEYGLSLFKPNSETCMKWLDSREIGSVVYVSFGSLANLGEQQMEELASGLMMSDFN  298

Query  619   FLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             FLWVVR++E++KL   F        +I NWCPQLDVLSHQAVGCF THCGWNSTLEALSL
Sbjct  299   FLWVVRATEENKLTEEFMSKSKKKCLIVNWCPQLDVLSHQAVGCFFTHCGWNSTLEALSL  358

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
             GVP+VAMPQW+DQPTNAK++ DVW  G+RV AGENG+V R+E+   + EVM+ E+G+MLK
Sbjct  359   GVPMVAMPQWSDQPTNAKFISDVWQTGVRVKAGENGVVNRDEIASSIREVMREEKGIMLK  418

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ENA KWK+LAKEAVDEGGSSDKNI+EF+  +
Sbjct  419   ENANKWKKLAKEAVDEGGSSDKNIEEFLKLV  449



>ref|XP_004253027.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum lycopersicum]
Length=453

 Score =   514 bits (1323),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 256/453 (57%), Positives = 323/453 (71%), Gaps = 7/453 (2%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASR-GVGVTVITPTSTSACIQV-SSSLIR  1337
             M E +  SHVLV+P+P+ GHI PMVQ SKRL S+  V VT+IT  S +  + +  SS I+
Sbjct  1     MEEKTNKSHVLVLPFPVQGHINPMVQFSKRLTSKESVKVTLITIDSVTKSMPILESSSIK  60

Query  1336  VESIP-DGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLV  1160
             + SIP +   P   +D   +W   LVS N  +I+ +++ S   +  +V+DSI  W  DL 
Sbjct  61    IHSIPHNDETPPQSYDLFLEWFHVLVSKNFTKIVEELSDSEYPVKVLVFDSITTWAIDLA  120

Query  1159  HQLGLRAAAFNSQSCAVFAVYHHTDQEN--LTAPTEGSTVSLPSMPPLGLNDLPSFVRNK  986
             H LGL+ AAF +QSCA+  VY+H D E   +    +   V LPS+P L   DLPSFV   
Sbjct  121   HDLGLKGAAFFTQSCALSVVYYHMDPEKNKICVFDDDDGVCLPSLPLLQKQDLPSFVCQT  180

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
               Y SL + V SRN+N +KADWLLFN+FD LEKEV+ W+ +Q  +K   IGPL+PSMYLD
Sbjct  181   DLYPSLKKLVFSRNINFKKADWLLFNSFDVLEKEVISWLRTQCRIK--TIGPLIPSMYLD  238

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR++DD  YGLSLFKPN+  CM+WLDS+E GSVVYVSFGSLANL ++QM E+A GL+ S 
Sbjct  239   KRLKDDKEYGLSLFKPNSETCMKWLDSREIGSVVYVSFGSLANLGEQQMEELASGLMMSD  298

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
               FLWVVR +E++KL   F        +I NWCPQLDVLSHQAVGCF THCGWNSTLEAL
Sbjct  299   FYFLWVVRVTEENKLTEEFMSKPKEKCLIVNWCPQLDVLSHQAVGCFFTHCGWNSTLEAL  358

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVM  266
             SLGVP+VAMPQW+DQPTNAK++ DVW  G+RV AGENG+V R+E+   +  VM+ E G+M
Sbjct  359   SLGVPMVAMPQWSDQPTNAKFISDVWQTGVRVKAGENGVVNRDEIASSVRRVMREEEGIM  418

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             LKENA KWK+LAKEAVDEGGSS+KNI+EF+  +
Sbjct  419   LKENAIKWKKLAKEAVDEGGSSNKNIEEFLKLV  451



>ref|XP_010091337.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
 gb|EXB44327.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
Length=453

 Score =   497 bits (1280),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 233/449 (52%), Positives = 319/449 (71%), Gaps = 2/449 (0%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRV  1334
             E   +   +H+LVIP PI GHI PM+Q SKRLAS+G+ VT++T  S +      + LIR 
Sbjct  2     ERERVHKTTHILVIPLPIQGHINPMLQFSKRLASKGLKVTLVTAFSNNEATHNQAGLIRF  61

Query  1333  ESIPDGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQ  1154
             E I +G++     + + +W +++ S  L E++ K   +G  ++ +VYDS MPW+ DL  +
Sbjct  62    EPICNGLEESDKIENMVEWFQNIASKRLPELIVKQETNGFPVSCLVYDSAMPWILDLAKR  121

Query  1153  LGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYS  974
              GL  A+F + SCAV  +Y++  Q+ L  P +   VSL  +P L  +DLPSF+ +  SY 
Sbjct  122   HGLSGASFFTHSCAVACIYYYLHQDLLRVPLKEPQVSLAGLPSLKAHDLPSFIYDPGSYP  181

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVR  794
             S L+ V+SR  N  KADW+ F++FD LEKEV+ WM + + +K   IGP +PSMYLDKR+ 
Sbjct  182   SFLKLVISRFSNLTKADWIFFSSFDNLEKEVVSWMRTLWRIK--TIGPTIPSMYLDKRLE  239

Query  793   DDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             +D +YG  LF PN + C++WLDS+E  SVVY+SFGS+ANL +EQM E+A+GL +S C FL
Sbjct  240   EDKDYGFGLFNPNADACIKWLDSKEVDSVVYLSFGSIANLGNEQMEELAEGLKRSNCNFL  299

Query  613   WVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGV  434
             WV R SE  KLPS F  + S  G++ NWCPQL VLSH++ GCF+THCGWNSTLEALSLGV
Sbjct  300   WVARESEVGKLPSKFVEETSEKGLVVNWCPQLGVLSHRSTGCFVTHCGWNSTLEALSLGV  359

Query  433   PVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKEN  254
             P+VAMPQWTDQ TNAK++ DVW VG+RV    +G+V REE+E C+ EV++GERG  +KEN
Sbjct  360   PMVAMPQWTDQTTNAKFVADVWRVGLRVRVDPSGIVPREEIELCIREVLQGERGKGIKEN  419

Query  253   AAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             + +W++LAKEAVDEGGSS+ NI+EFV+ +
Sbjct  420   SIRWRELAKEAVDEGGSSNNNIEEFVAEL  448



>ref|XP_002529823.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32572.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=467

 Score =   495 bits (1275),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 240/458 (52%), Positives = 329/458 (72%), Gaps = 7/458 (2%)
 Frame = -3

Query  1525  VERPEMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS-S  1349
             +E+ E    ++ +HVLV PYP+ GHI PM+QLSKRLAS+G+ VT++  +S +  ++ S +
Sbjct  1     MEKEEQFRAASQNHVLVFPYPVQGHINPMLQLSKRLASKGLRVTLVATSSIAKAMKASHA  60

Query  1348  SLIRVESIPDGVKPD---SGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMP  1178
             S + +E+I DG +     S  +A  +  K  V  +L E++ K  GS   +  ++YDS+ P
Sbjct  61    SSVHIETIFDGFEEGEKASDPNAFDETFKATVPKSLVELIEKHAGSPYPVKCLIYDSVTP  120

Query  1177  WVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSF  998
             W+ D+  + G+  A+F +QSCAV  +Y+H  Q  L  P E S VSLPS P L  NDLPS+
Sbjct  121   WLFDVARRSGIYGASFFTQSCAVTGLYYHKIQGALRVPLEESVVSLPSYPELESNDLPSY  180

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
             V    SY ++     S+  N  + DWLL+NTF+ELE EV+ WM S++P  ++ IGP +PS
Sbjct  181   VNGAGSYQAIYDMAFSQFSNVDEVDWLLWNTFNELEDEVVNWMKSKWP--IMPIGPTIPS  238

Query  817   MYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGL  638
             M+LD+R+ DD +YGLSLFKPN++ CM+WLDS+E  SVVYVSFGS A L+++QM EVA GL
Sbjct  239   MFLDRRLEDDKDYGLSLFKPNSDACMKWLDSKEARSVVYVSFGSQAALEEDQMAEVAWGL  298

Query  637   IQSKCKFLWVVRSSEQSKLPSNFWPD-KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNS  461
              +S   FLWVVR SE  KLP+NF  +     G++  W PQL+VL+H++VGCF+THCGWNS
Sbjct  299   RRSNSNFLWVVRESEAKKLPANFAEEITEEKGVVVTWSPQLEVLAHKSVGCFMTHCGWNS  358

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             TLEALSLGVP+VAMPQWTDQPTNAK++ DVW VG+RV   +NG+VT+EE+E+C+ EVM+G
Sbjct  359   TLEALSLGVPMVAMPQWTDQPTNAKFVTDVWRVGVRVKVDQNGIVTQEEIEKCIREVMEG  418

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             E G  ++ N+ KWK+LA+ AVDEGGSSDKNI+EFVS +
Sbjct  419   ETGKEMRMNSEKWKELARIAVDEGGSSDKNIEEFVSKL  456



>emb|CDP08071.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   495 bits (1274),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 241/457 (53%), Positives = 325/457 (71%), Gaps = 11/457 (2%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVE  1331
             M E+    HVL IPYP+ GH+ PM+QL KRL S+G+ +T++T TS    +Q     I++E
Sbjct  1     MDEIGCRIHVLAIPYPLQGHLNPMLQLCKRLTSKGLRITLVTSTSARISVQNQFESIQIE  60

Query  1330  SI--PDGVKPDSGFD-----AISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWV  1172
              I   D ++ +   D     A    ++  VS+NLA+++ +   SG  +  V+YDS+MPW+
Sbjct  61    YILDDDNIEAEGSNDSEKGAAHFKRIQIAVSDNLAKLVEEKASSGHPVNIVLYDSMMPWI  120

Query  1171  ADLVH-QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFV  995
              ++V  QLGL+ AAF +Q+CAV A+Y+H  +  L  P E ST+ LPSMP L  NDLPSFV
Sbjct  121   LEIVQGQLGLKGAAFFTQACAVSAIYNHIHRGTLKVPLETSTILLPSMPQLESNDLPSFV  180

Query  994   RNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSM  815
              N   Y  +L  VL +N+N +K+DWLLFN+FD+LE E + W+  ++P+K I  GP  PSM
Sbjct  181   YNPGPYPGVLDLVLGQNINLEKSDWLLFNSFDKLENEAVTWLTERYPIKTI--GPSTPSM  238

Query  814   YLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             Y DKR++DD +Y ++ F P++  C++WLD++ETGSVVYVSFGS+++L + QM E+A GL+
Sbjct  239   YTDKRLKDDKDYTINFFTPDSGACLKWLDTKETGSVVYVSFGSMSDLGENQMQEIACGLM  298

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTL  455
              S C FLWVVR SE+SK+P +F  +    G+I NWCPQ  VLSH+AVGCF+THCGWNST+
Sbjct  299   NSNCNFLWVVRPSEESKIPRDFMSEAEERGLIVNWCPQPKVLSHRAVGCFMTHCGWNSTI  358

Query  454   EALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAG-ENGMVTREEVERCLVEVMKGE  278
             EALSLGVP+V MP W DQ TN+KY+VDVW VG+RV A  E  MVTREEVER + EVM GE
Sbjct  359   EALSLGVPMVTMPVWADQTTNSKYIVDVWKVGLRVKASEEREMVTREEVERTIREVMHGE  418

Query  277   RGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +   L+ NA +WK+LAKEA  EGGSSDKNI+EFVS++
Sbjct  419   KASELRSNALRWKELAKEANSEGGSSDKNIEEFVSSV  455



>ref|XP_011037069.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Populus euphratica]
Length=461

 Score =   493 bits (1269),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 240/453 (53%), Positives = 330/453 (73%), Gaps = 9/453 (2%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVE  1331
             M +   + HV+VIPYP+ GHI PM+Q SKRLAS+G+ VT++  +S +     S   ++V 
Sbjct  1     MEKQERICHVVVIPYPVQGHINPMIQFSKRLASKGLQVTLVIFSSQTLSTPASLGCVKVV  60

Query  1330  SIPDGVKPDSGFDAISDWLKDL---VSNNLAEIMSKV-TGSGCLLTTVVYDSIMPWVADL  1163
             +I DG   D+G  +I+D LK     V+  L++++ ++   SG  ++ +VYDS MPWV ++
Sbjct  61    TISDG--SDTGSRSIADLLKQFQATVTQKLSQLVVELGISSGHPVSCLVYDSFMPWVLEI  118

Query  1162  VHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN-K  986
                LGL  A+F +QSCAV +VY+   +  L  P E   VS+P +PPL +++LPSFV + +
Sbjct  119   ARHLGLTGASFFTQSCAVNSVYYQIHEGQLKIPLEKLPVSVPGLPPLDVDELPSFVHDME  178

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
             S YSS+L  V+++ LN + ADW+  N+F+ LE+EV+ W+A Q  +K   IGP++PS+YLD
Sbjct  179   SEYSSILTLVVNQFLNFRGADWVFVNSFNPLEEEVVNWLAGQRSIK--PIGPMIPSVYLD  236

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             +++ DD  YGLSLFKP  + CMEWLD++ETGSVVYVSFGSLA L ++QM E+A GL +S 
Sbjct  237   RQLEDDTEYGLSLFKPALDGCMEWLDAKETGSVVYVSFGSLAALGEDQMAEIAWGLWRSG  296

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
             C FLWVVR SE+ KLP NF    S  G+I  W PQL+VLSH++VGCF+THCGWNSTLEAL
Sbjct  297   CYFLWVVRESEEKKLPCNFVEGSSEKGLIVTWSPQLEVLSHKSVGCFMTHCGWNSTLEAL  356

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVM  266
             SLGVP+VA+PQWTDQPTNAKY+ DVW VG+RV A E G+VT+EE+E+C+ EVM+ ERG  
Sbjct  357   SLGVPMVAVPQWTDQPTNAKYIADVWRVGVRVKANEKGIVTKEELEKCIREVMESERGSE  416

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ++ N+ KWK+LAK A+ EGGSS+KNI EF + +
Sbjct  417   MRRNSEKWKKLAKTAMGEGGSSEKNITEFAAKL  449



>emb|CAN67249.1| hypothetical protein VITISV_008684 [Vitis vinifera]
Length=419

 Score =   491 bits (1263),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 236/441 (54%), Positives = 315/441 (71%), Gaps = 34/441 (8%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +HVLVIPYP+ GHI PM+Q SKRLAS+G                                
Sbjct  10    THVLVIPYPVQGHINPMLQFSKRLASKG--------------------------------  37

Query  1309  PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAF  1130
              +   D   +  K +VS++L E++ +  GS   +  +VYDS+M W  D+V +L +  A F
Sbjct  38    EEESLDDYLERFKLIVSSSLVELIGRYNGSEYPVRVLVYDSVMSWAQDIVERLSVDGAPF  97

Query  1129  NSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLS  950
              +QSCAV  +Y+H +Q     P EG TVS+PSMP LG+NDLPSF+ + SSY +L   V +
Sbjct  98    FTQSCAVSTIYYHVNQGAFKIPLEGPTVSIPSMPILGVNDLPSFINDTSSYPTLWSLVKT  157

Query  949   RNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLS  770
             +  N +K +W+ FNTF ELE EV++W+AS+ P+K   IGP +PSMYLD+R+ DD++YGLS
Sbjct  158   QFSNFEKVNWVFFNTFCELEDEVVKWLASKRPIK--TIGPTIPSMYLDRRIDDDEDYGLS  215

Query  769   LFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQ  590
             LFKPN + C+ WLD+++T SVVYVSFGSLA+L +EQM E+A GL +S  +FLWVVR  E+
Sbjct  216   LFKPNADACITWLDTKDTVSVVYVSFGSLASLGEEQMEELAWGLKRSNSQFLWVVRELEK  275

Query  589   SKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQW  410
              KLPSNF  + S  G++ +WCPQL+VL+H+AVGCF+THCGWNSTLEALSLGVP+VAMPQW
Sbjct  276   KKLPSNFVEETSEKGLVVSWCPQLEVLAHKAVGCFMTHCGWNSTLEALSLGVPMVAMPQW  335

Query  409   TDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLA  230
             TDQ TNAK++ DVW VG+RV  GENG+V REE++ C+ EVM+GERG +++ NA +WK+LA
Sbjct  336   TDQTTNAKFIEDVWGVGVRVKVGENGIVKREEIKECIREVMEGERGNVMQRNAQRWKELA  395

Query  229   KEAVDEGGSSDKNIKEFVSAI  167
             KEAV+EGGSSD NI+EFV+ +
Sbjct  396   KEAVNEGGSSDNNIEEFVARL  416



>ref|XP_011037065.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Populus euphratica]
Length=461

 Score =   492 bits (1267),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 241/441 (55%), Positives = 324/441 (73%), Gaps = 9/441 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKP  1307
             HV+VIPYP  GHI PM+Q SK LAS+G+ VT++  +S +     S   ++V +I DG   
Sbjct  9     HVVVIPYPAQGHINPMIQFSKHLASKGLQVTLVIFSSPTHSTPASLGCVKVVTISDG--S  66

Query  1306  DSGFDAISDWLKDL---VSNNLAEIMSKV-TGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
             D+G  +I+D LK     V+  L++++ ++   SG  ++ +VYDS MPWV ++   LGL  
Sbjct  67    DTGSRSIADLLKQFQATVTQKLSQLVVELGISSGHPVSCLVYDSFMPWVLEIARHLGLTG  126

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN-KSSYSSLLR  962
             A+F +QSCAV +VY+   +  L  P E   VS+P +PPL +++LPSFV + +S YS++L 
Sbjct  127   ASFFTQSCAVNSVYYQIHEGQLKIPLEKFPVSVPGLPPLDVDELPSFVHDMESGYSAILT  186

Query  961   FVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDN  782
              V+++ LN + ADW+  N+F+ LE+EV+ W+A Q  +K   IGP++PS+YLD+++ DD  
Sbjct  187   LVVNQFLNFRGADWVFVNSFNTLEEEVVNWLAGQRSIK--PIGPMIPSVYLDRQLEDDTE  244

Query  781   YGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVR  602
             YGLSLFKP  + CMEWLDS+ETGSVVYVSFGSLA L +EQM E+A GL +S C FLWVVR
Sbjct  245   YGLSLFKPALDGCMEWLDSKETGSVVYVSFGSLAALGEEQMAEIAWGLWRSGCYFLWVVR  304

Query  601   SSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVA  422
              SE+ KLP NF    S  G+I  W PQL+VLSH++VGCF+THCGWNSTLEALSLGVP+VA
Sbjct  305   ESEEKKLPCNFMEGSSEKGLIVTWSPQLEVLSHKSVGCFMTHCGWNSTLEALSLGVPMVA  364

Query  421   MPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKW  242
             MPQWTDQPTNAKY+ DVW VG+RV A E G+VT+EE+E+C+ EVM+GERG  ++ N+ KW
Sbjct  365   MPQWTDQPTNAKYIADVWRVGVRVKANEKGIVTKEELEKCIREVMEGERGSEMRRNSEKW  424

Query  241   KQLAKEAVDEGGSSDKNIKEF  179
             K+LAK A+ EGGSS+KNI EF
Sbjct  425   KKLAKTAMGEGGSSEKNITEF  445



>ref|XP_011002911.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Populus 
euphratica]
Length=458

 Score =   488 bits (1257),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 244/451 (54%), Positives = 322/451 (71%), Gaps = 9/451 (2%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACI-QVSSSLIRVESIP  1322
             S+ SHVLV+P PI GHI PM+Q  KRLAS+G+ VT+ITPTS    + Q ++  I +E I 
Sbjct  8     SSASHVLVLPLPIQGHINPMLQFCKRLASKGLKVTLITPTSMGTSMHQDNACSINMEPIF  67

Query  1321  DGVKPDSGFDAISDW---LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
             DG +         ++    KD +  +LAE++ K + S      ++YDSI+PWV D+    
Sbjct  68    DGYREGERAATAKEYVERFKDTIPQSLAELIDKNSTSQYPFKFIIYDSILPWVLDVAKSW  127

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQEN-LTAPTE-GSTVSLPSMPPLGLNDLPSFVRNKSSY  977
             G+    F +QSCAV  +Y+HT Q   L  P E  S+VSLPS+P L  +DLPS V    SY
Sbjct  128   GIEGGPFFTQSCAVTVLYYHTLQGGALKIPMEEKSSVSLPSLPQLEFSDLPSLVHGPGSY  187

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
               +   + S+  N  +A WLL+NTF+ELE E+++WMAS++P+K   IGP +PSM+LDKR+
Sbjct  188   PGIYDLLFSQFSNIDEASWLLWNTFNELEDEIVDWMASKWPIK--PIGPTIPSMFLDKRL  245

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              DD +YGLSLFKPN+  CM+WLDS+E GSVVYVSFGSLA L ++QM E+A GL +S   F
Sbjct  246   EDDKDYGLSLFKPNSETCMKWLDSKEPGSVVYVSFGSLATLTEDQMAELAWGLKRSNTHF  305

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR SE+ KLP NF  + +  G++  W PQL VL+H++VGCF+THCGWNSTLEALSLG
Sbjct  306   LWVVRESEKQKLPGNFVEETTEMGLVITWSPQLKVLAHKSVGCFMTHCGWNSTLEALSLG  365

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM-KGERGVMLK  260
             VP+VAMPQWTDQPTNAK++ DVW VG+RV  GENGMVT+EE+ERC+ EVM +G R   ++
Sbjct  366   VPMVAMPQWTDQPTNAKFVADVWQVGVRVKVGENGMVTQEEIERCIREVMTEGGRRDEIR  425

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              ++ KWK+LA  A+DEGGSSDKNI+EFV+ +
Sbjct  426   THSEKWKKLAVMAMDEGGSSDKNIEEFVANL  456



>ref|XP_011002910.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X1 [Populus 
euphratica]
Length=458

 Score =   488 bits (1256),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 244/451 (54%), Positives = 322/451 (71%), Gaps = 9/451 (2%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACI-QVSSSLIRVESIP  1322
             S+ SHVLV+P PI GHI PM+Q  KRLAS+G+ VT+ITPTS    + Q ++  I +E I 
Sbjct  8     SSASHVLVLPLPIQGHINPMLQFCKRLASKGLKVTLITPTSMGTSMHQDNACSINMEPIF  67

Query  1321  DGVKPDSGFDAISDW---LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
             DG +         ++    KD +  +LAE++ K + S      ++YDSI+PWV D+    
Sbjct  68    DGYREGERAATAEEYVARFKDTIPQSLAELIDKNSTSQYPFKFIIYDSILPWVLDVAKSW  127

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQEN-LTAPTE-GSTVSLPSMPPLGLNDLPSFVRNKSSY  977
             G+    F +QSCAV  +Y+HT Q   L  P E  S+VSLPS+P L  +DLPS V    SY
Sbjct  128   GIEGGPFFTQSCAVTVLYYHTLQGGALKIPMEEKSSVSLPSLPQLEFSDLPSLVHGPGSY  187

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
               +   + S+  N  +A WLL+NTF+ELE E+++WMAS++P+K   IGP +PSM+LDKR+
Sbjct  188   PGIYDLLFSQFSNIDEASWLLWNTFNELEDEIVDWMASKWPIK--PIGPTIPSMFLDKRL  245

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              DD +YGLSLFKPN+  CM+WLDS+E GSVVYVSFGSLA L ++QM E+A GL +S   F
Sbjct  246   EDDKDYGLSLFKPNSETCMKWLDSKEPGSVVYVSFGSLATLTEDQMAELAWGLKRSNTHF  305

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR SE+ KLP NF  + +  G++  W PQL VL+H++VGCF+THCGWNSTLEALSLG
Sbjct  306   LWVVRESEKQKLPGNFVEETTEMGLVITWSPQLKVLAHKSVGCFMTHCGWNSTLEALSLG  365

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM-KGERGVMLK  260
             VP+VAMPQWTDQPTNAK++ DVW VG+RV  GENGMVT+EE+ERC+ EVM +G R   ++
Sbjct  366   VPMVAMPQWTDQPTNAKFVADVWQVGVRVKVGENGMVTQEEIERCIREVMTEGGRRDEIR  425

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              ++ KWK+LA  A+DEGGSSDKNI+EFV+ +
Sbjct  426   THSEKWKKLAVMAMDEGGSSDKNIEEFVANL  456



>ref|XP_006370131.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
 gb|ERP66700.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Populus 
trichocarpa]
Length=471

 Score =   488 bits (1255),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 244/451 (54%), Positives = 324/451 (72%), Gaps = 9/451 (2%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACI-QVSSSLIRVESIP  1322
             S+ SHVLV+P PI GHI PM+Q SKRLAS+G+ VT+ITPTS    + Q ++  I +E I 
Sbjct  8     SSASHVLVLPLPIQGHINPMLQFSKRLASKGLRVTLITPTSMGTSMHQDNACSINMEPIF  67

Query  1321  DGVKPDSGFDAISDWL---KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
             DG K         +++   K  +  +LAE++ K + S      ++YDSI+PWV D+    
Sbjct  68    DGYKEGERAATAEEYIERFKATIPQSLAELIDKNSTSQYPAKFIIYDSILPWVLDVAKSW  127

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQEN-LTAPTE-GSTVSLPSMPPLGLNDLPSFVRNKSSY  977
             G+    F +QSCAV  +Y+HT Q + L  P E  S VSLPS+P L  +DLPS V    SY
Sbjct  128   GIEGGPFFTQSCAVTVLYYHTLQGSALKIPMEEKSPVSLPSLPQLEFSDLPSLVHGPGSY  187

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
               +   + S+  N  +A WLL+NTF+ELE E+++WMAS++P+K   IGP +PSM+LDKR+
Sbjct  188   PGIYDLLFSQFSNIDEASWLLWNTFNELEDEIVDWMASKWPIK--PIGPTIPSMFLDKRL  245

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              DD +YGLSLFKPN+  CM+WLDS+E GSVVYVSFGSLA L ++QM E+A GL +S   F
Sbjct  246   EDDKDYGLSLFKPNSETCMKWLDSKEPGSVVYVSFGSLAVLTEDQMAELAWGLKRSNTHF  305

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR SE+ K+P NF  + +  G+I  W PQL VL+H++VGCF+THCGWNSTLEALSLG
Sbjct  306   LWVVRESEKQKVPGNFVEETTEMGLIITWSPQLKVLAHKSVGCFMTHCGWNSTLEALSLG  365

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEV-MKGERGVMLK  260
             VP+VAMPQWTDQP+NAK++ DVW  G+RV  GENGMVT+EE+ERC+ EV M+GER   ++
Sbjct  366   VPMVAMPQWTDQPSNAKFVADVWQAGVRVKVGENGMVTQEEIERCIREVMMEGERRDEIR  425

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              ++ KWK+LA+ A+DEGGSSDKNI EFV+++
Sbjct  426   THSEKWKKLARMAMDEGGSSDKNIDEFVASL  456



>emb|CDP08068.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   485 bits (1249),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 236/447 (53%), Positives = 317/447 (71%), Gaps = 4/447 (1%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIP  1322
             M+  +HVL +P P  GHI PM+Q  KRLASRG+ VT+ T  S +  +Q     IR+E IP
Sbjct  1     MAGKTHVLALPLPFQGHINPMLQFCKRLASRGIMVTLATVFSANISMQNQFESIRIEFIP  60

Query  1321  D--GVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
             D  G++  +      + +   +S+NL EI+ +    G  +  +++D ++P   + V++LG
Sbjct  61    DTSGIEAATSLADFVNRVTATISDNLPEIVEEKARCGEPVKVIMHDLLLPRALETVYKLG  120

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             +  AAF++QSCAV A+Y+H  +  L  P E   +SLPS+P L  NDLPSFV +  +Y   
Sbjct  121   IPVAAFSTQSCAVCAIYNHVRRGTLKIPLEKPNISLPSLPVLESNDLPSFVYDPCAYPDP  180

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
                +L +    +KADW+ FNTFD LEKEVLEW A+Q+P+K  +IGP +PS+YLDKR++DD
Sbjct  181   SGVLLDQITILEKADWIFFNTFDNLEKEVLEWTANQYPIK--SIGPAIPSVYLDKRLKDD  238

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
              +Y LSLFKP    CMEWLDS+E  SVVYVSFGSL+++ + Q+ E+A GL++S   FLWV
Sbjct  239   TDYSLSLFKPTTKSCMEWLDSKEIDSVVYVSFGSLSDIGENQLAEIAWGLMRSDYNFLWV  298

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             +R+SE+SKLPSNF       G+I NWCPQL+VLSHQAVGCF+THCGWNSTLEALSLGVP+
Sbjct  299   IRASEESKLPSNFQSKARDKGLILNWCPQLEVLSHQAVGCFMTHCGWNSTLEALSLGVPM  358

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             V +P W DQ TN+KY+VDVWD G+RV A ENG V +EEVE  + EVM GE+   L++NA 
Sbjct  359   VTVPVWVDQTTNSKYIVDVWDAGVRVKADENGAVQKEEVEMTIKEVMHGEKANKLRKNAL  418

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +WK+LA EA+ EGGSS +NI+EFVS+I
Sbjct  419   RWKELAIEAMSEGGSSHQNIEEFVSSI  445



>gb|AIE12489.1| UGT9 [Panax ginseng]
Length=439

 Score =   485 bits (1248),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 239/448 (53%), Positives = 322/448 (72%), Gaps = 13/448 (3%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIP  1322
             M + +H+LVIP+PI GHI PM+Q SKR+AS+G  VT++  T+ +  ++     I++ESI 
Sbjct  1     MESKAHILVIPFPIQGHINPMLQFSKRVASKGPQVTLLLTTTINKSMKSEMGSIQIESIS  60

Query  1321  DGVK--PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCL-LTTVVYDSIMPWVADLVHQL  1151
             DG K       DA ++ +  +V   L EI+ K     C+ +  +VYDS+MPWV D+   L
Sbjct  61    DGYKNKKSESMDAFTERINCVVLQTLPEIIKK----QCIPVNLLVYDSMMPWVLDIAKGL  116

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             GL+AAAF +QSC+V A+Y+H  +  L  P EG   SLP+MP LG+N+LP        Y +
Sbjct  117   GLKAAAFFTQSCSVCAIYYHMHKGILKVPLEGKNASLPAMPLLGINELPDM----KLYQN  172

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
             LL   +S+  N + ADWLLFN+FD+LE E+++WMAS++P+K   IGP +PS+YLDKR+ D
Sbjct  173   LLSINISQFSNIEGADWLLFNSFDKLENELVKWMASKWPIK--TIGPTIPSIYLDKRLED  230

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D +YG+SLFKPN++ CM+WLD++   SVVY+SFGSLANL +EQM E+A GL+ S   FLW
Sbjct  231   DKDYGISLFKPNDDVCMKWLDTKPNNSVVYISFGSLANLGEEQMEELAFGLLSSSHYFLW  290

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             VVR SE+ K+P+NF    S  G+I NWCPQL VL+H AVGCF+THCGWNSTLEAL  GV 
Sbjct  291   VVRGSEEGKIPNNFVSKISDKGLIVNWCPQLKVLAHGAVGCFMTHCGWNSTLEALCSGVL  350

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             +VAMPQWTDQPTN+ ++++VW  G+RV   E+G+VTREE+  CL EVM+GE+   L  NA
Sbjct  351   MVAMPQWTDQPTNSMFIMEVWRAGVRVKVNESGVVTREEIGVCLKEVMEGEKRDELIRNA  410

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              KWK+LAKEAVDE GSSDKNI++ +S +
Sbjct  411   VKWKELAKEAVDEDGSSDKNIEDLISRL  438



>emb|CBI24719.3| unnamed protein product [Vitis vinifera]
Length=453

 Score =   485 bits (1248),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 249/447 (56%), Positives = 319/447 (71%), Gaps = 8/447 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS--LIRVESIPDG  1316
             SH+LV P+P  GHI PM+Q SKRLAS G+ VT++T    +  I+ + S   I +E I DG
Sbjct  6     SHILVFPFPTPGHINPMLQFSKRLASMGLRVTLVTTQPNTKPIEEAQSNYPIHIEPISDG  65

Query  1315  VKPDSGFDAISDWL---KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
              +P     ++  +L   + + S +LA+++ K+  S   +  +VYDS+MPW  D   +LGL
Sbjct  66    FQPGEKAQSVEVYLEKFQKVASQSLAQLVEKLARSKRPIKFIVYDSVMPWALDTAQELGL  125

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLL  965
               A F +QSCAV A+Y+H  Q  +  P EG T S PSMP LG+NDLPSF+ +  SY SLL
Sbjct  126   DGAPFYTQSCAVSAIYYHVSQGMMKIPIEGKTASFPSMPLLGINDLPSFISDMDSYPSLL  185

Query  964   RFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDD  785
             R VL R  N +KA  LL NTFD LE EV++WM SQ+P+K I  GP +PSMYLDKR+ DD 
Sbjct  186   RLVLGRFSNFRKAKCLLINTFDMLEAEVVKWMGSQWPVKTI--GPTIPSMYLDKRLEDDK  243

Query  784   NYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVV  605
             +YGLS    N + C+ WLD+++ GSVVYVSFGSLA+L +EQM E+A GL +SK  FLWVV
Sbjct  244   DYGLSPLNLNVDACITWLDARDIGSVVYVSFGSLASLGEEQMEELAWGLKRSKGYFLWVV  303

Query  604   RSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVV  425
             R  E+ KLPSNF  + +  G++ +WCPQLDVL+H+AVGCF+THCGWNSTLEALSLGVP+V
Sbjct  304   RELEEQKLPSNFIENTADKGLVVSWCPQLDVLAHKAVGCFMTHCGWNSTLEALSLGVPMV  363

Query  424   AMPQWTDQPTNAKYLVDVWDVGIRVMAG-ENGMVTREEVERCLVEVMKGERGVMLKENAA  248
              MPQWTDQ TNAK++ DVW VG+RV A  E G+V REE+E C+ E M+GERG  +K NA 
Sbjct  364   VMPQWTDQMTNAKFVADVWGVGVRVKASDEKGIVKREEIEECIREAMEGERGKEMKRNAE  423

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +WK+LAKEA  EGGSSDKNI+EFV  I
Sbjct  424   RWKELAKEAATEGGSSDKNIEEFVKEI  450



>ref|XP_002275387.2| PREDICTED: UDP-glycosyltransferase 74E1-like [Vitis vinifera]
Length=459

 Score =   484 bits (1247),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 238/446 (53%), Positives = 319/446 (72%), Gaps = 6/446 (1%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESIPDGV  1313
             +H++V+P+   GHI PM+Q SKRLAS+G+ VT VI  TS S  +   +S I +E I +  
Sbjct  10    THIMVLPFHAQGHINPMLQFSKRLASKGIKVTLVIAATSNSQSMHAQTSSINIEIISEEF  69

Query  1312  KPDSGFDAISDWLKD---LVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLR  1142
                   ++I D+L+    L S  L  +M K   S      ++YDS++PW  DL   LGL 
Sbjct  70    DRRQQEESIEDYLERFRILASQGLTALMEKHNRSNHPAKLLIYDSVLPWAQDLAEHLGLD  129

Query  1141  AAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSY-SSLL  965
                F +QSCAV A+Y+H  Q     P E STVS+PSMP L ++DLPSF+  KS   S+LL
Sbjct  130   GVPFFTQSCAVSAIYYHFYQGVFNTPLEESTVSMPSMPLLRVDDLPSFINVKSPVDSALL  189

Query  964   RFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDD  785
               VLS+  N +K  W+L NTFD+LE +V++WM SQ PL +  IGP +PSMYLDKR+ DD 
Sbjct  190   NLVLSQFSNFKKGKWILCNTFDKLEDQVMKWMTSQRPL-IKTIGPTVPSMYLDKRLEDDK  248

Query  784   NYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVV  605
             +YGLSLF+ N + C+ WLD++  GSVVYVSFGSLA+L +EQM E+A GL +S   F+WVV
Sbjct  249   DYGLSLFQQNVDTCITWLDTKGIGSVVYVSFGSLASLGEEQMEELAWGLKRSNSHFMWVV  308

Query  604   RSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVV  425
             R  E+ KLP+NF  + S  G++ +WC QL+VL+H+AVGCF+THCGWNSTLEALSLGVP++
Sbjct  309   RELEKKKLPNNFIEETSEKGLVVSWCCQLEVLAHKAVGCFMTHCGWNSTLEALSLGVPMI  368

Query  424   AMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAK  245
             AMP+++DQ TNAK++ D+W VG+RV A E G+V REE+E CL E+M+GERG  +K NAA+
Sbjct  369   AMPRFSDQTTNAKFVEDIWQVGVRVKADEKGIVKREEIEMCLSEIMEGERGYEMKRNAAR  428

Query  244   WKQLAKEAVDEGGSSDKNIKEFVSAI  167
             WK+LAKEAV+EGGSSDKN++EFV+ +
Sbjct  429   WKELAKEAVNEGGSSDKNLEEFVAEL  454



>ref|XP_009366994.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
 ref|XP_009366995.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
 ref|XP_009366996.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
 ref|XP_009366997.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Pyrus x bretschneideri]
Length=463

 Score =   483 bits (1244),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 232/444 (52%), Positives = 312/444 (70%), Gaps = 6/444 (1%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESI-PDGVK  1310
             H+LV+P P+ GHI PM+Q SKRLAS+G+ VT++T +S +  I+     +++E I     +
Sbjct  12    HILVVPLPVQGHINPMLQFSKRLASKGLRVTLVTISSNAEAIETQLCKVKIEPIHATSEE  71

Query  1309  PDSGFDAISD---WLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
              +   + + +   W + ++S  L +++ K    G  +  +VYDS MPWV D    LG+  
Sbjct  72    EEEAGNNVENKVLWFQTILSRRLPQLILKQENDGYPVICLVYDSAMPWVLDTAKGLGIFG  131

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             A+F + SCAV AVY++  +  L  P +  T+SLP +P L   DLPSF+ +  SY S L  
Sbjct  132   ASFFTHSCAVGAVYYNVHEGLLRVPLKEPTISLPGLPLLEPQDLPSFIYDPGSYPSFLNL  191

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNY  779
             V+SR  N   ADW+ FNTF  LEKEV+ WM +Q+P+K   IGP LPSMYLDKR+ DD  Y
Sbjct  192   VVSRFSNITGADWIFFNTFHGLEKEVVNWMRTQWPIK--TIGPTLPSMYLDKRLEDDKEY  249

Query  778   GLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRS  599
             GLS+F PN   C +WL+S+ETG+VVYVSFGS+ANL ++QM E+A GL +S   FLWVVR 
Sbjct  250   GLSVFNPNTEACNKWLESKETGTVVYVSFGSMANLGEKQMEEIALGLKRSNANFLWVVRE  309

Query  598   SEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAM  419
             SE  KLPSNF    S  G++ NWCPQL+VL H+A+GCF+THCGWNSTLEALS GVP+VAM
Sbjct  310   SETQKLPSNFEEQTSEKGLVVNWCPQLEVLGHRALGCFMTHCGWNSTLEALSCGVPMVAM  369

Query  418   PQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWK  239
             PQWTDQ TNAK++ D W VG+RV   + G+VT+EE+ERC+ EV++GERG  +K N+  W+
Sbjct  370   PQWTDQTTNAKFVEDEWKVGVRVKVDQMGIVTKEEIERCIAEVIEGERGKEIKRNSMIWR  429

Query  238   QLAKEAVDEGGSSDKNIKEFVSAI  167
             +LAK A+DEGGSSDKNI+EFV+ +
Sbjct  430   ELAKAAMDEGGSSDKNIEEFVATL  453



>ref|XP_002529825.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32574.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=467

 Score =   483 bits (1243),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 237/458 (52%), Positives = 320/458 (70%), Gaps = 7/458 (2%)
 Frame = -3

Query  1525  VERPEMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQV-SS  1349
             +E+ E    +  SHVLV P+PI GHI PM QLSK LAS+G+ VT+I  +S +  ++   +
Sbjct  1     MEKEEQTRETPQSHVLVFPFPIQGHINPMFQLSKHLASKGLKVTLIATSSIARTMRAPQA  60

Query  1348  SLIRVESIPDGVKPDSGFDAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMP  1178
             S + +E+I DG K        S+++K     V  +LAE++ K  GS   +  V+YDS+ P
Sbjct  61    SSVHIETIFDGFKEGEKASNPSEFIKTYDRTVPKSLAELIEKHAGSPHPVKCVIYDSVTP  120

Query  1177  WVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSF  998
             W+ D+    G+  A+F +QSCA   +Y+H  Q  L  P E   VSLP+ P L  NDLPSF
Sbjct  121   WIFDVARSSGVYGASFFTQSCAATGLYYHKIQGALKVPLEEPAVSLPAYPELEANDLPSF  180

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
             V    SY ++     S+  N  + DWLL+NTF ELE E++ WMAS++   ++ IGP +PS
Sbjct  181   VNGPGSYQAVYDMAFSQLSNVDEVDWLLWNTFTELEDEIVNWMASKW--TIMPIGPAIPS  238

Query  817   MYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGL  638
             M+LD R+ DD +YG++LFKPN++ CM+WLDS+E  SV+YVSFGSLA L ++QM E+A GL
Sbjct  239   MFLDNRLEDDKDYGVNLFKPNSDACMKWLDSKEPSSVIYVSFGSLAALGEDQMAELAWGL  298

Query  637   IQSKCKFLWVVRSSEQSKLPSNFWPDKSGA-GIITNWCPQLDVLSHQAVGCFITHCGWNS  461
              +S   FLWVVR  EQ KLP NF  + S   G++  W PQL VL+H++VGCF+THCGWNS
Sbjct  299   KRSNNNFLWVVRELEQKKLPPNFVEEVSEENGLVVTWSPQLQVLAHKSVGCFMTHCGWNS  358

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             TLEALSLGVP+VAMPQWTDQPTNAK++ DVW VG+RV   +NG+VTREE+E+C+ EVM+G
Sbjct  359   TLEALSLGVPMVAMPQWTDQPTNAKFVTDVWRVGVRVKVDQNGIVTREEIEKCIREVMEG  418

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             E G  ++ N+ KWK+LA+ AVD+GGSSDKNI+EFVS +
Sbjct  419   ETGKEMRRNSEKWKELARIAVDKGGSSDKNIEEFVSKL  456



>ref|XP_008338819.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Malus domestica]
 ref|XP_008338820.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Malus domestica]
Length=456

 Score =   481 bits (1238),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 229/444 (52%), Positives = 311/444 (70%), Gaps = 6/444 (1%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESI-PDGVK  1310
             H+LV+P P+ GHI PM+Q SKRLAS+G+ VT++T +S +  I+     +++E I     +
Sbjct  12    HILVVPLPVQGHINPMLQFSKRLASKGLRVTLVTISSNTEAIETQLCKVKIEPIHATSEE  71

Query  1309  PDSGFDAISD---WLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
              +   + + +   W + ++S  L +++ K    G  +  +VYDS MPWV D    LG+  
Sbjct  72    EEEAGNNVENKVLWFQTILSRRLPQLILKQENDGYPIICLVYDSAMPWVLDTAKGLGIFG  131

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             A+F + SCAV AVY++  +  L  P +  T+SLP +P L   DLPSF+ +  SY S L  
Sbjct  132   ASFFTHSCAVGAVYYNVHEGLLRVPLKEPTISLPGLPLLEPQDLPSFIYDPGSYPSFLNL  191

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNY  779
             V+SR  N   ADW+ FNTF  LEKEV+ WM +++P+K   IGP LPSMYLDKR+ DD +Y
Sbjct  192   VVSRFSNISGADWIFFNTFHGLEKEVVNWMRTRWPIK--TIGPTLPSMYLDKRLEDDKDY  249

Query  778   GLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRS  599
             G S+F  N   C +WL+S+ETG+VVYVSFGS+ANL ++QM E+A GL  S   FLWVVR 
Sbjct  250   GFSIFNSNTEACKKWLESKETGTVVYVSFGSMANLGEKQMEEIALGLKGSNANFLWVVRE  309

Query  598   SEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAM  419
             SE  KLPSNF    S  G++ NWCPQL+VL H+A+GCF+THCGWNSTLEALS GVP+VAM
Sbjct  310   SETQKLPSNFEEQTSEKGLVVNWCPQLEVLGHRALGCFMTHCGWNSTLEALSSGVPMVAM  369

Query  418   PQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWK  239
             PQWTDQ TNAK++ D W VG+RV   + G+VT+EE+ERC+ EV++GERG  +K N  +W+
Sbjct  370   PQWTDQTTNAKFVEDEWKVGVRVKVDQMGIVTKEEIERCIAEVIEGERGKEIKRNLMRWR  429

Query  238   QLAKEAVDEGGSSDKNIKEFVSAI  167
             +LAKEA+DEGGSSDKNI+EF++ +
Sbjct  430   ELAKEAMDEGGSSDKNIEEFIATL  453



>ref|XP_006388126.1| hypothetical protein POPTR_0322s00200g [Populus trichocarpa]
 gb|ERP47040.1| hypothetical protein POPTR_0322s00200g [Populus trichocarpa]
Length=461

 Score =   481 bits (1237),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 242/453 (53%), Positives = 327/453 (72%), Gaps = 9/453 (2%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVE  1331
             M +   + HV+VIPYP  GHI PM+Q SKRLAS+G+ VT++  +S +  +   +SL  V+
Sbjct  1     MEKQERICHVVVIPYPAQGHINPMIQFSKRLASKGLQVTLVIFSSQT--LSTPASLGSVK  58

Query  1330  SIPDGVKPDSGFDAISDWLKDL---VSNNLAEIMSKV-TGSGCLLTTVVYDSIMPWVADL  1163
              +      D+G  +I D LK     V+  L +++ ++   SG  ++ +VYDS MPWV ++
Sbjct  59    VVTVSDSSDTGSSSIGDLLKQFQATVAPKLPQLVVELGISSGHPVSCLVYDSFMPWVLEI  118

Query  1162  VHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN-K  986
               QLGL  A+F +QSCAV +VY+   +  L  P E   VS+P +PPL +++LPSFV + +
Sbjct  119   ARQLGLIGASFFTQSCAVSSVYYQIHEGQLKIPLEKFPVSVPGLPPLDVDELPSFVHDME  178

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
             S YSS+L  V+++ LN + ADW+  N+F+ LE+EV+  +ASQ  +K   IGP++PS+YLD
Sbjct  179   SEYSSILTLVVNQFLNFRGADWVFVNSFNTLEEEVVNGLASQRSIK--PIGPMIPSVYLD  236

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             +++ DD  YGLSLFKP  + CMEWLDS+ETGSVVYVSFG+LA L +EQM E+A GL +S 
Sbjct  237   RQLEDDTEYGLSLFKPALDGCMEWLDSKETGSVVYVSFGTLAALGEEQMAEIAWGLRRSD  296

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
             C FLWVVR SE+ KLP NF    S  G+I  W PQL+VL+H++VGCF+THCGWNSTLEAL
Sbjct  297   CYFLWVVRESEEKKLPCNFVEGSSEKGLIVTWSPQLEVLAHKSVGCFMTHCGWNSTLEAL  356

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVM  266
             SLGVP+VA+PQWTDQPTNAKY+ DVW VG+RV A E G+VT+EE+E+C  EVM+GERG  
Sbjct  357   SLGVPMVAVPQWTDQPTNAKYIADVWRVGVRVKANEKGIVTKEELEKCTREVMEGERGSE  416

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ++ N+ KWK+LAK A+ EGGSSDKNI EF + I
Sbjct  417   MRRNSEKWKKLAKTAMGEGGSSDKNITEFAAKI  449



>ref|XP_002309739.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE90189.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=457

 Score =   480 bits (1235),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 242/448 (54%), Positives = 318/448 (71%), Gaps = 10/448 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             SHVLVIPYP  GHI PM+Q SKRLAS+G+ VT +  +S +         + V +I D   
Sbjct  4     SHVLVIPYPAQGHINPMIQFSKRLASKGLQVTAVIFSSQALLEHTQLGSVGVVTI-DCQS  62

Query  1309  PDSGFDAISDWLKDL---VSNNLAEIMSKV-TGSGCLLTTVVYDSIMPWVADLVHQLGLR  1142
              +    +I D+LK     V+  L E+++++   SG  +  +VYDS+MPWV +   QLGL 
Sbjct  63    HEEAKISIDDYLKQFQATVTLKLRELVAELKNSSGYPICCLVYDSLMPWVLETARQLGLS  122

Query  1141  AAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR---NKSSYSS  971
             AA+F +QSCAV  VY+H  +  L  P E   ++    P L + DLPSFV+   +KS YSS
Sbjct  123   AASFFTQSCAVDTVYYHIHEGQLKIPLEKLPLTFSRPPALEITDLPSFVQGLESKSEYSS  182

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
             LL  V+S+  N ++ADW+  NTF+ LE+E + W+ASQ  +K   IGP +PS+YLD+++ D
Sbjct  183   LLNLVVSQFSNFREADWIFVNTFNTLEEEAVNWLASQRSIK--PIGPTIPSVYLDRQLED  240

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D  YGLSLFKPN   C EWLDS+ETGSVVYVS+GS+A L +EQM E+A GL +S C FLW
Sbjct  241   DREYGLSLFKPNLYGCKEWLDSKETGSVVYVSYGSMAALGEEQMAEIAWGLKRSGCYFLW  300

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             VVR SE+ KLPSNF  + S  G+I  W  QL+VL+H++VGCF+THCGWNSTLEALSLGVP
Sbjct  301   VVRESEKKKLPSNFAEESSEKGLIVTWSQQLEVLAHKSVGCFMTHCGWNSTLEALSLGVP  360

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             +VAMPQWTDQPTNAKY+ DVW VG+RV   +  +VT+EEVERC+ EVM+ ER  ++++N+
Sbjct  361   MVAMPQWTDQPTNAKYIADVWHVGVRVEVNQKRIVTKEEVERCIREVMESERSNVIRKNS  420

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              KWK+L K AVDEGGSSDKNI+EFV+ +
Sbjct  421   DKWKKLVKMAVDEGGSSDKNIEEFVTEV  448



>ref|XP_006372897.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|ERP50694.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=461

 Score =   476 bits (1226),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 241/453 (53%), Positives = 325/453 (72%), Gaps = 9/453 (2%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVE  1331
             M +   + HV VIPYP  GHI PM+Q SK+LAS+G+ VT++  +S +  +   +SL  V+
Sbjct  1     MEKQERICHVAVIPYPAQGHINPMIQFSKQLASKGLQVTLVIFSSQT--LSTPASLGSVK  58

Query  1330  SIPDGVKPDSGFDAISDWLKDL---VSNNLAEIMSKV-TGSGCLLTTVVYDSIMPWVADL  1163
              +      D+G  +I D LK     V+  L +++ ++   SG  ++ +VYDS MPWV ++
Sbjct  59    VVTVSDSSDTGSSSIGDLLKQFQATVAPKLPQLVVELGISSGHPVSCLVYDSFMPWVLEI  118

Query  1162  VHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN-K  986
               QLGL  A+F +QSCAV +VY+   +  L  P E   VS+P +PPL +++LPSFV + +
Sbjct  119   ARQLGLIGASFFTQSCAVSSVYYQIHEGQLKIPLEKFPVSVPGLPPLDVDELPSFVHDME  178

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
             S YSS+L  V+++ LN + ADW+  N+F+ LE+EV+  +ASQ  +K   IGP++PS+YLD
Sbjct  179   SEYSSILTVVVNQFLNFRGADWVFVNSFNTLEEEVVNCLASQRSIK--PIGPMIPSVYLD  236

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             +++ DD  YGLSLFKP  + CMEWLDS+ETGSVVY SFGSLA L +EQM E+A GL +S 
Sbjct  237   RQLEDDTEYGLSLFKPALDGCMEWLDSKETGSVVYASFGSLAALGEEQMAEIAWGLRRSD  296

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
             C FLWVVR SE+ KLP NF    S  G+I  W PQL+VLSH++VGCF+THCGWNSTLEAL
Sbjct  297   CYFLWVVRESEEKKLPCNFVEGSSEKGLIVTWSPQLEVLSHKSVGCFMTHCGWNSTLEAL  356

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVM  266
             SLGVP+VA+PQWTDQPTNAKY+ DVW VG+RV A E G+V++EE+E+C  EVM+GERG  
Sbjct  357   SLGVPMVAVPQWTDQPTNAKYIADVWRVGVRVKANEKGIVSKEELEKCTREVMEGERGSE  416

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ++ N+ KWK+LAK A+ EGGSSDKNI EF + I
Sbjct  417   MRRNSEKWKKLAKTAMGEGGSSDKNITEFAAKI  449



>ref|XP_007033374.1| Uridine diphosphate glycosyltransferase 74E2, putative isoform 
1 [Theobroma cacao]
 gb|EOY04300.1| Uridine diphosphate glycosyltransferase 74E2, putative isoform 
1 [Theobroma cacao]
Length=645

 Score =   483 bits (1242),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 239/435 (55%), Positives = 319/435 (73%), Gaps = 9/435 (2%)
 Frame = -3

Query  1462  IHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL-IRVESIPDGVKPDSGFDAI  1286
             + GHI PM+Q +KRLAS+G+ VT +T   T      S+S+ I++   P+G + + G +  
Sbjct  214   MQGHINPMLQFAKRLASKGLKVTFLT---TKPMQSPSTSISIQIIEFPEGEQAN-GTEEF  269

Query  1285  SDWLKDLVSNNLAEIMSKVTGSGC-LLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAV  1109
             +   K LVS  L  ++ ++  S       +VYDS +PW  D+  Q GL  A+F +QS + 
Sbjct  270   AHLFKTLVSERLTNLIDRLNSSSSDPPKALVYDSFLPWALDVAKQCGLHGASFFTQSWSN  329

Query  1108  FAVYHHTDQENLTAP-TEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQ  932
              ++Y+H +Q  L  P  E + VSLPSMP LG+NDLPSFV +  SY SLL+ V+ R  N Q
Sbjct  330   SSIYYHLNQGTLKVPLEENAVVSLPSMPVLGINDLPSFVSDTGSYPSLLKMVVDRFSNFQ  389

Query  931   KADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNN  752
             +ADWL  NTF ELE EV+  MAS++P+K +  GP +PSMYLDKR++DD++YGL LFKP++
Sbjct  390   EADWLFCNTFKELEHEVINCMASKWPIKTV--GPTIPSMYLDKRIKDDNDYGLHLFKPDS  447

Query  751   NDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSN  572
               C++WLDS+ET SVVYVSFGSLA L +EQM E++ GL +S   FLWVVR +EQSK+PSN
Sbjct  448   ELCIKWLDSKETDSVVYVSFGSLAGLTEEQMLELSLGLKRSNRYFLWVVREAEQSKIPSN  507

Query  571   FWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTN  392
             F  + S  G++ +WCPQLDVL+H+AVGCF+THCGWNSTLEALSLGVP++AMPQWTDQPTN
Sbjct  508   FIEETSEKGLVVSWCPQLDVLAHRAVGCFMTHCGWNSTLEALSLGVPMIAMPQWTDQPTN  567

Query  391   AKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDE  212
             AK++ DVW  GIRV   E G+VT+EEVE C+ E+M+GER + +++N+ KWK LAKEAVDE
Sbjct  568   AKFVADVWQGGIRVSKDEKGVVTKEEVEWCIREIMEGERSLEIRKNSEKWKNLAKEAVDE  627

Query  211   GGSSDKNIKEFVSAI  167
             GGSSDKNI+EFV+ +
Sbjct  628   GGSSDKNIEEFVAKL  642


 Score =   156 bits (395),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 128/208 (62%), Gaps = 7/208 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIP--DG  1316
             +HVLV+P+PI GHI PM+Q SKRLAS+ + VT+IT   TS  +Q S+S +  ESI   +G
Sbjct  12    THVLVLPFPIQGHINPMLQFSKRLASKSLRVTLIT---TSKSMQPSASSVNFESIEFEEG  68

Query  1315  VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAA  1136
              + +S  D +  + K L+   LA+ +   T S      +VYDS MPW   +    G++ A
Sbjct  69    ERTNSVDDYLELYEK-LIPKRLAKFIENQTCSQHPAKVLVYDSCMPWALAVAKNFGVQGA  127

Query  1135  AFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFV-RNKSSYSSLLRF  959
             +F +QS AV A+++H  Q     P E   VSLPSMP L L+DLPSFV  N  SY  L + 
Sbjct  128   SFFTQSWAVNAIFYHLKQGTFRVPPEEPVVSLPSMPELRLSDLPSFVCDNSGSYPGLCKL  187

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLE  875
             V ++  N ++A+W+  NT+DELE EV++
Sbjct  188   VKNQFSNFEEANWVFCNTYDELEDEVMQ  215



>emb|CDP08069.1| unnamed protein product [Coffea canephora]
Length=435

 Score =   474 bits (1221),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 232/434 (53%), Positives = 314/434 (72%), Gaps = 11/434 (3%)
 Frame = -3

Query  1441  MVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDG----VKPDSGFDAISDWL  1274
             M+QL KRL S+GV +T++T TS S   Q     I++E I D     V+  +  + ++ +L
Sbjct  1     MLQLCKRLTSKGVRITLVTGTSASISEQNQFESIKIEYILDDDNIEVEGSNASEKVAAFL  60

Query  1273  KDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH-QLGLRAAAFNSQSCAVF  1106
             K     VS+NLA ++ +   S   +  V+YDS+MPW+ ++V  QLGL+ AAF +Q+CAV 
Sbjct  61    KRFNSAVSDNLARLVEEKASSDHPVKIVLYDSLMPWILEIVQGQLGLKGAAFFTQACAVS  120

Query  1105  AVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQKA  926
             A+Y+H  +  L  P E ST+ LPSMP L  NDLPSFV N   Y  +L  VLS N+N +K+
Sbjct  121   AIYNHIRRGTLKVPLETSTILLPSMPQLESNDLPSFVYNPGPYPGILDLVLSENINLEKS  180

Query  925   DWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNNND  746
             DWLLFN+FD+LE EV+ W+  ++P+K   IGP  PSMY DKR++DD +Y ++ F P++  
Sbjct  181   DWLLFNSFDKLENEVVTWLTERYPIK--TIGPCTPSMYTDKRLKDDKDYTINFFAPDSEA  238

Query  745   CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSNFW  566
             C++WLD++ETGSVVYVSFGS+++L + QM E+A GL+ S C FLWVVR SE+SK+P +F 
Sbjct  239   CLKWLDTKETGSVVYVSFGSVSDLGENQMQEIACGLMNSNCNFLWVVRPSEESKIPRDFM  298

Query  565   PDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTNAK  386
              +    G+I NWCPQ+ VLSH+AVGCF++HCGWNST+EALSLGVP+V MP W DQPTN+K
Sbjct  299   SEAQERGLIVNWCPQIKVLSHRAVGCFMSHCGWNSTIEALSLGVPMVTMPVWVDQPTNSK  358

Query  385   YLVDVWDVGIRVMAGENG-MVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDEG  209
             Y+VDVW VG+RV A E G MVTREEVE  + EVM GE+   L+ NA +WK+LAKEA+ EG
Sbjct  359   YIVDVWKVGLRVKASEEGEMVTREEVEGTIREVMHGEKASELRNNALRWKELAKEAISEG  418

Query  208   GSSDKNIKEFVSAI  167
             GSSDK+I+EFVS++
Sbjct  419   GSSDKHIEEFVSSL  432



>ref|XP_009603219.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana tomentosiformis]
Length=449

 Score =   474 bits (1219),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 239/447 (53%), Positives = 312/447 (70%), Gaps = 12/447 (3%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTST-SACIQVSSSLIRVESIP  1322
             S  +HVLV+P P  GHI P+VQ SK LAS+GV VT++T      A +     LI +ESIP
Sbjct  6     SQKTHVLVLPSPAQGHINPIVQFSKILASKGVKVTILTIDFVCKAMLLDCGPLINIESIP  65

Query  1321  DGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLR  1142
                 P  G D   +W + L+    + I+ K   S   +  +V DS++ W+ DL H+LGL+
Sbjct  66    HEAIPVEGVDDFLEWFQTLMLEKFSGIVEKFGDSEYPVKVLVIDSLITWIIDLAHELGLK  125

Query  1141  AAAFNSQSCAVFAVYHHTDQENLT--APTEGST-VSLPSMPPLGLNDLPSFVRNKSSYSS  971
              AAF++Q  A+ A+Y+H + E+ T   P +GS  VSLPS+P L   DLPSF+    +Y +
Sbjct  126   VAAFHTQPVALSALYYHINHEDSTNKIPFDGSAPVSLPSLPLLEKEDLPSFICETDAYPT  185

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
             + R V  +N N +KADWLLFNTFD LE+EV+ W+ +Q+ +K   IGP++  MY DK    
Sbjct  186   VKRLVFGQNFNFKKADWLLFNTFDMLEEEVVNWLRNQYSIK--TIGPVVLPMYFDKE---  240

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
                Y  SL KP+   C +WLDS+E GSVVYVSFGSLA+L ++QM E+A G + S   FLW
Sbjct  241   ---YDSSLIKPHYETCKKWLDSREIGSVVYVSFGSLASLGEKQMEELASGFMMSNSYFLW  297

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             VVR +E++KLP++F    S  G+I NW PQLDVL+H++VGCF THCGWNSTLEALSLGVP
Sbjct  298   VVRDTEENKLPNDFMSKASEKGLIVNWSPQLDVLAHKSVGCFFTHCGWNSTLEALSLGVP  357

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             +V MPQW DQPTNAKY+ DVW VGIRV AG++G++TREEV   + EVM+ ++GVMLKENA
Sbjct  358   MVCMPQWADQPTNAKYITDVWQVGIRVKAGKDGVITREEVASSIKEVMEEKKGVMLKENA  417

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVSA  170
              KWKQLAKEAVD+GGSSDKNI+EF+ A
Sbjct  418   IKWKQLAKEAVDKGGSSDKNIEEFIQA  444



>ref|XP_011002951.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74E2-like 
[Populus euphratica]
Length=493

 Score =   474 bits (1219),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 240/453 (53%), Positives = 317/453 (70%), Gaps = 11/453 (2%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACI-QVSSSLIRVESIP  1322
             S+ SHVLV+P PI GHI PM+Q  KRLAS+G+ VT+ITPTS    + Q ++  I +E I 
Sbjct  8     SSASHVLVLPLPIQGHINPMLQFCKRLASKGLKVTLITPTSMGTSMHQDNACSINMEPIF  67

Query  1321  DGVKPDSGFDAISDW---LKDLVS--NNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             DG +         ++    KD ++   +LAE++ K + S      ++YDSI+PWV D+  
Sbjct  68    DGYREGERAATAKEYVERFKDTIARPQSLAELIDKNSTSQYPFKFIIYDSILPWVLDVAK  127

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQEN-LTAPTE-GSTVSLPSMPPLGLNDLPSFVRNKS  983
               G+    F +QSCAV  +Y+HT Q   L  P E  S+VSLPS+P L  +DLPS V    
Sbjct  128   SWGIEGGPFFTQSCAVTVLYYHTLQGGALKIPMEEKSSVSLPSLPQLEFSDLPSLVHGPG  187

Query  982   SYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDK  803
             SY  +   + S+  N  +A WLL NTF+ELE E+++WMAS++P+K    GP +PSM+LDK
Sbjct  188   SYPGVYDLLFSQFSNIDEASWLLGNTFNELEDEIVDWMASKWPIK--PTGPTIPSMFLDK  245

Query  802   RVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKC  623
             R+ DD +YGLSLFKPN+  CM+WLDS+E GSVVYVSFG  A L ++QM E+A GL +S  
Sbjct  246   RLEDDKDYGLSLFKPNSETCMKWLDSKEPGSVVYVSFGGFAALTEDQMAELAWGLKRSNT  305

Query  622   KFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALS  443
              FLWVVR SE+ KLP NF  + +  G++  W PQ  VL+H++VGCF+THCGWNSTLEA+S
Sbjct  306   HFLWVVRESEKQKLPGNFVEETTEMGLVITWSPQPKVLAHKSVGCFMTHCGWNSTLEAVS  365

Query  442   LGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM-KGERGVM  266
             LGVPVVAMPQWTDQPTNAK++ DVW VG+RV  GENGMVT+EE+ERC+ EVM +G R   
Sbjct  366   LGVPVVAMPQWTDQPTNAKFVADVWQVGVRVKVGENGMVTQEEIERCIREVMTEGGRRDE  425

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ++ ++ KWK+LA  A+DEGGSSDKNI EFV+ +
Sbjct  426   IRTHSEKWKKLAVMAMDEGGSSDKNIDEFVANL  458



>ref|XP_010242476.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nelumbo nucifera]
Length=458

 Score =   472 bits (1215),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 232/447 (52%), Positives = 311/447 (70%), Gaps = 9/447 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKP  1307
             HVLV+PYP  GHI P++Q++KRLA +G+  T++T  S+   +   S  + V++I DG   
Sbjct  11    HVLVLPYPTQGHINPLLQVAKRLAFKGLKTTLVTTLSSWRSMYTESISVDVQTISDGYD-  69

Query  1306  DSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
             D GF      +A  +  K++ S  LAE++ K   SG  +  +VYDS +PW  D+    GL
Sbjct  70    DGGFLKAESIEAYLNRFKEVGSQTLAELIKKQKSSGHPVDCLVYDSFLPWALDVAKSFGL  129

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAP-TEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
               A F +QSCAV  +Y+H  Q  LT P TE +  SLP +PPL + D+PSF+    SY S 
Sbjct  130   VGAPFFTQSCAVENIYYHVHQGLLTVPMTETTAASLPGLPPLDIMDMPSFISVSGSYPSY  189

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
                V+++  N +  DW+L NTF ELE E ++WM  ++PL +  IGP +PSMY+DKRV  D
Sbjct  190   FAMVVNQFSNLETTDWILVNTFQELEVEEVDWMTRRWPL-LRTIGPTIPSMYMDKRVTYD  248

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
              +YGL+LFK + + C+ WL+ +  GSVVYVSFGSLA L+ EQM E+  GL ++   FLWV
Sbjct  249   MDYGLNLFKSDGSACLNWLNKRAAGSVVYVSFGSLAALEVEQMEELGWGLRRTNSHFLWV  308

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             VRSSE  KLP+ F  + S  G+I  W PQL+VL+HQAVGCF+THCGWNSTLEA+SLGVP+
Sbjct  309   VRSSEVDKLPNKFIEETSDKGLIVAWSPQLEVLAHQAVGCFVTHCGWNSTLEAVSLGVPM  368

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             V +PQWTDQPTNAKY+ DVW+VG+R   GE G+V REEVERC+ E+M+GERG  +++NA 
Sbjct  369   VGIPQWTDQPTNAKYVEDVWEVGLRARPGEKGIVCREEVERCVREIMEGERGEQIRKNAI  428

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             KW+ LAKEA+DEGGSSDKN+ EFV+ +
Sbjct  429   KWRNLAKEAMDEGGSSDKNLDEFVAKL  455



>ref|XP_007222137.1| hypothetical protein PRUPE_ppa005722mg [Prunus persica]
 gb|EMJ23336.1| hypothetical protein PRUPE_ppa005722mg [Prunus persica]
Length=447

 Score =   471 bits (1213),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 232/444 (52%), Positives = 320/444 (72%), Gaps = 6/444 (1%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSAC--IQVSSSLIRVESIPDGV  1313
             H+LV+P P+ GHI PM Q SKRLAS+G+ VT++T +S +    I+   SL+++ESI    
Sbjct  3     HILVVPLPLQGHINPMFQFSKRLASKGLRVTLVTISSDTHHEPIETQLSLVKIESIYAAS  62

Query  1312  KPDSGFDAIS--DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
             +     +A +   WL++++S  L E++SK    G  ++ ++YDS M W  D+   LG+  
Sbjct  63    EEADKINAENKMQWLQNILSKRLPELISKQESIGYPISCIIYDSAMTWALDMAKGLGIAG  122

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             A+F + SCAV  VY +  Q  L+ P +   + LP +P L  +DLPSF+ +  SY S L+ 
Sbjct  123   ASFFTHSCAVGTVYCNVHQGVLSVPLKEGPILLPGLPLLEPHDLPSFIYDPGSYPSFLKL  182

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNY  779
             V+ R  N   ADW+ +N+FD LE+EV+ WM ++ P+K   IGP LPSMYLDKR+ DD +Y
Sbjct  183   VVGRFSNITDADWIFWNSFDCLEQEVVSWMRTRLPIK--TIGPTLPSMYLDKRLEDDRDY  240

Query  778   GLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRS  599
             G +LF PN + C++WL+S++TG+VVYVSFGS+ANL+++QM E+A GL +SK  FLWVVR 
Sbjct  241   GFNLFTPNIDTCIKWLESKDTGTVVYVSFGSMANLEEKQMQELALGLKRSKTNFLWVVRE  300

Query  598   SEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAM  419
             SE  KLPSNF    S  G++ NWCPQL VL+H+AVGCF+THCGWNSTLEALS GVP+VAM
Sbjct  301   SEIQKLPSNFEEQTSEKGLVVNWCPQLQVLAHKAVGCFMTHCGWNSTLEALSSGVPMVAM  360

Query  418   PQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWK  239
             PQWTDQ TNAK++ D W VG+RV   + G+VT+EE+ERC+ +VM+GERG  +K N+ +W+
Sbjct  361   PQWTDQLTNAKFVEDEWKVGVRVKVDQMGIVTKEEIERCIAQVMEGERGNEIKRNSMRWR  420

Query  238   QLAKEAVDEGGSSDKNIKEFVSAI  167
             +LAKEAV EGGSSDKNI+EFV+A+
Sbjct  421   ELAKEAVAEGGSSDKNIEEFVAAL  444



>ref|XP_011082054.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Sesamum indicum]
Length=473

 Score =   471 bits (1212),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 226/444 (51%), Positives = 312/444 (70%), Gaps = 5/444 (1%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDG--  1316
             +H L++PYPI GHI PM+Q +KRL  +G+ +T++   +       SSS I +E+I DG  
Sbjct  12    AHCLILPYPIQGHINPMLQFAKRLLQKGIEITLVVTQTLVTSTLFSSSTIPLETISDGWA  71

Query  1315  -VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
              + P +G+D      K+  S  L E + ++T SG  +  +V+D  +PW  D+  ++GL A
Sbjct  72    DLPPGTGYDVHLARFKEFGSRTLKEALVRLTDSGRPVDCIVFDPFLPWCLDVAKEMGLAA  131

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             AAF +QSCAV  +Y+H  +  L  P  G  + +P +PPL   D+PSF+    SY  L   
Sbjct  132   AAFFTQSCAVDQIYYHVFKGELKVPLSGEEILIPGLPPLKPEDMPSFMYVHGSYPPLFEV  191

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNY  779
             VL++    +KADWL  NTF +LE+EV++ MA   P+K   IGP +PSMYLDKRV DD  Y
Sbjct  192   VLNQFSGLEKADWLFLNTFYQLEEEVIDNMAKFLPVK--TIGPTVPSMYLDKRVPDDKEY  249

Query  778   GLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRS  599
             GL+++KP+   CMEWL+ Q+  +VVYVSFGSLA L + QM E+A GL  S  +FLWVVRS
Sbjct  250   GLNVYKPDTVACMEWLNQQQPETVVYVSFGSLAQLGEVQMEELAWGLKLSNKQFLWVVRS  309

Query  598   SEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAM  419
             SE+SKLP +F  + S  G+I +WCPQLDVL+H+AV CF+THCGWNSTLEALSLGVP+VA+
Sbjct  310   SEESKLPKDFAQESSEKGLIVSWCPQLDVLAHEAVCCFVTHCGWNSTLEALSLGVPMVAV  369

Query  418   PQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWK  239
             PQW+DQ TN+K+++DVW +GIR    ++G+V RE +  C+ +VM+GERG  +K+NA KWK
Sbjct  370   PQWSDQGTNSKFVMDVWKMGIRAKTDDSGVVNRETIASCIRDVMEGERGEEIKKNAIKWK  429

Query  238   QLAKEAVDEGGSSDKNIKEFVSAI  167
             +LA+EAVDEGGSSDKNI++FVS++
Sbjct  430   ELAREAVDEGGSSDKNIQDFVSSL  453



>ref|XP_008233915.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=447

 Score =   467 bits (1202),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 230/444 (52%), Positives = 316/444 (71%), Gaps = 6/444 (1%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVT--VITPTSTSACIQVSSSLIRVESIPDGV  1313
             H+LV+P P+ GHI PM Q SKRLA +G+ VT  +I+  +    I+   SL+++ESI    
Sbjct  3     HILVVPLPLQGHINPMFQFSKRLAFKGLRVTLVIISSDTHHEPIETQLSLVKIESIYAAS  62

Query  1312  KPDSGFDAIS--DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
             +     +A     WL++++S  L E++SK    G  ++ +VYDS M W  D+   LG+  
Sbjct  63    EEADKINAEKKMQWLQNILSKRLPELISKQESIGYPISCIVYDSAMTWALDMAKGLGIAG  122

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             A+F + SCAV  VY +  Q  L+ P +   + LP +P L  +DLPSF+ +  SY S L+ 
Sbjct  123   ASFFTHSCAVGTVYCNVHQGVLSVPLKEGPILLPGLPLLEPHDLPSFIYDPGSYPSFLKL  182

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNY  779
             V+ R  N   ADW+ +N+FD LE+EV+ WM +++P+K   IGP LPSMYLDKR+ DD +Y
Sbjct  183   VVGRFSNITDADWIFWNSFDCLEQEVVSWMRTRWPIK--TIGPTLPSMYLDKRLEDDRDY  240

Query  778   GLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRS  599
             G +LF PN + C++WL+S++TG+VVYVSFGS+ANL ++QM E+A GL +SK  FLWVVR 
Sbjct  241   GFNLFTPNTDTCIKWLESKDTGTVVYVSFGSMANLGEKQMEELALGLKRSKTNFLWVVRE  300

Query  598   SEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAM  419
             SE  KLPSNF    S  G++ NWCPQL +L+H+AVGCF+THCGWNSTLEALS GVP+VAM
Sbjct  301   SEIQKLPSNFEEQTSEKGLVVNWCPQLQILAHEAVGCFMTHCGWNSTLEALSSGVPMVAM  360

Query  418   PQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWK  239
             PQWTDQ TNAK++ D W VG+RV   + G+VT+EE+ERC+ +VM+GERG  +K N+ +W+
Sbjct  361   PQWTDQLTNAKFVEDEWKVGVRVKVDQMGIVTKEEIERCIAQVMEGERGKEIKRNSMRWR  420

Query  238   QLAKEAVDEGGSSDKNIKEFVSAI  167
             +LAKEAV EGGSSDKNI+EFV+A+
Sbjct  421   ELAKEAVAEGGSSDKNIEEFVAAL  444



>ref|XP_010672483.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Beta vulgaris subsp. 
vulgaris]
Length=458

 Score =   467 bits (1201),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 223/455 (49%), Positives = 323/455 (71%), Gaps = 8/455 (2%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACI--QVSSSLI  1340
             E  + ST++HVLV P+PI GHI PM+Q SKRLAS+G+ VT I   S S  +  + +SS I
Sbjct  3     EETKTSTLAHVLVFPFPIQGHINPMLQFSKRLASKGLKVTFIITDSLSKLLPPRSNSSPI  62

Query  1339  RVESIPDGVKPDSGFDAISDWLK---DLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVA  1169
             ++ SI DG+K D   D    +L+    +V  ++A ++ +   +   +  +VYD ++ WV 
Sbjct  63    QIRSISDGLKDDEKVDDYEAYLELFERVVPQSVAHLIEEYKVTNHPVKFIVYDCLITWVL  122

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN  989
             DL     + AA + +QS AV ++++H  +  L  P EGS +S+PS+P L  N++PS + N
Sbjct  123   DLARTAEIEAAPYFTQSAAVHSIHYHVYERALKLPIEGSLISMPSIPLLRPNEMPSLIVN  182

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMAS-QFPLKVIAIGPLLPSMY  812
                YSS+    ++++ N  KA  + FNT D+LE +VL+WM S Q+P+K   IGP +PSMY
Sbjct  183   PGCYSSINCLNINQSSNFGKARLMFFNTIDKLESQVLDWMRSKQWPIK--TIGPAIPSMY  240

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LD+R+ DD  YGL+ F+P  + C++WLD++ET SVVY+S GS A L  EQM E+A+G+ Q
Sbjct  241   LDQRLEDDKEYGLNFFEPETDACLQWLDTKETSSVVYISMGSFAALGVEQMEEIAKGITQ  300

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             +   FLWVVR+SE++KLP NF  D +  G++ NWCPQL +L+H+A+GCF+THCGWNSTLE
Sbjct  301   TGKYFLWVVRASEEAKLPPNFKNDVTRQGLVVNWCPQLAILAHRAIGCFVTHCGWNSTLE  360

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             A+SLGVP+VAMPQWTDQPTNAKY+ DVW +G+R+   + G+VTR+EV+ C+ EVM+GER 
Sbjct  361   AISLGVPLVAMPQWTDQPTNAKYIADVWRIGVRLKVDDKGIVTRDEVDVCIREVMEGERS  420

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +  K+N  +WK+LA+EA++EGGSSD+NI+EFV+ +
Sbjct  421   IGFKKNVMEWKKLAQEAMEEGGSSDRNIEEFVAEL  455



>ref|XP_008233916.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=455

 Score =   466 bits (1200),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 230/444 (52%), Positives = 316/444 (71%), Gaps = 5/444 (1%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTS-TSACIQVSSSLIRVESIPDGV  1313
             +H+LV+P P+ GHI PM+Q SKRLAS+G+ VT++T +S T   I+   S++ +E I    
Sbjct  11    THILVVPLPVPGHINPMLQFSKRLASKGLRVTLVTISSKTHEPIETQLSMVNIEPIYATY  70

Query  1312  KPDSGFDAIS--DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
             +     D  S   WL  ++S NL +++SK   +G  +  +VYD+ + W   +   LG+  
Sbjct  71    EGAGKIDLESKLQWLLTILSQNLPDLISKQERNGYPICCLVYDASLTWALHIAKGLGIAG  130

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             A+F +Q+CAV  VY++  Q+ L  P E   V LP +P L  +DLPS + +  SY S+ + 
Sbjct  131   ASFFTQACAVGTVYYNVQQKLLRVPLEEDRVLLPGLPLLEPHDLPSLINHPGSYPSVFKM  190

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNY  779
             V+ R  N   ADW+  NTFD LE EV+ WM +++P+K   IGP LPSMYL+KR+ DD +Y
Sbjct  191   VVGRFSNITDADWIFCNTFDCLEPEVVSWMRTKWPIK--TIGPTLPSMYLEKRLEDDRDY  248

Query  778   GLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRS  599
             G++ FKPNN+ C++WLDS+E  +VVYVSFGS+ANL ++QM E+A GL +SK  FLWVVR 
Sbjct  249   GINFFKPNNDTCIKWLDSKEACTVVYVSFGSIANLGEKQMEELALGLKRSKTSFLWVVRE  308

Query  598   SEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAM  419
             SE  KLPSNF    S  G++ NWCPQL VL+H+A+GCF+THCGWNSTLEALSLG+P+VAM
Sbjct  309   SEIQKLPSNFEEQTSEKGLVVNWCPQLQVLAHRAIGCFMTHCGWNSTLEALSLGIPMVAM  368

Query  418   PQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWK  239
             PQWTDQ TNAK++ D W VG+RV   + G+VT+EE+ERC+ +VM+GERG   K N+ +W+
Sbjct  369   PQWTDQLTNAKFVEDEWKVGVRVKVDQMGIVTKEEIERCIAQVMEGERGNEFKRNSMRWR  428

Query  238   QLAKEAVDEGGSSDKNIKEFVSAI  167
             +LAKEA DEGGSSDKNI+EFV+A+
Sbjct  429   ELAKEAADEGGSSDKNIEEFVAAL  452



>ref|XP_002306205.2| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE86716.2| putative glucosyltransferase family protein [Populus trichocarpa]
Length=463

 Score =   466 bits (1198),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 240/459 (52%), Positives = 317/459 (69%), Gaps = 14/459 (3%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRV  1334
             E  E  + SHVL IP P  GHI PM+Q SKRLAS+GV VT++    +S  ++ +  L  V
Sbjct  2     EKQERKSKSHVLAIPVPAQGHINPMMQFSKRLASKGVQVTIVI--FSSKVLKHTHRLGSV  59

Query  1333  ESIPDGVKPDSGFDAISDWLKDL---VSNNLAEIMSKVTGS-GCLLTTVVYDSIMPWVAD  1166
             E +        G  +  D+LK L   V+  L E+++++  S G  ++ ++YDS +PW+ D
Sbjct  60    EVVTIDFVSYEGKLSSDDYLKQLRATVTRKLPELVAELNNSSGHPISCLLYDSHLPWLLD  119

Query  1165  LVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVS---LPSMPPLGLNDLPSFV  995
                QLGL  A+  +QSCAV  VY++  +  L  P E   V+   LP++  L + DLPSFV
Sbjct  120   TARQLGLTGASLFTQSCAVDNVYYNVHEMQLKIPPEKLLVTVSRLPALSALEITDLPSFV  179

Query  994   R---NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLL  824
             +   ++S +S LL  V+ +  N ++ADW+  NTF  LE+E + W+ASQ  +K   IGP++
Sbjct  180   QGMDSESEHSLLLNHVVGQFSNFREADWIFVNTFSTLEEEAVNWLASQRSIK--PIGPMI  237

Query  823   PSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQ  644
             PS YLDK++ DD  YG SLFKPN + CMEWLDS+ETGSVVYVSFGS+  L +EQM E+A 
Sbjct  238   PSFYLDKQLEDDREYGPSLFKPNLDGCMEWLDSKETGSVVYVSFGSMTALGEEQMEEIAW  297

Query  643   GLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWN  464
             GL +S C FLWVVR SE+ KLPSNF  + S  G+I  W  QL+VL+H++VGCF+THCGWN
Sbjct  298   GLKRSDCNFLWVVRESEKKKLPSNFAEESSKKGLIVTWSQQLEVLAHKSVGCFMTHCGWN  357

Query  463   STLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK  284
             S LEALSLGVP+VAMPQWTDQPTNAKY+ DVW VG+RV A E G+VT+EEVE C+ EVM+
Sbjct  358   SALEALSLGVPMVAMPQWTDQPTNAKYIADVWHVGVRVKANEKGIVTKEEVEGCIREVME  417

Query  283   GERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             GERG  ++ N+ KW +LAK AVDEGGSSDKNI EF + +
Sbjct  418   GERGSEMRRNSEKWMKLAKTAVDEGGSSDKNITEFAAEL  456



>ref|XP_002275194.2| PREDICTED: UDP-glycosyltransferase 74E2 [Vitis vinifera]
Length=654

 Score =   471 bits (1212),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 243/436 (56%), Positives = 311/436 (71%), Gaps = 8/436 (2%)
 Frame = -3

Query  1456  GHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS--LIRVESIPDGVKPDSGFDAIS  1283
             GHI PM+Q SKRLAS G+ VT++T    +  I+ + S   I +E I DG +P     ++ 
Sbjct  218   GHINPMLQFSKRLASMGLRVTLVTTQPNTKPIEEAQSNYPIHIEPISDGFQPGEKAQSVE  277

Query  1282  DWL---KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCA  1112
              +L   + + S +LA+++ K+  S   +  +VYDS+MPW  D   +LGL  A F +QSCA
Sbjct  278   VYLEKFQKVASQSLAQLVEKLARSKRPIKFIVYDSVMPWALDTAQELGLDGAPFYTQSCA  337

Query  1111  VFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQ  932
             V A+Y+H  Q  +  P EG T S PSMP LG+NDLPSF+ +  SY SLLR VL R  N +
Sbjct  338   VSAIYYHVSQGMMKIPIEGKTASFPSMPLLGINDLPSFISDMDSYPSLLRLVLGRFSNFR  397

Query  931   KADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNN  752
             KA  LL NTFD LE EV++WM SQ+P+K I  GP +PSMYLDKR+ DD +YGLS    N 
Sbjct  398   KAKCLLINTFDMLEAEVVKWMGSQWPVKTI--GPTIPSMYLDKRLEDDKDYGLSPLNLNV  455

Query  751   NDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSN  572
             + C+ WLD+++ GSVVYVSFGSLA+L +EQM E+A GL +SK  FLWVVR  E+ KLPSN
Sbjct  456   DACITWLDARDIGSVVYVSFGSLASLGEEQMEELAWGLKRSKGYFLWVVRELEEQKLPSN  515

Query  571   FWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTN  392
             F  + +  G++ +WCPQLDVL+H+AVGCF+THCGWNSTLEALSLGVP+V MPQWTDQ TN
Sbjct  516   FIENTADKGLVVSWCPQLDVLAHKAVGCFMTHCGWNSTLEALSLGVPMVVMPQWTDQMTN  575

Query  391   AKYLVDVWDVGIRVMAG-ENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVD  215
             AK++ DVW VG+RV A  E G+V REE+E C+ E M+GERG  +K NA +WK+LAKEA  
Sbjct  576   AKFVADVWGVGVRVKASDEKGIVKREEIEECIREAMEGERGKEMKRNAERWKELAKEAAT  635

Query  214   EGGSSDKNIKEFVSAI  167
             EGGSSDKNI+EFV  I
Sbjct  636   EGGSSDKNIEEFVKEI  651


 Score =   164 bits (414),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/208 (40%), Positives = 125/208 (60%), Gaps = 7/208 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKP  1307
             H+LV+PYP  GHI PM+Q S+RL S+GV  T+ TP   S   +  +  +++++I DG   
Sbjct  11    HILVLPYPSQGHINPMLQFSRRLVSKGVKATLATPIFISKTFKPQAGSVQLDTISDGFD-  69

Query  1306  DSGF---DAISDWLKDLV---SNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
             + GF   ++I ++L  L    S  LA+++ K    G     +VYD+ +PWV D+  Q GL
Sbjct  70    EGGFMQAESIHEYLTQLEAAGSRTLAQLIQKHRDLGHPFDCIVYDAFLPWVLDVAKQFGL  129

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLL  965
               AAF +Q+CAV  +Y+H     L  P + + VS+P +P L L D+PSF+    SY +  
Sbjct  130   VGAAFFTQTCAVNYIYYHAYHGLLPLPVKSTPVSIPGLPLLELRDMPSFIYVAGSYPAYF  189

Query  964   RFVLSRNLNTQKADWLLFNTFDELEKEV  881
             + VL++  N  KADW+L NTF +LE+EV
Sbjct  190   QLVLNQFCNVHKADWVLVNTFYKLEEEV  217



>emb|CBI24722.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   463 bits (1191),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 233/429 (54%), Positives = 312/429 (73%), Gaps = 7/429 (2%)
 Frame = -3

Query  1441  MVQLSKRLASRGVGVTV-ITPTSTSACIQVSSSLIRVESIPDGV---KPDSGFDAISDWL  1274
             M Q SKRLAS+G+ VT+ IT +S S  +    S I +E I +G    K +S  D++  + 
Sbjct  1     MFQFSKRLASKGLKVTLLITTSSISKSMHAQDSSINIEIICEGFDQRKAESIEDSLERY-  59

Query  1273  KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAVYH  1094
             +   S +L E++ + + S      +VYDSI+PW  D+  + GL  A+F +QSCAV A+Y+
Sbjct  60    RIAASQSLVELIEQHSRSNHPAKILVYDSILPWAQDVAERQGLHGASFFTQSCAVSAIYY  119

Query  1093  HTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADWLL  914
             H +Q   ++P EGS V+LPSMP   +NDLPSF+ +K S ++LL  +L++  N QK  W+L
Sbjct  120   HFNQRAFSSPLEGSVVALPSMPLFHVNDLPSFISDKGSDAALLNLLLNQFSNFQKVKWIL  179

Query  913   FNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEW  734
             FNTF +LE EV+ WM SQ P+K I  GP +PSMYLDKR+  D +YGLSLFK N + C+ W
Sbjct  180   FNTFTKLEDEVMNWMDSQRPVKTI--GPTVPSMYLDKRLEHDRDYGLSLFKQNIDTCITW  237

Query  733   LDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKS  554
             LD++E GSVVYVSFGS+A+L +EQM E+A GL +S   FLWVVR  E+ K P NF  + S
Sbjct  238   LDTKEIGSVVYVSFGSVASLGEEQMEELAWGLKRSNSHFLWVVRELEEKKFPYNFVEETS  297

Query  553   GAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVD  374
             G G++ +WCPQL VL+H+AVGCF+THCGWNSTLEALSLGVP+VAMPQ++DQ TNAK++ D
Sbjct  298   GKGLVVSWCPQLKVLAHKAVGCFLTHCGWNSTLEALSLGVPMVAMPQFSDQTTNAKFIED  357

Query  373   VWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDK  194
             VW VG+RV A E G+V R+E+E C+ E+M+GERG  +K NA +WK+LAKEAV+EGGSSDK
Sbjct  358   VWRVGVRVKADEKGIVKRQEIEMCIKEIMEGERGNEMKRNAERWKELAKEAVNEGGSSDK  417

Query  193   NIKEFVSAI  167
             NI+EFV+ I
Sbjct  418   NIEEFVAEI  426



>ref|XP_009782413.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana sylvestris]
Length=449

 Score =   462 bits (1190),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 236/447 (53%), Positives = 307/447 (69%), Gaps = 12/447 (3%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTST-SACIQVSSSLIRVESIP  1322
             S  +HVLV+P P  GHI P+VQ SK LAS+ V VT++T      A +     LI +ESIP
Sbjct  6     SQKTHVLVLPSPAQGHINPIVQFSKILASKEVKVTILTIDFVCKAMLLDCGPLINIESIP  65

Query  1321  DGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLR  1142
                 P  G D   +W + L+    + I+ K   S   +  VV DS++ W+ DL H+LGL+
Sbjct  66    HEAIPVEGVDNFLEWFQTLMLEKFSGIVEKFGDSEYPVKVVVIDSLITWIIDLAHELGLK  125

Query  1141  AAAFNSQSCAVFAVYHHTDQENLT--APTEGST-VSLPSMPPLGLNDLPSFVRNKSSYSS  971
              AAF++Q  A+ A+Y+H D+E+ T   P + S   SLPS+P L  +DLPSF+    +Y +
Sbjct  126   VAAFHTQPVALSALYYHIDREDSTNKIPFDSSAPFSLPSLPLLEKDDLPSFICETDAYPT  185

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
             + R V  +N N +KADWLLFNTFD LE+EV+ W+ +Q+ +K   IGP++ SMYLDK    
Sbjct  186   VKRLVFGQNFNFKKADWLLFNTFDALEEEVVNWLRTQYSIK--TIGPVVLSMYLDKE---  240

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
                Y  SL KP+   C +WLDS+E GSV+YVSFGSLA+L ++QM E+A GLI S   FLW
Sbjct  241   ---YDSSLTKPHYETCKKWLDSREIGSVIYVSFGSLASLGEKQMEELALGLIMSNSYFLW  297

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             VVR +E++KLP+ F       G+I NW PQLDVL+H++VGCF THCGWNSTLEALSLGVP
Sbjct  298   VVRDTEENKLPNEFISKVLEKGLIVNWSPQLDVLAHKSVGCFFTHCGWNSTLEALSLGVP  357

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             +V MPQW DQPTNAK++ D+W VGIRV   +NG++TREE+   + EVM  ++GVMLKENA
Sbjct  358   MVCMPQWADQPTNAKFITDIWQVGIRVKVEKNGVITREEIATSINEVMVEKKGVMLKENA  417

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVSA  170
              KWK LAKEA D+GGSSDKNIKEFV A
Sbjct  418   IKWKNLAKEAADKGGSSDKNIKEFVQA  444



>ref|XP_010242477.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nelumbo nucifera]
Length=464

 Score =   462 bits (1189),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 222/452 (49%), Positives = 307/452 (68%), Gaps = 9/452 (2%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRV  1334
             E  + +  +HV+V PYP  GHI PM+Q SKRLA +G+ VT       S  +  +S+ ++V
Sbjct  2     EKKDRAHGAHVIVFPYPAQGHINPMLQFSKRLAFKGLRVTFAVTKFVSKSMHTNSNSVQV  61

Query  1333  ESIPDGVKPDSGFD---AISDWL---KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWV  1172
             + I DG   D GF+   +I D+L   K++ S  LAE++ K   SG  +  ++YDS  PW 
Sbjct  62    QLISDGFD-DGGFEQAESIHDYLSRFKEVGSLTLAELIKKQDSSGKPVDCLIYDSFFPWA  120

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR  992
              D+  Q GL  A F +Q CAV  +Y+H  Q  L  P     VS+P +P + + D+PS++ 
Sbjct  121   LDVAKQFGLVGAPFFTQMCAVNNIYYHVHQGLLHLPVREPVVSIPGLPAIDIGDMPSYIS  180

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
             +  SY +    ++S+  NT+K DW+  NTF++LE+E++EWM  +FPL+  AIGP +PSMY
Sbjct  181   DPQSYPAYHAMIMSQFSNTEKVDWIFVNTFNKLEEEMIEWMEKRFPLR--AIGPTIPSMY  238

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LDK+V DD +YGL L+KP++ DC+ WL+ +  GSVVYVSFGS+A L  EQM E+A GL +
Sbjct  239   LDKQVEDDSDYGLHLYKPDSGDCINWLNKRAEGSVVYVSFGSMAALSVEQMEEIAWGLRR  298

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             S   FLWVVR SE  KLPS F  + S  G+I  WCPQL+VL+H  VGCF+THCGWNSTLE
Sbjct  299   SDSYFLWVVRRSEAEKLPSKFVEETSDKGLIVTWCPQLEVLTHNTVGCFVTHCGWNSTLE  358

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
              +SLGVP+V +PQWTDQ  NAK++ D+W +G+R    E G+V+REEVERC+ E+M+ E+ 
Sbjct  359   GVSLGVPMVGIPQWTDQIPNAKFVQDIWGMGLRAQPNEKGIVSREEVERCVREIMEEEKV  418

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFV  176
               +++NA KW+ LA+EAV EGG+SDKNI EFV
Sbjct  419   KEIRKNAIKWRDLAREAVGEGGTSDKNIDEFV  450



>ref|XP_010242475.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nelumbo nucifera]
Length=465

 Score =   462 bits (1189),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 224/447 (50%), Positives = 301/447 (67%), Gaps = 7/447 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +HVL  PYP  GHI PM+Q  KRLA +G+  T++T    S  +Q+    I V++I DG  
Sbjct  10    AHVLGFPYPCQGHINPMLQFCKRLAFKGLKATLVTTFFISKSMQMELDSIEVQTISDGYD  69

Query  1309  PDSGF---DAISDWL---KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              + GF   ++I  +L   K++ S  L +++ K   SG  +  +VYD  MPW  D+  Q G
Sbjct  70    -EGGFVQAESIEAYLTRFKEVGSQTLTDLIKKQNCSGHPVNCLVYDPFMPWALDVAKQFG  128

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             L  A F +QSCAV ++Y+H  Q  L  P   S +S+P +PPL + D PS +   +SY + 
Sbjct  129   LLGAPFFTQSCAVNSIYNHVHQGVLKVPVSDSIISIPGLPPLEVMDRPSLISVSASYPAY  188

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
                VL++  N + ADW+L N+F+ELE EV+EWM  + P  ++ IGP +PSMYLDKRV  D
Sbjct  189   TTMVLNQFSNVENADWILANSFNELESEVVEWMTKRLPTPLLTIGPAVPSMYLDKRVAGD  248

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
              +YGL+LFKP+   CM WLD +   SVVYVSFGS+A L  EQ+ E+A GL +S   FLWV
Sbjct  249   KDYGLNLFKPDKGSCMNWLDKRAARSVVYVSFGSMAALSAEQIEEIAWGLRRSNTYFLWV  308

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             +RS +  KLP  F  + +  G+I  WC QL+VL+ +A+GCFITHCGWNSTLEALS GV +
Sbjct  309   LRSDQDDKLPGEFLMETAEKGLIVRWCSQLEVLAREAIGCFITHCGWNSTLEALSTGVAM  368

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             V MPQWTDQ TNAK ++DVW +G+R    + G+V+REEVERC+VEVM+GERG  +K+NA 
Sbjct  369   VGMPQWTDQTTNAKLVMDVWRIGVRARPDDKGIVSREEVERCIVEVMEGERGKQIKKNAI  428

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             KWK LA+EAVDEGGSSDKNI  F++ +
Sbjct  429   KWKNLAREAVDEGGSSDKNIDGFIAKL  455



>dbj|BAO51836.1| UDP-glycosyltransferase 74Y1 [Camellia sinensis]
Length=463

 Score =   461 bits (1186),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 234/458 (51%), Positives = 320/458 (70%), Gaps = 15/458 (3%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQV------SSSLIR  1337
             S+ + +LV+PYP+ GHI PM+Q SKRL+S+G+ +T+IT TS S  +Q+      +S+ I+
Sbjct  4     SSETQILVLPYPVQGHINPMLQFSKRLSSKGLNITLITTTSISTTLQLNLHPTSTSTPIK  63

Query  1336  VESIPDGV-KPDSG--FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVAD  1166
               SI DG  K D    ++A     K  VS  LA+++     +      +VYDS++PW  D
Sbjct  64    TVSISDGTDKKDHSETYEAEILRFKTAVSQTLAQLIQTQLTTSSGTKVLVYDSVIPWALD  123

Query  1165  LVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP---TEGSTVSLPSMPPLGLNDLPSFV  995
             + H+ GLR A F +Q C V A+Y+H  +     P    +   VSLP++P +G +D+PSFV
Sbjct  124   IAHKFGLRGACFFTQPCGVCAIYYHLHEGEFKVPLDLDQSGVVSLPALPGIGFDDMPSFV  183

Query  994   RNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSM  815
              +  SY  +L  ++++  N +KADW+LFNTFD+LE+++++WMA Q    +  IGP +PS 
Sbjct  184   SDMGSYPVMLGLLVNQFSNFRKADWILFNTFDKLEEQIVKWMAIQRS-SIKTIGPAIPSK  242

Query  814   YLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             +LDKR+ DD +YGLSLFKP+  DCM+WLD++   SVVY SFGSLA+L + QM E+A GL 
Sbjct  243   FLDKRLEDDKDYGLSLFKPSVEDCMKWLDTKPKASVVYASFGSLASLSEAQMEEIAWGLK  302

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDKSG--AGIITNWCPQLDVLSHQAVGCFITHCGWNS  461
                  FLWVVRSSEQ KLPSNF  + S    G+I NWC QL VL+HQA+GCF+THCGWNS
Sbjct  303   NCNYYFLWVVRSSEQGKLPSNFIDETSSEKKGLIVNWCSQLQVLAHQAIGCFMTHCGWNS  362

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             TLEALSLGVP+VAMPQW+DQ TN K++VD+W  G+RV   + G++ +EE+E  + EVM+G
Sbjct  363   TLEALSLGVPMVAMPQWSDQMTNTKFVVDLWRTGVRVKVNDKGIIGKEEIETRIREVMEG  422

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ERG  L++NA +WK+LAKEAVDEGGSSD NI+EFVS I
Sbjct  423   ERGGELRKNAVRWKELAKEAVDEGGSSDTNIEEFVSEI  460



>ref|XP_002529824.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32573.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=467

 Score =   461 bits (1186),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 228/458 (50%), Positives = 321/458 (70%), Gaps = 7/458 (2%)
 Frame = -3

Query  1525  VERPEMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQV-SS  1349
             +E+ E    ++ SHVLV P+P+ GHI PM+QLSKRLAS+G+ VT+I  +S +  +Q   +
Sbjct  1     MEKEEQIRETSQSHVLVFPFPVQGHINPMLQLSKRLASKGLKVTLIATSSIAKTMQAPQA  60

Query  1348  SLIRVESIPDGVKPDSGFDAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMP  1178
               + +E+I DG K       + ++++     +  +LA ++ K   S   +  V+YDS  P
Sbjct  61    GSVHIETIFDGFKEGERTSDLEEFIETFNRTIPESLAGLIEKYASSPQPVKCVIYDSATP  120

Query  1177  WVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSF  998
             W+ D+    G+  A+F +QSCAV  +Y+H  Q  L  P   S VSLP+ P L  ND+PS+
Sbjct  121   WIFDIARSSGVYGASFFTQSCAVTGLYYHKIQGALKVPLGESAVSLPAYPELEANDMPSY  180

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
             V    SY ++     S+  N  + DW+L+NTF+ELE EV++WMAS++P+  I     +PS
Sbjct  181   VNGPGSYQAIYDMAFSQFSNVDEVDWVLWNTFNELEDEVVKWMASKWPIIPIGP--TIPS  238

Query  817   MYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGL  638
             M+LDKR++DD +YG+SLFKPN++ CM+WLDS+E  SVVYVSFGSLA L ++QM ++A GL
Sbjct  239   MFLDKRLKDDKDYGVSLFKPNSDTCMKWLDSKEPSSVVYVSFGSLAALGEDQMAQLAWGL  298

Query  637   IQSKCKFLWVVRSSEQSKLPSNFWPDKSG-AGIITNWCPQLDVLSHQAVGCFITHCGWNS  461
              +S   FLWVVR SE+ K+P NF  + +   G++  W PQL VL+H++VGCF+THCGWNS
Sbjct  299   KRSNNNFLWVVRESEEKKVPPNFIEETTEEKGLVVTWSPQLKVLAHRSVGCFLTHCGWNS  358

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             TLEALSLGVP+VAMPQW+DQ TNAK++ DVW VG+RV   +NG+VTREE+E+C+ EVM+G
Sbjct  359   TLEALSLGVPMVAMPQWSDQSTNAKFVTDVWRVGVRVEVDQNGIVTREEIEKCIREVMEG  418

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             E G  ++ N+ KWK+LA+  VDEGGSSDKNI+EFVS +
Sbjct  419   ETGKGMRMNSEKWKELARITVDEGGSSDKNIEEFVSRL  456



>ref|XP_006469358.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006469359.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Citrus 
sinensis]
 ref|XP_006469360.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X3 [Citrus 
sinensis]
Length=466

 Score =   460 bits (1183),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 226/455 (50%), Positives = 302/455 (66%), Gaps = 10/455 (2%)
 Frame = -3

Query  1507  AEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRV--  1334
             A  S ++H LV+ YP  GHI PM+Q SKRL  +G+ VT +T       +  +SS I +  
Sbjct  8     ASSSKLAHCLVLTYPGQGHINPMLQFSKRLQHKGIKVTFVTTHFLYKSLHRNSSTIPIAL  67

Query  1333  ESIPDGVKPDSG-----FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVA  1169
             E+I DG            DA  +    +    L E++ K+  S   +  VVYDS++PW  
Sbjct  68    EAISDGYDEGGAAQAESIDAYLERFWQIGPQTLTELVEKMNASSVPVDCVVYDSVLPWAL  127

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN  989
             D+  + GL  A F +QSCAV+ +Y+H ++  L  P  G+ +SLP MPPL   D+PS V +
Sbjct  128   DVAKKFGLLGATFLTQSCAVYCIYYHANRGFLKLPLTGNEISLPGMPPLEPQDMPSIVYD  187

Query  988   KSSYSSLLRFVLSRNL-NTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
               SY ++   VL     N  K DW+L NTF ELE+EV EW+   +PL+  AIGP +PSMY
Sbjct  188   LGSYPAISDLVLKNQFDNIDKVDWVLCNTFYELEEEVAEWLGRHWPLR--AIGPTVPSMY  245

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LDK++ D+ +YG S+FK +N  C++WL+ Q  GSVVYVSFGS A LK E+M E+A GL  
Sbjct  246   LDKQLEDEKDYGFSIFKQSNESCIKWLNDQAKGSVVYVSFGSAATLKIEEMEELAWGLKA  305

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             S   FLWVVR SEQSKLP NF  + S  G++ NWCPQL+VL+H+A GCF+THCGWNSTLE
Sbjct  306   SDKYFLWVVRESEQSKLPENFSDETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTLE  365

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             ALSLGVP+VAMPQWTDQ TN+KY++DVW +G++    E G+V RE +  C+ E+++GERG
Sbjct  366   ALSLGVPMVAMPQWTDQSTNSKYIMDVWKMGLKAPTDEKGIVRREAIAHCISEILEGERG  425

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +K+NA KW+  AKEAV +GGSSDKNI EFV+ +
Sbjct  426   KEIKQNAGKWRNFAKEAVAKGGSSDKNIDEFVANL  460



>ref|XP_007033375.1| Uridine diphosphate glycosyltransferase 74E2, putative isoform 
2 [Theobroma cacao]
 gb|EOY04301.1| Uridine diphosphate glycosyltransferase 74E2, putative isoform 
2 [Theobroma cacao]
Length=425

 Score =   458 bits (1178),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 233/428 (54%), Positives = 311/428 (73%), Gaps = 9/428 (2%)
 Frame = -3

Query  1441  MVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIP--DGVKPDSGFDAISDWLKD  1268
             M+Q SKRLAS+ + VT+IT   TS  +Q S+S +  ESI   +G + +S  D +  + K 
Sbjct  1     MLQFSKRLASKSLRVTLIT---TSKSMQPSASSVNFESIEFEEGERTNSVDDYLELYEK-  56

Query  1267  LVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHT  1088
             L+   LA+ +   T S      +VYDS MPW   +    G++ A+F +QS AV A+++H 
Sbjct  57    LIPKRLAKFIENQTCSQHPAKVLVYDSCMPWALAVAKNFGVQGASFFTQSWAVNAIFYHL  116

Query  1087  DQENLTAPTEGSTVSLPSMPPLGLNDLPSFV-RNKSSYSSLLRFVLSRNLNTQKADWLLF  911
              Q     P E   VSLPSMP L L+DLPSFV  N  SY  L + V ++  N ++A+W+  
Sbjct  117   KQGTFRVPPEEPVVSLPSMPELRLSDLPSFVCDNSGSYPGLCKLVKNQFSNFEEANWVFC  176

Query  910   NTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWL  731
             NT+DELE EV+  MAS++P+K +  GP +PSMYLDKR++DD++YGL LFKP++  C++WL
Sbjct  177   NTYDELEDEVINCMASKWPIKTV--GPTIPSMYLDKRIKDDNDYGLHLFKPDSELCIKWL  234

Query  730   DSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSG  551
             DS+ET SVVYVSFGSLA L +EQM E++ GL +S   FLWVVR +EQSK+PSNF  + S 
Sbjct  235   DSKETDSVVYVSFGSLAGLTEEQMLELSLGLKRSNRYFLWVVREAEQSKIPSNFIEETSE  294

Query  550   AGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDV  371
              G++ +WCPQLDVL+H+AVGCF+THCGWNSTLEALSLGVP++AMPQWTDQPTNAK++ DV
Sbjct  295   KGLVVSWCPQLDVLAHRAVGCFMTHCGWNSTLEALSLGVPMIAMPQWTDQPTNAKFVADV  354

Query  370   WDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKN  191
             W  GIRV   E G+VT+EEVE C+ E+M+GER + +++N+ KWK LAKEAVDEGGSSDKN
Sbjct  355   WQGGIRVSKDEKGVVTKEEVEWCIREIMEGERSLEIRKNSEKWKNLAKEAVDEGGSSDKN  414

Query  190   IKEFVSAI  167
             I+EFV+ +
Sbjct  415   IEEFVAKL  422



>gb|KDP35131.1| hypothetical protein JCGZ_10665 [Jatropha curcas]
Length=462

 Score =   457 bits (1176),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 235/452 (52%), Positives = 315/452 (70%), Gaps = 9/452 (2%)
 Frame = -3

Query  1504  EMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESI  1325
             E    +H+LV P+PI GHI PM+Q SKRLAS+ + VT IT +S+S+  + SS+ I  E+I
Sbjct  2     EKKKSTHILVFPFPIQGHINPMLQFSKRLASKNLKVTFIT-SSSSSVTENSSTCIDTETI  60

Query  1324  PDGVKPDSGFDAISDWL---KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQ  1154
              DG          ++++   +  V  +LAE++ K + S   +  +VYDSI+PWV D+  +
Sbjct  61    YDGFNKGEKSTDPAEFIARYESSVPKSLAELIEKYSSSEYPVKCIVYDSILPWVLDVARK  120

Query  1153  LGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVS--LPSMPPLGLNDLPSFVRNKSS  980
              G   A+F +Q+ AV A+Y+     +L  P E   +S  LPS+P L  NDLP FV    +
Sbjct  121   FGAFGASFFTQNVAVCALYYLAFDGSLKVPVEKDKMSFLLPSLPELEFNDLPPFVNGPGA  180

Query  979   YSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKR  800
             Y ++   V S+  N    DWL +NTF ELE E++ WMA ++P K   IGP +PSM+LDK+
Sbjct  181   YRAIYDMVFSQFSNIDDVDWLFWNTFYELEDEIVNWMARKWPTK--PIGPTIPSMFLDKQ  238

Query  799   VRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCK  620
             + DD +YGLSLFKPN++ CM WL+++E  SVVY+SFGSLA L ++QM E+A GL  SK  
Sbjct  239   LEDDKDYGLSLFKPNSDACMNWLNAKEPNSVVYISFGSLAALNEDQMTELACGLKSSKKG  298

Query  619   FLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             FLWVVR SE  KLP NF  +    G++  W PQLDVL+H++VGCFITHCGWNSTLEALSL
Sbjct  299   FLWVVRESEDKKLPDNFIEETKDMGLVVKWSPQLDVLAHKSVGCFITHCGWNSTLEALSL  358

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRV-MAGENGMVTREEVERCLVEVMKGERGVML  263
             GVP+VAMPQWTDQPTNAK++ DVW VG+RV +  E G+V +EE+ERC+ EVM+GE G  +
Sbjct  359   GVPMVAMPQWTDQPTNAKFIADVWKVGVRVKVDDEKGIVVKEEIERCIGEVMEGETGNRI  418

Query  262   KENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ++N+ KWK+LA EAVDEGGSSDKNI+EFVS +
Sbjct  419   RKNSEKWKKLACEAVDEGGSSDKNIEEFVSKL  450



>ref|XP_011079130.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Sesamum indicum]
Length=462

 Score =   457 bits (1176),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 223/447 (50%), Positives = 295/447 (66%), Gaps = 8/447 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTV-ITPTSTSACIQVSSSLIRVESIPDGV  1313
             +H L++P+P  GHI PM+Q +KRL  + + VT+ +T    S     S   I V +I DG 
Sbjct  9     AHCLILPHPTQGHINPMLQFAKRLTCKHIKVTLALTRFLLSTTPGFSGGSISVRAISDGF  68

Query  1312  KPDSGFDAISD-----WLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
                    A S        + +    LA+++  + GSGC +  VVYD  MPW  D+   LG
Sbjct  69    DEGGRAQAKSSDEYQARFQKIGQETLADLLQDLAGSGCPVDCVVYDPFMPWALDVAKGLG  128

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             L AAAF +QSCAV  +YHH  +  L  P  G  V +P +P +  +++PSF+ +  SY   
Sbjct  129   LFAAAFFTQSCAVDNIYHHVYRGELELPLSGGEVVVPGLPAMRPDEMPSFIYDHGSYPGT  188

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
              + VL++  N  KADW+  NTFDELE+EVLEWM+    L+V AIGP +PSMYLDKR++DD
Sbjct  189   FQMVLNQFRNVDKADWIFINTFDELEEEVLEWMSRS--LRVKAIGPAIPSMYLDKRLQDD  246

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
               Y  ++FKP+ N C  WL+ ++  SV+YVSFGSLA L  EQ  E+A  L      FLWV
Sbjct  247   REYDFTIFKPDTNACKNWLNQRQPKSVIYVSFGSLAQLTAEQTLELACALRACGNHFLWV  306

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             VRSSE++KLP NF  + S  G+I +WCPQL+VL+H+AV CFITHCGWNSTLE+LSLGVP+
Sbjct  307   VRSSEEAKLPENFSEETSEKGLIVSWCPQLEVLAHEAVACFITHCGWNSTLESLSLGVPI  366

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             V MPQWTDQ TNAK++ +VW  GIR  A E G+V REE+ RC+  VM+GE G ++  NAA
Sbjct  367   VGMPQWTDQSTNAKFVTEVWGTGIRAQADEEGLVRREEIVRCVKNVMEGEEGKVVSTNAA  426

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             KW  +A+ AVDEGGSSD+NI+EFV A+
Sbjct  427   KWSSIARAAVDEGGSSDRNIEEFVRAL  453



>ref|XP_009786106.1| PREDICTED: UDP-glycosyltransferase 74E2-like, partial [Nicotiana 
sylvestris]
Length=440

 Score =   456 bits (1172),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 230/443 (52%), Positives = 303/443 (68%), Gaps = 12/443 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS-SSLIRVESIPDGVK  1310
             HVLV+P P  GHI P+VQ SK LAS+ V VT++T       + +    LI +ESIP    
Sbjct  1     HVLVLPCPAQGHINPIVQFSKILASKEVKVTILTIDFVCKTMLLDCGPLINIESIPHEAI  60

Query  1309  PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAF  1130
             P  G D   +W + L+    + I+ K   S   +  V+ DSI+ W+ DL H+LGL+ AAF
Sbjct  61    PGEGLDNFLEWFQTLMLEKFSGIVEKFGDSEYPVKIVLIDSIITWIIDLAHELGLKVAAF  120

Query  1129  NSQSCAVFAVYHHTDQENLT--APTEGST-VSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             ++Q  A+ A+Y++ DQE+ T   P +GS  VSLPS+P L   DLPSF+R   +Y ++ R 
Sbjct  121   HTQPVALSALYYYIDQEDSTNKIPFDGSVPVSLPSLPLLEKEDLPSFIRETDAYPTVKRL  180

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNY  779
                +N N +KADWLLFNTFD LE+EV+ W+ + + +K   IGP++ SMYLDK       Y
Sbjct  181   AFGQNFNFKKADWLLFNTFDALEEEVVNWLRTLYSIK--TIGPVVLSMYLDKE------Y  232

Query  778   GLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRS  599
               SL  P    C +WLDS+E G V+YVSFGSL  L ++QM E+A GLI S   FLWVVR 
Sbjct  233   DSSLTSPLYETCKKWLDSREIGLVIYVSFGSLVCLGEKQMEELAFGLIMSNSYFLWVVRD  292

Query  598   SEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAM  419
             +E++KLP+ F    S  G+  NW PQLDVL+H+++GCF THCGWNSTLEALSLGVP+V M
Sbjct  293   TEENKLPNEFKSKASEKGLTVNWSPQLDVLAHKSIGCFFTHCGWNSTLEALSLGVPMVCM  352

Query  418   PQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWK  239
             PQW DQPTNAK++ D+W  GIRV AG++G++TREE+   + EVM  ++GVMLKENA KWK
Sbjct  353   PQWADQPTNAKFISDIWKTGIRVKAGKDGVITREEIASSIKEVMVEKKGVMLKENAIKWK  412

Query  238   QLAKEAVDEGGSSDKNIKEFVSA  170
             +LAKEAVD+GGSSDKNI+EF+ A
Sbjct  413   KLAKEAVDKGGSSDKNIEEFIQA  435



>ref|XP_006469357.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Citrus sinensis]
Length=464

 Score =   456 bits (1172),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 224/453 (49%), Positives = 301/453 (66%), Gaps = 15/453 (3%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ---VSSSLIRVES  1328
             S ++H LV+ YP  GHI P++Q SKRL  +G+ VT++T    S  +     SS+ I +E+
Sbjct  12    SKLAHCLVLSYPAQGHINPLLQFSKRLEHKGIKVTLVTTYFISKSLHRDPSSSNSIALET  71

Query  1327  IPDGVKPDSGFDAIS-----DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             I DG        A S     D    +      E++ ++    C    +VYDS +PW  D+
Sbjct  72    ISDGYDEGGSAQAESNQAYVDRFWKIGLQTFTELVERMNDVDC----IVYDSFLPWALDV  127

Query  1162  VHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKS  983
               + GL  A F +QSCAV+ +Y+H ++  L  P  G+ +SLP MPPL   D+PSFV +  
Sbjct  128   AKKFGLLGATFLTQSCAVYCIYYHANRGFLKLPLTGNEISLPGMPPLEPQDMPSFVYDLG  187

Query  982   SYSSLLRFVLSRNL-NTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
             SY ++   VL     N  K DW+L NTF ELE+EV EW+   +PL+  AIGP +PSMYLD
Sbjct  188   SYPAISDLVLKNQFDNIDKVDWVLCNTFYELEEEVAEWLGRHWPLR--AIGPTVPSMYLD  245

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             K++ D+ +YG S+FK +N  C++WL+ Q  GSVVYVSFGS A LK E+M E+A GL  S 
Sbjct  246   KQLEDEKDYGFSIFKQSNESCIKWLNDQAKGSVVYVSFGSAATLKIEEMEELAWGLKASD  305

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
               FLWVVR SEQSKLP NF  + S  G++ NWCPQL+VL+H+A GCF+THCGWNSTLEAL
Sbjct  306   KYFLWVVRESEQSKLPENFSDETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTLEAL  365

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVM  266
             SLGVP+VAMPQWTDQ TN+KY++DVW +G++    E G+V RE +  C+ E+++GERG  
Sbjct  366   SLGVPMVAMPQWTDQSTNSKYIMDVWKMGLKAPTDEKGIVRREAIAHCISEILEGERGKE  425

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +K+NA KW+  AKEAV +GGSSDKNI EFV+ +
Sbjct  426   IKQNAGKWRNFAKEAVAKGGSSDKNIDEFVANL  458



>ref|XP_006447926.1| hypothetical protein CICLE_v10015147mg [Citrus clementina]
 gb|ESR61166.1| hypothetical protein CICLE_v10015147mg [Citrus clementina]
Length=466

 Score =   455 bits (1170),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 224/455 (49%), Positives = 300/455 (66%), Gaps = 10/455 (2%)
 Frame = -3

Query  1507  AEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRV--  1334
             A  S ++H LV+ YP  GHI PM+Q SKRL  +G+ VT +T       +  +SS I +  
Sbjct  8     ASSSKLAHCLVLTYPGQGHINPMLQFSKRLQHKGIKVTFVTTHFLYKSLHRNSSPIPIAL  67

Query  1333  ESIPDGVKPDSG-----FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVA  1169
             E+I DG            DA  +    +    L E++ K+  S   +  VVYDS++PW  
Sbjct  68    EAISDGYDEGGAAQAESIDAYLERFWQIGPQTLTELVEKMNASSVPVDCVVYDSVLPWAL  127

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN  989
             D+  + GL  A F +QSCAV+ +Y+H +   L  P  G+ +SLP MPPL   D+PS V +
Sbjct  128   DVAKKFGLLGATFLTQSCAVYCIYYHANMGFLKLPLTGNEISLPGMPPLEPQDMPSIVYD  187

Query  988   KSSYSSLLRFVLSRNL-NTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
               SY ++   VL     N  K DW+L NTF ELE+EV EW+   +PL+  AIGP +PS Y
Sbjct  188   LGSYPAISDLVLKNQFDNIDKVDWVLCNTFYELEEEVAEWLGRHWPLR--AIGPTVPSKY  245

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LDK++ DD +YG S+F  +N  C++WL+ Q  GSVVYVSFGS+A LK E+M E+A GL  
Sbjct  246   LDKQLEDDKDYGFSMFMQSNESCIKWLNDQAKGSVVYVSFGSMATLKIEEMEELAWGLKA  305

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             S   FLWVVR SEQSKLP NF  + S  G++ NWCPQL+VL+H+A GCF+THCGWNSTLE
Sbjct  306   SDKYFLWVVRESEQSKLPENFSDETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTLE  365

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             ALS+GVP+VAMPQWTDQ TN+KY++DVW +G++    E G+V RE +  C+ E+++GERG
Sbjct  366   ALSVGVPMVAMPQWTDQSTNSKYIMDVWKMGLKAPTDEKGIVRREAIAHCISEILEGERG  425

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +K+NA KW+  AKEAV +GGSSDKNI EFV+ +
Sbjct  426   KEIKQNAGKWRNFAKEAVAKGGSSDKNIDEFVANL  460



>ref|XP_011047628.1| PREDICTED: UDP-glycosyltransferase 74E1-like isoform X1 [Populus 
euphratica]
Length=467

 Score =   454 bits (1168),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 240/463 (52%), Positives = 319/463 (69%), Gaps = 18/463 (4%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRV  1334
             E  E+ + SHVL IP P  GHI PM+Q SKRLAS+G+ VT++    +S  ++ +  L  V
Sbjct  2     EKQEIQSKSHVLAIPVPAQGHINPMMQFSKRLASKGLRVTIVI--FSSKVLKHTRRLGSV  59

Query  1333  ESIP-DGVKPDSGF--DAISDWLKDLVSNNLAEIMSKVTGS-GCLLTTVVYDSIMPWVAD  1166
             E +  D V  +     D  S   +  V+  L E+++++  S G  +  ++YDS +PW+ D
Sbjct  60    EVVTVDFVSYEGKLSSDDYSKQFRAAVTRKLPELVAELNNSSGHPINCLLYDSHLPWLLD  119

Query  1165  LVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSL---PSMPPLGLNDLPSFV  995
                QLGL  A+  +QSCAV  VY++  +  L  P E   V+L   P++ PL + DLPSFV
Sbjct  120   TARQLGLTGASLFTQSCAVDNVYYNVHEMQLKIPPEKLLVTLSRLPALSPLEITDLPSFV  179

Query  994   RN-------KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAI  836
             +        +S YS LL  V+ + LN ++ADW+  NTF+ LE++ + W+ SQ  +K   I
Sbjct  180   QGMDSESESESEYSLLLNHVVGQFLNFREADWIFINTFNTLEEKAVNWLDSQRSVK--PI  237

Query  835   GPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMC  656
             GP++PS YLD+++ DD  YG SLFKPN + CMEWLDS+ETGSVVYVSFGS+A L +EQM 
Sbjct  238   GPMIPSFYLDRQLEDDKEYGPSLFKPNLDGCMEWLDSKETGSVVYVSFGSMAALGEEQMA  297

Query  655   EVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITH  476
             E+A GL +S C FLWVVR SE+ KLPSNF  + S  G++  W PQL+VL+H++VGCF+TH
Sbjct  298   EIAWGLRRSDCNFLWVVRVSEKKKLPSNFVEESSEKGLMVTWSPQLEVLAHKSVGCFMTH  357

Query  475   CGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLV  296
             CGWNSTLEALSLGVP+VAMPQWTDQPTNAK + DVW VG+RV A E G+VT+EEVE C+ 
Sbjct  358   CGWNSTLEALSLGVPMVAMPQWTDQPTNAKCIADVWRVGVRVKANEKGIVTKEEVEGCIR  417

Query  295   EVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             EVM+GERG  ++ N+ KW QLAK AVDEGGSSDKNI EF + +
Sbjct  418   EVMEGERGNKIRRNSEKWMQLAKTAVDEGGSSDKNITEFAAEL  460



>gb|EYU17621.1| hypothetical protein MIMGU_mgv1a006158mg [Erythranthe guttata]
Length=454

 Score =   451 bits (1161),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 221/456 (48%), Positives = 313/456 (69%), Gaps = 16/456 (4%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ--VSSSLIRVES  1328
             M+T SH++ IP+P+ GHI PMVQL  RL S+G+ VT++T  S S  +Q     + I +E+
Sbjct  1     MATNSHIIAIPFPLQGHINPMVQLCNRLISKGIRVTLVTTFSISKTLQNRTDENTINIET  60

Query  1327  IPDGVKP----DSGFDAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVA  1169
             +PD        D   D    ++++    ++N + +I+ K + SG  +  VVYDS++PW  
Sbjct  61    VPDIDSTVNGGDENLDIYEVFIRNFRASITNGVPDIIRKHSSSGHHVKAVVYDSVIPWCL  120

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTE--GSTVSLPSMPPLGLNDLPSFV  995
             D+    GLR A   +Q C V ++++H  + NL   ++  G  VSLP MP +GL DLP+ V
Sbjct  121   DIAKGNGLRGAVLFTQPCTVCSIFYHLHEGNLEISSDEVGFEVSLPGMPVMGLKDLPTLV  180

Query  994   RNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSM  815
              + +SY SLLR ++ +    + ADW LFNTFD+LE E+L+WM++++P++   IGP +PSM
Sbjct  181   YDMNSYPSLLRLLVEQFSTFENADWRLFNTFDKLEDEILKWMSNKYPIR--TIGPTVPSM  238

Query  814   YLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             Y DKR++ + +YGLSLFKP+   C +WL+++E  SV+YVSFGSLA+L ++QM E+A GL+
Sbjct  239   YADKRLKGNYDYGLSLFKPSTESCFQWLETKEDRSVIYVSFGSLADLTEKQMEELAWGLV  298

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTL  455
             ++K  FLWVVR +EQ K+P +F  ++   G+I NWC QL+VLSH++VGCF TH GWNSTL
Sbjct  299   ETKRNFLWVVRETEQCKIPKDFVSER---GLIVNWCTQLEVLSHRSVGCFFTHGGWNSTL  355

Query  454   EALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGER  275
             EAL LGV +V MPQWTDQ TNAK + DVW  G+RV    NG+V+REEV  C+ EVM+GE 
Sbjct  356   EALCLGVALVVMPQWTDQTTNAKLIADVWRNGVRVKCDPNGIVSREEVVACVNEVMEGES  415

Query  274   GVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             G +++ NA KWK++A EAV EGGSSD NI EF   I
Sbjct  416   GDVIRRNAVKWKEMAVEAVSEGGSSDTNIAEFAEEI  451



>ref|XP_009630995.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Nicotiana tomentosiformis]
 gb|AAF61647.1|AF190634_1 UDP-glucose:salicylic acid glucosyltransferase [Nicotiana tabacum]
Length=459

 Score =   451 bits (1160),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 222/450 (49%), Positives = 310/450 (69%), Gaps = 13/450 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP  GHI PM+Q SKRL S+GV +T+    S    +Q  S+ + VE+I DG  
Sbjct  6     AHCLILPYPAQGHINPMLQFSKRLQSKGVKITIAATKSFLKTMQELSTSVSVEAISDGYD  65

Query  1309  PDSG------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              D G      F A     K++ S+ L++++ K+T  GC ++ +VYD  +PW  ++ +  G
Sbjct  66    -DGGREQAGTFVAYITRFKEVGSDTLSQLIGKLTNCGCPVSCIVYDPFLPWAVEVGNNFG  124

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEG--STVSLPSMPPLGLNDLPSFVRNKSSYS  974
             +  AAF +QSCAV  +Y+H  +  L  P       +S+P +  +  +D+PSFV N  S S
Sbjct  125   VATAAFFTQSCAVDNIYYHVHKGVLKLPPTDVDKEISIPGLLTIEASDVPSFVSNPES-S  183

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVR  794
              +L  ++++  N +  DW+L N+F ELEKEV++WMA  +P+K   IGP +PSMYLDKR+ 
Sbjct  184   RILEMLVNQFSNLENTDWVLINSFYELEKEVIDWMAKIYPIK--TIGPTIPSMYLDKRLP  241

Query  793   DDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             DD  YGLS+FKP  N C+ WL+ Q   SVVYVSFGSLA L+ EQM E+A GL  S   FL
Sbjct  242   DDKEYGLSVFKPMTNACLNWLNHQPVSSVVYVSFGSLAKLEAEQMEELAWGLSNSNKNFL  301

Query  613   WVVRSSEQSKLPSNFWPD-KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             WVVRS+E+SKLP+NF  +  S  G++ +WCPQL VL H+++GCF+THCGWNSTLEA+SLG
Sbjct  302   WVVRSTEESKLPNNFLEELASEKGLVVSWCPQLQVLEHKSIGCFLTHCGWNSTLEAISLG  361

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP++AMP W+DQPTNAK + DVW++GIR    E G+V RE +E C+  VM+ ++G  ++E
Sbjct  362   VPMIAMPHWSDQPTNAKLVEDVWEMGIRPKQDEKGLVRREVIEECIKIVMEEKKGKKIRE  421

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA KWK+LA++AVDEGGSSD+NI+EFVS +
Sbjct  422   NAKKWKELARKAVDEGGSSDRNIEEFVSKL  451



>ref|XP_004296695.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=473

 Score =   451 bits (1161),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 226/456 (50%), Positives = 312/456 (68%), Gaps = 17/456 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSS-----SLIRVESI  1325
             SH+LV P+P+ GH+ PMVQ +KRL S+G  VT++T  S+S  +   +     S +R+E I
Sbjct  17    SHILVFPFPVQGHMNPMVQFAKRLVSKGQRVTIVTTISSSKSLPTLNPTSFGSNLRMEFI  76

Query  1324  PDGVKP-DSGFDAISDWLKDL---VSNNLAEIMSKVTGSGCL----LTTVVYDSIMPWVA  1169
              DG +    G + I + ++      + +L  +M+K+  S       L  VVY S MPW+ 
Sbjct  77    SDGSEQVKGGSETIEESIERFRIATTKSLTSLMTKIRNSSDASQYPLKFVVYHSGMPWIL  136

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN  989
             D+  + G+  A F + S AV  V+HH  +  L  P E     +PSMPPL LNDLP+FV +
Sbjct  137   DVARRQGIDGAPFFTTSLAVATVFHHVHEGTLKLPLEEPRAIMPSMPPLELNDLPTFVSD  196

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQ-FPLKVIAIGPLLPSMY  812
               SY + L+  +++  N +K + + F++FD+LEKE+L+WM SQ +P+K+I  GP +PS +
Sbjct  197   VESYPAFLKLAMNQYSNLKKVNCIFFSSFDKLEKELLKWMESQDWPVKMI--GPTIPSTF  254

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LDKR+ DD +YGLSLFKPN   CM+WLDS++ GSVVY SFGSLA+L  EQ  E+A GL  
Sbjct  255   LDKRLEDDKDYGLSLFKPNVETCMKWLDSKKPGSVVYASFGSLADLSIEQTEELACGLRN  314

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             S   FLWVVR SEQ KLP NF  + SG G++ +WC QL VL+H+AVGCF+THCGWNSTLE
Sbjct  315   SSFNFLWVVRESEQDKLPENFVEEISGKGLVVSWCAQLQVLAHKAVGCFLTHCGWNSTLE  374

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRV-MAGENGMVTREEVERCLVEVMKGER  275
             ALSLGVP+V +P W DQPTNAK++ DVW VG+RV +  ++G+ T+EE+  C+ EVM  E+
Sbjct  375   ALSLGVPMVVLPHWADQPTNAKFVEDVWKVGVRVNVNKKSGLATKEEIAVCIKEVMDKEK  434

Query  274   GVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             G+  ++ +  WK+LAKEAVDEGGSSDKNI+EFV+ +
Sbjct  435   GMKFRKASLMWKELAKEAVDEGGSSDKNIEEFVAKV  470



>ref|XP_006447928.1| hypothetical protein CICLE_v10017682mg [Citrus clementina]
 gb|ESR61168.1| hypothetical protein CICLE_v10017682mg [Citrus clementina]
Length=466

 Score =   451 bits (1159),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 224/457 (49%), Positives = 300/457 (66%), Gaps = 14/457 (3%)
 Frame = -3

Query  1507  AEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRV--  1334
             A  S ++H LV+ +P  GHI PM+Q SKRL  +G+ VT +T       +  +SS I +  
Sbjct  8     ASSSKLAHCLVLAFPSQGHINPMLQFSKRLQHKGIKVTFVTTHFLYKSLHRNSSPIPIAL  67

Query  1333  ESIPDGVKPDSG-------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPW  1175
             E+I DG   D G        DA  +    +    L E++ K+  S   +  +VYDSI+PW
Sbjct  68    EAISDGY--DGGGTAQAESIDAYMERFWQIGPQTLTELVEKMNASSVPVDCIVYDSILPW  125

Query  1174  VADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFV  995
               D+  + GL  A F +QSCAV+ +Y+H ++  L  P  G+ + LP MPPL   D+PS V
Sbjct  126   ALDVAKKFGLLGATFLTQSCAVYCIYYHVNRGFLKLPLTGNEILLPGMPPLEPRDMPSLV  185

Query  994   RNKSSYSSLLRFVLSRNL-NTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
              +  SY ++    L     N  KADW+L NTF ELE+EV EW+   +PLK I  GP +PS
Sbjct  186   YDSGSYPAISDLWLKSQFDNFDKADWVLSNTFYELEEEVAEWLGRHWPLKTI--GPTVPS  243

Query  817   MYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGL  638
             MYLDK++ D+ +YG S+FK NN  C++WL+ Q  GSVVYVSFGS+A LK E++ E+A GL
Sbjct  244   MYLDKQLEDNKDYGFSMFKQNNESCIKWLNDQAKGSVVYVSFGSVATLKIEELEELAWGL  303

Query  637   IQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNST  458
               S   FLW VR SEQSKLP NF  + S  G++ NWCPQL+VL+H+A GCF+THCGWNST
Sbjct  304   KASDKYFLWAVRESEQSKLPENFSDETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNST  363

Query  457   LEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGE  278
             LEALSLGVP+VAMPQWTDQ TN+KY++DVW +G++  A   G+V RE +  C+ E+++GE
Sbjct  364   LEALSLGVPMVAMPQWTDQGTNSKYIMDVWKMGLKAPADGKGIVRREAIAHCISEILEGE  423

Query  277   RGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             RG  +K+N  KW   AKEAV +GGSSDKNI EFV+ +
Sbjct  424   RGKEIKQNTGKWSNFAKEAVAKGGSSDKNIDEFVANL  460



>ref|XP_002532442.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29928.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=457

 Score =   450 bits (1157),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 220/455 (48%), Positives = 302/455 (66%), Gaps = 8/455 (2%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS-LIR  1337
             E A  ++ +H +++PYP  GHI PM+Q +KRL S+GV  T+    + +  +    S LI 
Sbjct  2     EKAANASKAHAVILPYPSQGHINPMLQFAKRLVSKGVKATLANTKAINKSMHSDPSCLID  61

Query  1336  VESIPDGVKPDSGFDAIS-----DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWV  1172
             +E+I DG        A S       LK + + +LA ++ +   S C +T ++YD  +PW 
Sbjct  62    IETISDGFDEGGSAQAKSTEVYLSTLKVVGAKSLANVIKRFKDSDCPVTAIIYDGFLPWA  121

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR  992
              D+  Q G+ A AF +Q+CAV   Y+H  +  L  P    TVSLP +P L +++LPSF+ 
Sbjct  122   LDVAKQFGILAVAFLTQACAVNNAYYHVQRGLLRVPGSSPTVSLPGLPLLQVSELPSFIS  181

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
             +  SY      ++ +  N   ADW+L NTF  LE+EV++WMA ++ L+ +  GP LPS Y
Sbjct  182   DYVSYPGFRNLLVDQFRNIDGADWVLCNTFYRLEEEVVDWMAKKWRLRTV--GPTLPSKY  239

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LDKR+  D +YG++LFKP++  C+ WL ++ + SVVYVSFGS+A L  EQM E+A GL  
Sbjct  240   LDKRLEYDKDYGINLFKPDSGTCLNWLKTKPSRSVVYVSFGSVAELGTEQMEELALGLKG  299

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             S C FLWVVR+S  SKLP NF  +  G G+  +WCPQL+VL+++A+GCF+THCG+NS LE
Sbjct  300   SNCYFLWVVRTSGWSKLPENFIEETYGKGLAVSWCPQLEVLANEAIGCFVTHCGFNSVLE  359

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             ALSLGVP+VAMPQW DQPTNAKY+ DVW VGIR    E G+V RE VE C+ EVM+G++G
Sbjct  360   ALSLGVPIVAMPQWADQPTNAKYVEDVWKVGIRARPNEKGIVRRETVELCIREVMEGQKG  419

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +KENA KWK LAKEA+DE G+SDKNI E V+ I
Sbjct  420   KEIKENANKWKNLAKEAIDESGTSDKNIDELVAKI  454



>emb|CAN80193.1| hypothetical protein VITISV_017236 [Vitis vinifera]
Length=1122

 Score =   470 bits (1210),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 235/435 (54%), Positives = 311/435 (71%), Gaps = 6/435 (1%)
 Frame = -3

Query  1456  GHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESIPDGVKPDSGFDAISD  1280
             GHI PM+Q SKRLAS+G+ VT VI  TS S  +   +S I +E I +        ++I D
Sbjct  684   GHINPMLQFSKRLASKGIKVTLVIAATSNSQSMHAQTSSINIEIISEEFDRRQQEESIED  743

Query  1279  WLKD---LVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAV  1109
             +L+    L S  L  +M K   S      ++YDS++PW  DL   LGL    F +QSCAV
Sbjct  744   YLERFRILASQGLTALMEKHNRSNHPAKLLIYDSVLPWAQDLAEHLGLDGVPFFTQSCAV  803

Query  1108  FAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSY-SSLLRFVLSRNLNTQ  932
              A+Y+H  Q     P E STVS+PSMP L ++DLPSF+  KS   S+LL  VLS+  N +
Sbjct  804   SAIYYHFYQGVFNTPLEESTVSMPSMPLLRVDDLPSFINVKSPVDSALLNLVLSQFSNFK  863

Query  931   KADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNN  752
             K  W+L NTFD+LE +V++WM SQ PL +  IGP +PSMYLDKR+ DD +YGLSLF+ N 
Sbjct  864   KGKWILCNTFDKLEDQVMKWMTSQRPL-IKTIGPTVPSMYLDKRLEDDKDYGLSLFQQNV  922

Query  751   NDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSN  572
             + C+ WLD++  GSVVYVSFGSLA+L +EQM E+A GL +S   F+WVVR  E+ KLP+N
Sbjct  923   DTCITWLDTKGIGSVVYVSFGSLASLGEEQMEELAWGLKRSNSHFMWVVRELEKKKLPNN  982

Query  571   FWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTN  392
             F  + S  G++ +WC QL+VL+H+AVGCF+THCGWNSTLEALSLGVP++AMP+++DQ TN
Sbjct  983   FIEETSEKGLVVSWCCQLEVLAHKAVGCFMTHCGWNSTLEALSLGVPMIAMPRFSDQTTN  1042

Query  391   AKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDE  212
             AK++ D+W VG+RV A E G+V REE+E CL E+M+GERG  +K NAA+WK+LAKEAV+E
Sbjct  1043  AKFVEDIWQVGVRVKADEKGIVKREEIEMCLSEIMEGERGYEMKRNAARWKELAKEAVNE  1102

Query  211   GGSSDKNIKEFVSAI  167
             GGSSDKN++EFV+ +
Sbjct  1103  GGSSDKNLEEFVAEL  1117


 Score =   383 bits (983),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 181/324 (56%), Positives = 240/324 (74%), Gaps = 9/324 (3%)
 Frame = -3

Query  1183  MPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLP  1004
             MPW  D+  +LGL  AAF +QSCAV  +Y+  +Q  L  P EG   S+P MP L +NDLP
Sbjct  1     MPWAQDVATRLGLDGAAFFTQSCAVSVIYYLVNQGALNMPLEGEVASMPWMPVLCINDLP  60

Query  1003  SFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLL  824
             S +  KSS ++ L F+L       K  W+LFNT+D+LE EV+ WMASQ P++  AIGP +
Sbjct  61    SIIDGKSSDTTALSFLL-------KVKWILFNTYDKLEDEVINWMASQRPIR--AIGPTV  111

Query  823   PSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQ  644
             PSMYLDK + DD +YGLSLFK N + C+ WLD++ +GSVVYVSFGS+A+   EQM E+A 
Sbjct  112   PSMYLDKMLEDDRDYGLSLFKQNADSCITWLDTKGSGSVVYVSFGSMASQGKEQMEELAW  171

Query  643   GLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWN  464
             GL +S   F+WVVR S++ K+PSNF  + S  G++ +WCPQL+VL+H+AVGCF+THCGWN
Sbjct  172   GLRKSNTHFMWVVRESKEKKIPSNFLEETSERGLVVSWCPQLEVLAHKAVGCFLTHCGWN  231

Query  463   STLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK  284
             STLEALSLGVP++AMPQ+ DQ TNA+++ DVW VG+RV A E G+  +EE+E C+ E+M+
Sbjct  232   STLEALSLGVPMIAMPQFLDQTTNARFVEDVWRVGVRVKADEKGIDKKEEIEMCIREIME  291

Query  283   GERGVMLKENAAKWKQLAKEAVDE  212
             GERG  +K NA +W++LAKEAV E
Sbjct  292   GERGNEMKTNAQRWRELAKEAVTE  315


 Score =   211 bits (537),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = -3

Query  619  FLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
            + +VVR SE+ KLP N   + S  G++ +WCPQL+VLSH+AVGCF+THCGWNSTLEALSL
Sbjct  534  YQYVVRESEREKLPGNLLEETSEKGLVVSWCPQLEVLSHKAVGCFMTHCGWNSTLEALSL  593

Query  439  GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
            GVP++A+P ++DQPTNAK++ DVW VGIR    + G+V REE+E C+ E M+GE+G  +K
Sbjct  594  GVPMIAIPHFSDQPTNAKFVQDVWGVGIRAKGDDKGIVNREEIEACIREAMEGEKGNEMK  653

Query  259  ENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
             NA +WK+LAKEAV+EGG+SDKNI+EFV+
Sbjct  654  RNALRWKELAKEAVNEGGTSDKNIEEFVA  682


 Score = 99.4 bits (246),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 59/192 (31%), Positives = 92/192 (48%), Gaps = 47/192 (24%)
 Frame = -3

Query  1456  GHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKPDSGFDAISDW  1277
             GHI+PM Q  KRL S+G+ V                                        
Sbjct  382   GHISPMFQFCKRLVSKGLKV----------------------------------------  401

Query  1276  LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAVY  1097
                    +LA+++ K + S      +VYDS++ W  D+  ++GL AA F +QSCAV A+ 
Sbjct  402   ------QSLAQLIEKHSRSDSPAWILVYDSVILWAQDVADRMGLDAAPFFTQSCAVSAIS  455

Query  1096  HHTDQENLTAPTEGSTVSLPSMPPLGLN-DLPSFVRNKSSYSSLLRFVLSRNLNTQKADW  920
             +H +      P EGS +S+PS+PPL  + DLPS V++  SY ++++  L++     K   
Sbjct  456   YHENHGTFKLPLEGSMISIPSLPPLDTDHDLPSLVKDMDSYPAIMKINLNQFSAFHKVKC  515

Query  919   LLFNTFDELEKE  884
             + FNT+ +LE E
Sbjct  516   VFFNTYHKLEHE  527



>gb|KDP35129.1| hypothetical protein JCGZ_10663 [Jatropha curcas]
Length=452

 Score =   449 bits (1155),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 226/445 (51%), Positives = 308/445 (69%), Gaps = 13/445 (3%)
 Frame = -3

Query  1495  TVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIP-D  1319
             T +HVL +P P  GHI PM+Q SKRLAS+G+ VT++T    +   +  +  + +E I  D
Sbjct  10    TETHVLALPLPFQGHINPMLQFSKRLASKGLKVTLLTFID-NQITKTKNGSVNIEFISSD  68

Query  1318  GVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
               + D  F      LK +VS  L EI++K++ SG  ++ ++YDSIMPW  D+  +LGL  
Sbjct  69    ANEEDDYFQN----LKSIVSVKLPEIVAKISESGFPVSCLIYDSIMPWALDMARELGLFG  124

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             A   +QSCAV  +Y+  ++  L  P E   VS+  MP L L DLPSF  +  +Y + L  
Sbjct  125   ACLFTQSCAVSNIYYKANEGKLRTPVEKVPVSIEGMPLLDLYDLPSFFFDLENYPTSLNL  184

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWM-ASQFPLKVIAIGPLLPSMYLDKRVRDDDN  782
             + ++ LN   ADW+ FNTF+ LE EV+  M A QFP+K   IGP +PSM+LDKR++++  
Sbjct  185   LTNQFLNLGDADWVFFNTFNGLEDEVINRMTARQFPIK--PIGPSIPSMFLDKRIQENKE  242

Query  781   YGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVR  602
             YGL+L+KPN   CM+WLDS+ET SV+YVSFGSL  + ++QM E+A GL +S   FLWVVR
Sbjct  243   YGLNLYKPNIESCMKWLDSRETFSVIYVSFGSLCIMGEKQMEEIAFGLKRSNHYFLWVVR  302

Query  601   SSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVA  422
              SE+ KLPSNF  +    G+I  WC QL+VL+H+++GCF+THCGWNST+EALSLGVP+VA
Sbjct  303   ESEEEKLPSNFVEETMEKGMIVTWCNQLEVLAHKSIGCFMTHCGWNSTMEALSLGVPMVA  362

Query  421   MPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKW  242
             MPQW DQ TNAK++ DVW  GIRV   E G+VT+EE+E CL EVM+GE    +++N  KW
Sbjct  363   MPQWCDQTTNAKFVADVWRTGIRVKVDEEGIVTKEEIEMCLKEVMEGE----IRKNCEKW  418

Query  241   KQLAKEAVDEGGSSDKNIKEFVSAI  167
             K+LAKEA++E GSSDKNI+EFV+ +
Sbjct  419   KKLAKEAMEEDGSSDKNIEEFVAKL  443



>ref|XP_010095580.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
 gb|EXB61153.1| UDP-glycosyltransferase 74F2 [Morus notabilis]
Length=455

 Score =   449 bits (1155),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 222/453 (49%), Positives = 304/453 (67%), Gaps = 11/453 (2%)
 Frame = -3

Query  1504  EMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSS-SLIRVES  1328
             EM T SH LV+ YP  GHI P++Q  KRL  +G+ VT++T  S    + V++ SLI +++
Sbjct  5     EMETSSHCLVLSYPTQGHINPLLQFCKRLRHKGLHVTLVTAKSMLKNLHVTAASLISIDT  64

Query  1327  IPDGVKPDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVAD  1166
             I DG   D G       DA  D    +    LA+++ K++G+G  +  VVYDS +PW  D
Sbjct  65    ISDGYD-DGGLRQAGSTDAYLDRFWRVGPATLAQLIKKLSGAGRPVDCVVYDSFLPWALD  123

Query  1165  LVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNK  986
             +  + GL  A F +QSC V  +Y+H  +  L  P   S +S+P  PP   +DLPSFV + 
Sbjct  124   VAKEFGLVGAVFFTQSCTVDCIYYHVHRGLLRVPVSESGISIPGCPPFRPSDLPSFVYDT  183

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
              S+ ++++ V+ +  N +KADW+L NT+ ELE+EV  WM    PL+ I  GP +PSMYLD
Sbjct  184   VSHQAVIKMVVDQFSNVEKADWVLCNTYYELEEEVANWMMKILPLRTI--GPTIPSMYLD  241

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+  DD YG SLF   +  C++WL+S+  GSV Y+SFGSL +++ EQ+ E+A GL +S 
Sbjct  242   KRLEGDDQYGFSLFPSQSEACLKWLNSRPKGSVAYLSFGSLVDVEAEQIEELANGLKRSN  301

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
             C FLWVVR+SE  KLP  F  D S  G++ +WCPQL+VL++ AVGCF+THCGWNSTLEAL
Sbjct  302   CHFLWVVRASEADKLPKGFVDDTSDRGLVVSWCPQLEVLANDAVGCFVTHCGWNSTLEAL  361

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVM  266
             SLGVP+VAMPQW+DQ TNAKY+VDVW VG++    + G+   E VE C+ E++ GERG  
Sbjct  362   SLGVPMVAMPQWSDQFTNAKYIVDVWKVGLKAPTADKGIARGEAVENCVKEII-GERGKE  420

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +K NA KW  LAK+AV+EGGSSDKNI EF++ +
Sbjct  421   MKRNAIKWSSLAKKAVNEGGSSDKNIDEFIAKL  453



>gb|KDP45201.1| hypothetical protein JCGZ_15066 [Jatropha curcas]
Length=457

 Score =   449 bits (1154),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 217/447 (49%), Positives = 304/447 (68%), Gaps = 10/447 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS-SSLIRVESIPDGVK  1310
             HVLV+PYP+ GH+ PM+Q SKRL S+GV  T+    + +  +    +S + +E+I DG  
Sbjct  11    HVLVVPYPLQGHLNPMLQFSKRLVSKGVKATLPNTIAINKSMHADPNSPVDIETISDGFD  70

Query  1309  PDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              + GF      +     L+++ S  LA++++++   G  +T V+YD  MPW  D+  Q G
Sbjct  71    -EGGFAQAESTEIYLSRLQEVGSKTLADLINRLKDLGRPVTAVIYDGFMPWALDVAKQFG  129

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             L    F +QSC+V  +Y+H  +  L  P    TVSLP +P L  ++ PSFV +  SY   
Sbjct  130   LTGVTFFNQSCSVNNIYYHVQRGLLRLPLSEPTVSLPGLPLLHASETPSFVSDSVSYPGF  189

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
                V+++  N  +ADW+LFN+F +LE+E++ WMA ++ L+ I  GP LPSMYLDKR+ DD
Sbjct  190   HHLVMNQFCNIDEADWVLFNSFYKLEEEIVVWMAKRWRLRTI--GPTLPSMYLDKRIEDD  247

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
              +YG+S FKP+  +C++WL  + + SVVYV+FGS+A L  EQM E+A GL  S   FLWV
Sbjct  248   KDYGISTFKPDETNCIKWLQDKPSASVVYVAFGSVARLGAEQMEELAWGLKASNYYFLWV  307

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             VR++EQ+KLP NF  D S   ++  W PQL+VL++++ GCF+THCG+NS LEALS GVP+
Sbjct  308   VRAAEQAKLPKNFKEDTSDKSLVVIWSPQLEVLANESTGCFVTHCGFNSVLEALSFGVPM  367

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             VAMPQWTDQPTNAKY+ DVW +GIR MA E G+V R+ +E CL +VM+GE+G  +KENA 
Sbjct  368   VAMPQWTDQPTNAKYVEDVWKMGIRAMADEKGVVRRQVIEHCLRQVMEGEKGKEIKENAI  427

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             KWK LAKEA+ EGG+SD NI EFV+ +
Sbjct  428   KWKNLAKEAISEGGNSDTNIDEFVAKL  454



>ref|XP_010672479.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Beta vulgaris subsp. 
vulgaris]
Length=455

 Score =   446 bits (1147),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 217/444 (49%), Positives = 311/444 (70%), Gaps = 6/444 (1%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTV-ITPTSTSACIQVSSSLIRVESIPDGVK  1310
             H +V PYPI GHI PM+Q SK+LASRG+ VT+  T T +S  + + S+ I +E+I DG  
Sbjct  11    HAIVFPYPIQGHINPMLQFSKQLASRGLKVTLATTSTFSSKFMMLQSNSITIETISDGSG  70

Query  1309  PDSGFDAISDWLK--DLVS-NNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
              ++  + +  ++K  D+V+  +L E++ K  GSG  +  ++YDS +PW  ++  +L + +
Sbjct  71    ENATTENLDTYVKRFDVVAPRSLTELIEKKIGSGHDIRCLIYDSCIPWALNIAKKLEIYS  130

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             A+F +QSC V  +Y    Q  L+AP +G  V +  MP +   DLPSFVR    +  L + 
Sbjct  131   ASFFTQSCLVGLIYLQAYQGILSAPVKGPGVCVVGMPLIEDRDLPSFVRLVGVHPILEKL  190

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNY  779
             + S+  N   ADW  FNTF+ LE EV+ WM +Q+P+K I  GP +PS YLDKR+ DD +Y
Sbjct  191   MFSQVSNCGDADWRFFNTFEGLESEVVNWMTNQWPVKTI--GPCIPSTYLDKRLPDDKDY  248

Query  778   GLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRS  599
             GLSLF+   N C++WLD+++  SVVY+S GS+A+L +EQM E+A+GL +S   FLWVVR+
Sbjct  249   GLSLFEAQTNACIQWLDARKPASVVYISMGSMASLGNEQMGEIAKGLDKSNKYFLWVVRA  308

Query  598   SEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAM  419
             SE++KLP NF    S   +I +WCPQL+VL+H A+GCF+THCGWNSTLEA+SLGVP++A 
Sbjct  309   SEENKLPLNFKEKTSQKALIVSWCPQLEVLAHHAIGCFVTHCGWNSTLEAISLGVPMIAF  368

Query  418   PQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWK  239
             PQWTDQPTNAK +VD W +G+RV   ENG ++ +E+E C+ EVM+GE    +K NAAKW+
Sbjct  369   PQWTDQPTNAKCIVDHWKIGVRVRVDENGFLSADEIELCIREVMEGEFTKEIKNNAAKWR  428

Query  238   QLAKEAVDEGGSSDKNIKEFVSAI  167
              L ++A+++GGSSD+NI+EFVS +
Sbjct  429   HLTRQAMEQGGSSDRNIEEFVSKL  452



>ref|XP_004289758.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=461

 Score =   446 bits (1146),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 220/455 (48%), Positives = 309/455 (68%), Gaps = 20/455 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPT-------STSACIQVSSSLIRVE  1331
             +H LV PYP  GHI P++Q SK LA +GV VT++T           S C  + +  I +E
Sbjct  10    AHCLVFPYPSQGHINPLLQFSKLLAHKGVKVTLVTTRFIYNTMYKGSCCTALET--ISLE  67

Query  1330  SIPDGVKPDSGFD----AISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWV  1172
             +I DG   D G+     +I  +L+ L    S NLAE++ K++GSGC +  +VYD+ MPW 
Sbjct  68    AISDGF--DEGWKTQGVSIQAYLESLWKVGSQNLAELIEKLSGSGCPVDCLVYDAFMPWP  125

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR  992
              D+  + G+  A F +QSCAV  +Y+H ++  L  P   S +SLP MPPL   DLPSF+ 
Sbjct  126   LDIAKKFGIVGAVFFTQSCAVDNIYNHVNKGVLKLPLTDSEISLPGMPPLEPLDLPSFLS  185

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
             +  SY +    V+ +  N  KADW+L NTF +LE++V++W+A  +P++ I  GP +PS Y
Sbjct  186   HFGSYPAFFEVVIGQFCNVDKADWVLCNTFYDLEEQVVDWLAKFWPVRTI--GPTIPSNY  243

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LD R++DD  YG+ LFK +N+ CM+WL+     SV Y+SFGS A L  EQM E+A GL +
Sbjct  244   LDNRLKDDKGYGVDLFKSSNDACMKWLNKHPKNSVAYISFGSAAQLGLEQMEELAWGLKR  303

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             SK KFLWVVR SE +K+P  F  + +  G++ +WC QL+VL+H+AVGCFITHCGWNSTLE
Sbjct  304   SKSKFLWVVRESEAAKVPEGFIEETAEKGLVVSWCSQLEVLAHEAVGCFITHCGWNSTLE  363

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             +LSLGVP+VAMPQWTDQ TNAKY+ DVW++G++    E G+V REEVE C+ E+M+ ++G
Sbjct  364   SLSLGVPLVAMPQWTDQSTNAKYIKDVWEIGVKAQPDEKGIVRREEVEHCINEIMERDKG  423

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +++NA KWK LA++AV +GGSS++NI EF+  +
Sbjct  424   KEIQKNAMKWKDLARKAVVDGGSSNRNIDEFIETL  458



>emb|CDP13110.1| unnamed protein product [Coffea canephora]
Length=451

 Score =   445 bits (1145),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 221/447 (49%), Positives = 296/447 (66%), Gaps = 10/447 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP+ GH+ PM+Q +KRL   GV +T          +   S+ I VE+I DG  
Sbjct  6     AHCLLLPYPVQGHLNPMLQFAKRLQHEGVKITFAITKFLFETLDEVSASISVETISDGY-  64

Query  1309  PDSGFDAIS---DW--LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
              D G + I     W   + + S  L E++ K+  SGC +  ++YDS +PW  D+   LG+
Sbjct  65    -DEGANGIVMEIYWPRFQKVGSETLTELILKLQDSGCPVDCIIYDSFLPWCLDVAKDLGV  123

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSY-SSL  968
             RA  F +QSCAV  +Y+H  +  L  P E S V +P +PPL  +DLPSFV N   Y +S 
Sbjct  124   RAGVFFTQSCAVNNIYNHVHKGLLKLPLEESGVDIPGLPPLLASDLPSFVSNPGLYPAST  183

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
               F   +  N ++ADW+ FNTF  LE+E + WMA   P+K I  GP +PSMYL+KR+ DD
Sbjct  184   QLFAHDQMENFEEADWIFFNTFYGLEEEAIHWMAKILPVKTI--GPTIPSMYLEKRLEDD  241

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
               YGL+LFKP  N CM WL+ +   SVVYVSFGSLA L+ +QM E+A  L  S   FLWV
Sbjct  242   KQYGLNLFKPMTNACMSWLNERSISSVVYVSFGSLAELEVKQMEELAWSLRASSYNFLWV  301

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             VR SE  KLP +F  +  G G+I +WCPQLDVL+H++VGCF+THCGWNSTLEALSLGVP+
Sbjct  302   VRESESKKLPKDFVKETFGKGLIISWCPQLDVLAHKSVGCFVTHCGWNSTLEALSLGVPM  361

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             +AMPQWTDQ TNAK+++DVW  GI+    E G+V R+ + +C+  VM G++G  + ++A 
Sbjct  362   IAMPQWTDQSTNAKFVMDVWKTGIKAGPDEAGIVRRDAISQCINLVMDGKKGQEISKHAK  421

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             KWK LA++A DEGGSSDKNIK+FVS +
Sbjct  422   KWKDLARQAFDEGGSSDKNIKDFVSKL  448



>dbj|BAG80541.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=463

 Score =   444 bits (1143),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/454 (48%), Positives = 308/454 (68%), Gaps = 17/454 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP  GHI PM+Q SKRL S+GV +T+ T  S    +Q  ++ + +E+I DG  
Sbjct  6     AHCLILPYPSQGHINPMLQFSKRLQSKGVKITIATTKSFLKTMQELTTSVSIEAISDGYD  65

Query  1309  PDSGFDAISDW------LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              D G D    +       K++ S+ LA+++ K+  SGC +  +VYD  +PW  ++    G
Sbjct  66    -DGGRDQAGSFVAYITRFKEVGSDTLAQLIKKLANSGCPVNCIVYDPFLPWAVEVAKDFG  124

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMP-PLGLNDLPSFVRNKSSY  977
             L +AAF +Q+CAV  +Y+H  +  L  P   +   + +P    P+  +D+PSFV +  + 
Sbjct  125   LVSAAFFTQNCAVDNIYYHVHKGVLKLPPTQDDEEILIPGFSCPIESSDVPSFVISPEA-  183

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
             + +L  ++++  N  K DW+L N+F ELEKEV++WM+  +P+K   IGP +PSMYLD R+
Sbjct  184   ARILDMLVNQFSNLDKVDWVLINSFYELEKEVIDWMSKIYPIK--TIGPTIPSMYLDNRL  241

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              DD  YGLS+FKP  N+C+ WL+ Q   SVVYVSFGSLA ++ EQM E+A GL  S   F
Sbjct  242   PDDKEYGLSVFKPMTNECLNWLNHQLISSVVYVSFGSLAKVEVEQMEELAWGLKNSNKNF  301

Query  616   LWVVRSSEQSKLPSNFWPD----KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
             LWVVRS+E+SKLP NF  +        G++ +WCPQL VL H++ GCF+THCGWNSTLEA
Sbjct  302   LWVVRSTEESKLPKNFLEELKLVSENKGLVVSWCPQLQVLEHKSTGCFLTHCGWNSTLEA  361

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             +SLGVP++ MPQWTDQPTNAK + DVW++G+R    E G+V RE +E C+  VM+ E+G 
Sbjct  362   ISLGVPMLTMPQWTDQPTNAKLVKDVWEMGVRAKQDEKGIVRREVIEECIKLVMEEEKGK  421

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             M+KENA KWK+LA++AVDEGGSSDKNI+EFVS +
Sbjct  422   MIKENAQKWKELARKAVDEGGSSDKNIEEFVSKL  455



>ref|XP_006469356.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Citrus sinensis]
 gb|ACS87993.1| UDP-glucosyltransferase family 1 protein [Citrus sinensis]
Length=468

 Score =   445 bits (1144),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 221/452 (49%), Positives = 306/452 (68%), Gaps = 16/452 (4%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ----VSSSLIRVESIPD  1319
             H LV+ YP  GHI P++Q +KRL  +G+ VT++T    S  +      SS+ I +E+I D
Sbjct  15    HCLVLSYPAQGHINPLLQFAKRLDHKGLKVTLVTTCFISKSLHRDSSSSSTSIALEAISD  74

Query  1318  GVKPDSGFDAISDWLKDLVSN-------NLAEIMSKVTGSGCLLTTVVYDSIMPWVADLV  1160
             G   D G  A ++ ++  +         +L E++ ++ GSG  +  +VYDS +PW  D+ 
Sbjct  75    GY--DEGGSAQAESIEAYLEKFWQIGPRSLCELVEEMNGSGVPVDCIVYDSFLPWALDVA  132

Query  1159  HQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSS  980
              + GL  AAF +QSCAV  +Y+H ++  L  P   S + LP MPPL  +D+PSFV +  S
Sbjct  133   KKFGLVGAAFLTQSCAVDCIYYHVNKGLLMLPLPDSQLLLPGMPPLEPHDMPSFVYDLGS  192

Query  979   YSSLLRFVLSRNL-NTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDK  803
             Y ++   V+     N  KADW+L NTF ELE+EV EW+   + LK I  GP +PS+YLDK
Sbjct  193   YPAVSDMVVKYQFDNIDKADWVLCNTFYELEEEVAEWLGKLWSLKTI--GPTVPSLYLDK  250

Query  802   RVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKC  623
             ++ DD +YG S+FKPNN  C++WL+ +  GSVVYVSFGS A LK E+M E+A GL  +  
Sbjct  251   QLEDDKDYGFSMFKPNNESCIKWLNDRAKGSVVYVSFGSYAQLKVEEMEELAWGLKATNQ  310

Query  622   KFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALS  443
              FLWVVR SEQ+KLP NF  + S  G++ NWCPQL+VL+H+A GCF+THCGWNST+EALS
Sbjct  311   YFLWVVRESEQAKLPENFSDETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALS  370

Query  442   LGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVML  263
             LGVP+VAMPQW+DQ TNAKY++DVW  G++V A E G+V RE +  C+ E+++GERG  +
Sbjct  371   LGVPMVAMPQWSDQSTNAKYIMDVWKTGLKVPADEKGIVRREAIAHCIREILEGERGKEI  430

Query  262   KENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ++NA +W   AKEAV +GGSSDKNI +FV+ +
Sbjct  431   RQNAGEWSNFAKEAVAKGGSSDKNIDDFVANL  462



>ref|XP_006447932.1| hypothetical protein CICLE_v10015140mg [Citrus clementina]
 gb|ESR61172.1| hypothetical protein CICLE_v10015140mg [Citrus clementina]
Length=468

 Score =   444 bits (1143),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 221/452 (49%), Positives = 306/452 (68%), Gaps = 16/452 (4%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ----VSSSLIRVESIPD  1319
             H LV+ YP  GHI P++Q +KRL  +G+ VT++T    S  +      SS+ I +E+I D
Sbjct  15    HCLVLSYPAQGHINPLLQFAKRLDHKGLKVTLVTTYFISKSLHRDSSSSSTSIALEAISD  74

Query  1318  GVKPDSGFDAISDWLKDLVSN-------NLAEIMSKVTGSGCLLTTVVYDSIMPWVADLV  1160
             G   D G  A ++ ++  +         +L E++ ++ GSG  +  +VYDS +PW  D+ 
Sbjct  75    GY--DEGGSAQAESIEAYLEKFWQIGPRSLCELVEEMNGSGFPVDCIVYDSFLPWALDVA  132

Query  1159  HQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSS  980
              + GL  AAF +QSCAV  +Y+H ++  L  P   S + LP MPPL  +D+PSFV +  S
Sbjct  133   KKFGLVGAAFLTQSCAVDCIYYHVNKGLLMLPLPDSQLLLPGMPPLEPHDMPSFVYDLGS  192

Query  979   YSSLLRFVLSRNL-NTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDK  803
             Y ++   V+     N  KADW+L NTF ELE+EV EW+   + LK I  GP +PS+YLDK
Sbjct  193   YPAVSDMVVKYQFDNIDKADWVLCNTFYELEEEVAEWLGKLWSLKTI--GPTVPSLYLDK  250

Query  802   RVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKC  623
             ++ DD +YG S+FKPNN  C++WL+ +  GSVVYVSFGS A LK E+M E+A GL  +  
Sbjct  251   QLEDDKDYGFSMFKPNNESCIKWLNDRAKGSVVYVSFGSYAQLKVEEMEELAWGLKATNQ  310

Query  622   KFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALS  443
              FLWVVR SEQ+KLP NF  + S  G++ NWCPQL+VL+H+A GCF+THCGWNST+EALS
Sbjct  311   YFLWVVRESEQAKLPENFSDETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEALS  370

Query  442   LGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVML  263
             LGVP+VAMPQW+DQ TNAKY++DVW  G++V A E G+V RE +  C+ E+++GERG  +
Sbjct  371   LGVPMVAMPQWSDQSTNAKYIMDVWKTGLKVPADEKGIVRREAIAHCIREILEGERGKEI  430

Query  262   KENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ++NA +W   AKEAV +GGSSDKNI +FV+ +
Sbjct  431   RQNAGEWSNFAKEAVAKGGSSDKNIDDFVANL  462



>ref|XP_009590343.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana tomentosiformis]
Length=447

 Score =   444 bits (1141),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 223/444 (50%), Positives = 306/444 (69%), Gaps = 13/444 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITP--TSTSACIQVSSSLIRVESIP-DG  1316
             HVL +P P+ GHI PMV  SK L SR V VT+ T      S     + SLI +ESIP D 
Sbjct  10    HVLALPSPLQGHINPMVHFSKCLVSRRVNVTIFTLDFVCMSMLSDCNGSLINIESIPHDE  69

Query  1315  VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAA  1136
               P+   D + +W +  ++NN   I+ K +     +  +++DS+  W+ DL HQLGL+ A
Sbjct  70    SPPNGNIDDLLEWYQVQITNNFRAIVEKFSD----VKVLIFDSLASWIIDLAHQLGLKVA  125

Query  1135  AFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFV-RNKSSYSSLLRF  959
             AF+   CA  A+Y+H   E    P +GST+SLPS+P L   DLPSFV +++  + ++ R 
Sbjct  126   AFSPIPCAPSAIYYHMHPETSKIPLDGSTLSLPSLPLLEKEDLPSFVYQHRDLHPTIARL  185

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNY  779
                  +N +KADWLLFNTFD LE EV+ W+ +Q+ +K   IGP   +MYLDK+++D    
Sbjct  186   FFGLTINLKKADWLLFNTFDVLENEVINWLRTQYSIK--TIGPTFLTMYLDKQLKDVKEN  243

Query  778   GLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRS  599
             GLS   P+   C++WLD +E GSV+YVSFGSLA+L ++QM E+A GL+ + C FLW+VR+
Sbjct  244   GLS---PSGETCIKWLDLREIGSVIYVSFGSLASLGEKQMEELASGLLMTNCYFLWIVRT  300

Query  598   SEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAM  419
             SE  KLP  F    S  G+I NWC QLDVL+H++VGCF THCGWNSTLE+LSLGVP+V M
Sbjct  301   SEVHKLPKEFMSKLSKKGLIVNWCAQLDVLAHKSVGCFFTHCGWNSTLESLSLGVPMVGM  360

Query  418   PQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWK  239
             PQW D+PTN K+++D+W  GIRV AG++G++TRE +   + E+M+G +GVMLKENA KWK
Sbjct  361   PQWADEPTNVKFIMDIWQTGIRVKAGKDGIITREVIASSIKEIMEGGKGVMLKENAIKWK  420

Query  238   QLAKEAVDEGGSSDKNIKEFVSAI  167
             QLAKEA++EGGSS+KNI+EF+ ++
Sbjct  421   QLAKEAINEGGSSNKNIEEFIQSL  444



>ref|XP_010069220.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW57496.1| hypothetical protein EUGRSUZ_H00261 [Eucalyptus grandis]
Length=475

 Score =   444 bits (1143),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 229/459 (50%), Positives = 304/459 (66%), Gaps = 20/459 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSA----CIQVSSSLIRVESIP  1322
             +HVLV+ +P  GHI PMV+ SKRLAS+G+ V +I P S  +         +S I++E I 
Sbjct  13    THVLVLTFPAQGHINPMVEFSKRLASKGLNVALIIPISEPSKSLHSTNHGTSSIKIEQIS  72

Query  1321  DGVK----PDSGFDAISDWLKDLVSNNLAEIMSKVTGS-GCLLTTVVYDSIMPWVADLVH  1157
             DG +     +   D   +     VS +L   + +   S       +VYDS+MPW  D+  
Sbjct  73    DGFEGVYTDELSLDVYFELFTVSVSKSLTNFIERHQSSQDNPAKVLVYDSVMPWALDIAI  132

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGST-VSLPSMPP----LGLNDLPSFVR  992
             Q G+  A+F +QSC V A+YHH  +  L  P E S      S+PP    L LNDLPSFV 
Sbjct  133   QHGMHGASFFTQSCTVGAIYHHVHRGTLKFPLEDSRGQGHDSVPPVISNLSLNDLPSFVV  192

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
             +  +Y +L++ VL +  N  +A+W LFNTF ELE EV++WM SQ PL  + +GP +PSMY
Sbjct  193   DVDAYPALVKLVLGQFSNVMRANWRLFNTFAELEVEVVKWMGSQCPL--LTVGPTVPSMY  250

Query  811   LDKRVRDDDNYGLSLFKPNNND-CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             LDKR++ D +YGLSLFKPN+ + C+EWLDS++  SVVYVSFGSLA+L +EQM E+A GL 
Sbjct  251   LDKRIQHDKDYGLSLFKPNDAETCIEWLDSKDADSVVYVSFGSLASLGEEQMEEIAIGLK  310

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDKS---GAGIITNWCPQLDVLSHQAVGCFITHCGWN  464
             + K  FLWVVR+SE+ KLP NF  D     G G++  WC QL VLSH +VGCF+THCGWN
Sbjct  311   RMKGNFLWVVRASEEKKLPCNFLQDMELLDGKGLVVKWCDQLQVLSHGSVGCFMTHCGWN  370

Query  463   STLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK  284
             ST+E +SLGVP+V MPQWTDQPTNA ++ +VW VG+RV   E G+VT EE+E C+ EVM 
Sbjct  371   STMEGVSLGVPMVVMPQWTDQPTNAAFITEVWKVGLRVRVNEKGIVTSEEIESCVNEVMG  430

Query  283   GERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             GERG  +K N+ KW++ A+ A++EGGSSD NI +F   I
Sbjct  431   GERGKEIKANSLKWRERARIAMEEGGSSDNNISDFAKNI  469



>ref|XP_007033641.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
 ref|XP_007033642.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
 gb|EOY04567.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
 gb|EOY04568.1| Uridine diphosphate glycosyltransferase 74E2 isoform 1 [Theobroma 
cacao]
Length=442

 Score =   443 bits (1140),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 224/441 (51%), Positives = 308/441 (70%), Gaps = 11/441 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +HVLV+  P  GHI P++Q SKRL S G+ VT+ T  S +  + V    +++E + D ++
Sbjct  10    THVLVLALPGQGHINPILQFSKRLGSEGLEVTLCT-ASVNKSMPVQVGPVKLELVCDELQ  68

Query  1309  PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAF  1130
              D   + + +  K +V+  L +I++K+ G  CL    VYD+  PW  D+  +LGL AAAF
Sbjct  69    VD---NDMLERFKAVVTLRLPQIIAKL-GISCL----VYDAHFPWALDIAKKLGLPAAAF  120

Query  1129  NSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLS  950
              +QSCAV  +Y++  +  +  P   S++S+  +P L   DLPSFV +  SY + L   ++
Sbjct  121   FTQSCAVDTIYYNVHEGLVKLPLAESSLSIDGLPLLQGCDLPSFVYDIGSYPAFLHTCVN  180

Query  949   RNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLS  770
             +  N  +ADW+  NTF  LE+EVL WMASQ P+K  AIGP++PS YLDKRV DD+ YGL 
Sbjct  181   QFSNFMEADWVFINTFTSLEEEVLNWMASQRPIK--AIGPVIPSKYLDKRVEDDEEYGLH  238

Query  769   LFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQ  590
             LFKP  + C+ WL+S+ETGSVVY+SFGSLA L +EQM E A GL  S   FLWVVR +EQ
Sbjct  239   LFKPEIDICINWLNSKETGSVVYISFGSLAALGEEQMQEFASGLQSSNSYFLWVVRETEQ  298

Query  589   SKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQW  410
              KLP++F  + S  G++ +W PQL+VL+H+AVGCF+THCGWNSTLEALSLGVP+VA+P W
Sbjct  299   KKLPASFIGETSDKGLVVSWSPQLEVLAHEAVGCFMTHCGWNSTLEALSLGVPMVAVPHW  358

Query  409   TDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLA  230
             TDQ TNAKY+ DVW VGIR    + G++T+EE++RC+ E+M+G++   +K NA KWK LA
Sbjct  359   TDQTTNAKYVADVWQVGIRARKDDKGIITKEEIQRCIREIMEGDKTKDIKRNAEKWKTLA  418

Query  229   KEAVDEGGSSDKNIKEFVSAI  167
              EAV+ GGSSDKNI+EFV+ +
Sbjct  419   VEAVNVGGSSDKNIREFVAKL  439



>ref|XP_007199115.1| hypothetical protein PRUPE_ppa020804mg [Prunus persica]
 gb|EMJ00314.1| hypothetical protein PRUPE_ppa020804mg [Prunus persica]
Length=463

 Score =   444 bits (1141),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 220/461 (48%), Positives = 302/461 (66%), Gaps = 17/461 (4%)
 Frame = -3

Query  1504  EMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ--------VSS  1349
             E    +H LV+ YPI GHI PM+Q SKRL  +GV VT++T  S    +          S 
Sbjct  2     EKKEKAHCLVLFYPIQGHINPMLQFSKRLQHKGVKVTLVTTRSVHKAMHGDGGGKSPSSF  61

Query  1348  SLIRVESIPDGVKPDSG------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDS  1187
             S I +E+I DG   + G        A  D  +++ S  LAE++ K++ SG     +VYD 
Sbjct  62    SSIALETISDGFDGEGGSSQAESIQAYWDRFREIGSQTLAELIDKLSASGHPADCLVYDQ  121

Query  1186  IMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP-TEGSTVSLPSMPPLGLND  1010
             I+PW  D+  ++G+  A F + SCAV  +Y       L  P    S + LP +P L  +D
Sbjct  122   ILPWALDVAKRVGIAGAPFFTVSCAVTNIYSLVHNGLLKLPLNPDSEILLPGLPTLQPSD  181

Query  1009  LPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGP  830
              PSFV    SY +  +  + +  N  KADW+ ++TF ELE+E ++WMA  +PL+ I  GP
Sbjct  182   TPSFVHAPESYPAFFKLSMEQFSNLDKADWVFYSTFYELEQEAVDWMAKFWPLRTI--GP  239

Query  829   LLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEV  650
              +PSMYLDKR  +D  YGLSL  PN++ CM+WL+++  GSV YVSFGS+A L +E+M E+
Sbjct  240   TIPSMYLDKRHEEDKEYGLSLLNPNSDACMKWLNAKPKGSVAYVSFGSVAKLGEEKMEEL  299

Query  649   AQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCG  470
               GL +SKC FLWVVR+SE +KLP  F  + S  G++ +WCPQL+VL+H+AVGCF+THCG
Sbjct  300   CFGLRRSKCYFLWVVRASESAKLPKGFAEETSEKGLVVSWCPQLEVLAHEAVGCFVTHCG  359

Query  469   WNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEV  290
             WNSTLEALSLGVP+VA+PQW DQ TNAK+++DVW VG++  A E G+V  EE+  C+ E+
Sbjct  360   WNSTLEALSLGVPMVAVPQWVDQGTNAKFIMDVWKVGLKAQADEKGIVRGEEIAHCVREI  419

Query  289   MKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ++GERG  +++NA KWK LAK AVDEGGSSDKNI  F++ +
Sbjct  420   LEGERGKEIRKNALKWKALAKSAVDEGGSSDKNIDGFIAKL  460



>gb|KDP45199.1| hypothetical protein JCGZ_15064 [Jatropha curcas]
Length=469

 Score =   444 bits (1141),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 224/461 (49%), Positives = 312/461 (68%), Gaps = 15/461 (3%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ---VSSSL  1343
             E A  ++  H LV+ YP  GHI PM+Q SKRL ++G+ VT +T  S S  I     SS  
Sbjct  2     EKATKTSTGHCLVLAYPAQGHINPMLQFSKRLQNKGLKVTFVTTKSLSNTIHKPSSSSPS  61

Query  1342  IRVESIPDGVKPD---SGFDAISDWLK---DLVSNNLAEIMSKVTGS--GCLLTTVVYDS  1187
             I +E+I D V  D   S  + I  +L    D+   +L  ++ ++  S   C +  ++YD+
Sbjct  62    IALETISD-VYDDCDQSQRENIEAYLAMFWDIGPKSLTNLVQRLNNSVSECPVDCIIYDA  120

Query  1186  IMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTV-SLPSMPPLGLND  1010
              MPW  D+  +  L +AAF +QSCAV ++Y+H  ++ +  P   S +  +P +PPL L D
Sbjct  121   FMPWGLDVAEKFQLFSAAFFTQSCAVDSIYYHIHKKLIELPVSNSEILRVPGLPPLQLQD  180

Query  1009  LPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGP  830
             LPSFV +  SY +    ++ +  N  KADW+  NTF +LEKEV++W+A  +P K I  GP
Sbjct  181   LPSFVSDFGSYPAFFDMLVDQCSNIDKADWVFCNTFYDLEKEVVDWLAKIWPFKTI--GP  238

Query  829   LLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEV  650
              +PS+YLDK++ +D +YG+S+FKPNN  CM WL  +  GSV YVSFGSL +LK EQM E+
Sbjct  239   CIPSIYLDKQLENDKDYGISIFKPNNEACMNWLSKRPKGSVAYVSFGSLVDLKIEQMEEL  298

Query  649   AQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCG  470
             + GL  SK  FLWVVR +E++KLP  F  + S  GI+ NWCPQL+VLSH+A+GCF+THCG
Sbjct  299   SCGLKGSKSYFLWVVRENEEAKLPKKFIEENSEKGIVVNWCPQLEVLSHEAIGCFVTHCG  358

Query  469   WNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEV  290
             WNS+LEALSLGVP+VAMPQ TDQ TNAKY+ DVW +GI+V   E G+   +E+E C++E+
Sbjct  359   WNSSLEALSLGVPMVAMPQRTDQSTNAKYIRDVWKMGIKVKVDEKGITRGKEIEYCILEL  418

Query  289   MKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ++GE+G  LK NA+KWK+LA+EAV+EGG+S KNI EFV+ +
Sbjct  419   LEGEKGKELKRNASKWKELAREAVNEGGTSYKNIDEFVAKL  459



>ref|XP_009783229.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Nicotiana sylvestris]
Length=462

 Score =   443 bits (1139),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 217/450 (48%), Positives = 308/450 (68%), Gaps = 13/450 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP  GHI PM+Q SKRL S+GV  T+    S    +Q  S+ + VE+I DG  
Sbjct  6     AHCLILPYPAQGHINPMLQFSKRLQSKGVKTTIAATKSFLKNMQELSTSVSVEAISDGYD  65

Query  1309  PDSG------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              D G      F A     K++ S+ L++++ K+T  GC ++ +VYD  +PW  ++  + G
Sbjct  66    -DGGREQAGTFVAYFTRFKEVGSDTLSQLIGKLTNCGCPVSCIVYDPFLPWAVEVAKKFG  124

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEG--STVSLPSMPPLGLNDLPSFVRNKSSYS  974
             L  AAF +QSC V  +Y+H  +  L  P       +S+P +  +  +D+P+F  +  S +
Sbjct  125   LATAAFFTQSCTVDNIYYHVHKGVLKLPPTDIDEEISIPGLLTVETSDVPTFEISPES-A  183

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVR  794
              +L  ++++  N +K DW+L N+F ELEKEV++WM+  +P+K   IGP +PSMYLDKR+ 
Sbjct  184   RVLEMLVNQFSNLEKVDWVLINSFYELEKEVIDWMSEVYPIK--TIGPAIPSMYLDKRLP  241

Query  793   DDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             DD  YGLS+FKP  + C+ WL+ Q   SVVYVSFGSLA ++ EQM E+A GL  S   FL
Sbjct  242   DDKEYGLSVFKPMTDACLNWLNHQPVSSVVYVSFGSLAKVEAEQMEELAWGLRNSNKNFL  301

Query  613   WVVRSSEQSKLPSNFWPD-KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             WVVRS+E+SKLP NF  +  S  G++ +WCPQL VL H+++GCF+THCGWNSTLEA+SLG
Sbjct  302   WVVRSTEESKLPKNFVEELASEKGLVVSWCPQLQVLEHKSIGCFLTHCGWNSTLEAISLG  361

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP+VAMPQW+DQPTNAK + DVW++G+R    E G+V RE +E C+  VM+ E+G M++E
Sbjct  362   VPMVAMPQWSDQPTNAKLVKDVWEMGVRAKQDEKGIVRREIIEECIKIVMEEEKGKMIRE  421

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA KWK+L ++AVDEGGSS++NI+EFVS +
Sbjct  422   NAKKWKELTRKAVDEGGSSNRNIEEFVSKL  451



>ref|XP_007222164.1| hypothetical protein PRUPE_ppa005780mg [Prunus persica]
 gb|EMJ23363.1| hypothetical protein PRUPE_ppa005780mg [Prunus persica]
Length=444

 Score =   442 bits (1137),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 225/444 (51%), Positives = 307/444 (69%), Gaps = 16/444 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTS-TSACIQVSSSLIRVESIPDGV  1313
             +H+LV+P P  GHI PM+Q SKRLAS+G+ VT++T +S T   I+   S++ +E I    
Sbjct  11    THILVVPLPSPGHINPMLQFSKRLASKGLRVTLVTVSSKTHEPIETQLSMVNIEPIYATY  70

Query  1312  KPDSGFD--AISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
             +     D  ++  WL  ++S NL +++SK   +G  +  +VYD+ + W  D+   LG+  
Sbjct  71    EEAGKIDLESMLQWLLTILSKNLPDLISKQERNGYPICCLVYDASLTWALDIAKGLGIAG  130

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             A+F +Q+CAV  VY++  Q+ L  P E   V LP +P L  +DLPS + +  SY S+ + 
Sbjct  131   ASFFTQACAVGTVYYNVQQKLLRVPPEEDRVLLPGLPLLEPHDLPSLINHPGSYPSVFKM  190

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNY  779
             V+ R  N   ADW+  NTFD LE EV+ WM +++P+K   IGP LPSMYLDKR+ DD +Y
Sbjct  191   VIGRFSNITDADWIFCNTFDCLEPEVVSWMRTKWPIK--TIGPTLPSMYLDKRLEDDRDY  248

Query  778   GLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRS  599
             G++ FKPNN+ C++WLDS+E  +VVYVSFGS+ANL ++QM E+A GL +SK  FLWVVR 
Sbjct  249   GINFFKPNNDTCIKWLDSKEASTVVYVSFGSIANLGEKQMEEIALGLKRSKTSFLWVVRE  308

Query  598   SEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAM  419
             SE  KLPSNF    S             VL+H+A+GCF+THCGWNSTLEALSLGVP+VAM
Sbjct  309   SEIQKLPSNFEEQTSE-----------KVLAHRAIGCFMTHCGWNSTLEALSLGVPMVAM  357

Query  418   PQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWK  239
             PQWTDQ TNAK++ D W VG+RV     G+VT+EE+ERC+ +VM+GERG   K N+ +W+
Sbjct  358   PQWTDQLTNAKFVEDEWKVGVRVKVDHMGIVTKEEIERCIAQVMEGERGNEFKRNSMRWR  417

Query  238   QLAKEAVDEGGSSDKNIKEFVSAI  167
             +LA EAVDEGGSSDKNI+EFV+A+
Sbjct  418   ELATEAVDEGGSSDKNIEEFVAAL  441



>ref|XP_009625439.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nicotiana tomentosiformis]
Length=456

 Score =   442 bits (1138),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 219/454 (48%), Positives = 308/454 (68%), Gaps = 13/454 (3%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIP  1322
             MS  +H L++PYPI GHI PM+Q SKRL S+ V +T+         +Q  S+ + +E+I 
Sbjct  1     MSHKAHCLILPYPIQGHINPMLQFSKRLQSKNVKITIAATKFFLKTMQELSTPVSIEAIS  60

Query  1321  DGVKPDSGFDAISDW------LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLV  1160
             DG   D G D    +       K++ SN L++++  +T  G  +  +VYD  +PW  ++ 
Sbjct  61    DGYD-DGGIDQAESFAAYITRFKEVGSNTLSQLIETLTTRGYPVNCIVYDPFLPWAVEVA  119

Query  1159  HQLGLRAAAFNSQSCAVFAVYHHTDQENLT-APTE-GSTVSLPSMPPLGLNDLPSFVRNK  986
              + GL +AAF +QSCAV  +Y+H     L   PTE    +S+P +  +  +D+PSFV   
Sbjct  120   KKYGLASAAFFTQSCAVDNIYYHVHNGVLKLPPTEVDEEISIPGLVTIESSDVPSFVSTP  179

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
              S +  L  ++++  N +  DW+L N+F ELEKEV++WM+  +P+K   IGP +PS+YLD
Sbjct  180   ES-ARALEMLVNQFSNLENIDWVLINSFYELEKEVIDWMSKLYPIK--TIGPTIPSIYLD  236

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+ DD  YGLS+FKP  N+C+ WL+ Q   SVVYVSFGSL  L+ EQM E+A GL  S 
Sbjct  237   KRLPDDKEYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLTKLEPEQMEELAWGLKSSN  296

Query  625   CKFLWVVRSSEQSKLPSNFWPD-KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
               FLWVVRS+E+SKLP+NF  +  S  G++ +WCPQL VL H+++GCF+THCGWNSTLEA
Sbjct  297   KNFLWVVRSTEESKLPNNFLEELASEKGLVVSWCPQLQVLEHKSIGCFLTHCGWNSTLEA  356

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             +SLGVP+VAMPQW+DQPTNAK + DVW +G+R    + G+V RE +E C+  VM+ E+G 
Sbjct  357   ISLGVPMVAMPQWSDQPTNAKLVEDVWGMGVRAKQDDKGIVKREVIEECIRIVMEEEKGK  416

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ++ ENA KWK+LA++AVDEGGSSD+NI+EFVS +
Sbjct  417   IITENAKKWKELARKAVDEGGSSDRNIEEFVSKL  450



>emb|CAN68288.1| hypothetical protein VITISV_017017 [Vitis vinifera]
Length=1085

 Score =   462 bits (1188),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 237/432 (55%), Positives = 306/432 (71%), Gaps = 8/432 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS--LIRVESIPDG  1316
             SH+LV P+P  GHI PM+Q SKRLAS G+ VT++T    +  I+ + S   I +E I DG
Sbjct  6     SHILVFPFPTPGHINPMLQFSKRLASMGLRVTLVTTQPNTKPIEEAQSNYPIHIEPISDG  65

Query  1315  VKPDSGFDAISDWL---KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
              +P     ++  +L   + + S +LA+++ K+  S   +  +VYDS+MPW  D   +LGL
Sbjct  66    FQPGEKAQSVEVYLEKFQKVASQSLAQLVEKLARSKRPIKFIVYDSVMPWALDTAQELGL  125

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLL  965
               A F +QSCAV A+Y+H  Q  +  P EG T S PSMP LG+NDLPSF+ +  SY SLL
Sbjct  126   DGAPFYTQSCAVSAIYYHVSQGMMKIPIEGKTASFPSMPLLGINDLPSFISDMDSYPSLL  185

Query  964   RFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDD  785
             R VL R  N +KA  LL NTFD LE EV++WM SQ+P+K I  GP +PSMYLDKR+ DD 
Sbjct  186   RLVLGRFSNFRKAKCLLINTFDMLEAEVVKWMGSQWPVKTI--GPTIPSMYLDKRLEDDK  243

Query  784   NYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVV  605
             +YGLS    N + C+ WLD+++ GSVVYVSFGSLA+L +EQM E+A GL +SK  FLWVV
Sbjct  244   DYGLSPLNLNVDACITWLDARDIGSVVYVSFGSLASLGEEQMEELAWGLKRSKGYFLWVV  303

Query  604   RSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVV  425
             R  E+ KLPSNF  + +  G++ +WCPQLDVL+H+AVGCF+THCGWNSTLEALSLGVP+V
Sbjct  304   RELEEQKLPSNFIENTADKGLVVSWCPQLDVLAHKAVGCFMTHCGWNSTLEALSLGVPMV  363

Query  424   AMPQWTDQPTNAKYLVDVWDVGIRVMAG-ENGMVTREEVERCLVEVMKGERGVMLKENAA  248
              MPQWTDQ TNAK++ DVW VG+RV A  E G+V REE+E C+ E M+GERG  +K NA 
Sbjct  364   VMPQWTDQMTNAKFVADVWGVGVRVKASDEKGIVKREEIEECIREAMEGERGKEMKRNAE  423

Query  247   KWKQLAKEAVDE  212
             +WK+LAKEA  E
Sbjct  424   RWKELAKEAATE  435


 Score =   404 bits (1038),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 211/431 (49%), Positives = 285/431 (66%), Gaps = 32/431 (7%)
 Frame = -3

Query  1453  HITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGV--KPDSGFDAISD  1280
             HI PM+Q SKRL S+G+ VT++  TS  A    +S  I +E IPDG+  K     DA   
Sbjct  682   HINPMLQFSKRLISKGLKVTLVATTSIDAKSMPTS--INIELIPDGLDRKEKKSVDASMQ  739

Query  1279  WLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAV  1100
               + +VS +L E++ K + S      +VYD+ MPW   +  +LGL  AAF +QSCAV A+
Sbjct  740   LFETVVSQSLPELIEKHSKSDHPANVLVYDASMPWAHGIAERLGLVGAAFFTQSCAVTAI  799

Query  1099  YHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADW  920
             YH+  Q  +  P +G T+ +P MPPLG++DLPSFV++  SY ++   +  +    QK  W
Sbjct  800   YHYVSQ-GVEIPVKGPTLPMPFMPPLGIDDLPSFVKDPGSYPAVWSLISKQVSTFQKVKW  858

Query  919   LLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCM  740
              LFN+FD+LE                           D+R+ DD +YGLSLFKPN + C+
Sbjct  859   ALFNSFDKLE---------------------------DERLEDDKDYGLSLFKPNTDTCI  891

Query  739   EWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPD  560
              WLD+++  SVVYVSFGS+A+L +EQM E+A GL +S   FLWVVR SE+ KLP+NF  +
Sbjct  892   TWLDTKDINSVVYVSFGSMASLGEEQMEELAWGLKRSNSYFLWVVRESEEEKLPTNFVEE  951

Query  559   KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYL  380
              S  G+  +WC Q++VL+H+AVGCF+THCGWNSTLEALS GVP++AMP W DQPTNAK++
Sbjct  952   TSEKGLFVSWCHQVEVLAHKAVGCFMTHCGWNSTLEALSQGVPMIAMPCWADQPTNAKFV  1011

Query  379   VDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDEGGSS  200
              DVW+VG+RV   E G+  REE+E C+ EVM+GERG  +K N  KWK+L KEAV+EGGSS
Sbjct  1012  EDVWEVGVRVTVDEKGIAKREEIEECIREVMEGERGNEMKRNGEKWKELGKEAVNEGGSS  1071

Query  199   DKNIKEFVSAI  167
             D NI+EFV+ +
Sbjct  1072  DSNIEEFVAQL  1082


 Score =   167 bits (424),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/256 (42%), Positives = 148/256 (58%), Gaps = 17/256 (7%)
 Frame = -3

Query  1573  ITRNCDCQFKFW-KLRGVERPEMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGV  1397
             I    D   +FW K+R  +R  + E+    H++V P+P+ GHI PM+Q  KRLAS+G+ V
Sbjct  450   INAFSDSSGEFWRKMRRGKR--VGEI----HIMVFPFPLQGHINPMLQFFKRLASKGLKV  503

Query  1396  TVITPTST---SACIQVSSSL-----IRVESIPDGVKPDSGFDAISDWLKDLVSNNLAEI  1241
             T++   S+   S   Q SSS+        ES PD  + D    A  +  K L S +L+E+
Sbjct  504   TLLMAASSINKSVQDQASSSINIELIANYESDPDKKQED--IKAYLEKFKILASQSLSEV  561

Query  1240  MSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPT  1061
             + K   S      +VYDSIMPW  DL   LGL  A F +QSCAV  +Y+H +Q     P 
Sbjct  562   IEKHNRSDHPAKILVYDSIMPWAQDLAEPLGLEGARFFTQSCAVSTIYYHANQGAFKNPL  621

Query  1060  EGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEV  881
             EGSTVSLPSMP LG+ND+PSF+R   SY + L  +L++ LN QK  W+ FNTF++LE E 
Sbjct  622   EGSTVSLPSMPILGINDMPSFMREMGSYPASLALLLNQFLNLQKVKWVFFNTFNKLEDES  681

Query  880   LEWMASQFPLKVIAIG  833
                   QF  ++I+ G
Sbjct  682   HINPMLQFSKRLISKG  697



>ref|XP_009783231.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nicotiana sylvestris]
Length=459

 Score =   441 bits (1135),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 220/457 (48%), Positives = 306/457 (67%), Gaps = 16/457 (4%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIP  1322
             MS  +H L++PYPI GHI PM+Q SKRL S+ V +T+         +Q  S+ + +E+I 
Sbjct  1     MSHKAHCLILPYPIQGHINPMLQFSKRLQSKNVKITIAATKFFLQTMQELSTPVSIEAIS  60

Query  1321  DGVKPDSG------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLV  1160
             DG   D G      F A     K++ S+ +++++  +T  G  +  +VYD  +PW  ++ 
Sbjct  61    DGYD-DGGIYQAESFAAYITRFKEVGSDTMSQLIETLTTRGYPVNCIVYDPFLPWAVEVA  119

Query  1159  HQLGLRAAAFNSQSCAVFAVYHHTDQENLT-APTE-GSTVSLPSMPPLGLNDLPSFVRNK  986
              + GL  AAF +QSCAV  +Y+H  +  L   PTE    +S+P +  +  +D+PSFV   
Sbjct  120   KKYGLACAAFFTQSCAVDNIYYHVHKGVLKLPPTEVDEEISIPGLVTIESSDVPSFVSTP  179

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
              S +  L  ++++  N +K DW+L N+F ELEKEV +WM+  +P+K   IGP +PS+YLD
Sbjct  180   ES-ARALEMLVNQFSNLEKIDWVLINSFYELEKEVTDWMSKLYPIK--TIGPTIPSVYLD  236

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+ DD  YGLS+FKP  N+C+ WL+ Q   SVVYVSFGSL  L+ EQM E+A GL  S 
Sbjct  237   KRLPDDKEYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLTKLEPEQMEELAWGLKNSN  296

Query  625   CKFLWVVRSSEQSKLPSNFWPD----KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNST  458
               FLWVVRS+E+SKLP NF  +        G++ +WCPQL VL H++VGCF+THCGWNST
Sbjct  297   KNFLWVVRSTEESKLPKNFLEELKLASENKGLVVSWCPQLQVLEHKSVGCFLTHCGWNST  356

Query  457   LEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGE  278
             LEA+SLGVP+VAMPQW+DQPTNAK + DVW++G++    E G+V RE +E C+  VM+ E
Sbjct  357   LEAISLGVPMVAMPQWSDQPTNAKLVEDVWEMGVKAKQDEKGLVRREVIEECIRIVMEEE  416

Query  277   RGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +G M+KEN  KWK+LA+ AVDEGGSSD+NI+EFVS +
Sbjct  417   KGKMIKENTKKWKELARNAVDEGGSSDRNIEEFVSKL  453



>gb|KDP35128.1| hypothetical protein JCGZ_10662 [Jatropha curcas]
Length=448

 Score =   441 bits (1133),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 225/445 (51%), Positives = 305/445 (69%), Gaps = 13/445 (3%)
 Frame = -3

Query  1495  TVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIP-D  1319
             T +HVL +P P  GHI PM+Q SKRLAS+G+ VT+++        +     + +E I  D
Sbjct  10    TETHVLALPLPFQGHINPMLQFSKRLASKGLKVTLLSFIDKQI-TRTKHGSVNIEFISSD  68

Query  1318  GVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
             G K D  F      LK +VS  L EI+++   SG  ++ ++YDS+MPW  D+  +LGL  
Sbjct  69    GNKEDDYFQN----LKSIVSIKLPEIVARNGESGYPVSCLLYDSVMPWALDIARELGLFG  124

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             A   +QSCAV  +Y+   +  L+ P E   VS+  MP L L DLPSF  +  +Y ++L  
Sbjct  125   ACLFTQSCAVSTIYYKAHEGALSTPVEKVPVSIEGMPLLDLYDLPSFFFDLENYPTVLTL  184

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWM-ASQFPLKVIAIGPLLPSMYLDKRVRDDDN  782
             + ++ LNT  ADW+ FNTF ELE EV+  M A +FP+K   IGP +PSM+LDKR++D+ +
Sbjct  185   LGNQFLNTGDADWVFFNTFCELEDEVINGMIARKFPIK--PIGPSIPSMFLDKRIQDNKD  242

Query  781   YGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVR  602
             YGL+L KPN  + M+WLDS ET SV+YVSFGSL  + ++QM E+A GL +S   FLWVVR
Sbjct  243   YGLNLHKPNIENYMKWLDSNETCSVIYVSFGSLCIMGEKQMEEIAFGLKRSNHYFLWVVR  302

Query  601   SSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVA  422
              SE+ KLPSNF  +    G+I  WC QL+VL+H++ GCF+THCGWNST+EALSLGVP+VA
Sbjct  303   ESEEEKLPSNFVEETMEKGMIVTWCNQLEVLAHKSTGCFMTHCGWNSTMEALSLGVPMVA  362

Query  421   MPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKW  242
             MPQW DQ TNAK++ DVW  G+RV   E G+VT+EE+E CL EVM+GE    +++N  KW
Sbjct  363   MPQWCDQTTNAKFVADVWRTGVRVKVDEEGIVTKEEIEMCLKEVMEGE----IRKNCEKW  418

Query  241   KQLAKEAVDEGGSSDKNIKEFVSAI  167
             K+LAKEA+DE GSSDKN++EFV+ +
Sbjct  419   KKLAKEAMDEDGSSDKNVEEFVAKL  443



>ref|XP_007049529.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
 gb|EOX93686.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
Length=459

 Score =   441 bits (1133),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 222/451 (49%), Positives = 312/451 (69%), Gaps = 14/451 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPT--STSACIQVSSSLIRVESIPDG  1316
             +HVL+ PYP  GHI PMVQ +KRL S GV  T++T    S S    ++SS + +++I DG
Sbjct  10    AHVLIFPYPGQGHINPMVQFAKRLVSEGVKATLVTTVFLSKSRFSDLTSS-VDLQTISDG  68

Query  1315  VKPDSGFDAISD---WLK---DLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQ  1154
                + G+D       +L+    + S +LA ++ K+  +G  +  +VYD  +PW  D+  Q
Sbjct  69    FD-EGGYDQAGSADVYLQTFWSVGSKSLATLIKKLVDAGHPIHGLVYDGFLPWALDVAKQ  127

Query  1153  LGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTV-SLPSMPPLGLNDLPSFVRNKSSY  977
              G+R+A F +QSCAV +VY+H  +  L  P +GS V SLP +PPL +++LPSFV    SY
Sbjct  128   FGIRSAVFFTQSCAVNSVYYHVSRGLLQLPLQGSNVISLPGLPPLEVSELPSFVFRHGSY  187

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
              + L  V+++  N  +ADW+ FN F ELEKE ++WM S+F  KV+ +GP +PS+YLD R+
Sbjct  188   PAWLDVVVNQFSNVDEADWVFFNIFYELEKEAVDWM-SKF-WKVMTVGPTVPSLYLDGRL  245

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              +D +YG++LFKP+ + CM WL+ +   SVVYVSFGS A+L  EQ+ E+A  L    C F
Sbjct  246   ENDKDYGMNLFKPSTSACMSWLNGKPKSSVVYVSFGSFASLGVEQIAELAWALKGCNCYF  305

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR SE++KLP  F  + +  G++  WCPQL+VLSH++ GCF+THCG+NS LEALSLG
Sbjct  306   LWVVRESEEAKLPGKFIEETAEKGLVVTWCPQLEVLSHESTGCFLTHCGFNSVLEALSLG  365

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGEN-GMVTREEVERCLVEVMKGERGVMLK  260
             VP++AMPQWTDQ TNAK++ DVW +GIR    E  G+VTRE +E+C+ E+ +GE+G  +K
Sbjct  366   VPMLAMPQWTDQGTNAKHVEDVWGIGIRARPDEKLGLVTREIIEQCIKELTEGEKGKEIK  425

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +NA KWK LAK+AVDEGGSSDKNI EF++ +
Sbjct  426   KNAIKWKNLAKKAVDEGGSSDKNINEFIAKL  456



>gb|KDO43525.1| hypothetical protein CISIN_1g012194mg [Citrus sinensis]
Length=468

 Score =   440 bits (1132),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 220/452 (49%), Positives = 304/452 (67%), Gaps = 16/452 (4%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ----VSSSLIRVESIPD  1319
             H LV+ YP  GHI P++Q +KRL  +G+ VT++T    S  +      SS+ I +E+I D
Sbjct  15    HCLVLSYPAQGHINPLLQFAKRLDHKGLKVTLVTTYFISKSLHRDSSSSSASIALEAISD  74

Query  1318  GVKPDSGFDAISDWLKDLVSN-------NLAEIMSKVTGSGCLLTTVVYDSIMPWVADLV  1160
             G   D G  A ++ ++  +         +L E++ K+ GS   +  +VYDS +PW  D+ 
Sbjct  75    GY--DQGGSAQAESIEAYLEKFWQIGPRSLCELVEKMNGSVVPVDCIVYDSFLPWALDVA  132

Query  1159  HQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSS  980
              + GL  AAF +QSCAV  +Y+H ++  L  P   S + LP MPPL   D+PSFV +  S
Sbjct  133   KKFGLVGAAFLTQSCAVDCIYYHVNKGLLKLPLPDSQLLLPGMPPLEPQDMPSFVYDLGS  192

Query  979   YSSLLRFVLSRNL-NTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDK  803
             Y ++   V+     N  KADW+L NTF ELE+EV EW+   + LK I  GP +PS+YLDK
Sbjct  193   YPAVSDMVVKYQFDNIDKADWVLCNTFYELEEEVAEWLGKLWSLKTI--GPTVPSLYLDK  250

Query  802   RVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKC  623
             ++ DD +YG S+FKP+N  C++WL+ +  GSVVYVSFGS A LK E+M E+A GL  +  
Sbjct  251   QLEDDKDYGFSMFKPDNESCIKWLNDRAKGSVVYVSFGSYAPLKVEEMEELAWGLKATNQ  310

Query  622   KFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALS  443
              FLWVVR SEQ+KLP NF  + S  G++ NWCPQL+VL+H+A GCF+THCGWNST+EALS
Sbjct  311   YFLWVVRESEQAKLPENFSDETSQKGLVVNWCPQLEVLAHEAAGCFLTHCGWNSTMEALS  370

Query  442   LGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVML  263
             LGVP+VAMPQW+DQ TN KY++DVW +G++V A E G+V RE +  C+ E+++GERG  +
Sbjct  371   LGVPMVAMPQWSDQSTNGKYIMDVWKMGLKVPADEKGIVRREAIAHCISEILEGERGKEI  430

Query  262   KENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ++NA KW   AKEAV +GGSSDKNI +FV+ +
Sbjct  431   RQNAGKWSNFAKEAVAKGGSSDKNIDDFVANL  462



>ref|XP_002529822.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF32571.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=453

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 222/446 (50%), Positives = 308/446 (69%), Gaps = 6/446 (1%)
 Frame = -3

Query  1504  EMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESI  1325
             E +T + VL +P P  GH+ PM+Q SKR+AS+G+ VT+++   T+  +   +  I VE  
Sbjct  5     ERATETSVLALPLPFQGHMNPMLQFSKRIASKGIRVTLVS--FTNKVLIGENGPINVEVF  62

Query  1324  PDGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
             P     +   D   + L+  +   L +I++K + SG  ++ V+YDS+MPWV D+  QLGL
Sbjct  63    PAYSSEED--DGYLNNLQATMRQTLPQIVAKHSESGFPVSCVIYDSLMPWVLDIARQLGL  120

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLL  965
               A+  +QS AV  +Y+   +  L  PTE   VS+  MPPL + DLPSF      Y + L
Sbjct  121   PGASLFTQSSAVNHIYYKLHEGKLNVPTEQVLVSVEGMPPLEIYDLPSFFYELEKYPTCL  180

Query  964   RFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDD  785
              F+ ++ LN ++ADW+ FNTF+ LE EVL  M SQ+P+K  +IGP +PSMYLDKRV D+ 
Sbjct  181   TFMANQFLNIEEADWVFFNTFNSLEDEVLRGMTSQWPVK--SIGPTIPSMYLDKRVEDNR  238

Query  784   NYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVV  605
              YG++LFKPN  +CM+WLD +E  SVVYVSFGS+ +L ++QM E+A GL +S   FLWVV
Sbjct  239   EYGINLFKPNVENCMKWLDLREASSVVYVSFGSITDLGEKQMQELANGLKRSGHYFLWVV  298

Query  604   RSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVV  425
             +  E+ KLPSNF  +    G+I NWC QL+VL+H+++ CF+THCGWNSTLEA SLGVP+V
Sbjct  299   KEPEEKKLPSNFVEETLEKGLIVNWCSQLEVLAHKSIRCFMTHCGWNSTLEAFSLGVPMV  358

Query  424   AMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAK  245
             AMPQW DQ TNAKY+ DVW VG+RV   E G+VT EE+E  + EVM+G +   +++N+ K
Sbjct  359   AMPQWADQSTNAKYVADVWHVGVRVKLDEEGIVTEEEIELRIREVMEGVKANEIRKNSEK  418

Query  244   WKQLAKEAVDEGGSSDKNIKEFVSAI  167
             WK+LA+EAVDEGGSS+KNI+EFV+ +
Sbjct  419   WKKLAREAVDEGGSSEKNIEEFVAEL  444



>ref|XP_007033645.1| UDP-glucosyltransferase 74F2, putative [Theobroma cacao]
 gb|EOY04571.1| UDP-glucosyltransferase 74F2, putative [Theobroma cacao]
Length=455

 Score =   439 bits (1130),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 223/455 (49%), Positives = 304/455 (67%), Gaps = 10/455 (2%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSS-SLIRV  1334
             M + +  +HVL +PYP  GH+ PM+Q SKRLAS+G+  T  T    S  ++  S   +  
Sbjct  1     MEKKAYRAHVLALPYPSQGHVNPMLQFSKRLASKGIKATFATTLFISHTMKPESLGSVEF  60

Query  1333  ESIPDGVKPDSGF---DAISDWLKDLV---SNNLAEIMSKVTGSGCLLTTVVYDSIMPWV  1172
             ++I  G     GF   ++I D+LK L    S  LA+++ K   S      V+YDS +PW 
Sbjct  61    DTISHGCD-QGGFSEAESIHDYLKRLEAAGSKTLADLIIKYKNSPHPFDCVIYDSFLPWA  119

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR  992
              D+  Q GL  AAF +Q+CAV  +Y++     L+ P     VS+P +P L L D+PSF+ 
Sbjct  120   LDVAKQFGLVGAAFFTQACAVNYIYYYAHHGLLSLPVSSEPVSIPGLPLLQLRDMPSFIY  179

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
                SY      VLS+  N+ KAD++L NTF +LE E +E M+   PL  + IGP +PSMY
Sbjct  180   VAGSYPFYFELVLSQFSNSDKADFVLVNTFYKLEHEAVESMSKVSPL--LTIGPTIPSMY  237

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LD+RV  D++Y L+LFK +++   EWL ++  GSVV+VSFGS+ANL  +QM E+A G+ Q
Sbjct  238   LDQRVETDEDYDLNLFKLDSSSSTEWLSTKPPGSVVFVSFGSMANLSVKQMEELAWGIKQ  297

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             S   FLWVVRSSE++K+P+ F  +    G+I NW PQ+ VL++++VGCF THCGWNST+E
Sbjct  298   SNFYFLWVVRSSEEAKIPNKFVQEMGDKGVIANWIPQMQVLANESVGCFFTHCGWNSTIE  357

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             AL LGVP+VAMPQWTDQ T+AK++ DVW VG+RV   ENG+V R+E+E C+ +VM+GE G
Sbjct  358   ALCLGVPMVAMPQWTDQTTDAKFVEDVWKVGVRVEVDENGIVNRDEIEYCIRQVMEGETG  417

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              ++KENA KWKQLA EAV EGGSSDKNI EFVS +
Sbjct  418   KVMKENAKKWKQLAIEAVSEGGSSDKNINEFVSKL  452



>emb|CAN67248.1| hypothetical protein VITISV_008683 [Vitis vinifera]
Length=422

 Score =   438 bits (1126),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 217/441 (49%), Positives = 294/441 (67%), Gaps = 33/441 (7%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H++V+PY   GHI PM+Q S+RLAS+G+       +                       
Sbjct  10    THIMVLPYCSQGHINPMLQFSRRLASKGLEERKEEESIEDYV------------------  51

Query  1309  PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAF  1130
                      +  + + S +LAE++ K + S      +VYDS+MPW  D+   LGL    F
Sbjct  52    ---------ERFRMVASQSLAELIKKHSRSSHPAKFLVYDSMMPWAQDVAEPLGLDGVPF  102

Query  1129  NSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLS  950
              +QSCAV  +Y+H +Q  L  P EG TVS+PSMP L +NDLPSF+ +K+    +L F+L 
Sbjct  103   FTQSCAVSTIYYHFNQGKLKTPLEGYTVSIPSMPLLCINDLPSFINDKT----ILGFLLK  158

Query  949   RNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLS  770
             +  N QK  W+ FNTFD+LE+EV++WMAS  P+K I  GP +PSMYLDKR+ +D  YGLS
Sbjct  159   QFSNFQKVKWIWFNTFDKLEEEVMKWMASLRPIKTI--GPTVPSMYLDKRLEEDKEYGLS  216

Query  769   LFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQ  590
             LFK N +  + WLD +  GSVVY SFGS+A+L +EQM E+A GL ++   F+WVVR SE+
Sbjct  217   LFKQNVDAYIAWLDLKGIGSVVYASFGSMASLGEEQMEEIAWGLKRNNTHFMWVVRESEE  276

Query  589   SKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQW  410
              KLP  F  +    G++ +WC QL+VLSH+AVGCF++HCGWNSTLEALSLGVP++AMP +
Sbjct  277   KKLPCKFLEETCEKGLVVSWCSQLEVLSHKAVGCFMSHCGWNSTLEALSLGVPMIAMPHF  336

Query  409   TDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLA  230
             +DQ TNAK++ DVW VG+RV   E G+V REE+E C+ E+M+GERG  ++ NA  WK+LA
Sbjct  337   SDQTTNAKFIEDVWGVGVRVKPDEKGLVKREEIEMCIREMMQGERGNEMRRNAEMWKELA  396

Query  229   KEAVDEGGSSDKNIKEFVSAI  167
             KEAV EGG+SDKNI+EFV+ I
Sbjct  397   KEAVTEGGTSDKNIEEFVAEI  417



>ref|XP_010069221.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=464

 Score =   439 bits (1129),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 232/454 (51%), Positives = 306/454 (67%), Gaps = 20/454 (4%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ-VSSSLIRVESIPDGVK  1310
             HVLV+ +P+ GHI PM+Q S+RLAS+G+ VT + P ST      V+SS I V  IPDG +
Sbjct  8     HVLVLTHPVQGHINPMLQFSRRLASKGLKVTFLIPISTKKSPNLVNSSSINVVYIPDGFE  67

Query  1309  P-DSGFDAISDWLKDL---VSNNLAEIMSKVTGSGC---LLTTVVYDSIMPWVADLVHQL  1151
               D    ++ D LK     V+++L + + K     C       +VYDS M W  D+  Q 
Sbjct  68    DVDREKLSMGDALKHFQVSVTHSLNDFIEK--HQACEEKPAKVLVYDSFMFWALDIAIQH  125

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTE-----GSTVSLPS-MPPLGLNDLPSFVRN  989
             G+  A F +QSC V   Y+   Q  +  P E     G  VS P  M  LG +D PSFV +
Sbjct  126   GMHGAPFFTQSCVVCCTYYMIHQGRVKLPLEAAHGQGHVVSDPPVMSVLGPDDFPSFVVD  185

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
              +SY   L FVL +  N Q+A W LFN+F ELE+E+++WM +Q+   ++ IGP +PS+YL
Sbjct  186   VNSYPGALPFVLGQFSNIQRAKWFLFNSFAELEEEIVKWMGNQW--SIMTIGPTIPSVYL  243

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR+ DD +YGLSLFKP    C++WLDS+   SV+YVSFGS+A+L ++QM E+A GL + 
Sbjct  244   DKRLEDDKDYGLSLFKPEAEACLKWLDSKPPKSVLYVSFGSMASLGEDQMEELANGLKRM  303

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGA--GIITNWCPQLDVLSHQAVGCFITHCGWNSTL  455
             K  FLWVVR SE+ KLP NF  D   A  G++  WC QL VLSH +VGCF+THCGWNSTL
Sbjct  304   KSNFLWVVRQSEEKKLPRNFLQDVGIADQGLVVKWCNQLQVLSHGSVGCFMTHCGWNSTL  363

Query  454   EALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGER  275
             EALSLGVP+V MPQWTDQPTNA ++V+VW VG+RV A E  +VT EE+E C+  VM+GER
Sbjct  364   EALSLGVPMVVMPQWTDQPTNATFIVEVWKVGLRVRANERRIVTGEEIESCVNHVMEGER  423

Query  274   GVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
             G M+++N+ +WK++A+EAVDEGGSSDKNI EFV+
Sbjct  424   GEMIRKNSLRWKKMAREAVDEGGSSDKNILEFVT  457



>ref|XP_010095579.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
 gb|EXB61152.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
Length=456

 Score =   439 bits (1128),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 222/456 (49%), Positives = 303/456 (66%), Gaps = 10/456 (2%)
 Frame = -3

Query  1510  MAEMSTVS-HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS----  1346
             MAE   +S H LV+ +P+ GHI P++Q  KRL  +G+ VT++T  S    + V+++    
Sbjct  1     MAERGMISSHCLVLSFPLQGHINPLLQFCKRLHHKGLHVTLVTAKSILRTLNVTAASAVD  60

Query  1345  LIRVESIPDGV---KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPW  1175
              I +++I DG    + +  FDA  D    +   +LA+++ K++ +G  +  +VYDS +PW
Sbjct  61    AISLDAISDGYDDGEKEESFDAYFDRFWRVGPVSLAQLIRKLSETGRPVDCIVYDSFIPW  120

Query  1174  VADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFV  995
               D+  + GL  AAF +QSCAV ++Y+H     L  P   S VS+P  PP   +DLPSFV
Sbjct  121   ALDVAKEFGLIGAAFFTQSCAVVSIYNHVQGGLLRVPVSESEVSIPGCPPFRPSDLPSFV  180

Query  994   RNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSM  815
              +  SY  + +  + +  N +KADW+L NT  ELE+EV  WM    PLK   IGP +PSM
Sbjct  181   YDTVSYPVITKVAVDQFSNVEKADWVLCNTCYELEEEVANWMMKILPLK--TIGPTIPSM  238

Query  814   YLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             +LDKR+  D  YG SLF   +  C++WLDS+  GSV Y+SFGSLA ++ EQ+ E+A GL 
Sbjct  239   FLDKRLEGDKLYGFSLFPSQSEACLKWLDSRPKGSVAYLSFGSLAVVEAEQIDELANGLK  298

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTL  455
             +S C FLWVVR+SE  KLP  F  D SG G++ +WCPQL+VLS+ AVGCF+THCGWNSTL
Sbjct  299   RSNCHFLWVVRASEADKLPKGFVDDTSGKGLVVSWCPQLEVLSNDAVGCFVTHCGWNSTL  358

Query  454   EALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGER  275
             EALSLGVP+V +PQW+DQ TNAKY+VDVW VG+R    E G+V  E VE  + E+++GER
Sbjct  359   EALSLGVPMVVIPQWSDQFTNAKYVVDVWKVGLRAPTDEKGIVRGEAVEHYVKEIIEGER  418

Query  274   GVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             G  +K NA KW  LAK AV+EGGSSDKNI EF++ +
Sbjct  419   GREMKMNAIKWSALAKMAVNEGGSSDKNIDEFIAKL  454



>gb|KCW57495.1| hypothetical protein EUGRSUZ_H00261 [Eucalyptus grandis]
Length=472

 Score =   439 bits (1128),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 228/459 (50%), Positives = 302/459 (66%), Gaps = 23/459 (5%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSA----CIQVSSSLIRVESIP  1322
             +HVLV+ +P  GHI PMV+ SKRLAS+G+ V +I P S  +         +S I++E I 
Sbjct  13    THVLVLTFPAQGHINPMVEFSKRLASKGLNVALIIPISEPSKSLHSTNHGTSSIKIEQIS  72

Query  1321  DGVK----PDSGFDAISDWLKDLVSNNLAEIMSKVTGS-GCLLTTVVYDSIMPWVADLVH  1157
             DG +     +   D   +     VS +L   + +   S       +VYDS+MPW  D+  
Sbjct  73    DGFEGVYTDELSLDVYFELFTVSVSKSLTNFIERHQSSQDNPAKVLVYDSVMPWALDIAI  132

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGST-VSLPSMPP----LGLNDLPSFVR  992
             Q G+  A+F +QSC V A+YHH  +  L  P E S      S+PP    L LNDLPSFV 
Sbjct  133   QHGMHGASFFTQSCTVGAIYHHVHRGTLKFPLEDSRGQGHDSVPPVISNLSLNDLPSFVV  192

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
             +  +Y +L++ VL +  N  +A+W LFNTF ELE   +EWM SQ PL  + +GP +PSMY
Sbjct  193   DVDAYPALVKLVLGQFSNVMRANWRLFNTFAELE---VEWMGSQCPL--LTVGPTVPSMY  247

Query  811   LDKRVRDDDNYGLSLFKPNNND-CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             LDKR++ D +YGLSLFKPN+ + C+EWLDS++  SVVYVSFGSLA+L +EQM E+A GL 
Sbjct  248   LDKRIQHDKDYGLSLFKPNDAETCIEWLDSKDADSVVYVSFGSLASLGEEQMEEIAIGLK  307

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDKS---GAGIITNWCPQLDVLSHQAVGCFITHCGWN  464
             + K  FLWVVR+SE+ KLP NF  D     G G++  WC QL VLSH +VGCF+THCGWN
Sbjct  308   RMKGNFLWVVRASEEKKLPCNFLQDMELLDGKGLVVKWCDQLQVLSHGSVGCFMTHCGWN  367

Query  463   STLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK  284
             ST+E +SLGVP+V MPQWTDQPTNA ++ +VW VG+RV   E G+VT EE+E C+ EVM 
Sbjct  368   STMEGVSLGVPMVVMPQWTDQPTNAAFITEVWKVGLRVRVNEKGIVTSEEIESCVNEVMG  427

Query  283   GERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             GERG  +K N+ KW++ A+ A++EGGSSD NI +F   I
Sbjct  428   GERGKEIKANSLKWRERARIAMEEGGSSDNNISDFAKNI  466



>ref|XP_007049526.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
 gb|EOX93683.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
Length=459

 Score =   438 bits (1126),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/450 (48%), Positives = 303/450 (67%), Gaps = 12/450 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTS-ACIQVSSSLIRVESIPDGV  1313
             +HVL+ PYP  GHI PM+Q +KRL S+GV  T+++    S       +S I +++I DG 
Sbjct  10    AHVLIFPYPAQGHINPMLQFAKRLVSKGVKATLVSTVFLSKTTFSDPTSSIDMQTISDGF  69

Query  1312  KPDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
               + G+      D        + S +LA ++ K+  +G  +  +VYD+ + +  D+  Q 
Sbjct  70    D-EGGYNQAGSPDVYLPTFWSVGSKSLASLIKKLVDAGHPIDAIVYDAFLDFALDVAKQF  128

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             G+R AAF +Q+CAV +VY+H  +  L  P     VSLP +PPL +++LPSFV +  SY +
Sbjct  129   GIRTAAFFTQACAVNSVYYHVSRGLLQLPLPEPKVSLPGLPPLEVSELPSFVCHHGSYPA  188

Query  970   LLRFVLSRNL-NTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVR  794
                 V++    N  +ADW+  N F +LEKE ++WM SQF   V+ IGP +PSMYLDKR+ 
Sbjct  189   WFDVVVNHQFSNINEADWVFLNIFYDLEKEAVDWM-SQF-WNVMTIGPTIPSMYLDKRLE  246

Query  793   DDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             +D +YG+ LFKP  + CM WL  +   SVVYVSFGS+A L  EQM E+A GL  S C F+
Sbjct  247   NDKHYGMHLFKPKTSTCMSWLSGKPKSSVVYVSFGSMAELDVEQMAEIAWGLKGSNCYFM  306

Query  613   WVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGV  434
             WVVR SE++KLP NF  + +  G++ +WCPQL+VLSH+++GCF+THCG+NS LEALSLGV
Sbjct  307   WVVRESEEAKLPQNFIEETAEKGLVVSWCPQLEVLSHESIGCFLTHCGFNSVLEALSLGV  366

Query  433   PVVAMPQWTDQPTNAKYLVDVWDVGIRVMAG-ENGMVTREEVERCLVEVMKGERGVMLKE  257
             P++AMPQWTDQ TNAKY+ DVW++G+R     ENG VTRE VE C+ E+ +GE+G   ++
Sbjct  367   PLLAMPQWTDQGTNAKYVEDVWEIGMRARPDEENGFVTREIVEHCIKELTEGEKGKEARK  426

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA+KWK LA++AVDEGG SDKNI EFV+ +
Sbjct  427   NASKWKNLARKAVDEGGRSDKNIDEFVTKL  456



>ref|XP_009783230.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Nicotiana sylvestris]
Length=458

 Score =   438 bits (1126),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 211/453 (47%), Positives = 307/453 (68%), Gaps = 16/453 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP  GHI PM+Q SKRL S+ V +T+ T  S    +Q  S+L+ +E+I DG  
Sbjct  6     AHCLILPYPAQGHINPMLQFSKRLQSKSVKITIATTKSFLKTMQELSTLVSIEAISDGYD  65

Query  1309  PDSGFDAISDW------LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              D G +    +       K++ S+ L+ ++  +T  GC +  ++YD  +PW  ++  + G
Sbjct  66    -DGGHEQAGSFVTYITRFKEVGSDTLSHLIETLTTRGCPVNCIIYDPFLPWAVEVAKKYG  124

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLT-APTE-GSTVSLPSMPPLGLNDLPSFVRNKSSYS  974
             L  AAF +QSCAV  +Y++  +  +   PTE    V +P +  +  +D+P+FV N  S +
Sbjct  125   LACAAFFTQSCAVDNIYYYVHKGVIKLPPTEVDEQVLVPGLLTIEKSDVPTFVSNPES-A  183

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVR  794
              +L  ++ +  N +  DW+L N+F ELEKE+++WM+  +P+K   IGP +PS+YLDKR+ 
Sbjct  184   KILEMLVDQFSNLENVDWVLINSFYELEKEIIDWMSKLYPIK--TIGPTIPSIYLDKRLP  241

Query  793   DDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             +D  YGLS+FKP  N+C+ WL+ Q   SVVYVSFGS A L+ +QM E+A GL  S   FL
Sbjct  242   NDKEYGLSVFKPMTNECLNWLNHQPISSVVYVSFGSYAKLEPDQMEELAWGLRNSNKNFL  301

Query  613   WVVRSSEQSKLPSNFWPD----KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
             WVVRS+E+SKLP N+  +        G++ +WCPQL +L H+++GCF+THCGWNSTLEA+
Sbjct  302   WVVRSNEESKLPKNYLEELKLASENKGLVVSWCPQLQILEHKSIGCFLTHCGWNSTLEAI  361

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVM  266
             SLGVP+VAMPQW+DQPTNAK + DVW++G+R    + G+V RE +E C+  VM+ E+G M
Sbjct  362   SLGVPMVAMPQWSDQPTNAKLVEDVWEIGVRAKQDDKGIVRREVIEECIRLVMEEEKGKM  421

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +KENA KWK+LA+ AVDEGGSSD+NI+EFVS +
Sbjct  422   IKENAKKWKELARNAVDEGGSSDRNIEEFVSKL  454



>ref|XP_004289756.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=461

 Score =   437 bits (1124),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 217/455 (48%), Positives = 308/455 (68%), Gaps = 20/455 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPT-------STSACIQVSSSLIRVE  1331
             +H LV PYP  GHI P++Q SK L  +GV VT++T           S C  + +  I +E
Sbjct  10    AHCLVFPYPSQGHINPLLQFSKLLDHKGVKVTLVTTRFIYNTMYKGSCCTALET--ISLE  67

Query  1330  SIPDGVKPDSGFD----AISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWV  1172
             +I DG   D G+     +I  +L+      S NL E++ K++GSGC +  +VYD+IMPW 
Sbjct  68    AISDGF--DEGWKTQGVSIQAYLESFWKVGSQNLFELIEKLSGSGCPVDCLVYDAIMPWP  125

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR  992
              D+  + G+  A F +QSCAV  +Y+H ++  L  P   S +SLP M PL   DLPSF+ 
Sbjct  126   LDIAKKFGIVGAVFFTQSCAVDNIYNHVNKGVLKLPLTDSEISLPGMLPLEPLDLPSFLS  185

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
             +  SY +    V+ +  N  KADW+L NTF ELE++V++W+A  +P++   IGP +PS Y
Sbjct  186   DFGSYPAYFEVVVGQFCNVDKADWVLCNTFYELEEQVVDWLAKFWPVR--TIGPTIPSNY  243

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LD R++DD  YG+ LFK +N+ CM+WL+     SV Y+SFGS A L  EQM E+A GL +
Sbjct  244   LDNRLKDDKGYGVDLFKSSNDACMKWLNKHPKNSVAYISFGSAAQLGLEQMEELAWGLKR  303

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             SK KFLWVVR SE +K+P  F  + +  G++ +WC Q++VL+H+AVGCFITHCGWNSTLE
Sbjct  304   SKSKFLWVVRESEAAKVPEGFIKEIAEKGLVVSWCSQIEVLAHEAVGCFITHCGWNSTLE  363

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             +LSLGVP+VAMPQ++DQ TNAKY+ DVW++G++    E G+V REEVERC+ E+M+G+ G
Sbjct  364   SLSLGVPLVAMPQYSDQSTNAKYIKDVWEIGVKAQPDEKGIVRREEVERCINEIMEGDNG  423

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +++NA KWK LA++AV +GGSS++NI EF++ +
Sbjct  424   KEIQKNAMKWKDLARKAVVDGGSSNRNIDEFIATL  458



>ref|XP_009111039.1| PREDICTED: UDP-glycosyltransferase 74E2 [Brassica rapa]
Length=453

 Score =   436 bits (1122),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 219/454 (48%), Positives = 305/454 (67%), Gaps = 11/454 (2%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTST-SACIQVSSSLIRVESI  1325
             M   SHV+V+P+P  GHITP+ Q  KRLAS+G+  T+I  +   +   ++ +  I V  I
Sbjct  1     MREGSHVIVLPFPGQGHITPLSQFCKRLASKGLKPTLILVSDKPTPPYKIDNDSITVFPI  60

Query  1324  PDGVK----PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
              +G +    P    D   + ++  +   L E++  +  SG +   +VYDS MPW+ D+ H
Sbjct  61    SNGFQEGEDPLQDLDDYMERVETSIKKRLPELIQDMKLSGNIPKALVYDSTMPWLLDVAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRN  989
               GLR A+F +Q   V A+Y+H  + + T P+      +  S PS P L  NDLPSF+  
Sbjct  121   DHGLRGASFFTQPWLVSAIYYHVFKGSFTVPSTKYGHSTLASFPSFPMLNANDLPSFLCE  180

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
              SSY ++LR V+ +  N  + D +L NTFD+LE+++L+W+ S +P  V+ +GP LPSMYL
Sbjct  181   SSSYPNILRVVVDQLSNIDRVDIVLCNTFDKLEEKLLKWVKSMWP--VLNVGPTLPSMYL  238

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR+ +D NYG SLF   + +C+EWL+S++  SVVYVSFGSL  L ++QM E+A GL QS
Sbjct  239   DKRLSEDKNYGFSLFTAKSTECIEWLNSKQPSSVVYVSFGSLVILNEDQMMELATGLKQS  298

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
              C FLWVVR +E  K+P N+  +    G+I +W PQL+VL+H++VG F+THCGWNSTLE 
Sbjct  299   GCFFLWVVRETETDKIPKNYVEEIGEKGLIVSWSPQLEVLAHESVGSFLTHCGWNSTLEG  358

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LSLGVP++ MP WTDQPTNAK++ DVW VG+RV A  +G V REE+ RC+ EVM+GE+G 
Sbjct  359   LSLGVPMIGMPHWTDQPTNAKFVEDVWKVGVRVKAEGDGFVRREEIVRCVGEVMEGEKGK  418

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              +++NA KWK LAKEAV EGGSSDK+I EFVS +
Sbjct  419   EIRKNAEKWKMLAKEAVAEGGSSDKSIDEFVSMV  452



>emb|CAN68287.1| hypothetical protein VITISV_017016 [Vitis vinifera]
Length=458

 Score =   436 bits (1122),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 220/447 (49%), Positives = 299/447 (67%), Gaps = 10/447 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKP  1307
             H+LV+PYP  GHI PM+Q S+RL S+GV  T+ TP   S   +  +  +++++I DG   
Sbjct  11    HILVLPYPSQGHINPMLQFSRRLVSKGVKATLATPIFISKTFKPQAGSVQLDTISDGFD-  69

Query  1306  DSGF---DAISDWLKDLV---SNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
             + GF   ++I ++L  L    S  LA+++ K    G     +VYD+ +PWV D+  Q GL
Sbjct  70    EGGFMQAESIHEYLTQLEAAGSRTLAQLIQKHRDLGHPFDCIVYDAFLPWVLDVAKQFGL  129

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLL  965
               AAF +Q+CAV  +Y+H     L  P + + VS+P +P L L D+PSF+    SY +  
Sbjct  130   VGAAFFTQTCAVNYIYYHAYHGLLPLPVKSTPVSIPGLPLLELRDMPSFIYVAGSYPAYF  189

Query  964   RFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDD  785
             + VL++  N  KADW+L NTF +LE+EV++ MA   PL  I IGP +PS YLD R+ ++ 
Sbjct  190   QLVLNQFCNVHKADWVLVNTFYKLEEEVVDAMAKLSPL--ITIGPTIPSKYLDNRLENEA  247

Query  784   NYGLSLFKPN-NNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
              YG  LF    +   + WLD++ T SV+YVSFGS+A L + QM E+A GL  S   FLWV
Sbjct  248   EYGFDLFSSEPSAHTINWLDNKPTRSVIYVSFGSMACLSEAQMEELAWGLKGSGHYFLWV  307

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             VR SE++KLP +F  + SG G    W PQL+VL+++AVGCF THCGWNST+EALSLGVP+
Sbjct  308   VRDSEEAKLPKHFIHETSGKGWFVKWSPQLEVLANEAVGCFFTHCGWNSTVEALSLGVPM  367

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             V MPQWTDQ T+AK++ DVW VGIRV   ENG+V R+EVE C+ EVM+GERG  +KENA 
Sbjct  368   VGMPQWTDQTTDAKFVEDVWKVGIRVRVDENGIVGRKEVEDCIREVMEGERGKAMKENAK  427

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             KW++ A EAV EGG+SDKNI EFV+ +
Sbjct  428   KWRKSAVEAVSEGGTSDKNIDEFVAKL  454



>ref|XP_006447931.1| hypothetical protein CICLE_v10015145mg [Citrus clementina]
 gb|ESR61171.1| hypothetical protein CICLE_v10015145mg [Citrus clementina]
Length=466

 Score =   436 bits (1122),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 221/455 (49%), Positives = 302/455 (66%), Gaps = 10/455 (2%)
 Frame = -3

Query  1507  AEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLI--RV  1334
             A  S ++H LV+ YP  GHI PM+Q SKRL  +G+ VT +T    +  +  +SS I   +
Sbjct  8     ASSSKLAHCLVLTYPGQGHINPMLQFSKRLQHKGIKVTFVTTHFFNKSLHRNSSPIPTAL  67

Query  1333  ESIPDGVKPDSG-----FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVA  1169
             E+I DG            DA  +    +    L E++ K+  S   +  +VYDSI+PW  
Sbjct  68    EAISDGYDEGGAAQAESIDAYLERFWQIGPQTLTELVEKMNASSVPVDCIVYDSILPWAL  127

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN  989
             D+  + GL  A F +QSCAV  +Y+H ++  L  P  G+ + LP +PPL   D+PSFV +
Sbjct  128   DVAKKFGLLGATFLTQSCAVCCIYYHANRGFLKLPLTGNEILLPGLPPLEPQDMPSFVYD  187

Query  988   KSSYSSLLRFVLSRNL-NTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
              S Y ++   V+     N  KADW+L NTF +LE+EV+EW+   + L+ I  GP +PS Y
Sbjct  188   LSLYPAISDLVVKNQFDNIDKADWVLSNTFYDLEEEVVEWLGRHWSLRTI--GPTVPSTY  245

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LDK++ DD +YG S+FK NN  C++WL+ Q  GSVVYVSFGS+A LK E+M E+A GL  
Sbjct  246   LDKQLEDDKDYGFSMFKQNNESCIKWLNDQAKGSVVYVSFGSMATLKIEEMEELAWGLKA  305

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             S   FLWVVR SEQSKLP NF  + S  G++ NWCPQL+VL+H+A GCF+THCGWNSTLE
Sbjct  306   SDKYFLWVVRESEQSKLPENFSEETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTLE  365

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             ALSLGVP+VAMPQWTDQ TN+KY++D W +G++  A + G+V RE +  C+ E+++GERG
Sbjct  366   ALSLGVPMVAMPQWTDQSTNSKYIMDGWKMGLKAPADKKGIVRREAIAHCISEILEGERG  425

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +++NA KW+  AKEAV +GGSSDKNI EFV+ +
Sbjct  426   KEIRQNAGKWRNFAKEAVAKGGSSDKNIDEFVANL  460



>gb|KDP35130.1| hypothetical protein JCGZ_10664 [Jatropha curcas]
Length=458

 Score =   436 bits (1121),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 222/454 (49%), Positives = 304/454 (67%), Gaps = 7/454 (2%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQV--SSSLI  1340
             E  +++   HV+ +P+P  GHI PM+Q SKRLAS+G+ VT++T        ++   SS I
Sbjct  2     ERNQIAVEIHVIALPFPAQGHINPMLQFSKRLASKGLKVTLVTFLENENLTKLPKHSSNI  61

Query  1339  RVESIPDGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSG-CLLTTVVYDSIMPWVADL  1163
              +ESI D     S  +        +V   L E++ K    G  + + +VYDSI+PW  D+
Sbjct  62    TIESISDNNAVISTVEEYWKNFSSMVEQKLVEMVEKQNKFGKHMRSCLVYDSIIPWALDI  121

Query  1162  VHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKS  983
               QLGL AA+F +QSCAV A+Y+H  +  +  P E   VSL  MP L  +DLPS   N  
Sbjct  122   AKQLGLSAASFFTQSCAVSAIYYHVREGKINVPIEQDFVSLEGMPQLESHDLPSSRYNSE  181

Query  982   SYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDK  803
                S +  +  +  N +  DW++F++F+ LE+EV+ W+A+Q+P+K++  GP +PS YLD 
Sbjct  182   DQPSFISLMTGQFSNLKDVDWIVFSSFNSLEEEVMNWLATQYPIKLV--GPTIPSRYLDN  239

Query  802   RVRDDDN--YGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             R+ DDD+  YGLSLFK N    +EWLDS+ET SVVYV+FGSLA L ++QM EVA GL +S
Sbjct  240   RLEDDDDDDYGLSLFKSNTKTLIEWLDSKETSSVVYVAFGSLAALGEKQMEEVANGLKRS  299

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
                FLWVVR SE+ KLP NF  + S  G++  WCPQL++LSH++VGCFITHCGWNSTLEA
Sbjct  300   DYHFLWVVRESEEKKLPQNFVDETSDRGLVVGWCPQLEILSHKSVGCFITHCGWNSTLEA  359

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LSLGVP+VAMPQW DQ TNAK++ DVW VG+RV     G+V++EE++ C+ +VM+GE   
Sbjct  360   LSLGVPMVAMPQWGDQLTNAKFVTDVWRVGVRVKVNVEGLVSKEEIDWCIRQVMEGEPAN  419

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              +++N+ KWK LA+ AV EGGSSD NI EFV  +
Sbjct  420   EIRKNSEKWKNLARVAVGEGGSSDMNIDEFVKQL  453



>ref|XP_004244486.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Solanum lycopersicum]
Length=456

 Score =   436 bits (1120),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 211/451 (47%), Positives = 304/451 (67%), Gaps = 14/451 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP+ GHI PM+Q SKRL S+ V +T+    S    ++   + + +E+I DG  
Sbjct  6     AHCLILPYPVQGHINPMLQFSKRLRSKRVKITIALTKSFLKNMKELPTSMSIEAISDGYD  65

Query  1309  PDSGFDAISDW------LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              D G D    +       K++ S+ L++++ K+  SGC +  +VYD  +PW  ++  Q G
Sbjct  66    -DGGRDQAGTFVAYITRFKEIGSDTLSQLIQKLAISGCPVNCIVYDPFLPWAVEVAKQFG  124

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMP-PLGLNDLPSFVRNKSSY  977
             L +AAF +Q+C V  +Y+H  +  +  P       + +P    P+  +D+P+FV N    
Sbjct  125   LISAAFFTQNCVVDNIYYHVHKGVIKLPPTQNDEKIIIPGFSSPIKASDVPNFVINPEG-  183

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
               +L  ++++  N  K DW+L N+F ELEKEV++WM+  +P+K   IGP +PSMYLDKR+
Sbjct  184   ERILEMLVNQFSNLDKVDWVLINSFYELEKEVIDWMSKIYPIK--TIGPTIPSMYLDKRL  241

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              DD  YGLS+FKP  N+C+ WL+ Q   SV+YVSFGSLA L  EQM E+A GL  S   F
Sbjct  242   HDDKEYGLSMFKPMTNECLNWLNHQPISSVLYVSFGSLAKLGSEQMEELAWGLKNSNKSF  301

Query  616   LWVVRSSEQSKLPSNFWPD-KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             LWVVRS+E+ KLP+NF  +  S  G++ +WCPQL VL H+++GCF+THCGWNSTLEA+SL
Sbjct  302   LWVVRSTEEPKLPNNFIEELTSEKGLVVSWCPQLQVLEHESIGCFLTHCGWNSTLEAISL  361

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
             GVP+VAMPQW+DQPTNAK + DVW++G+R    E G+V RE +E C+  VM+ ++G +++
Sbjct  362   GVPMVAMPQWSDQPTNAKLVKDVWEIGVRAKQDEKGIVRREVIEECIKLVMEEDKGKLIR  421

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ENA KWK++A+  VDEGGSSDKNI+EFVS +
Sbjct  422   ENAKKWKEIARNVVDEGGSSDKNIEEFVSKL  452



>ref|XP_010025874.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=475

 Score =   436 bits (1121),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 228/458 (50%), Positives = 305/458 (67%), Gaps = 20/458 (4%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTST-SACIQVS---SSLIRVESIPD  1319
             HV+V+ YP  GHI P+V+ SKRLAS+G+ V +I P S  S  + ++   +S I++E I D
Sbjct  14    HVIVLAYPAQGHINPVVEFSKRLASKGLNVALIIPVSEPSKSLHLTNHGTSSIKIEQISD  73

Query  1318  GVKP----DSGFDAISDWLKDLVSNNLAEIMSKVTGS-GCLLTTVVYDSIMPWVADLVHQ  1154
             G +     +   D   + L   VS +L   + +   S       +VYDS+MPW  D+  Q
Sbjct  74    GFEGVDTNELSLDVYFELLTVSVSKSLTNFIKRHQSSQDNPAKVLVYDSVMPWALDIAIQ  133

Query  1153  LGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGST-VSLPSMPP----LGLNDLPSFVRN  989
              G+  A+F +QSCAV A+YHH  +  L  P E S      S+PP    L LNDLPSF+ +
Sbjct  134   HGMHGASFFTQSCAVGAIYHHVHRGTLKFPLEDSRGQGQDSVPPVISNLSLNDLPSFLVD  193

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
               +Y +L++ VL +  N  +A+W LF+TF ELE EV++WM SQ PL  + +GP +PSMYL
Sbjct  194   VDAYPALVKLVLGQFSNVMRANWRLFSTFAELEVEVVKWMGSQCPL--LTVGPTVPSMYL  251

Query  808   DKRVRDDDNYGLSLFKPNNND-CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             DKR++ D +YGLSLFKPN+ + C+EWLDS++  SVVYVSFGSLA+L +EQM E+A GL +
Sbjct  252   DKRIQHDKDYGLSLFKPNDAETCIEWLDSKDADSVVYVSFGSLASLGEEQMEEIAIGLKR  311

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKS---GAGIITNWCPQLDVLSHQAVGCFITHCGWNS  461
              K  FLWVVR+SE+ KLP NF  D     G G++  WC QL VLSH +VGCF+THCGWNS
Sbjct  312   MKGNFLWVVRASEEKKLPCNFLQDMELLDGKGLVVKWCDQLQVLSHGSVGCFMTHCGWNS  371

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             T+E +S GVP+V MPQ TDQPTNA ++ +VW VG+RV   E G+VT EE+E C+ EVM G
Sbjct  372   TMEGVSWGVPMVVMPQRTDQPTNAAFITEVWKVGLRVRVNEKGIVTSEEIESCINEVMGG  431

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ERG  +K N+ KWK+ A+ A++EGGSSD NI  F   I
Sbjct  432   ERGKEIKANSLKWKERARIAMEEGGSSDNNINNFAKNI  469



>ref|XP_007033644.1| Uridine diphosphate glycosyltransferase 74E2 [Theobroma cacao]
 gb|EOY04570.1| Uridine diphosphate glycosyltransferase 74E2 [Theobroma cacao]
Length=525

 Score =   438 bits (1126),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 222/440 (50%), Positives = 307/440 (70%), Gaps = 12/440 (3%)
 Frame = -3

Query  1477  VIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKPDSG  1298
             ++P+ ++ HI PM+Q SKRL S G+ VT+ T  S +  + V    +++E + D ++ D+ 
Sbjct  92    LVPH-LYCHINPMLQFSKRLGSEGLEVTLCT-FSGNKSMPVQVGPVKLEPVSDDLQLDND  149

Query  1297  F---DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFN  1127
                 DA  +  K + +  L EI++K       ++ +VYDS +PW  D+   LGL AAAF 
Sbjct  150   LKTVDAYLERFKAVATLRLPEIIAKRG-----ISYLVYDSAIPWALDIAKHLGLPAAAFF  204

Query  1126  SQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSR  947
             +QSCAV  +Y++  +  +  P   S++S+  +P L   DLPSFV +  SY +LL   +++
Sbjct  205   TQSCAVDTIYYNVHEGLVKLPLAESSLSIDGLPLLQECDLPSFVYDIGSYPALLHTCVNQ  264

Query  946   NLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSL  767
               N  +ADW+  NTF  LE EVL WMASQ P+K  AIGP +PS YLDKRV DD+ YGL L
Sbjct  265   FSNFMEADWVFINTFTSLEDEVLNWMASQRPIK--AIGPAIPSKYLDKRVEDDEEYGLHL  322

Query  766   FKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQS  587
             FKP  + C+ WL+S+ETGSVVY+SFGSLA L +EQM E+A GL  S   FLWVVR +EQ 
Sbjct  323   FKPEIDICINWLNSKETGSVVYISFGSLAALGEEQMQELASGLQSSNSYFLWVVRETEQK  382

Query  586   KLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWT  407
             KLP++F  + S  G++ +W PQL+VL+H+AVGCF+THCGWNSTLEALSLGVP+VA+PQWT
Sbjct  383   KLPASFIGETSDKGLVVSWSPQLEVLAHEAVGCFMTHCGWNSTLEALSLGVPMVAVPQWT  442

Query  406   DQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAK  227
             DQ TNAKY+ DVW VGIR    + G++T+EE++RC+ E+M+G++   +K+NA KWK LA 
Sbjct  443   DQTTNAKYVTDVWQVGIRARKDDKGIITKEEIQRCIREIMEGDKSKDIKKNAEKWKNLAV  502

Query  226   EAVDEGGSSDKNIKEFVSAI  167
             EAV+ GGSSDKNI+EFV+ +
Sbjct  503   EAVNVGGSSDKNIREFVAKL  522



>ref|XP_002892308.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH68567.1| UDP-glucoronosyl/UDP-glucosyl transferase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=453

 Score =   435 bits (1119),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 219/454 (48%), Positives = 299/454 (66%), Gaps = 11/454 (2%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESI  1325
             M   SH++V+P+P  GHITPM Q  KRLAS+G+ +T V+     S   +     I V  I
Sbjct  1     MREGSHLIVLPFPGQGHITPMSQFCKRLASKGLKLTLVLVSDKPSPPYKTEHDSITVFPI  60

Query  1324  PDGVK----PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
              +G +    P    D   + ++  + N L +++  +  SG     +VYDS MPW+ D+ H
Sbjct  61    SNGFQEGEEPLQDLDDYMERVETSIKNTLPKLIEDMKQSGNPPRAIVYDSTMPWLLDVAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRN  989
               GLR A F +Q   V A+Y+H  + + + P+      +  S PS P L  NDLPSF+  
Sbjct  121   SYGLRGAVFFTQPWLVSAIYYHVFKGSFSVPSTKYAHSTLASFPSFPMLNANDLPSFLSE  180

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
              SSY ++LR V+ +  N  + D LL NTFD LE+++L+W+ S +P  V+ IGP +PSMYL
Sbjct  181   SSSYPNILRIVVDQLSNIDRVDILLCNTFDRLEEKLLKWVQSLWP--VLNIGPTVPSMYL  238

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR+ +D NYG SLF     +CMEWL+S++  SVVYVSFGSL  LK++QM E+A GL QS
Sbjct  239   DKRLSEDKNYGFSLFNAKVAECMEWLNSKQPNSVVYVSFGSLVILKEDQMLELAAGLKQS  298

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
                FLWVVR +E  K+P N+  +    G+I +W PQLDVL+H+++GCF+THCGWNS LE 
Sbjct  299   GRFFLWVVRETETDKIPRNYVEEIGEKGLIVSWSPQLDVLAHKSIGCFLTHCGWNSMLEG  358

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LSLGVP++ MP WTDQPTNAK++ DVW VG+RV A ++G V REE+ R + EVM+GE+G 
Sbjct  359   LSLGVPMIGMPHWTDQPTNAKFMEDVWKVGVRVKAEDDGFVRREEIVRSVGEVMEGEKGK  418

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              +++NA KWK LA+EAV EGGSSDK+I EFVS  
Sbjct  419   EIRKNAEKWKVLAQEAVSEGGSSDKSINEFVSVF  452



>ref|XP_010069226.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW57504.1| hypothetical protein EUGRSUZ_H00277 [Eucalyptus grandis]
Length=483

 Score =   436 bits (1121),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 230/469 (49%), Positives = 314/469 (67%), Gaps = 20/469 (4%)
 Frame = -3

Query  1522  ERPEMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ-VSSS  1346
             ++P M     V HVLV+ +P+ GHI PM+Q SKRLAS+G+ VT + P ST   +  V++S
Sbjct  13    KQPNMDPAKDV-HVLVLAHPVQGHINPMLQFSKRLASKGLKVTFLIPISTKKSLNLVNAS  71

Query  1345  LIRVESIPDGV-KPDSGFDAISDWLKDL---VSNNLAEIMSK-VTGSGCLLTTVVYDSIM  1181
              ++VE I DG    ++   +I + LK     VS +L++ + K  +      T ++YDS  
Sbjct  72    SVQVEYISDGFDNVEADKLSIDESLKHFRLSVSQSLSDFIQKHQSCQDNSATVLIYDSFD  131

Query  1180  PWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTE-----GSTVS-LPSMPPLG  1019
              W  D+  + G+  AAF +QSC V  +Y+   Q  +  P E     G  +S  P+M  LG
Sbjct  132   CWALDVAIEHGMHGAAFFTQSCVVSCIYYLVHQGKVKLPVEAVDGQGRVLSDPPAMSVLG  191

Query  1018  LNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIA  839
             LND PSFV +   Y ++L+ VL +  N +KA WLLFNTF ELE+E++ WM +Q+ +  + 
Sbjct  192   LNDFPSFVVDVHKYPAILKMVLRQFSNFRKAKWLLFNTFTELEEEMVNWMGNQWLM--LT  249

Query  838   IGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQM  659
             +GP +PS+YLDKR+ DD +YGLSLFKP    C+ WLDS+   S +Y+SFGSLA+L ++QM
Sbjct  250   VGPTIPSLYLDKRLEDDTDYGLSLFKPEAEACLRWLDSKPPCSTLYISFGSLASLGEDQM  309

Query  658   CEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWP----DKSGAGIITNWCPQLDVLSHQAVG  491
              E+A GL   K  FLWVVR SE+ KLP NF      D    G++  WC QL VLSH +VG
Sbjct  310   EELASGLRSMKSHFLWVVRESEEEKLPRNFLQELGLDDDKKGLVVRWCNQLQVLSHGSVG  369

Query  490   CFITHCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEV  311
             CF+THCGWNSTLEALSLGVP+V MPQWTDQPTNA ++V+VW VG+RV A E G+VT EE+
Sbjct  370   CFMTHCGWNSTLEALSLGVPMVVMPQWTDQPTNATFIVEVWKVGLRVRANERGVVTGEEI  429

Query  310   ERCLVEVMK-GERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             E C+ E+M+ GERG  ++EN+  WK++AK A+DEGGSS+KNI+EFVS +
Sbjct  430   ENCVNEIMEGGERGKEIRENSLGWKEMAKRAIDEGGSSEKNIQEFVSNV  478



>ref|XP_009335348.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Pyrus x bretschneideri]
Length=460

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 218/448 (49%), Positives = 309/448 (69%), Gaps = 9/448 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRV-ESIPDGV  1313
             +H L++PYP  GHI PM+Q +K L  + V VT++T       +  S S     E+I DG 
Sbjct  11    AHCLILPYPSQGHINPMLQFAKLLDHKEVRVTLVTTRFLYKTMYSSGSNCAAWETISDGF  70

Query  1312  ----KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
                 K D+  D   +  + + S +L +++ K++ SG  +  VVYD+ MPW  D+  +LG+
Sbjct  71    DDTGKRDTKIDIYLERFRQVGSKHLGKLLEKLSNSGSPVDCVVYDAFMPWPLDVAKKLGI  130

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAP-TEG-STVSLPSMPPLGLNDLPSFVRNKSSYSS  971
               A F +QSCAV  VY+H  +  L  P  +G S + LP +P L   DLPSFV +  SY +
Sbjct  131   AGAVFFTQSCAVDNVYYHVHRGLLKLPLADGQSQILLPGLPALDPLDLPSFVSDCGSYPA  190

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
               R ++ +  N  KADW+L NTF +LE +V++WMA  + LK +  GP +PS YL+KR++D
Sbjct  191   AYRVLVGQFSNVDKADWVLCNTFYDLEVQVVDWMAKLWRLKTV--GPTIPSNYLNKRLKD  248

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D  Y ++LFK +N+ C++WL+ +  GSV YVSFGSLA L+DEQM E+A GL +SK  FLW
Sbjct  249   DKEYSVNLFKSDNDACIKWLNERPKGSVAYVSFGSLAKLEDEQMEELAWGLRRSKSSFLW  308

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             VVR SE +K+P  F  + S  G++ +WCPQ++VL+H+AVGCF+THCGWNSTLEALSLGVP
Sbjct  309   VVRESEATKVPKGFIEETSEKGLVVSWCPQMEVLAHKAVGCFVTHCGWNSTLEALSLGVP  368

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             +VA+PQ +DQ TNAKY++DVW+VG+R    E G+V +  V++C+ EVM+GERG  +++NA
Sbjct  369   MVALPQLSDQRTNAKYIMDVWEVGVRAPTDEKGVVRQVVVKQCISEVMEGERGKEIQKNA  428

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             AKWK+LA++AVDEGGSSDKNI EF++ +
Sbjct  429   AKWKELARKAVDEGGSSDKNIDEFIAKL  456



>ref|XP_004290110.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Fragaria vesca 
subsp. vesca]
Length=468

 Score =   435 bits (1118),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 219/460 (48%), Positives = 301/460 (65%), Gaps = 14/460 (3%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRV  1334
             E  + +  +H LV+P+P  GH+ PM+Q SKRL  +G+ VT+ T  S        S+ I +
Sbjct  2     EKEDRAYKAHCLVVPFPTQGHVNPMLQFSKRLQRKGLKVTLATTRSFRKLSSPPSTSIAL  61

Query  1333  ESIPDGVKPDSGFDAIS-------DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPW  1175
             E+I DG   D G  A++       D  +++ S  L E++ K++  G  +  +VYD+ MPW
Sbjct  62    ETISDGY--DEGGMAVAENIGDYLDRFREIGSRTLTELIEKLSDLGHKVHCIVYDAFMPW  119

Query  1174  VADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP---TEGSTVSLPSMP-PLGLNDL  1007
               D+  + G+  A F +QSCAV  +Y++  Q  L  P    E   + +P +  PL  +D+
Sbjct  120   PLDVAKRFGIVGATFFTQSCAVDNIYYNVQQGLLKVPPSTDEADEILVPGVRVPLRASDM  179

Query  1006  PSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPL  827
             PSFV   S Y + LR V+ +  N  KADW+  NTF ELE E  +WM+  +PL +  IGP 
Sbjct  180   PSFVSVPSQYPAFLRMVVDQFSNVDKADWIFCNTFYELEVEEADWMSKFWPL-LRTIGPT  238

Query  826   LPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVA  647
             +PSMYLDKR  DD  YG SLFKPN++ C++WL+ ++ GSV YVSFGSLA L  EQM E+ 
Sbjct  239   IPSMYLDKRHEDDKEYGYSLFKPNSDACLKWLNERQKGSVAYVSFGSLAELGAEQMEELG  298

Query  646   QGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGW  467
              GL  S   FLWVVR  E +KLP  F    S  G++ +WCPQL+VL+++AVGCF+THCGW
Sbjct  299   WGLKNSNIYFLWVVREKEANKLPKGFAEAISEKGLVVSWCPQLEVLANEAVGCFVTHCGW  358

Query  466   NSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM  287
             NSTLEALS GVP+VA+PQWTDQ TNAKY++DVW +G+R  A E G+V REE+E C+ E++
Sbjct  359   NSTLEALSSGVPMVAVPQWTDQSTNAKYIMDVWKMGLRAQADEKGIVRREEIECCVREIL  418

Query  286   KGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +GERG  + +NA KWK+LA +A DEGGSSD+NI EF + +
Sbjct  419   EGERGKEITKNALKWKELAGKAADEGGSSDRNIDEFTAKL  458



>ref|XP_010475277.1| PREDICTED: UDP-glycosyltransferase 74E2 [Camelina sativa]
Length=452

 Score =   434 bits (1115),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 221/452 (49%), Positives = 302/452 (67%), Gaps = 11/452 (2%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESI  1325
             M   SHV+V+P+P  GHITPM QL KRLAS+G+ +T V+     +   +     I V  I
Sbjct  1     MGEGSHVIVLPFPGQGHITPMSQLCKRLASKGLQLTLVLVSDKPTPPYKTEHDSITVFPI  60

Query  1324  P----DGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             P    DG KP    D   + ++  + N+L +++  +  SG   + +VYDS MPW+ D+ H
Sbjct  61    PNGFQDGEKPLEDLDDYMERVETSIKNSLPKLIEDMKLSGNSPSALVYDSTMPWLLDVAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRN  989
               GLR A F +Q   V A+Y+H    + + P       +  S PS P L  NDLPSF+  
Sbjct  121   NYGLRGAVFFTQPWLVTAIYYHVFNGSFSVPPTKYGHSTLASFPSFPMLSANDLPSFLCE  180

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
              SSY ++LR V+ +  N  + D LL NTFD+LE++VL+W+ S +P  V+ IGP++PSMYL
Sbjct  181   SSSYPNILRIVVDQLSNIDRVDILLCNTFDKLEEKVLKWVQSLWP--VLNIGPMVPSMYL  238

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR+ +D NYG SLF     +C+EWL+S++  SVVYVSFGSL  LK++QM E+A GL Q+
Sbjct  239   DKRLSEDKNYGFSLFNAKVTECIEWLNSKQPNSVVYVSFGSLVILKEDQMMELAAGLKQT  298

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
                FLWVVR +E  K+P NF  +    G+I +W PQL+VL+H+++GCF+THCGWNS  E 
Sbjct  299   GRFFLWVVRETETDKIPRNFVEEIGEKGLIVSWSPQLEVLAHRSIGCFLTHCGWNSMSEG  358

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LSLGVP++ MP WTDQPTNAK++ DVW VG+RV A  +G+V REE+ R + EVM+GE+G 
Sbjct  359   LSLGVPMIGMPHWTDQPTNAKFMEDVWKVGVRVKAEGDGLVRREEIVRRVGEVMEGEKGK  418

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
              +++NA KWK LA+EAV EGGSSDK+I EFVS
Sbjct  419   EIRKNAEKWKVLAQEAVSEGGSSDKSIDEFVS  450



>ref|XP_009630994.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nicotiana tomentosiformis]
Length=456

 Score =   433 bits (1114),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 210/450 (47%), Positives = 305/450 (68%), Gaps = 13/450 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L+ PYP  GHI PM+Q SKRL S+GV +T+ T  S    +Q  S+ + +E+I DG  
Sbjct  7     AHCLIFPYPAQGHINPMLQFSKRLQSKGVKITIATTKSFLKTMQELSTPVSIEAISDGYD  66

Query  1309  PDSG------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              D G      F A     K++ SN L++++  +T  GC +  +VYD  +PW  ++ ++ G
Sbjct  67    -DGGHEQADSFAAYITRFKEVGSNTLSQLIETLTTRGCPVNCIVYDPFLPWAVEVGNKFG  125

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMPPLGLNDLPSFVRNKSSYS  974
             L  AAF +QSCAV  +Y+H  +  +  P       + +P +  +  +D+P+FV N  S +
Sbjct  126   LVTAAFFTQSCAVDNIYYHVLKGVIKLPPIEVDKEIIVPGLVTIESSDVPTFVSNPES-A  184

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVR  794
              +L  ++ +  N +  DW+L N+F ELE EV++WM+  +P+    IGP +PS+YLDKR+ 
Sbjct  185   KILEMLVDQFSNLENVDWVLINSFYELENEVIDWMSKLYPIS--TIGPTIPSVYLDKRLP  242

Query  793   DDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             +D  YGLS+FKP  N+C+ WL+ Q   SVVYVSFGS A ++ EQM E+A GL +S   FL
Sbjct  243   NDKEYGLSVFKPMTNECLNWLNHQPISSVVYVSFGSYAKVEPEQMEELAWGLKKSDNNFL  302

Query  613   WVVRSSEQSKLPSNFWPD-KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             WVVRS+E+SKLP+NF  +  S  G++ +WC QL VL H+++GCF+THCGWNSTLEA+SLG
Sbjct  303   WVVRSTEESKLPNNFLEELTSKKGLVVSWCQQLQVLEHKSIGCFLTHCGWNSTLEAISLG  362

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP+VAMPQW+DQPTNAK + D+W++G+R    E G+V RE +E C+  VM+ E+G  +++
Sbjct  363   VPMVAMPQWSDQPTNAKLVKDIWEIGVRAKQDEKGIVRREVIEECIKIVMEEEKGKKIRD  422

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA KWK+LA+ A+DEGG+SDKNI+EFVS +
Sbjct  423   NAKKWKELARNAMDEGGTSDKNIEEFVSKL  452



>ref|XP_006447930.1| hypothetical protein CICLE_v10015149mg [Citrus clementina]
 gb|ESR61170.1| hypothetical protein CICLE_v10015149mg [Citrus clementina]
Length=465

 Score =   434 bits (1115),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 222/455 (49%), Positives = 299/455 (66%), Gaps = 18/455 (4%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ---VSSSLIRVES  1328
             S ++H LV+ YP  GHI P++Q SKRL  +G+ VT++T    S  +     SS+ I +E+
Sbjct  12    SKLAHCLVLSYPAQGHINPLLQFSKRLEHKGIKVTLVTTYFISKSLHRDPSSSNSIALET  71

Query  1327  IPDGVKPDSGFDAISD-------WLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVA  1169
             I DG        A SD       W   L      E++ ++    C    +VYDS +PW  
Sbjct  72    ISDGYDEGGSAQAESDQAYVDRFWQIGL--QTFTELVERLNDVDC----IVYDSFLPWAL  125

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN  989
             D+  + GL  AAF +QSCAV ++YHH ++  +  P  G  V LP +PPL   D PSF+  
Sbjct  126   DVAKKFGLTGAAFLTQSCAVASIYHHVNKGLIKLPLTGDQVLLPGLPPLDPQDTPSFINA  185

Query  988   KSSYSSLLRFVLSRNL-NTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
              +SY +    +++R + N  KADW+L NTF ELEKEV EW+  Q  L +  IGP LPS+Y
Sbjct  186   PASYPAFFDMIVTRQVSNIDKADWILCNTFYELEKEVTEWLGKQHWL-LRTIGPTLPSIY  244

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LDK++ DD  YG S+F+PN   CM+WL+ +  GSVVY+SFGS+A LK EQM E+A GL  
Sbjct  245   LDKQIEDDKEYGFSIFEPNIESCMKWLNDRANGSVVYLSFGSMATLKIEQMEELAWGLKA  304

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             S   FLWVVR SEQ KLP NF  + S  G++ NWCPQL VL+H+A GCF+THCGWNST+E
Sbjct  305   SDKYFLWVVRESEQFKLPENFSDETSQKGLVVNWCPQLGVLAHEATGCFLTHCGWNSTME  364

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             AL LGVP++AMPQW+DQ TNAKY++DV  +G++V A E G+V RE +  C+ E+++GERG
Sbjct  365   ALGLGVPMLAMPQWSDQSTNAKYIMDVGKMGLKVPADEKGIVRREAIAHCINEILEGERG  424

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +K+NA KW+  AKEAV +GGSSDKNI +FV+ +
Sbjct  425   KEIKQNADKWRNFAKEAVAKGGSSDKNIDDFVANL  459



>ref|XP_010321783.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Solanum lycopersicum]
Length=460

 Score =   433 bits (1114),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 215/450 (48%), Positives = 306/450 (68%), Gaps = 12/450 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVI-TPTSTSACIQVSSSLIRVESIPDGVK  1310
             H LVIP+P  GHI PM+Q SKRL  +G+ +T++ T    +  +Q  +S I +E I DG  
Sbjct  9     HCLVIPFPTQGHINPMLQFSKRLQHKGIEITLVPTIYIFNKSMQELTSSITIEPISDGYD  68

Query  1309  PDSGF---DAISDWLKD---LVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
               +G     +I  +L+    + S  L +++ K+   G  +  V+YDS MPW+ D+    G
Sbjct  69    DVNGLFCAKSIETYLESHQIVGSQALIQLIEKLKNKGNPINCVIYDSFMPWILDVAKMFG  128

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEG-STVSLPSM-PPLGLNDLPSFVRNKSSYS  974
             L +  F + SCAV  +++H   + L  P EG   V LP +  PL  +DLPSFV +  SY 
Sbjct  129   LVSGVFFTMSCAVENIFYHIQLKELKLPVEGHDQVLLPGLLQPLVPSDLPSFVNDMGSYP  188

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVR  794
               L+ ++ +  N Q+ADW+L NT  ELEK  ++W+  +  L+   IGP +PSMY+DKR+ 
Sbjct  189   PFLKMLVDQFSNIQEADWILCNTIYELEKHEVDWITKRLRLR--TIGPTIPSMYVDKRLE  246

Query  793   DDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             +D++YGLS++KP ++ CM+WL   + GSVVYVSFGS+A LK+EQM E+A GL +S   FL
Sbjct  247   NDNSYGLSIYKPKSDVCMKWLSDCDDGSVVYVSFGSMAELKEEQMKEIACGLNKSNHNFL  306

Query  613   WVVRSSEQSKLPSNFWPD-KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             WVVR SE+ K+P +F  + K   G++  WCPQLDVLSH+A+GCF+THCGWNSTLEALSLG
Sbjct  307   WVVRESEEPKIPKDFLDNIKREKGLVVTWCPQLDVLSHKAIGCFMTHCGWNSTLEALSLG  366

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP VA+P WTDQ TNAKY++D+W++GI+  A E G+V +E VE C+ EVM+GERG  +++
Sbjct  367   VPTVAIPIWTDQCTNAKYVMDIWEMGIKAQANEKGVVEQEVVEHCIREVMEGERGKEIRK  426

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA KW+++ K+A+DEGGSSD+NI +FV  +
Sbjct  427   NATKWREVTKKAMDEGGSSDRNINDFVDKL  456



>ref|XP_006357098.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=457

 Score =   433 bits (1113),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 210/454 (46%), Positives = 305/454 (67%), Gaps = 14/454 (3%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPD  1319
             S  +H L++PYP  GHI PM+Q SKRL S+ V +T+    S    ++   + + +E+I D
Sbjct  4     SHKAHCLILPYPFQGHINPMLQFSKRLQSKHVEITIAPTKSFLKKMKELPTSVSIEAISD  63

Query  1318  GVKPDSGFDAISDW------LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             G   D G D    +       K++ S+ L++++ K+  SGC +  +VYD  +PWV ++  
Sbjct  64    GYD-DGGIDQAKTYEAYLTRFKEVGSDTLSQLIQKLENSGCPVNCIVYDPFLPWVVEVAK  122

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMP-PLGLNDLPSFVRNK  986
             + GL +AAF +Q+C V  +Y+H  +  +  P       + +P    P+  +D+P+FV   
Sbjct  123   KFGLISAAFFTQNCTVDNIYYHVHKGVIKLPPTQNDEKILIPGFSCPIEASDVPTFVIYP  182

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
                  +L+ ++++  N  K DW+L N+F ELEKEV++WM+  +P+K   IGP +PSMYLD
Sbjct  183   EG-ERILQVLVNQFSNLDKVDWILINSFYELEKEVIDWMSKIYPIK--TIGPTIPSMYLD  239

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+ DD  YGLS+FKP  N+C+ WL+ Q   SVVYVSFGSLA L+ EQM E+A GL  S 
Sbjct  240   KRLHDDKEYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLAKLEAEQMEELAWGLKNSN  299

Query  625   CKFLWVVRSSEQSKLPSNFWPDKS-GAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
               FLWVVRS+E+SKLP NF  + +   G++ +WCPQL VL H+++GCF+THCGWNSTLE+
Sbjct  300   NNFLWVVRSTEESKLPKNFLEELTIEKGLVVSWCPQLQVLEHESIGCFLTHCGWNSTLES  359

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             +S+GVP+VA+PQWTDQPTNAK + DVW++G+R    E G+V RE +E  +  VM+ E+G 
Sbjct  360   ISMGVPMVAIPQWTDQPTNAKLVKDVWEIGVRAKQDEKGIVRREIIEEYIKLVMEEEKGK  419

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +++ENA KWK++A+  VDEGGSSDKNI+EFVS +
Sbjct  420   LIRENAKKWKEMARNVVDEGGSSDKNIEEFVSKL  453



>ref|XP_004289755.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Fragaria vesca 
subsp. vesca]
Length=461

 Score =   433 bits (1113),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 215/455 (47%), Positives = 306/455 (67%), Gaps = 20/455 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPT-------STSACIQVSSSLIRVE  1331
             +H LVIPYP  GHI P++Q SK L  +GV VT++T           S C  + +  I +E
Sbjct  10    AHCLVIPYPSQGHINPLLQFSKLLDHKGVKVTLVTTRYIYNTMYKGSCCTALET--ISLE  67

Query  1330  SIPDGVKPDSGFD----AISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWV  1172
             +I DG   D G+     +I  +L+      S  LAE++ K++ SGC +  +VYD+ MPW 
Sbjct  68    TISDGF--DEGWKTQGVSIQAYLESFWKVGSQTLAELIEKLSVSGCPVDCLVYDAFMPWP  125

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR  992
              D+  + G+  A F +QSCAV  +Y+H ++  L  P   S +SLP MPPL   DLPSF+ 
Sbjct  126   LDIAKKFGIVGAVFFTQSCAVDNIYNHVNKGVLKLPLTDSEISLPGMPPLEPLDLPSFLS  185

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
             +  SY +    V+ +  N  KADW+L NTF ELE++V++W+A  +P++   IGP +PS Y
Sbjct  186   DFGSYPAFFEVVIGQFCNIDKADWVLCNTFYELEEQVVDWLAKFWPVR--TIGPTIPSNY  243

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LD  ++DD  YG+ LFK +N+ CM+WL+     +V Y+SFGS A L  EQM E+A GL +
Sbjct  244   LDNLLKDDQGYGVDLFKSSNDACMKWLNKHPKNTVAYISFGSGAQLGLEQMQELAWGLKR  303

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             SK KFLWVVR SE +K+P  F  + +  G++ +WC QL+VL+HQAVGCF+THCGWNSTLE
Sbjct  304   SKSKFLWVVRESEAAKVPEGFIEETAEKGLVVSWCSQLEVLAHQAVGCFVTHCGWNSTLE  363

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             +LSLGVP+VAMPQ TDQ TNAKY+ DVW++G++    E G+V R+EVE C+ E+M+G++G
Sbjct  364   SLSLGVPLVAMPQLTDQSTNAKYIKDVWEIGVKAQPDEKGIVRRDEVEHCINEIMEGDKG  423

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +++NA KWK LA++AV +GGSS++NI EF++ +
Sbjct  424   KEIQKNAMKWKDLARKAVVDGGSSNRNIDEFIATL  458



>gb|KDP45202.1| hypothetical protein JCGZ_15067 [Jatropha curcas]
Length=454

 Score =   432 bits (1112),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/452 (47%), Positives = 302/452 (67%), Gaps = 11/452 (2%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS-SSLIR  1337
             E  + +  SHVLV+PYP  GHI PM+Q SKRL SRGV  T+    + +  +    +SLI 
Sbjct  2     EKEKRTYKSHVLVLPYPAQGHINPMLQFSKRLVSRGVKATLANTIAINKSMHRDPNSLID  61

Query  1336  VESIPDGVKPDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPW  1175
             +++  DG   + GF      +     L+++ S   A+++ K+  S   +T V+YD  + W
Sbjct  62    IQTYSDGFD-EGGFGQAESTEIYLSRLQEVGSKTFADLIKKLRDSDFPVTAVIYDGFLTW  120

Query  1174  VADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFV  995
               D+  Q GL A  F +QSCAV  +Y+H  +  L  P + S+VS+P +P L +++ PSF+
Sbjct  121   ALDVAKQFGLFAVVFFTQSCAVNNIYYHVQRGLLPLPLK-SSVSVPGLPLLQVSETPSFI  179

Query  994   RNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSM  815
                 SY      ++++  N  +ADW+L+N+F +LE+E ++WMA ++ L+ I  GP LPSM
Sbjct  180   SIWGSYPGFSHLLVNQFSNFDEADWILYNSFYKLEEEAVDWMAKRWRLRTI--GPTLPSM  237

Query  814   YLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             YLDKR+ DD +YG++LF+P+   C+ WL  + +GSVVYVSFGS+A L   QM E+A GL 
Sbjct  238   YLDKRLEDDKHYGINLFEPDTTACLNWLQDKPSGSVVYVSFGSMAQLGAAQMEELAWGLK  297

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTL  455
              S   FLWV+R+ EQ+KLP NF  + S   ++  W PQL+VL+ +++GCF+THCG+NS L
Sbjct  298   ASNYYFLWVIRAPEQAKLPENFKEETSDKSLVVTWSPQLEVLAPESIGCFVTHCGFNSVL  357

Query  454   EALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGER  275
             EALS GVP+VAMPQWTDQPTNAKY+ DVW +GIR MA E G+V R+ +E CL +VM+GE+
Sbjct  358   EALSFGVPMVAMPQWTDQPTNAKYVEDVWKMGIRAMADEKGVVRRQVIEHCLRQVMEGEK  417

Query  274   GVMLKENAAKWKQLAKEAVDEGGSSDKNIKEF  179
             G  +KENA KWK LAKEA+ EGG+SD NI EF
Sbjct  418   GKEIKENAIKWKNLAKEAISEGGNSDTNIDEF  449



>gb|KEH25943.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=457

 Score =   432 bits (1112),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 218/457 (48%), Positives = 304/457 (67%), Gaps = 12/457 (3%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS--SSLI  1340
             E    + V+H L++P+P  GH+ PM+Q SKRL  +GV VT++T  S    I+    SS I
Sbjct  2     EKENKNYVAHCLILPFPGQGHMNPMIQFSKRLIHKGVKVTLVTIISLWRTIKNKNLSSNI  61

Query  1339  RVESIPDGVKPDSGFDAIS------DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMP  1178
              VESI DG   D G+++        D    + S +L+E++ K++ S      V++D+ MP
Sbjct  62    DVESISDGYD-DGGYESAESLEIYMDTFWRVGSKDLSELLHKLSSSKYPPNCVIFDAFMP  120

Query  1177  WVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSF  998
             W  D+    GL   AF +QSC+V ++Y HT ++ +  P   S   LP +P L   DLPSF
Sbjct  121   WALDVAKSFGLVGVAFFTQSCSVNSIYFHTHEKLIELPLTQSEYLLPGLPKLAQGDLPSF  180

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
             +    SY      V+++  N  KADW+L NTF ELEKEV++WM   +PL+   IGP +PS
Sbjct  181   LYKYGSYPGYFDIVVNQFSNIGKADWILANTFYELEKEVVDWMVKIWPLR--TIGPSIPS  238

Query  817   MYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGL  638
             ++LDKR++DD  YG+S+  PN   C++WL+ +  GSVVYVSFGS+A L +EQ  E+A GL
Sbjct  239   IFLDKRLKDDKEYGVSISDPNTEICIKWLNEKPKGSVVYVSFGSMAGLSEEQTQELALGL  298

Query  637   IQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNST  458
               S+  FLWVVR SEQ KLP N + + S  G+I  WCPQL VL+H+A+GCF+THCGWNST
Sbjct  299   KDSESYFLWVVRESEQVKLP-NGYVESSKKGLIVTWCPQLLVLTHEALGCFVTHCGWNST  357

Query  457   LEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGE  278
             LEALS+GVP++AMP WTDQ TNAK + DVW +G+R +A E  +V  E ++ C+ E+++ E
Sbjct  358   LEALSIGVPLIAMPLWTDQVTNAKLIADVWKMGVRAIADEKEIVRSETIKNCIKEIIETE  417

Query  277   RGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +G  +K+NA KWK LAK++VDEGG SDKNI+EFV+A+
Sbjct  418   KGNEIKKNALKWKNLAKDSVDEGGRSDKNIEEFVAAL  454



>ref|NP_001274852.1| UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
 gb|AFX67035.1| UDP-glucose:glucosyltransferase [Solanum tuberosum]
Length=462

 Score =   432 bits (1112),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 207/454 (46%), Positives = 309/454 (68%), Gaps = 16/454 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP+ GHI PM+Q SKRL S+ V +T+    S    ++   + + +E+I DG  
Sbjct  6     AHCLILPYPVQGHINPMLQFSKRLQSKRVKITIAPTKSFLKNMKELPTSVSIEAISDGYD  65

Query  1309  PD-----SGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
              D       ++A     K++ S+ L++++ K+  SGC +  +VYD  +PW  ++  + GL
Sbjct  66    DDGINQAKTYEAYLTRFKEVGSDTLSQLIQKLANSGCPVNCIVYDPFLPWAVEVAKKFGL  125

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMP-PLGLNDLPSFVRNKSSYS  974
              +AAF +Q+CAV  +Y+H  +  +  P     + + +P +   +  +D+PSF  +  S  
Sbjct  126   VSAAFFTQNCAVDNIYYHVHKGVIKLPPTQHDAKILIPGLSCTIESSDVPSFESSPES-D  184

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVR  794
              L+  ++++  N +K DW+L N+F ELEKEV++WM+  +P+K   IGP +PSMYLDKR+ 
Sbjct  185   KLVELLVNQFSNLEKTDWVLINSFYELEKEVIDWMSKIYPIK--TIGPTIPSMYLDKRLH  242

Query  793   DDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             DD  YGLS+FKP  N+C+ WL+ Q   SV+YVSFGSLA +K EQM E+A GL+ S   FL
Sbjct  243   DDKEYGLSIFKPMTNECLNWLNHQPISSVLYVSFGSLAIVKAEQMEELAWGLMNSNKNFL  302

Query  613   WVVRSSEQSKLPSNFWPD-----KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
             WVVRS+E+SKLP NF  +      +  G++ +WCPQL VL H+++GCF+THCGWNSTLEA
Sbjct  303   WVVRSTEESKLPKNFLEELELTSGNNKGLVVSWCPQLQVLEHESIGCFLTHCGWNSTLEA  362

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             +SLGVP+V MPQW+DQPTN K + DVW++G+R    + G+V R+ +E+C+  VM+ ++G 
Sbjct  363   ISLGVPMVIMPQWSDQPTNTKLVQDVWEMGVRAKQDDKGIVRRDVIEKCIKLVMEEDKGK  422

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +++ENA KWK+LA+ AVDEGGSSDKNI+EFVS +
Sbjct  423   VIRENAKKWKELARNAVDEGGSSDKNIEEFVSKL  456



>ref|XP_004244487.1| PREDICTED: UDP-glycosyltransferase 74F2-like isoform X1 [Solanum 
lycopersicum]
Length=458

 Score =   432 bits (1111),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 208/450 (46%), Positives = 303/450 (67%), Gaps = 12/450 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP+ GHI PM+Q SKRL S+ V +T+    S    ++   + + +E+I DG  
Sbjct  6     AHCLILPYPVQGHINPMLQFSKRLQSKRVKITIAPTKSFLKNMKELPTSVSIEAISDGYD  65

Query  1309  PD-----SGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
              D       +++     K + S+ LA+++ K+  SGC +  +VYD  +PW  ++  Q GL
Sbjct  66    DDGINQAKTYESYLARFKKVGSDTLAQLIKKLAKSGCHVNCIVYDPFLPWAVEVAKQFGL  125

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPTEGS--TVSLPSMP-PLGLNDLPSFVRNKSSYS  974
              +AAF +Q+C V  +Y+H  +  +  P   S   + +P +   +  + +PSF  +     
Sbjct  126   ISAAFFTQNCVVDNIYYHAHKGVIKLPPTKSDEKILIPGLSCTIESSYVPSF-ESSPETD  184

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVR  794
              L+  ++++  N +K DW+L N+F ELEKEV++WM+  +P+K   IGP +PSMYLDKR+ 
Sbjct  185   KLIELLVNQFSNLEKTDWVLINSFYELEKEVIDWMSKIYPIK--TIGPTIPSMYLDKRLH  242

Query  793   DDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             DD  YGLS+FKP  N+C+ WL+ Q   SV+YVSFGSLA L  EQM E+A GL  S   FL
Sbjct  243   DDKEYGLSMFKPMTNECLNWLNHQPISSVLYVSFGSLAKLGSEQMEELAWGLKNSNKSFL  302

Query  613   WVVRSSEQSKLPSNFWPD-KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             WVVRS+E+ KLP+NF  +  S  G++ +WCPQL VL H+++GCF+THCGWNSTLEA+SLG
Sbjct  303   WVVRSTEEPKLPNNFIEELTSEKGLVVSWCPQLQVLEHESIGCFLTHCGWNSTLEAISLG  362

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP+VAMPQW+DQPTNAK + DVW++G+R    E G+V RE +E C+  VM+ ++G +++E
Sbjct  363   VPMVAMPQWSDQPTNAKLVKDVWEIGVRAKQDEKGIVRREVIEECIKLVMEEDKGKLIRE  422

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA KWK++A+  VDEGGSSDKNI+EFVS +
Sbjct  423   NAKKWKEIARNVVDEGGSSDKNIEEFVSKL  452



>ref|XP_002278455.1| PREDICTED: UDP-glycosyltransferase 74F2 [Vitis vinifera]
Length=457

 Score =   432 bits (1110),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 215/456 (47%), Positives = 301/456 (66%), Gaps = 11/456 (2%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVE  1331
             M + +  +H L++ YP  GHI PM+Q SKRL S+G+  T+ T  S +  +Q+  S ++++
Sbjct  1     MEKKAYGAHALLLSYPTQGHINPMLQFSKRLVSKGLKATLATTLSITKSMQLDCSSVQID  60

Query  1330  SIPDGVKPDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCL-LTTVVYDSIMPWV  1172
             +I DG   D GF      +A     + + S  LAE++ K   SG + +  ++YD+ +PW 
Sbjct  61    AISDGYD-DGGFAQAESVEAYLQRFQAVGSQTLAELIRKHKRSGQVPIDCIIYDAFLPWA  119

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR  992
              D+  + GL  AAF +Q+CAV  ++++     LT P     VS+P +P L L D+PSF+ 
Sbjct  120   LDVAKEFGLVGAAFFTQTCAVTYIFYYVHHGLLTLPVSSPPVSIPGLPLLDLEDMPSFIS  179

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
                SY + L+ VL +  N  KAD +L N+F +LE  V++ M+    L  + IGP +PS +
Sbjct  180   APDSYPAYLKMVLDQFCNVDKADCILVNSFYKLEDSVVDAMSKVCTL--LTIGPTIPSFF  237

Query  811   LDKRVRDDDNYGLSLFKPNNND-CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
              DKRV DD  YGL+ FK + ++ C+EWL S+  GSVVYVSFGS+A+L +EQM E+A GL 
Sbjct  238   SDKRVNDDMAYGLNFFKAHQSETCIEWLSSKPKGSVVYVSFGSMASLSEEQMGELAWGLK  297

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTL  455
              S   FLWVVR+SE++KLP  F  ++   G +  WCPQL+VL+  A+GCF THCGWNST 
Sbjct  298   GSSHYFLWVVRASEEAKLPKGFINEELEKGFLVRWCPQLEVLASNAIGCFFTHCGWNSTS  357

Query  454   EALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGER  275
             EAL+LGVP+V MPQWTDQ TNAK++ DVW VG+RV  GE+G+V REE+E C+ EVM+GER
Sbjct  358   EALTLGVPMVGMPQWTDQTTNAKFIKDVWKVGVRVREGEDGVVRREEIEACIREVMEGER  417

Query  274   GVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             G  +KENA KW    +EAV EGG+SD+NI EFVS +
Sbjct  418   GKEMKENAMKWSGFTREAVGEGGTSDRNIDEFVSKL  453



>ref|XP_010069223.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=476

 Score =   432 bits (1110),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 223/461 (48%), Positives = 303/461 (66%), Gaps = 26/461 (6%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSA----CIQVSSSLIRVESIPD  1319
             HVLV+ YP   HI P+V+ SKRLAS+G+ V +I P S  +        ++S I++E I D
Sbjct  15    HVLVLAYPSQSHINPVVEFSKRLASKGLNVALIIPISEPSKSLHSTNHATSSIKIEQISD  74

Query  1318  G--------VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             G        +  D  F+  +  +   ++N + +  S       +L   VYDS+MPW  D+
Sbjct  75    GFEGVDTNELSRDVYFELFTVSVSKSLTNFIEQHQSSQDDPAKVL---VYDSVMPWALDI  131

Query  1162  VHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGST----VSLPS-MPPLGLNDLPSF  998
               + G+  A+F ++SCAV A+YHH  +  L  P E S     VS+P  M  L LNDLPSF
Sbjct  132   AIRHGMHGASFFTESCAVSAIYHHVHRGTLKFPLEDSRGQEHVSVPPVMLNLKLNDLPSF  191

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
             V +  +Y + ++ VL +  N  +A+W LFNTF ELE EV++WM SQ P  V+ +GP +PS
Sbjct  192   VADVDAYPAFVKLVLDQFSNVMRANWRLFNTFAELEDEVVKWMGSQCP--VLTVGPTIPS  249

Query  817   MYLDKRVRDDDNYGLSLFKPNNND-CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQG  641
             MYLDKR++ D +YGLSLFKPN+ + C+ WLDS++  SVVY SFGSLA+L +EQM E+A G
Sbjct  250   MYLDKRIQHDKDYGLSLFKPNDAETCIGWLDSKDADSVVYASFGSLASLGEEQMEEIAIG  309

Query  640   LIQSKCKFLWVVRSSEQSKLPSNFWPDKS---GAGIITNWCPQLDVLSHQAVGCFITHCG  470
             L + K  FLWVVR+SE+ KLP NF  D     G G++  WC QL VLSH +VGCF+THC 
Sbjct  310   LKRMKGNFLWVVRASEEKKLPCNFLQDMELLDGKGLVVKWCDQLQVLSHGSVGCFMTHCR  369

Query  469   WNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEV  290
             WNST+E +SLGVP+V MPQWTDQPTNA ++ +VW VG+RV   E G+VT EE+E C+ EV
Sbjct  370   WNSTMEGVSLGVPMVVMPQWTDQPTNAAFITEVWKVGLRVRVNEKGIVTSEEIESCINEV  429

Query  289   MKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             M GERG  +K N+ KW++ A+ +++EGGSSD NI +F   I
Sbjct  430   MGGERGKEIKANSLKWRERARISMEEGGSSDNNISDFAKNI  470



>gb|KCW57498.1| hypothetical protein EUGRSUZ_H00263 [Eucalyptus grandis]
Length=475

 Score =   432 bits (1110),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 223/461 (48%), Positives = 303/461 (66%), Gaps = 26/461 (6%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSA----CIQVSSSLIRVESIPD  1319
             HVLV+ YP   HI P+V+ SKRLAS+G+ V +I P S  +        ++S I++E I D
Sbjct  14    HVLVLAYPSQSHINPVVEFSKRLASKGLNVALIIPISEPSKSLHSTNHATSSIKIEQISD  73

Query  1318  G--------VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             G        +  D  F+  +  +   ++N + +  S       +L   VYDS+MPW  D+
Sbjct  74    GFEGVDTNELSRDVYFELFTVSVSKSLTNFIEQHQSSQDDPAKVL---VYDSVMPWALDI  130

Query  1162  VHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGST----VSLPS-MPPLGLNDLPSF  998
               + G+  A+F ++SCAV A+YHH  +  L  P E S     VS+P  M  L LNDLPSF
Sbjct  131   AIRHGMHGASFFTESCAVSAIYHHVHRGTLKFPLEDSRGQEHVSVPPVMLNLKLNDLPSF  190

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
             V +  +Y + ++ VL +  N  +A+W LFNTF ELE EV++WM SQ P  V+ +GP +PS
Sbjct  191   VADVDAYPAFVKLVLDQFSNVMRANWRLFNTFAELEDEVVKWMGSQCP--VLTVGPTIPS  248

Query  817   MYLDKRVRDDDNYGLSLFKPNNND-CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQG  641
             MYLDKR++ D +YGLSLFKPN+ + C+ WLDS++  SVVY SFGSLA+L +EQM E+A G
Sbjct  249   MYLDKRIQHDKDYGLSLFKPNDAETCIGWLDSKDADSVVYASFGSLASLGEEQMEEIAIG  308

Query  640   LIQSKCKFLWVVRSSEQSKLPSNFWPDKS---GAGIITNWCPQLDVLSHQAVGCFITHCG  470
             L + K  FLWVVR+SE+ KLP NF  D     G G++  WC QL VLSH +VGCF+THC 
Sbjct  309   LKRMKGNFLWVVRASEEKKLPCNFLQDMELLDGKGLVVKWCDQLQVLSHGSVGCFMTHCR  368

Query  469   WNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEV  290
             WNST+E +SLGVP+V MPQWTDQPTNA ++ +VW VG+RV   E G+VT EE+E C+ EV
Sbjct  369   WNSTMEGVSLGVPMVVMPQWTDQPTNAAFITEVWKVGLRVRVNEKGIVTSEEIESCINEV  428

Query  289   MKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             M GERG  +K N+ KW++ A+ +++EGGSSD NI +F   I
Sbjct  429   MGGERGKEIKANSLKWRERARISMEEGGSSDNNISDFAKNI  469



>ref|XP_006417998.1| hypothetical protein EUTSA_v10007603mg [Eutrema salsugineum]
 gb|ESQ36351.1| hypothetical protein EUTSA_v10007603mg [Eutrema salsugineum]
Length=453

 Score =   430 bits (1106),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 220/454 (48%), Positives = 299/454 (66%), Gaps = 11/454 (2%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESI  1325
             M   SHV+V+P+P  GH+TPM Q  KRLAS+G+  T V+     S   +     I V  I
Sbjct  1     MRQGSHVIVLPFPGQGHLTPMSQFCKRLASKGLKPTFVLVSDKPSPPYKTEIDSITVFPI  60

Query  1324  PDGVK----PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             P+G K    P    D   + ++  + N L E++  +  SG     +VYDS MPW+ D+ H
Sbjct  61    PNGFKDGEDPLQDLDDYMERVERSIKNCLPELIQDMKLSGNPPRVLVYDSTMPWLLDVAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAP----TEGSTVSLPSMPPLGLNDLPSFVRN  989
               GL  A F +Q   V A+Y+H  + + + P       +  S PS P L   DLPSF+  
Sbjct  121   GHGLSGAVFFTQPWLVSAIYYHVLKGSYSVPYTKYAHSTLASFPSFPMLNAKDLPSFLCE  180

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
              +SY ++LR V+ +  N  + D +L NTFD+LE+++L W+ S +P  V+ IGP +PSMYL
Sbjct  181   SASYPNMLRIVIDQLSNIDRVDVVLCNTFDKLEEKLLTWVQSLWP--VMNIGPTVPSMYL  238

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR+ +D NYG SLF     +C+EWL+S++  SVVYVSFGSL  LK++QM E+A GL Q+
Sbjct  239   DKRLPEDKNYGFSLFNAKVAECIEWLNSKQPNSVVYVSFGSLVILKEDQMLELAAGLKQT  298

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
              C FLWVVR +E  KLP N+  +    G+I +W PQL+VL+H++VGCF+THCGWNSTLE 
Sbjct  299   GCFFLWVVRETETDKLPKNYTDEIGEKGLIVSWSPQLEVLAHESVGCFLTHCGWNSTLEG  358

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LSLGVP++ MP WTDQPTNAK++ DVW VG+RV A ++G V REE+ RC+ EVM+GE G 
Sbjct  359   LSLGVPMIGMPHWTDQPTNAKFMEDVWKVGVRVKAEDDGFVRREEIVRCVGEVMEGESGK  418

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              +++N+ KWK LA+EAV EGGSSDK+I EFVS I
Sbjct  419   EIRKNSEKWKVLAREAVSEGGSSDKSIDEFVSMI  452



>ref|XP_006357048.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=460

 Score =   431 bits (1107),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 208/458 (45%), Positives = 305/458 (67%), Gaps = 18/458 (4%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPD  1319
             S  +H L++P+P+ GHI PM+Q SKRL S+ + +T+    S    +   S+ + +++I D
Sbjct  3     SHKAHCLILPFPLQGHINPMLQFSKRLQSKRIKITIAPTKSFLKNMNELSTSVSIDTISD  62

Query  1318  GVKPDSG------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             G   D G      F A +   K++ S+ LA+++ K+  SGC +  +VYD  +PW  ++  
Sbjct  63    GYN-DGGIYQAENFLAYTTRFKEVGSDTLAQLIQKLANSGCPVNCIVYDPFLPWAVEVAK  121

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMPP-LGLNDLPSFVRNK  986
               GL +AAF +Q+CAV  +Y+H  +  +  P       + +P     +  +D+P+FV N 
Sbjct  122   NFGLISAAFFTQNCAVDNIYYHVHKGVIKLPPTQNDEEILIPGFSSTIEASDVPTFVINP  181

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
                  +L  ++++  N  K DW+L N+F ELEKEV+++M+  +P+K   IGP +PSMYLD
Sbjct  182   EG-ERILEMLVNQFSNLDKVDWVLINSFYELEKEVIDYMSKIYPIK--TIGPTIPSMYLD  238

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+ DD  YGLS+FKP  N+C+ WL+ Q   SVVYVSFGS+ NL+ EQM E+A GL  S 
Sbjct  239   KRLHDDKEYGLSVFKPMTNECLNWLNHQPINSVVYVSFGSITNLEAEQMLELAWGLKNSN  298

Query  625   CKFLWVVRSSEQSKLPSNFWPD-----KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNS  461
               FLWVVRS+E++KLP NF  +      +  G++ +WCPQL VL H+++GCF+THCGWNS
Sbjct  299   NNFLWVVRSTEEAKLPKNFLEELKLTSGNNKGLVVSWCPQLQVLEHESIGCFLTHCGWNS  358

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             TLEA+SLGVP+V MPQWTDQPTNAK + DVW++G+R    + G+V RE +E C+  VM+ 
Sbjct  359   TLEAISLGVPMVTMPQWTDQPTNAKLVKDVWEMGVRAKQDDKGIVRREVIEECIKLVMEE  418

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             E+G +++ENA KW++LA+  VDEGGSSDKNI+EF+S +
Sbjct  419   EKGKVIRENAKKWRELARNVVDEGGSSDKNIEEFISKL  456



>ref|XP_010672480.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   430 bits (1106),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 210/445 (47%), Positives = 300/445 (67%), Gaps = 7/445 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ-VSSSLIRVESIPDG--  1316
             HV+V PYPI GHI PM+Q SK+LASRG+ VT+ T ++ S+  + + SS I +E+I DG  
Sbjct  11    HVIVFPYPIQGHINPMLQFSKQLASRGLKVTLATTSTFSSKFKNLQSSSITIETISDGSN  70

Query  1315  -VKPDSGFDAISDWLKDLVSNNLAEIMSKVTG-SGCLLTTVVYDSIMPWVADLVHQLGLR  1142
              V      DA  +    +   +L++++ +  G     +  ++YDS +PW  D+  +  + 
Sbjct  71    EVATPENVDAYIEKFDVVAPRSLSQLIEQKIGFEHGDVRCLIYDSTIPWALDIAKKFNIY  130

Query  1141  AAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLR  962
              A+F +Q C +  +Y+      L+ P EG  + +  MP +   DLPSFVR    + SL +
Sbjct  131   GASFFTQCCLISLIYYQVYHGILSVPIEGPGICVAEMPFIEATDLPSFVRQVGVHPSLEK  190

Query  961   FVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDN  782
              V+ +  N  +ADW  FNTF+ LE + + WM +Q+P+K   IGP +PS YLDKR+ DD +
Sbjct  191   LVIDQFSNYGEADWRFFNTFEALESKAVNWMTNQWPVK--TIGPCIPSTYLDKRLPDDKD  248

Query  781   YGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVR  602
             YGLSLF+   + C++WLD++E  SVVY+S GSLA+L  EQM E+A GL +S   FLWVVR
Sbjct  249   YGLSLFEAQTDACIQWLDAREPTSVVYISMGSLASLGREQMGEIATGLQKSNKYFLWVVR  308

Query  601   SSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVA  422
             SSE++KLP NF  + S  G+I NWCPQL+VL+H AVGCF+THCGWNSTLEA+SLGVP+VA
Sbjct  309   SSEENKLPMNFKENISEKGLIVNWCPQLEVLAHCAVGCFVTHCGWNSTLEAISLGVPMVA  368

Query  421   MPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKW  242
              PQWTDQPTNAK +VD   +G+RV   + G++T +E+E C+ EVM G++   +K  A KW
Sbjct  369   FPQWTDQPTNAKCIVDFGKIGVRVKVDKRGLLTADEIEFCIQEVMDGKQTKEIKSTATKW  428

Query  241   KQLAKEAVDEGGSSDKNIKEFVSAI  167
             + ++K+A ++GGSSD+NI+EFVS +
Sbjct  429   RHISKQATEKGGSSDRNIEEFVSKL  453



>emb|CAN67246.1| hypothetical protein VITISV_008681 [Vitis vinifera]
Length=431

 Score =   429 bits (1103),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 219/445 (49%), Positives = 301/445 (68%), Gaps = 30/445 (7%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTV-ITPTSTSACIQVSSSLIRVESIPDGV  1313
             +H++V+P+   GHI PM Q SKRLAS+G+ VT+ IT +S S  +    S I +E I +G 
Sbjct  10    THIMVLPFHSQGHINPMFQFSKRLASKGLKVTLLITTSSISKSMHAQDSSINIEIICEGF  69

Query  1312  ---KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLR  1142
                K +S  D++  + +   S +L E++ + + S      +VYDSI+PW  D+  + GL 
Sbjct  70    DQRKAESIEDSLERY-RIAASQSLVELIEQHSRSNHPAKILVYDSILPWAQDVAERQGLH  128

Query  1141  AAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLR  962
              A+F +QSCAV A+Y+H +Q   ++P EGS V+LPSMP   +NDLPSF+ +K S ++LL 
Sbjct  129   GASFFTQSCAVSAIYYHFNQRAFSSPLEGSVVALPSMPLFHVNDLPSFISDKGSDAALLN  188

Query  961   FVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDN  782
              +L++  N QK  W+LFNTF +LE E   W  ++  +                       
Sbjct  189   LLLNQFSNFQKVKWILFNTFTKLEDETKGWSMTETTV-----------------------  225

Query  781   YGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVR  602
                SLFK N + C+ WLD++E GSVVYVSFGS+A+L +EQM E+A GL +S   FLWVVR
Sbjct  226   --FSLFKQNIDTCITWLDTKEIGSVVYVSFGSVASLGEEQMEELAWGLKRSNSHFLWVVR  283

Query  601   SSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVA  422
               E+ K P NF  + SG G++ +WCPQL VL+H+AVGCF+THCGWNSTLEALSLGVP+VA
Sbjct  284   ELEEKKFPYNFVEETSGKGLVVSWCPQLKVLAHKAVGCFLTHCGWNSTLEALSLGVPMVA  343

Query  421   MPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKW  242
             MPQ++DQ TNAK++ DVW VG+RV A E G+V R+E+E C+ E+M+GERG  +K NA +W
Sbjct  344   MPQFSDQTTNAKFIEDVWRVGVRVKADEKGIVKRQEIEMCIKEIMEGERGNEMKRNAERW  403

Query  241   KQLAKEAVDEGGSSDKNIKEFVSAI  167
             K+LAKEAV+EGGSSDKNI+EFV+ I
Sbjct  404   KELAKEAVNEGGSSDKNIEEFVAEI  428



>ref|NP_172059.1| Uridine diphosphate glycosyltransferase 74E2 [Arabidopsis thaliana]
 sp|Q9SYK9.1|U74E2_ARATH RecName: Full=UDP-glycosyltransferase 74E2 [Arabidopsis thaliana]
 gb|AAD30627.1|AC007153_19 Similar to indole-3-acetate beta-glucosyltransferase [Arabidopsis 
thaliana]
 gb|AAY25431.1| At1g05680 [Arabidopsis thaliana]
 gb|ABJ17124.1| At1g05680 [Arabidopsis thaliana]
 gb|AEE27876.1| Uridine diphosphate glycosyltransferase 74E2 [Arabidopsis thaliana]
Length=453

 Score =   430 bits (1105),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 219/452 (48%), Positives = 299/452 (66%), Gaps = 11/452 (2%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESI  1325
             M   SH++V+P+P  GHITPM Q  KRLAS+G+ +T V+     S   +     I V  I
Sbjct  1     MREGSHLIVLPFPGQGHITPMSQFCKRLASKGLKLTLVLVSDKPSPPYKTEHDSITVFPI  60

Query  1324  PDGVK----PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
              +G +    P    D   + ++  + N L +++  +  SG     +VYDS MPW+ D+ H
Sbjct  61    SNGFQEGEEPLQDLDDYMERVETSIKNTLPKLVEDMKLSGNPPRAIVYDSTMPWLLDVAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRN  989
               GL  A F +Q   V A+Y+H  + + + P+      +  S PS P L  NDLPSF+  
Sbjct  121   SYGLSGAVFFTQPWLVTAIYYHVFKGSFSVPSTKYGHSTLASFPSFPMLTANDLPSFLCE  180

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
              SSY ++LR V+ +  N  + D +L NTFD+LE+++L+W+ S +P  V+ IGP +PSMYL
Sbjct  181   SSSYPNILRIVVDQLSNIDRVDIVLCNTFDKLEEKLLKWVQSLWP--VLNIGPTVPSMYL  238

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR+ +D NYG SLF     +CMEWL+S+E  SVVY+SFGSL  LK++QM E+A GL QS
Sbjct  239   DKRLSEDKNYGFSLFNAKVAECMEWLNSKEPNSVVYLSFGSLVILKEDQMLELAAGLKQS  298

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
                FLWVVR +E  KLP N+  +    G+I +W PQLDVL+H+++GCF+THCGWNSTLE 
Sbjct  299   GRFFLWVVRETETHKLPRNYVEEIGEKGLIVSWSPQLDVLAHKSIGCFLTHCGWNSTLEG  358

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LSLGVP++ MP WTDQPTNAK++ DVW VG+RV A  +G V REE+ R + EVM+GE+G 
Sbjct  359   LSLGVPMIGMPHWTDQPTNAKFMQDVWKVGVRVKAEGDGFVRREEIMRSVEEVMEGEKGK  418

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
              +++NA KWK LA+EAV EGGSSDK+I EFVS
Sbjct  419   EIRKNAEKWKVLAQEAVSEGGSSDKSINEFVS  450



>ref|XP_008235866.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=463

 Score =   430 bits (1106),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 218/461 (47%), Positives = 304/461 (66%), Gaps = 17/461 (4%)
 Frame = -3

Query  1504  EMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ--------VSS  1349
             E    +H LV+ YPI GHI PM+Q SKRL  +G+ VT++T  S    +          S 
Sbjct  2     EKREKAHCLVLFYPIQGHINPMLQFSKRLQHKGLKVTLVTTRSVHKALHGDGGGKSPSSF  61

Query  1348  SLIRVESIPDGVKPDSG------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDS  1187
             S I +E+I DG   + G        A  D  +++ S  LAE++ K++ SG     +VYD 
Sbjct  62    SSIALETISDGFDGEGGSSQAESIQAYWDRFREIGSQTLAELIDKLSASGHPADCLVYDQ  121

Query  1186  IMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP-TEGSTVSLPSMPPLGLND  1010
             I+PW  D+  ++G+  AAF + SCAV  +Y    +  L  P    S + LP +PPL  +D
Sbjct  122   ILPWALDVAKRVGIAGAAFFTVSCAVTNIYSLVHKGLLKLPLNPDSEILLPGLPPLQPSD  181

Query  1009  LPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGP  830
              PSF+    SY +  +  +    N  KADW+ ++TF ELE E ++WMA  +PL+ I  GP
Sbjct  182   TPSFIYAPESYPAFFKLCVEPFSNLDKADWVFYSTFYELEHETVDWMAKFWPLRTI--GP  239

Query  829   LLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEV  650
              +PSMYLDKR  +D  YGL+L  PN++ CM+WL+++  GSV YVSFGS+A L +E+M E+
Sbjct  240   TIPSMYLDKRHEEDKEYGLNLLNPNSDACMKWLNAKPKGSVAYVSFGSVAKLGEEKMEEL  299

Query  649   AQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCG  470
               GL +SKC FLWVVR+SE +KLP  F  + S  G+  +WCPQL+VL+H+AVGCF+THCG
Sbjct  300   CLGLRRSKCYFLWVVRASESAKLPKGFAEETSEKGLAVSWCPQLEVLAHEAVGCFVTHCG  359

Query  469   WNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEV  290
             WNSTLEALSLGVP+VA+PQW DQ TNAK+++DVW +G++  A E G+V  EE+  C+ E+
Sbjct  360   WNSTLEALSLGVPMVAVPQWVDQGTNAKFIMDVWKIGLKAQADEKGIVRGEEIAHCVREI  419

Query  289   MKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ++GERG  +++NA+KWK LAK AVDEGGSS+KNI EF++ +
Sbjct  420   LEGERGKEIRKNASKWKALAKSAVDEGGSSNKNIDEFIAKL  460



>ref|XP_010037081.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
 gb|KCW48705.1| hypothetical protein EUGRSUZ_K02356 [Eucalyptus grandis]
Length=468

 Score =   430 bits (1106),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 215/463 (46%), Positives = 302/463 (65%), Gaps = 9/463 (2%)
 Frame = -3

Query  1534  LRGVERPEMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQV  1355
             L  V   E  +    +HVLV+PYP  GHI+PM+Q +KRL S+GV VT+ T    +  +  
Sbjct  4     LESVMEEEKMKRPCKAHVLVLPYPAQGHISPMLQFAKRLVSKGVRVTLATTFFVAKSMHA  63

Query  1354  S-SSLIRVESIPDGVKPDSGFDA--ISDWLKDLV---SNNLAEIMSKVTGSGCLLTTVVY  1193
             + +  I +E+I DG        A  I  +L+ L    S  LA ++ K+  SG  +  ++Y
Sbjct  64    ALNDSIGIETISDGFDEGGSAQAESIEAYLRSLQAVGSRTLAALIKKLDNSGDAIDAIIY  123

Query  1192  DSIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLN  1013
             D  + W  D+  Q G    AF +Q+CAV  VY+H  Q  L  P  G+T+SLP +PPL   
Sbjct  124   DGFLSWALDVAKQFGKSGVAFYTQACAVNNVYYHAYQGLLPLPLSGTTISLPGLPPLEPA  183

Query  1012  DLPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIG  833
             + PSF+    SY +    ++++  N   AD +L+N+F ELEKEV+++MA  +PLK +  G
Sbjct  184   ETPSFLYVLGSYPAFFNLIVNQFSNIDGADLVLYNSFYELEKEVVDYMAKLWPLKTV--G  241

Query  832   PLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCE  653
             P +PS+YLDKR++DD +YG++LF+P+   C+ WL+ +   SV+YVSFGS+A L+  QM E
Sbjct  242   PAIPSIYLDKRLQDDKDYGINLFRPDTESCLSWLNDKPINSVIYVSFGSMAELETSQMEE  301

Query  652   VAQGLIQSKCKFLWVVRSSEQSKLPSNFWPD-KSGAGIITNWCPQLDVLSHQAVGCFITH  476
             +A GL  S   FLWVVR SE +KLP  F    +SG G++  W PQL++L+H + GCFIT+
Sbjct  302   LAWGLRNSNRHFLWVVRESETAKLPPGFAEQTRSGMGLLVPWGPQLEILAHGSTGCFITN  361

Query  475   CGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLV  296
             CGWNSTLEALSL VP+VAMPQWTDQ TNAK++ DVW VG+R    E+G++ R E+ERC+ 
Sbjct  362   CGWNSTLEALSLRVPMVAMPQWTDQGTNAKFVEDVWGVGVRASKDEDGIIVRGEIERCIS  421

Query  295   EVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             EVM+G +G  ++ NA KW +LAKE VDEGGSSD+NI +FV  +
Sbjct  422   EVMEGGKGKEIERNAEKWWELAKETVDEGGSSDRNIDDFVRKL  464



>ref|XP_008236256.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Prunus mume]
Length=459

 Score =   429 bits (1104),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 219/458 (48%), Positives = 313/458 (68%), Gaps = 11/458 (2%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS---L  1343
             E  + +  +H LV+P+P  GHI PM+Q +K LA +GV VT++T   T   +  S+S    
Sbjct  2     EKGQTAYKAHCLVLPFPCQGHINPMLQFAKLLAHKGVKVTLVTTRYTHKTMYGSASSCIA  61

Query  1342  IRVESIPDGV----KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPW  1175
             + +E+I DG     + ++  DA  +  +++ S  LAE++ K++ SG  +  V+YD+ M W
Sbjct  62    LDLETISDGYDEAGRGETSIDAYLEIFREVGSKTLAELLEKLSSSGSPVDCVIYDAFMTW  121

Query  1174  VADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMPPLGLNDLPS  1001
               D+  + G+  A F +QSCAV  +Y+H  +  L  P   + S + LP +PPL   DLPS
Sbjct  122   PLDIARKFGIGGAVFFTQSCAVENIYYHIHEGLLKLPLADDQSRILLPGLPPLEPLDLPS  181

Query  1000  FVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLP  821
             FV +  SY    +  L++  N  KADW+LFNTF ELE++V++W+A  +PL+ +  GP +P
Sbjct  182   FVYDFGSYPVFYQASLAQFSNVDKADWILFNTFYELEEQVVDWLAKFWPLRTV--GPTIP  239

Query  820   SMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQG  641
             S YLD+R+ DD  YG++LFK  N+ C++WL+ +  GSV YVSFGS A L  EQM E+A+G
Sbjct  240   SKYLDERLEDDKEYGVNLFKSENDACIKWLNERPKGSVAYVSFGSFAELGVEQMEELARG  299

Query  640   LIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNS  461
             L +SK  FLWVVR+SE +K+P  F  +    G++ +WCPQ++VL+H+AVGCF+THCGWNS
Sbjct  300   LRRSKSNFLWVVRASEAAKVPKGFVEETLEKGLVVSWCPQMEVLAHEAVGCFVTHCGWNS  359

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             TLEALSLGVP++AMPQWTDQ TNAK+++DVW +G+   + E G+V  E VE C+ E+M+G
Sbjct  360   TLEALSLGVPMLAMPQWTDQTTNAKFIMDVWKIGLTAPSDEKGLVGPEVVEHCISEIMEG  419

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ERG  +K NA KWK+LAK+AV EGGSSDKNI EF+S +
Sbjct  420   ERGKEMKINALKWKELAKKAVAEGGSSDKNIDEFISKL  457



>ref|XP_006447240.1| hypothetical protein CICLE_v10015138mg [Citrus clementina]
 ref|XP_006469903.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Citrus sinensis]
 gb|ESR60480.1| hypothetical protein CICLE_v10015138mg [Citrus clementina]
Length=468

 Score =   430 bits (1105),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 216/448 (48%), Positives = 293/448 (65%), Gaps = 12/448 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL----IRVESIPD  1319
             H LV+ YP  GHI P++Q +KRL  +G+ VT++T    S  +   SS     I +E+I D
Sbjct  15    HCLVLSYPAQGHINPLLQFAKRLEHKGLKVTLVTTHFISKSLHRDSSSPSTSIALEAISD  74

Query  1318  GVKPDS-----GFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQ  1154
             G          G +A  +    +   +L E++  + GSG  +  +VYDS +PW  D+  +
Sbjct  75    GYDEGGSAQAEGVEAYLERFWQIGPRSLCELVENMNGSGVPVDCIVYDSFLPWALDVAKK  134

Query  1153  LGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYS  974
              GL  AAF +QSC V  +Y+H ++  L  P   S + LP MPPL   D+PSFV +  SY 
Sbjct  135   FGLVGAAFLTQSCVVDCIYYHVNKGLLKLPLLDSQLLLPGMPPLEPQDMPSFVYDLGSYP  194

Query  973   SLLRFVLSRNL-NTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
             ++   V+     N  KADW+L NTF ELEKEV +W+   + LK I  GP  PSMYL K++
Sbjct  195   AVSDMVVKYQFDNIDKADWVLCNTFYELEKEVAQWLGKHWSLKTI--GPTKPSMYLGKQI  252

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              +D +YG S+FKPNN  C++WL+ +  G VVYVSFGS+A LK E+M E+A GL  S   F
Sbjct  253   EEDKDYGFSIFKPNNESCIKWLNDRANGCVVYVSFGSMATLKIEEMEELAWGLKASDKYF  312

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR SEQSKLP NF  + S  G++ NWCPQL+VL+H+A GCF+THCGWNST+EA SLG
Sbjct  313   LWVVRESEQSKLPENFSEETSQKGLVVNWCPQLEVLAHEATGCFLTHCGWNSTMEARSLG  372

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP+VAMPQWTDQ TN+K ++DVW  G++V A + G+V RE +  C+ E+++GER   +++
Sbjct  373   VPMVAMPQWTDQSTNSKCVMDVWKTGLKVPADDKGIVRREAIAHCIREILEGERCKEIRQ  432

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
             NA KW   AKEAV +GGSSDKNI +FV+
Sbjct  433   NAGKWSNFAKEAVTKGGSSDKNIDDFVA  460



>ref|XP_006344123.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Solanum tuberosum]
Length=458

 Score =   429 bits (1104),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 214/448 (48%), Positives = 306/448 (68%), Gaps = 10/448 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVI-TPTSTSACIQVSSSLIRVESIPDGVK  1310
             H LVIP+P  GHI PM+Q SKRL  +G+ +T++ T       +Q  +S I +E I DG  
Sbjct  9     HCLVIPFPTQGHINPMLQFSKRLQHKGIEITLVPTIHIFKKSMQELTSSITIEPISDGYD  68

Query  1309  PDSGF---DAISDWL---KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
               +G     +I  +L   + + S  + +++ K+   G  +  V+YDS MPW+ D+    G
Sbjct  69    DVNGLFCAKSIETYLESYQKVGSQAIIQLIEKLKNKGNPINCVIYDSFMPWILDVAKMFG  128

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             L +  F + SCAV  +++H   + L  P EG  V LP +PPL  +DLPSFV +  SY   
Sbjct  129   LVSCVFFTMSCAVENIFYHIQLKELKLPVEGHQVLLPGLPPLVPSDLPSFVNDLGSYPPF  188

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
             L+ ++ +  N Q+ADW+L NT  ELEK  ++W+  +  L+   IGP +PSMY+DKR+ +D
Sbjct  189   LKMLVDQFSNIQEADWILCNTIYELEKHEVDWITKRLSLR--TIGPTIPSMYVDKRLEND  246

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
             ++YGLS++ P  + CM+WL   + GSVVYVSFGS+A LK+EQM E+A GL +S   FLWV
Sbjct  247   NSYGLSMYTPKTDVCMKWLSDCDDGSVVYVSFGSMAELKEEQMKEIACGLKKSNHNFLWV  306

Query  607   VRSSEQSKLPSNFWPDKSG-AGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             VR SE+ K+P +F  + +   G++  WCPQLDVLSH+A+GCF+THCGWNSTLEALSLGVP
Sbjct  307   VRESEEPKIPKDFLENITKEKGLVVTWCPQLDVLSHKAIGCFMTHCGWNSTLEALSLGVP  366

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             +VA+P WTDQ TNAKY++DVW++GI+  A E G+V +E VE C+ EVM+GERG  +++NA
Sbjct  367   MVAIPIWTDQCTNAKYVMDVWEMGIKAQANEKGVVKQEVVEHCIKEVMEGERGKEIRKNA  426

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              KW+++ K+A+DEGGSSD+NI EF++ +
Sbjct  427   TKWREVTKKAMDEGGSSDRNINEFIAKL  454



>ref|XP_003548080.2| PREDICTED: UDP-glycosyltransferase 74E2-like [Glycine max]
 gb|KHN32810.1| UDP-glycosyltransferase 74E2 [Glycine soja]
Length=478

 Score =   430 bits (1105),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 217/459 (47%), Positives = 299/459 (65%), Gaps = 15/459 (3%)
 Frame = -3

Query  1513  EMAEM--STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSS-SL  1343
             EM E   +  +H LV+PYP  GHI PM+Q SKRL  RGV VT++T  S    ++  + + 
Sbjct  17    EMKEQRKNHAAHCLVLPYPAQGHINPMLQFSKRLVQRGVKVTLVTVVSNWKNMRNKNFTS  76

Query  1342  IRVESIPDGVKPDSGFDAISDWLKDLV-------SNNLAEIMSKVTGSGCLLTTVVYDSI  1184
             I VESI DG   D G  A ++ L+  +       S   AE++ K+ GS      V+YD+ 
Sbjct  77    IEVESISDGY--DDGGLAAAESLEAYIETFWRVGSQTFAELVQKLAGSSHPPDCVIYDAF  134

Query  1183  MPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLP  1004
             MPWV D+  + GL  A F +Q+C    +Y H  ++ +  P   +   LP +P L   DLP
Sbjct  135   MPWVLDVAKKFGLLGATFFTQTCTTNNIYFHVYKKLIELPLTQAEYLLPGLPKLAAGDLP  194

Query  1003  SFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLL  824
             SF+    SY      V+++ +N  KADW+L N+F ELE+ V++W+   +PLK   IGP L
Sbjct  195   SFLNKYGSYPGYFDVVVNQFVNIDKADWVLANSFYELEQGVVDWLVKIWPLK--PIGPCL  252

Query  823   PSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQ  644
             PS+YLDKR++DD +YG++++ PN+  C++WLD +  GSVVYVSFGS+A L +EQ  E+A 
Sbjct  253   PSIYLDKRLQDDKDYGVNMYNPNSEACIKWLDEKPKGSVVYVSFGSMAGLNEEQTEELAW  312

Query  643   GLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWN  464
             GL  S   F+WV+R  ++ KLP  F  D S  G+I +WCPQL VL+H+A+GCF+THCGWN
Sbjct  313   GLGDSGSYFMWVIRDCDKGKLPKEF-ADTSEKGLIVSWCPQLQVLTHEALGCFLTHCGWN  371

Query  463   STLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK  284
             STLEALSLGVPV+AMP WTDQ TNAK L DVW +G++ +A E  +V RE +  C+ E+++
Sbjct  372   STLEALSLGVPVIAMPLWTDQITNAKLLKDVWKIGVKAVADEKEIVRRETITHCIKEILE  431

Query  283   GERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              E+G  +K+NA KWK LAK  VDEGG+SDKNI EFV  +
Sbjct  432   TEKGNEIKKNAIKWKNLAKSYVDEGGNSDKNIAEFVEEL  470



>ref|XP_010069222.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW57499.1| hypothetical protein EUGRSUZ_H00266 [Eucalyptus grandis]
Length=475

 Score =   429 bits (1104),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 223/461 (48%), Positives = 302/461 (66%), Gaps = 26/461 (6%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSA----CIQVSSSLIRVESIPD  1319
             HVLV+ YP  GH+ P+V+ SKRLAS+G+ V +I P S  +        + S I++E I D
Sbjct  15    HVLVLAYPAQGHMNPVVEFSKRLASKGLNVALIIPISEPSNSLHSTNHAMSSIKIEQISD  74

Query  1318  G--------VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             G        +  D  F+  +  +   ++N + +  S       +L   VYDS+M W  D+
Sbjct  75    GFEGVDTRELNRDVYFELFTVSVSKSLTNFIEQHQSSQDNPAKVL---VYDSVMSWALDI  131

Query  1162  VHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGST----VSLPS-MPPLGLNDLPSF  998
               Q G+  A+F +QSCAV A+Y H     L  P E S     VS+P  +  L LNDLPSF
Sbjct  132   AIQHGMHGASFFTQSCAVSAIYRHVHTGTLKFPLEDSRGQGHVSVPPVISNLKLNDLPSF  191

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
             V +  +Y +L + VL +  N  +A+W LFNTF ELE EV++W  SQ P  V+ +GP +PS
Sbjct  192   VADADAYPALAKLVLDQFSNVMRANWRLFNTFAELEVEVVKWTGSQCP--VLTVGPTIPS  249

Query  817   MYLDKRVRDDDNYGLSLFKPNNND-CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQG  641
             MYLDKR++ D +YGLSLFK N+ + C+EWLDS++  SVVY+SFGSLA+L +EQM E+A G
Sbjct  250   MYLDKRIQHDKDYGLSLFKLNDAETCIEWLDSKDADSVVYISFGSLASLGEEQMEEIAIG  309

Query  640   LIQSKCKFLWVVRSSEQSKLPSNFWPDKS---GAGIITNWCPQLDVLSHQAVGCFITHCG  470
             L + K  FLWVVR+SE+ KLP NF  D     G G++  WC QL VLSH +VGCF+THCG
Sbjct  310   LKRMKSNFLWVVRASEEKKLPCNFMRDMELLDGKGLVVKWCDQLQVLSHGSVGCFMTHCG  369

Query  469   WNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEV  290
             WNST+E +SLGVP+V MPQWTDQPTNA ++ +VW VG+RV   E G+VT EE+E C+ ++
Sbjct  370   WNSTMEGVSLGVPMVVMPQWTDQPTNAAFITEVWKVGLRVRVNEKGIVTGEEIESCVNKI  429

Query  289   MKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             M GERG  +K N+ KW++ A+ A++EGGSSD NI +FV  I
Sbjct  430   MGGERGKEIKANSLKWRERARIAMEEGGSSDNNISDFVKNI  470



>ref|XP_007049534.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
 gb|EOX93691.1| UDP-xylose phenolic glycosyltransferase, putative [Theobroma 
cacao]
Length=459

 Score =   429 bits (1102),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 208/446 (47%), Positives = 303/446 (68%), Gaps = 10/446 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS-SSLIRVESIPDGV  1313
             +HVL++PY   GHI PM+Q +KRL S+G+  T++T T  S  + V  ++ I ++SI DG 
Sbjct  12    AHVLILPYTAQGHINPMLQFAKRLVSKGLKATLVTSTFISKSMLVDPNTPIDIQSISDGF  71

Query  1312  KPDSGF---DAISDWL---KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
               + GF   ++  D+L   + + S +LA +M K+   G  +  ++YD  +PW  D+  Q 
Sbjct  72    D-EGGFAQAESSEDYLTTFQKVGSPSLATLMKKLGEIGRPVHALIYDPFLPWALDVAKQF  130

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             G+   AF +QSCAV ++Y+H  +  L  P   S VSLP +P L +++LPS+V    SY +
Sbjct  131   GVAGVAFFTQSCAVNSIYYHVHKGLLQLPLSVSNVSLPGLPELNVSELPSYVSLYGSYPA  190

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
                 V+++  N    DW+LF+ F ELE +V++WM+  +  K+  IGP LPSMYLDKR+ D
Sbjct  191   FFDMVVNQFSNLDLVDWVLFDNFYELETQVVDWMSKLW--KLGTIGPTLPSMYLDKRIED  248

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D +YG++LFKP+   CM WL+ +  GSVVY SFGS+A +  EQM E+A GL  S C FLW
Sbjct  249   DKDYGVNLFKPDTGTCMSWLNGKPKGSVVYASFGSMAEVDVEQMREIAWGLKGSSCYFLW  308

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             VVR SE++KLP+ F  + S  G++  WC QL+VLSH++VGCF+THCG NS +EA+ LG+P
Sbjct  309   VVRESEEAKLPTKFMEETSEKGLVVRWCSQLEVLSHESVGCFLTHCGLNSVMEAMCLGIP  368

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             +VA+PQWTDQ TNAK++ D+W+VGI+    E G+V  + +E  + E+M+GE+G  +K+NA
Sbjct  369   MVAVPQWTDQITNAKFVEDIWEVGIKAQPDEKGIVKSQAIELSVKEIMEGEKGKEIKKNA  428

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVS  173
              KWK LA+EA+DEGGSSDK+I +FV+
Sbjct  429   NKWKNLAREAIDEGGSSDKHINQFVA  454



>ref|XP_011082055.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Sesamum indicum]
Length=476

 Score =   429 bits (1103),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 215/447 (48%), Positives = 299/447 (67%), Gaps = 8/447 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITP--TSTSACIQVSSSLIRVESIPDG  1316
             +H L++P+P+ GHI PM+Q +KRL   G+ +T +     + +A    ++S I +E I  G
Sbjct  21    AHCLILPFPVQGHINPMLQFAKRLLQNGIQITFVVTQNVAKTALFSSTTSAIPLEIISLG  80

Query  1315  VKPD----SGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
                D    + +D       +  S  L E + ++  SG  +  +VYD I+PW  D+  + G
Sbjct  81    SAADLPHGTSYDVYLARFLEFGSRTLKEALVRLADSGRPVDCIVYDPILPWGLDVAKEFG  140

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             + AAAF + SCAV  +Y+H  +  L  P  G  + LP +PPL  +D+PSFV    +Y   
Sbjct  141   MAAAAFFTHSCAVDQIYYHVFKGELKVPLSGEEILLPGLPPLMPDDMPSFVHVHGAYPPF  200

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
             L   ++R    + ADWL FNTF +LE+EV++ MA  FP+K +  GP +PSMYLDKR+ DD
Sbjct  201   LEMTVNRFSGLENADWLFFNTFYKLEEEVIDNMAKFFPVKTV--GPTIPSMYLDKRLSDD  258

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
               YGLS++ P+   CMEWL  ++  SVVYVSFGSLA L +EQM E+A GL  S   FLWV
Sbjct  259   REYGLSIYNPDTEACMEWLKQRQPESVVYVSFGSLAKLGEEQMEELAWGLRLSNKHFLWV  318

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             VRSSE+SKLP +F  +    G+I  WCPQLDVL+H+AV CF+THCGWNSTLEALSLGVP+
Sbjct  319   VRSSEESKLPKDFAKESWEMGLIVPWCPQLDVLAHEAVCCFVTHCGWNSTLEALSLGVPM  378

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             VA+PQW+DQ TN+K+++DVW +G+     +NG+V RE V RC+ +VM+G+R   +K NA 
Sbjct  379   VAIPQWSDQTTNSKFVMDVWKMGVWAKVDDNGVVGRETVARCIKDVMEGQRREDMKRNAG  438

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             KWK+LA+EAV+EGG+S KNI++F+SAI
Sbjct  439   KWKELAREAVEEGGTSHKNIQDFLSAI  465



>gb|KFK42906.1| hypothetical protein AALP_AA1G053600 [Arabis alpina]
Length=460

 Score =   428 bits (1101),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 214/449 (48%), Positives = 300/449 (67%), Gaps = 12/449 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVI----TPTSTSACIQVSSSLIRVES-I  1325
             SHV+V+P+P  GHITPM Q  KRLAS+G+ +T++     PT        S ++  + +  
Sbjct  11    SHVIVLPFPGQGHITPMFQFCKRLASKGLKLTLVLVSNKPTPPYKTEHDSITIFPISNGF  70

Query  1324  PDGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
              +G  P    D   D ++  + N L E++  +  SG     +VYDS MPW+ DL H  GL
Sbjct  71    QEGEDPLQDLDDYMDRVQTNIKNRLPELIQDMKLSGNHPRALVYDSTMPWLLDLAHGHGL  130

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRNKSSY  977
             + A F +Q   V  +Y+H  + + + P+      +  S PS P L  NDLPSF+   SSY
Sbjct  131   KGAVFFTQPWLVSVIYYHVLKGSFSIPSTKYGHSTLASFPSFPMLNANDLPSFLCESSSY  190

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
              ++LR V+ +  N  + D +L NTFD LE+++L+W+ S +P  V+ IGP +PSMYLDKR+
Sbjct  191   PNILRIVVDQLSNIDRVDIVLCNTFDILEEKLLKWVQSLWP--VLNIGPTVPSMYLDKRL  248

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              +D NYG SLF+    +C+EWL++++  SVVYVSFGSL   K++QM E+A GL ++ C F
Sbjct  249   TEDKNYGFSLFEAKVTECIEWLNTKQPNSVVYVSFGSLVIHKEDQMMELAAGLKETGCYF  308

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR +E+ KLP N+  +    G+I +W PQL+VL+H++VGCF+THCGWNSTLE LSLG
Sbjct  309   LWVVRETEKDKLPRNYIEEIGEKGLIVSWSPQLEVLAHKSVGCFLTHCGWNSTLEGLSLG  368

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMA-GENGMVTREEVERCLVEVMKGERGVMLK  260
             VP++ MP WTDQPTNAK++ DVW VG+RV   G +G V REE+ RC+ EVM+G +G  ++
Sbjct  369   VPMIGMPHWTDQPTNAKFVEDVWKVGVRVKTEGNDGFVRREEIVRCVKEVMEGVKGKEIR  428

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
             +NA KWK LA+EA+ EGGSSDK+I EFVS
Sbjct  429   KNAEKWKMLAREAISEGGSSDKSIDEFVS  457



>ref|XP_004244485.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum lycopersicum]
Length=456

 Score =   428 bits (1100),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 209/451 (46%), Positives = 302/451 (67%), Gaps = 14/451 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++P+P  GHI PM+Q SKRL S+ V +T+    S    +Q  S+ + +E+I DG  
Sbjct  6     AHCLILPFPGQGHINPMLQFSKRLQSKRVKITIALTKSCLKTMQELSTSVSIEAISDGYD  65

Query  1309  PDSGFDAISDW------LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              D GF    ++       K++ S+ L++++ K+  S C +  +VYD  +PW  ++  Q G
Sbjct  66    -DGGFHQAENFVAYITRFKEVGSDTLSQLIKKLENSDCPVNCIVYDPFIPWAVEVAKQFG  124

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMP-PLGLNDLPSFVRNKSSY  977
             L +AAF +Q+C V  +Y+H  +  +  P       + +P  P  +  +D+PSFV +  + 
Sbjct  125   LISAAFFTQNCVVDNLYYHVHKGVIKLPPTQNDEEILIPGFPNSIDASDVPSFVISPEA-  183

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
               ++  + ++  N  K D +L N+F ELEKEV+EWM+  +P+K   IGP +PSMYLDKR+
Sbjct  184   ERIVEMLANQFSNLDKVDCVLINSFYELEKEVIEWMSKIYPIK--TIGPTIPSMYLDKRL  241

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              DD  YGLS+FKP  N+C+ WL+ Q   SVVYVSFGS+  L DEQM E+A GL  S   F
Sbjct  242   HDDKEYGLSVFKPMTNECLNWLNHQPISSVVYVSFGSITKLGDEQMEELAWGLKNSNKSF  301

Query  616   LWVVRSSEQSKLPSNFWPD-KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             LWVVRS+E+ KLP+NF  +  S  G++ +WCPQL VL H++ GCF+THCGWNSTLEA+SL
Sbjct  302   LWVVRSTEEPKLPNNFIEELTSEKGLVVSWCPQLQVLEHESTGCFLTHCGWNSTLEAISL  361

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
             GVP+VAMPQW+DQPTNAK + DVW++G+R    E G+V RE +E C+  VM+ ++G +++
Sbjct  362   GVPMVAMPQWSDQPTNAKLVKDVWEIGVRAKQDEKGVVRREVIEECIKLVMEEDKGKLIR  421

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ENA KWK++A+  V+EGGSSDKNI+EFVS +
Sbjct  422   ENAKKWKEIARNVVNEGGSSDKNIEEFVSKL  452



>ref|XP_003632443.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Vitis vinifera]
Length=456

 Score =   428 bits (1100),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 218/446 (49%), Positives = 285/446 (64%), Gaps = 7/446 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H +V+PYP  GHI PM+Q SKRL   G  VT+      S      S  I +E+I DG  
Sbjct  10    AHCIVLPYPSQGHINPMLQFSKRLVHNGAKVTLAATRFISKSFVGDSGPITIETISDGYD  69

Query  1309  PDSGFDAISDW-----LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
                   A SD       + + S  L  ++ K+  SGC +  VVYD+ +PW  D+  QLGL
Sbjct  70    EGGSAQAESDGAYLERFRVVGSETLGSLIEKLKSSGCPVDCVVYDAFLPWALDVAKQLGL  129

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLL  965
               A F +QSC V  +Y+H  Q  L  P     V +P + PL   DLPSFV    SY +  
Sbjct  130   VGAVFFTQSCTVNDIYYHVHQGMLKLPLSEPEVVVPGLFPLQACDLPSFVYLYGSYPAFF  189

Query  964   RFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDD  785
               V+++  N +K DW+  NTF +LE++V++WMA   PL+ I  GP LPS+YLDKR+ DD 
Sbjct  190   DMVVNQFSNIEKVDWVFCNTFYKLEEKVVDWMAKICPLRTI--GPTLPSVYLDKRLGDDK  247

Query  784   NYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVV  605
             +YGL++ KP    CMEWLDS+  GSVVY S+GS A L+ EQM EVA GL +S   FL VV
Sbjct  248   DYGLNMLKPVTGACMEWLDSKPNGSVVYASYGSFAVLEPEQMEEVAWGLRRSNAYFLVVV  307

Query  604   RSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVV  425
             R SEQ+KLP NF  + +  G++ +WCPQL+VL+H+A+GCF+TH GWNSTLEALSLGVP+V
Sbjct  308   RESEQAKLPQNFKEETAEKGLVVSWCPQLEVLAHRAIGCFLTHGGWNSTLEALSLGVPMV  367

Query  424   AMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAK  245
               P WTDQPTNAK++ DVW +G+R  A   G+V RE +E C+ +VM  +    +K NA K
Sbjct  368   VAPLWTDQPTNAKFVEDVWGIGLRARADHKGIVRREVLEDCIGKVMGSDGLKEIKNNAMK  427

Query  244   WKQLAKEAVDEGGSSDKNIKEFVSAI  167
             WK LA+EAVDEGGSSDK I EFV+ +
Sbjct  428   WKNLAREAVDEGGSSDKCIDEFVAKL  453



>ref|XP_007045533.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007045534.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY01365.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
 gb|EOY01366.1| UDP-xylose phenolic glycosyltransferase, putative isoform 1 [Theobroma 
cacao]
Length=457

 Score =   427 bits (1099),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 209/448 (47%), Positives = 298/448 (67%), Gaps = 10/448 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTST-SACIQVSSSLIRVESIPDGV  1313
              HVLV+PYP  GHI PM+Q +KRL S+GV  T++T     ++ +   +S I +++I DG 
Sbjct  10    GHVLVLPYPGQGHINPMLQFAKRLVSKGVKATLVTTIFLYNSILSDPTSSIDLQTISDGF  69

Query  1312  KPDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
               + GF       A     + + S +LA ++ K+  +      ++YDS +PW  D+  QL
Sbjct  70    D-EGGFAQAGSPGAYLSTFRSVGSQSLASLIQKLGDTDFPFDAIIYDSFLPWALDVARQL  128

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             GL  A F +QSCAV ++ +H  +  L  P EG  VSLP +P   +++LPS V    S+ +
Sbjct  129   GLLGAVFFTQSCAVNSINYHVSEGLLKLPLEGPNVSLPGLPLYKVSELPSVVYLYGSHPA  188

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
                 ++++  N   ADW+L NTF ELEKEV++WM+  +  K+  +GP +PSM+LD+R+  
Sbjct  189   WFDMIVNQFSNIDAADWVLVNTFYELEKEVVDWMSEIW--KLGTVGPTIPSMHLDRRLEG  246

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             + +YG++LF PN N CM WL+ +  GSVVYVSFGSLA+L  E+M E+A GL  S   FLW
Sbjct  247   NKDYGMNLFNPNTNTCMNWLNGKPNGSVVYVSFGSLADLGVEEMAEIAWGLKVSNFYFLW  306

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             VVR SE++KLP NF  +    G++  WCPQL+VL+H +VGCF+THCG+NS LEAL LGVP
Sbjct  307   VVRESEETKLPYNFKEETGEKGLMVEWCPQLEVLAHDSVGCFLTHCGYNSVLEALCLGVP  366

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             ++ MPQW DQ TNAK++ ++W +GIR    E G+V  E +++C+ E+M+GERG  +KENA
Sbjct  367   MLGMPQWADQATNAKHVEEIWGIGIRAFPDEKGIVRGEIIQQCIKELMEGERGKQVKENA  426

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              KWK LA++A DEGGSSDKNI EFV+ +
Sbjct  427   NKWKNLARDATDEGGSSDKNIDEFVAKL  454



>ref|XP_011073993.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Sesamum indicum]
Length=452

 Score =   427 bits (1098),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/444 (48%), Positives = 291/444 (66%), Gaps = 12/444 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS-SSLIRVESIPDG--  1316
             HVLV+PYP  GHI P ++ +K LAS+GV +T IT  + +   + S   L+ +  + DG  
Sbjct  12    HVLVVPYPAQGHINPALEFAKYLASKGVRITFITTKAVTKSAKSSLCGLLTIVDVSDGSE  71

Query  1315  -VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
              VK     +      K + S NLA  + +   +      +VYDS MPWV D+ H+ GLR 
Sbjct  72    DVKDPESIEGYFKRFKAVFSKNLARFIDEQRDAA---QVIVYDSTMPWVLDIAHERGLRG  128

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRF  959
             A+F +QSCAV AV++H  QE L  P E S VSLPS+P LG  DLPSF+       ++   
Sbjct  129   ASFFTQSCAVSAVFYHLKQETLRFPYEDSVVSLPSLPALGTKDLPSFLEFTDPKQTIPTV  188

Query  958   VLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNY  779
             +  +  N +K DW+  NTFD+LE +V+EWMAS++P+K   +GP    + +DK++ +  N+
Sbjct  189   MADQFSNLEKVDWIFLNTFDKLENQVVEWMASRYPIK--TVGPTFSLLQMDKKLSNSKNH  246

Query  778   GLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRS  599
              ++L +P    C EWLDS+ETGSVVYVSFGS+A+L  +QM EVA GL+ S C FLWVVR 
Sbjct  247   TINLLEPA---CTEWLDSRETGSVVYVSFGSIASLGKKQMEEVAWGLMTSNCYFLWVVRP  303

Query  598   SEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAM  419
              E  KLP +F    S  G+I  WC Q +VL+H+A+ CF+THCGWNSTLEALS GVP++AM
Sbjct  304   LEVDKLPDDFTSLASEKGLIVGWCKQPEVLAHRAIACFLTHCGWNSTLEALSCGVPLIAM  363

Query  418   PQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWK  239
             PQW DQ  N+K++ DVW VG+RV  GE+G+V REE+  C+ EV + +RG+ LK NA  WK
Sbjct  364   PQWVDQQMNSKFIEDVWGVGVRVKRGEDGIVGREEIAMCIKEVTEEDRGMELKRNACMWK  423

Query  238   QLAKEAVDEGGSSDKNIKEFVSAI  167
              L  EAV++GG+S  NI++FVS +
Sbjct  424   DLVNEAVEKGGTSANNIEDFVSKL  447



>gb|ACM09899.2| glycosyltransferase [Withania somnifera]
Length=456

 Score =   427 bits (1098),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/451 (47%), Positives = 301/451 (67%), Gaps = 14/451 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP  GH+ PM+Q SKRL S+ V +T+ T  S    +Q   + I +E+I DG  
Sbjct  6     AHCLILPYPGQGHVNPMLQFSKRLQSKSVKITIATTKSFLKKMQKLPTSISIEAISDGYD  65

Query  1309  PDSGFDAISDW------LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              D G D    +       K++ S+ L++++ K+  SG  +  +VYD  +PWV ++    G
Sbjct  66    -DDGLDQARSYAAYLTRFKEVGSDTLSQLIEKLANSGSPVNCIVYDPFLPWVVEVAKNFG  124

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTE--GSTVSLPSMP-PLGLNDLPSFVRNKSSY  977
             L  AAF +QSCAV  +Y+H  +  L  P       + +P +   +  +D+PSF  + S  
Sbjct  125   LAIAAFFTQSCAVDNIYYHVHKGVLKLPPTQVDEEILIPGLSYAIESSDVPSF-ESTSEP  183

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
               L+  + ++  N +K DW+L N+F ELEK V++WM+  +P+K  AIGP +PSMYLDKR+
Sbjct  184   DLLVELLANQFSNLEKTDWVLINSFYELEKHVIDWMSKIYPIK--AIGPTIPSMYLDKRL  241

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              DD  YGLS+FKP  + C+ WL+ Q   SV+YVSFGSLA L+ EQM E+A GL  S   F
Sbjct  242   PDDKEYGLSMFKPITDACINWLNHQPINSVLYVSFGSLAKLEAEQMEELAWGLKNSNKNF  301

Query  616   LWVVRSSEQSKLPSNFWPD-KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             LWVVRS+E+ KLP NF  +  S  G++ +WCPQL VL H+++GCF+THCGWNSTLEA+SL
Sbjct  302   LWVVRSAEEPKLPKNFIEELPSEKGLVVSWCPQLQVLEHESIGCFMTHCGWNSTLEAISL  361

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
             GVP+V +PQW+DQPTN K + DVW++G+R    + G+V RE +E C+  VM+ E+G +++
Sbjct  362   GVPMVTLPQWSDQPTNTKLVKDVWEMGVRAKQDDKGLVRREVIEECIKLVMEEEKGKVIR  421

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ENA KWK+LA+ AVDEGGSSDKNI+EFVS +
Sbjct  422   ENAKKWKELARNAVDEGGSSDKNIEEFVSKL  452



>ref|XP_004287163.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=504

 Score =   429 bits (1102),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 227/487 (47%), Positives = 312/487 (64%), Gaps = 37/487 (8%)
 Frame = -3

Query  1522  ERPEMAEMSTVS-HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS  1346
             + P+    ST S HVLV PYP  GHI PMV+ SKRLAS+GV VTV+  T ++A + +   
Sbjct  16    QAPQSRSTSTSSAHVLVFPYPFQGHICPMVEFSKRLASKGVRVTVVITTISAATVAMKQL  75

Query  1345  L---------IRVESIPDGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCL------  1211
             L          RVE I DG +     +   +    + + NL+ +++ +     L      
Sbjct  76    LAAESRNKTSFRVEIISDGSEHLQKSENKDEVFNRVATQNLSNLITDIKNKKDLASDSDS  135

Query  1210  ---------LTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTE  1058
                      L  V+Y S MPWV D+  Q G+  A F + S AV A++HH  +  L  P++
Sbjct  136   SDEDDDDYPLKCVIYHSAMPWVLDVARQHGIDGAPFFTCSAAVTAIFHHFYEGVLKIPSK  195

Query  1057  GS-------TVSLPSMP-PLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTF  902
              S       T+ +PSMP PLG NDLPSF+ +  +YSS L   L+   N  +  W+ +NT+
Sbjct  196   DSAARSSNTTMLIPSMPGPLGFNDLPSFLCDVDAYSSFLNSTLNMFSNITQVKWIFYNTY  255

Query  901   DELEKEVLEWMAS-QFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNN-NDCMEWLD  728
             ++LE++VL+W AS  +P+K I  GP +PS +LDKR+ D+ +Y LSLFKP+    CM+WLD
Sbjct  256   EKLEEQVLKWTASLDWPVKTI--GPTIPSSFLDKRLEDEKDYSLSLFKPDRVETCMKWLD  313

Query  727   SQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGA  548
             S+ETGSVVYVSFGSLANL  EQM E+A GL  S   FLWV++ SE+ KLP+NF+ + S  
Sbjct  314   SKETGSVVYVSFGSLANLTKEQMEELAWGLNNSNYHFLWVIKESEKQKLPTNFFEEISEK  373

Query  547   GIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVW  368
             G++ +WC QL VL+H+AVGCF+THCGWNSTLEALSLGVP+V +PQ+ DQ TN K + DVW
Sbjct  374   GLVVSWCSQLQVLAHKAVGCFVTHCGWNSTLEALSLGVPMVTLPQFADQTTNGKLVADVW  433

Query  367   DVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNI  188
              VG+RV   E G +T+EE+   + +VM  E GV +++ +  WK+LAKEAVDEGGSSD+NI
Sbjct  434   KVGVRVKVNEKGFITKEELVMRVKQVMDKEVGVEIRKASQIWKKLAKEAVDEGGSSDRNI  493

Query  187   KEFVSAI  167
             +EF + +
Sbjct  494   EEFAAQL  500



>gb|AEZ01222.1| UDP-glucosyltransferase [Carica papaya]
Length=472

 Score =   427 bits (1099),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 225/471 (48%), Positives = 316/471 (67%), Gaps = 23/471 (5%)
 Frame = -3

Query  1522  ERPEMAEMSTVSH--VLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACI----  1361
             ++ +M   + ++H  VLV+P+PI GHI PM+Q +KRL S+G+ VT++TPTS++  +    
Sbjct  3     KKNQMKGATELTHLRVLVLPFPIQGHINPMLQFAKRLLSKGLTVTLLTPTSSAHNLIKPN  62

Query  1360  -QVSSSLIRVE----SIPDGVKPD------SGFDA-ISDWLKDLVSNNL-AEIMSKVTGS  1220
                +S  + ++    S P G KP       + F A I+  L DL+ +++ A   +  T +
Sbjct  63    PNSTSKSLHIQPIDDSFPPGTKPGVTAEYFNQFRAGITKSLTDLIRHDISATTTTTTTTT  122

Query  1219  GCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSL  1040
               L   +VYD  M W  D+  + G+ AA F +QSCAV AVY+   +  +    EG  VSL
Sbjct  123   KPLPKFLVYDCFMTWALDVARESGIDAAPFFTQSCAVNAVYNDFKEAEVKGGDEG--VSL  180

Query  1039  PSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQ  860
             P    L  NDLPS V   + Y  L  F++ +  N  +A  +L N+FDELE +V+ WM SQ
Sbjct  181   PWKGLLSWNDLPSLVHETTVYGVLREFLMDQYYNVGEAKCVLANSFDELENQVMNWMPSQ  240

Query  859   FPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLA  680
             + +K   IGP +PSM+LDKR+ DD +YGL+LFKP    C+ WLDS++  SV+YVSFGSLA
Sbjct  241   WRIK--NIGPTVPSMFLDKRLEDDKDYGLTLFKPQAVTCLTWLDSKQPSSVIYVSFGSLA  298

Query  679   NLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQ  500
             +L  EQM E+A+GL  S   FLWVVR  E+ KLP +F  + S  G++ +W PQL+VL+H+
Sbjct  299   SLSGEQMTELARGLQMSCDHFLWVVRDLEKLKLPESFKEETSDKGLVVSWSPQLEVLAHK  358

Query  499   AVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTR  320
             ++GCF+THCGWNSTLEALSLGVP+VAMPQWTDQPTNAK++ DVW VGIRV   E G+VTR
Sbjct  359   SMGCFMTHCGWNSTLEALSLGVPMVAMPQWTDQPTNAKFITDVWQVGIRVEVNEEGIVTR  418

Query  319   EEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             EE+ +C+ E+M+GE+G  +K+N+ KW+ LA  A++EGGSSDKNI EF++ +
Sbjct  419   EEISKCINEIMEGEKGKDIKKNSEKWRDLAIAAMNEGGSSDKNIGEFIALL  469



>ref|XP_011100878.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Sesamum indicum]
Length=455

 Score =   427 bits (1097),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 207/451 (46%), Positives = 300/451 (67%), Gaps = 7/451 (2%)
 Frame = -3

Query  1504  EMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESI  1325
             E +  +HV+V+ Y   GHI PMVQ SKRLA++G+ VTV T  S +  ++ +   I+ E+I
Sbjct  4     EETYKAHVVVLAYHGQGHINPMVQFSKRLAAKGIKVTVTTTLSNTKAMKSAYGPIKFETI  63

Query  1324  PD-----GVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLV  1160
              D     GV    GF    D  + + S NL E +SK   S   +  +VYD+ +PW +++ 
Sbjct  64    YDDCTEGGVAGPGGFKGFLDRFEAIGSRNLVEFISKFQDSEKPVKCLVYDANIPWASNVA  123

Query  1159  HQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSS  980
              +LG+  AAF +QSCA     +    +    P     +S+P +P L + +LPS       
Sbjct  124   TELGIARAAFFTQSCAFVTTCYPMHCDLSGKPPSVPLLSMPGLPELRVPNLPSLGPETGR  183

Query  979   YSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKR  800
             Y  ++R +LS+  N++KADW+LFN+F +LE+EV+ WM+  +PLK I  GP LPS+Y+D R
Sbjct  184   YPPIIRLILSQFDNSEKADWVLFNSFAKLEEEVINWMSRLWPLKTI--GPTLPSVYVDNR  241

Query  799   VRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCK  620
             ++DD++YG +++ PN + CM+WLDS+ET SV+Y+SFGS A+L  EQ  E+A  L+     
Sbjct  242   LKDDNDYGFNIYTPNTDTCMKWLDSKETRSVIYISFGSAASLSAEQTTELANALLHGNKS  301

Query  619   FLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             FLWVV+ SE+SKLP+NF       G++  WCPQL VL+H AVGCF++HCGWNST+EA+SL
Sbjct  302   FLWVVKPSEESKLPTNFSKGNPDKGLVVKWCPQLAVLAHGAVGCFVSHCGWNSTMEAISL  361

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
             GVP+VAMPQ+ DQ TNA ++  VW VGI+    ENG+ + EE+E C+ E+M+GERG  +K
Sbjct  362   GVPLVAMPQFLDQMTNAHFVEHVWQVGIKPKTDENGVASCEEIETCIDEIMQGERGREIK  421

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +NAA+W+  AKEA+DEGGSSDK I + ++ +
Sbjct  422   KNAARWRASAKEAIDEGGSSDKCIDDIIAQL  452



>ref|XP_010679006.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Beta vulgaris subsp. 
vulgaris]
Length=465

 Score =   427 bits (1098),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 223/465 (48%), Positives = 304/465 (65%), Gaps = 20/465 (4%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL---  1343
             E A+    SHVLV+P+P  GHI PM+Q SKRLA +G+  T +TPT   A    ++++   
Sbjct  2     EDAKQGQKSHVLVVPFPAQGHINPMLQFSKRLAFKGIKPT-LTPTVYIAKSMQTTTIPTH  60

Query  1342  ----IRVESIPDGVKPDSGF---DAISDWLKDLVSNN---LAEIMSKVTGSGCLLTTVVY  1193
                 I++  I DG   D GF   ++   +L +L +N    LA+++ K+T  G  +  V+Y
Sbjct  61    YGPSIQIRPISDGYD-DGGFSQAESTKAYLDNLRTNGSKTLAQLIQKLTEEGDSVKAVIY  119

Query  1192  DSIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEG---STVSLPSMPPL  1022
             D  +PWV D+ +Q GL    F +QSC+V ++Y+H  +  +  P  G   STVS+P +P L
Sbjct  120   DGFLPWVLDVANQFGLVGVVFFTQSCSVNSIYYHVQRGLIQLPLLGPGPSTVSVPGVPEL  179

Query  1021  GLNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVI  842
              L ++PSFV    SY      VL +  N  + DW+L N F E+EKEV++WMA  +  KV 
Sbjct  180   QLWEVPSFVGQYGSYPFWFDVVLEQFSNIDQVDWVLCNIFYEMEKEVIDWMAKMW--KVR  237

Query  841   AIGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQ  662
              IGP +PS YLDKR+ DD +Y L L KPN   C  WLD++   SV+YVSFGS+A+L ++Q
Sbjct  238   TIGPTVPSYYLDKRLEDDRDYSLQLLKPNTALCKNWLDTKTKESVIYVSFGSMADLSEQQ  297

Query  661   MCEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFI  482
               E+A GL  S   FLWVVR SEQ+KLP  F  + SG G++  W  QL+VL+H+A GCF+
Sbjct  298   FEELAWGLKNSHKSFLWVVRESEQAKLPKGFVEEASGQGLVVGWASQLEVLAHEATGCFV  357

Query  481   THCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERC  302
             THCG+NS LEAL LGVPVV +PQWTDQ TNAK++ DVW VGIR    E G+V R+EVE C
Sbjct  358   THCGFNSVLEALCLGVPVVGVPQWTDQGTNAKFVEDVWGVGIRAKVDEKGIVRRKEVEEC  417

Query  301   LVEVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             + +VM+GE+   L +N AKWK+LAKEA+DEGG+SD+NI EFV+ +
Sbjct  418   IRKVMEGEKKEELGKNVAKWKKLAKEAMDEGGNSDENIDEFVAYL  462



>gb|KEH25945.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=457

 Score =   427 bits (1097),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 218/457 (48%), Positives = 296/457 (65%), Gaps = 12/457 (3%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS--SSLI  1340
             E    + V+H L++PYP  GH+ PM+Q SKRL  +GV VT+IT  S    I+    SS I
Sbjct  2     EKERKNHVAHCLILPYPAQGHMNPMIQFSKRLIEKGVKVTLITVYSYWKTIKNKNLSSNI  61

Query  1339  RVESIPDGVKPDSG------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMP  1178
              VESI DG   D G      FD        + S  L E++ K++ S      V++D+ MP
Sbjct  62    EVESISDGYD-DGGYESAKSFDVYIQTFWRVGSQTLCELLHKLSSSKTPPNCVIFDAFMP  120

Query  1177  WVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSF  998
             W  D+    GL    F +QSC+V ++Y HT Q+ +  P   S   LP +P L   DLPSF
Sbjct  121   WALDVAKNFGLLGVPFFTQSCSVNSIYFHTHQKLIELPISQSEYLLPGLPKLAQGDLPSF  180

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
             +    SY  +   V+++  N  KADW+L NTF ELE EV++W++  +PLK   IGP +PS
Sbjct  181   LYKYGSYPIIFDVVVNQFSNIGKADWILANTFYELEPEVVDWLSKIWPLK--TIGPSVPS  238

Query  817   MYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGL  638
              +LDKR++DD  YG+S+  PN    ++WL+ +   SVVYVSFGS A L +EQ+ E+A GL
Sbjct  239   SHLDKRIKDDKEYGVSVSDPNTESSIKWLNEKPKRSVVYVSFGSNARLSEEQIEELALGL  298

Query  637   IQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNST  458
               S+  FLWVVR SEQ KLP  F  + S  G+I  WCPQL+VL+H+AV CF+THCGWNST
Sbjct  299   NDSEKYFLWVVRESEQVKLPKGF-EETSKNGLIVTWCPQLEVLTHEAVACFVTHCGWNST  357

Query  457   LEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGE  278
             LEALS+GVP++AMP WTDQ TNAK++ DVW +G+R +A E  +V  E ++ C+ E+++ E
Sbjct  358   LEALSIGVPLIAMPLWTDQATNAKFIADVWKMGVRAVADEKEIVRSETIKNCIKEIIETE  417

Query  277   RGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +G  +K+NA KWK LAK +VDEGG SDKNI+EFV+A+
Sbjct  418   KGNEIKKNALKWKNLAKSSVDEGGRSDKNIEEFVAAL  454



>ref|XP_002273866.1| PREDICTED: UDP-glycosyltransferase 74E2 [Vitis vinifera]
Length=456

 Score =   426 bits (1096),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 217/446 (49%), Positives = 285/446 (64%), Gaps = 7/446 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H +V+PYP  GHI PM+Q SKRL   G  VT+      S  +   S  I +E+I DG  
Sbjct  10    AHCIVLPYPSQGHINPMLQFSKRLVHNGAKVTLAATRFISKSLVGDSGPITIETISDGYD  69

Query  1309  PDSGFDAISDW-----LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
                   A SD       + + S  L  ++ K+  SGC +  VVYD+ +PW  D+  +LGL
Sbjct  70    EGGSAQAESDGAYLERFQVVGSETLGSLIEKLKSSGCPVDCVVYDAFLPWALDVAKKLGL  129

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLL  965
               A F +QSC V  +Y+H  Q  L  P     V +P + PL   DLPSFV    SY +  
Sbjct  130   VGAVFFTQSCTVNNIYYHVHQGMLKLPLSEPEVVVPGLFPLQACDLPSFVYLYGSYPAFF  189

Query  964   RFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDD  785
               V+++  N +K DW+  NTF +LE++V++WMA   PL+ I  GP LPS YLDKR+ DD 
Sbjct  190   DMVVNQFSNIEKVDWVFCNTFYKLEEKVVDWMAKICPLRTI--GPTLPSAYLDKRLGDDK  247

Query  784   NYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVV  605
             +YGL++ KP    CMEWLDS+  GSVVY S+GS A L+ EQM EVA GL +S   FL VV
Sbjct  248   DYGLNMLKPVTGACMEWLDSKPNGSVVYASYGSFAVLEPEQMEEVAWGLRRSNAYFLMVV  307

Query  604   RSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVV  425
             R SEQ+KLP NF  + +  G++ +WCPQL+VL+H+A+GCF+TH GWNSTLEALSLGVP+V
Sbjct  308   RESEQAKLPQNFKEETAEKGLVVSWCPQLEVLTHRAIGCFLTHGGWNSTLEALSLGVPMV  367

Query  424   AMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAK  245
               P WTDQPTNAK++ DVW +G+R  A   G+V RE +E C+ +VM  +    +K NA K
Sbjct  368   VAPLWTDQPTNAKFVEDVWGIGLRARADHKGIVRREVLEDCIGKVMGSDGLKEIKNNAMK  427

Query  244   WKQLAKEAVDEGGSSDKNIKEFVSAI  167
             WK LA+EAVDEGGSSDK I EFV+ +
Sbjct  428   WKNLAREAVDEGGSSDKCIDEFVAKL  453



>ref|XP_002532451.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29937.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=458

 Score =   426 bits (1096),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 212/453 (47%), Positives = 297/453 (66%), Gaps = 9/453 (2%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACI--QVSSSLI  1340
             E  +    SH +V+ YPI GHI PM+Q SKR+  +GV VT++T       +  +  S+ +
Sbjct  2     EQEKKGRTSHCIVLAYPIQGHINPMLQFSKRIQHKGVKVTLVTTRFIYKTLMHKPPSTSV  61

Query  1339  RVESIPDGVKPDSGFDAIS-----DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPW  1175
              +E+I DG       DA S     D  + + S  L +++ K++ SGC +  +VYD+ +PW
Sbjct  62    DLETISDGYDDGGIDDAESIKVYLDTFRKVGSQTLTDLVHKLSISGCPVDCIVYDAFLPW  121

Query  1174  VADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFV  995
               ++  + G+  A + +QSCAV  +Y+H +Q  +  P +   +S+P +PPL   DLPSF+
Sbjct  122   CLEVAKKFGIYGAVYFTQSCAVDIIYYHANQGLIELPLKEIKISVPGLPPLQPQDLPSFL  181

Query  994   RNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSM  815
                 +Y +    ++ +  N  KADW+L NTF ELE E  +W+A  +PL+   IGP +PSM
Sbjct  182   YQFGTYPAAFEMLVDQFSNIGKADWVLCNTFYELEYEAADWLAKLWPLR--TIGPTIPSM  239

Query  814   YLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             YLDK+++DD +YG ++FKPN++ CM WL  +  GSVVYVSFGSLA L  EQM E++ GL 
Sbjct  240   YLDKQLQDDRDYGFNIFKPNDDACMNWLKDKPKGSVVYVSFGSLATLGVEQMEELSWGLK  299

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTL  455
              S   FLWVVR+ E++KLP NF  + +  G++  WCPQL VL ++AVG F+THCGWNSTL
Sbjct  300   MSDSYFLWVVRAPEEAKLPKNFMSEITEKGLVVKWCPQLQVLGNEAVGSFLTHCGWNSTL  359

Query  454   EALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGER  275
             EALSLGVP+VAMPQWTDQ TNAKY+ DVW +G+RV   E G+  R+ +  C+ EVM+GER
Sbjct  360   EALSLGVPMVAMPQWTDQTTNAKYIEDVWKMGVRVPVDEKGIGRRDAIRECIREVMEGER  419

Query  274   GVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFV  176
                +  NA KW+ LA+ A  EGGSSDKNI+EFV
Sbjct  420   RTEMDVNAKKWRNLAQMAAGEGGSSDKNIREFV  452



>ref|XP_010457662.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Camelina sativa]
Length=452

 Score =   426 bits (1095),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 215/452 (48%), Positives = 302/452 (67%), Gaps = 11/452 (2%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESI  1325
             M   SHV+V+P+P  GHITPM Q  KRLAS+G+ +T V+     +   +     I V  I
Sbjct  1     MREGSHVIVLPFPGQGHITPMSQFCKRLASKGLQLTLVLVSDKPTPPYKTEDDSITVFPI  60

Query  1324  PDGVK----PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             P+G +    P    D   + ++  + N+L +++  +  SG     +VYDS MPW+ D+ H
Sbjct  61    PNGFQEGEEPLEDLDDYMERVETSIKNSLPKLIEDMKLSGNHPRALVYDSTMPWLLDVAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRN  989
               GLR A F +Q   V A+Y+H  + + + P       +  S PS P L  NDLPSF+  
Sbjct  121   SYGLRGAVFFTQPWLVTAIYYHVFKGSFSVPPTKYDHSTLASFPSFPMLSANDLPSFLCE  180

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
              SSY ++LR V+ +  N  + D LL NTFD+LE++VL+W+ S +P  V+ IGP++PSMYL
Sbjct  181   SSSYPNILRIVVDQLSNIDQVDILLCNTFDKLEEKVLKWVQSLWP--VLNIGPMVPSMYL  238

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR+ +D +YG SLF     +C+EWL+S++  SVVYVSFGSL  LK++QM E+A+GL Q+
Sbjct  239   DKRLSEDKSYGFSLFNAKVTECIEWLNSKQPNSVVYVSFGSLVILKEDQMMELAEGLKQT  298

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
                FLWVVR +E  K+P NF  +    G+I +W PQL+VL+H+++GCF+THCGWNS  E 
Sbjct  299   GRFFLWVVRETETDKIPRNFVDEIGEKGLIVSWSPQLEVLAHESIGCFLTHCGWNSMSEG  358

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LSLGVP++ MP WTDQPTNAK++ DVW VG+RV A  +G+V REE+ R + EVM+GE+G 
Sbjct  359   LSLGVPMIGMPHWTDQPTNAKFMEDVWKVGVRVKAEGDGLVRREEIVRRVGEVMEGEKGK  418

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
              +++NA KWK LA++AV EGGSSDK+I +FVS
Sbjct  419   EIRKNAEKWKVLAQDAVSEGGSSDKSIDKFVS  450



>ref|XP_010475278.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X1 [Camelina 
sativa]
Length=453

 Score =   426 bits (1095),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 216/454 (48%), Positives = 295/454 (65%), Gaps = 11/454 (2%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESI  1325
             M   SHV+V+P+P  GHITPM Q  KRLAS+G+ +T +I     S   +     I V  I
Sbjct  1     MREGSHVIVLPFPAQGHITPMSQFCKRLASKGLKITLIIVSDKPSPPYKTEHDSITVVPI  60

Query  1324  PDGV----KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
              +G     K     D I + ++  +   L +++  +  SG     +VYDS M W+ D+ H
Sbjct  61    SNGFQEGEKRSQDLDDIMERVQTSIKTRLPKLIEDMNLSGNPPRALVYDSTMSWLLDVAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRN  989
               GLR A F +Q   V  +Y+H  + + + P+      +  S PS P L +NDLPSF+  
Sbjct  121   SYGLRGAVFFTQPWLVSTIYYHVTKGSFSVPSTKYGHSALASFPSFPMLNMNDLPSFLCE  180

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
              SSY +LLR V+ +  N  + D +L NTF +LE+++L+W+ S +P  V+ IGP +PSMYL
Sbjct  181   SSSYPNLLRVVIDQLSNIDRVDIILCNTFGKLEEKLLKWVQSLWP--VLNIGPTVPSMYL  238

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR+  D NYG SLF  N  +C+EWL+S++  SVVYVS GSL  LK++QM E+A+GL QS
Sbjct  239   DKRLSSDKNYGFSLFDANVAECVEWLNSKQPSSVVYVSLGSLVVLKEDQMMELAEGLRQS  298

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
                FLWVVR +E++KLP N+  +    G+I +W PQLDVL+H++VGCF+THCGWNS LE 
Sbjct  299   GHFFLWVVRETEKNKLPRNYVEETGEKGLIVSWSPQLDVLTHESVGCFLTHCGWNSMLEG  358

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LS GVP++ MP W DQPTNAK++ DVW VG+RV A  NG V REE+ R + EVM+GE+G 
Sbjct  359   LSFGVPMIGMPHWADQPTNAKFMEDVWKVGVRVKADVNGFVRREEIVRRVGEVMEGEKGK  418

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              +++N  KWK LA+EAV EGGSSDK+I EFVS  
Sbjct  419   EIRKNGEKWKVLAREAVSEGGSSDKSINEFVSKF  452



>ref|NP_001234680.1| UDP-xylose phenolic glycosyltransferase [Solanum lycopersicum]
 emb|CAI62049.1| UDP-xylose phenolic glycosyltransferase [Solanum lycopersicum]
Length=456

 Score =   426 bits (1094),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 208/451 (46%), Positives = 303/451 (67%), Gaps = 14/451 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP+ GHI PM+Q SKRL S+ V +T+    S    ++   + + +E+I DG  
Sbjct  6     AHCLILPYPVQGHINPMLQFSKRLRSKRVKITIALTKSFLKNMKELPTSMSIEAISDGYD  65

Query  1309  PDSGFDAISDW------LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              D G D    +       K++ S+ L++++ K+  SGC +  +VYD  +PW  ++  Q G
Sbjct  66    -DGGRDQAGTFVAYITRFKEIGSDTLSQLIQKLAISGCPVNCIVYDPFLPWAVEVAKQFG  124

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMP-PLGLNDLPSFVRNKSSY  977
             L +AAF +Q+C V  +Y+H  +  +  P       + +P  P  +  +D+PSFV +  + 
Sbjct  125   LISAAFFTQNCVVDNLYYHVHKGVIKLPPTQNDEEILIPGFPNSIDASDVPSFVISPEA-  183

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
               ++  + ++  N  K D +L N+F ELEKEV++WM+  +P+K   IGP +PSMYLDKR+
Sbjct  184   ERIVEMLANQFSNLDKVDCVLINSFYELEKEVIDWMSKIYPIK--TIGPTIPSMYLDKRL  241

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              DD  YGLS+FKP  N+C+ WL+ Q   SV+YVSFGSLA L  EQM E+A GL  S   F
Sbjct  242   HDDKEYGLSMFKPMTNECLNWLNHQPISSVLYVSFGSLAKLGSEQMEELAWGLKNSNKSF  301

Query  616   LWVVRSSEQSKLPSNFWPD-KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             LWVVRS+E+ KLP+NF  +  S  G++ +WCPQL VL H+++GCF+THCGWNSTLEA+SL
Sbjct  302   LWVVRSTEEPKLPNNFIEELTSEKGLVVSWCPQLQVLEHESIGCFLTHCGWNSTLEAISL  361

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
             GVP+VAMPQW+DQPTNAK + DVW++G+R    E G+V RE +E C+  VM+ ++G +++
Sbjct  362   GVPMVAMPQWSDQPTNAKLVKDVWEIGVRAKQDEKGVVRREVIEECIKLVMEEDKGKLIR  421

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ENA KWK++A+  V+EGGSSDKNI+EFVS +
Sbjct  422   ENAKKWKEIARNVVNEGGSSDKNIEEFVSKL  452



>ref|XP_002320558.1| putative glucosyltransferase family protein [Populus trichocarpa]
 gb|EEE98873.1| putative glucosyltransferase family protein [Populus trichocarpa]
Length=459

 Score =   426 bits (1095),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 208/453 (46%), Positives = 295/453 (65%), Gaps = 9/453 (2%)
 Frame = -3

Query  1504  EMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESI  1325
             E    +H LV+ +P  GHI PM+Q SKRL  +GV VT +T    S  I   SS   +   
Sbjct  2     EKRCKAHCLVVSFPAQGHINPMLQFSKRLEHKGVKVTPVTTRFISNAIMSGSSSSSISLQ  61

Query  1324  PDGVKPDSGFDAISDWLKDLVS-------NNLAEIMSKVTGSGCLLTTVVYDSIMPWVAD  1166
                   D G    ++ +K  +          L  ++ K++GS C +  ++YD+ MPW  D
Sbjct  62    TISDGYDEGGIGHAESIKSYLDRFWKVGLQTLDNLVEKLSGSDCPVDCIIYDAFMPWGLD  121

Query  1165  LVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNK  986
             +  + GL  AAF +QSCAV ++Y+H  +  +  P   + + +P +PPL   DLPSF+ + 
Sbjct  122   VAKKFGLVGAAFFTQSCAVDSIYYHVYRGLIKLPVTETQILVPGLPPLEPQDLPSFIYHL  181

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
              +Y      +L +  N  +ADW+  N+F  LE+EV +W A  +P +  +IGP +PSMYLD
Sbjct  182   GTYPDFFDMLLDQFSNIDRADWVFCNSFYMLEREVADWFAKLWPFR--SIGPTIPSMYLD  239

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             K++ +D +YG S F  NN+ CM WL+ +  GSVV+VSFGSL +LK EQM E+A GL +S 
Sbjct  240   KQLENDRDYGFSFFMQNNDVCMNWLNDRAKGSVVHVSFGSLVDLKAEQMEELAWGLKRSD  299

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
             C FLWVVR+SE+SK+  +F  + S  G++  WC QL+VL+H+AVGCF+THCGWNS+LEAL
Sbjct  300   CYFLWVVRASEESKMSKDFAEESSAKGLVVRWCSQLEVLAHEAVGCFVTHCGWNSSLEAL  359

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVM  266
             SLGVP+VAMPQ TDQ TNAKY+ DVW++G++    E  +  RE +E C+ E+++GE+G  
Sbjct  360   SLGVPMVAMPQRTDQSTNAKYITDVWNMGVKAAVDEKEIARRETIESCIKEILEGEKGKE  419

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +K NA+KWK+LAKEAV+EGGSSDKNI EFV+ +
Sbjct  420   IKRNASKWKELAKEAVEEGGSSDKNIDEFVANL  452



>ref|XP_010242509.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Nelumbo nucifera]
Length=462

 Score =   426 bits (1095),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 220/449 (49%), Positives = 298/449 (66%), Gaps = 14/449 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKP  1307
             HVLV   P  GH+ P++  +KRL  +G+  T+      S  +Q     I +E+I DG   
Sbjct  13    HVLVFVGPGQGHMNPLLHFAKRLIFKGIKSTLAVTVFISKSMQSDVGSIPIETISDGFD-  71

Query  1306  DSGFD------AISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
             + GFD      A ++  KD+ S  LAE++ K  GS    T +VYDS  PWV D+  + GL
Sbjct  72    EGGFDSAGGAEAYNERFKDVGSRTLAEVIQKYEGSEYPFTCLVYDSFFPWVLDVAKRFGL  131

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPT-EGSTVSLPSMPPLGLNDLPSFVRNKSSYSS-  971
               A+F +QSCAVFA+Y+H  QE +T P+ E  TV LP +PPLG+ + PSF+ +K S +S 
Sbjct  132   EGASFVTQSCAVFAIYYHVRQECVTIPSAEQDTVVLPGLPPLGVTEFPSFIVDKESNNSY  191

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
                 +L +  N  K DW+  NTF +LE EVL  +   + +K   IGP +PS+YL+K V  
Sbjct  192   FFSMLLGQFSNLDKVDWVFINTFHDLESEVLSTLVGLWRVK--TIGPSVPSVYLNKSVDG  249

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D +  LSL K N +  + WLD++E GSVV++SFGSLA L +EQM EVA+GL +SK  FLW
Sbjct  250   DTD--LSLRKANTDAYLGWLDTKEAGSVVFISFGSLAKLGEEQMEEVAKGLRESKRNFLW  307

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             VVR  E+SKLP+ F  D S  G++  WC QL+VL+H+AVGCF+THCGWNSTLEALSLGV 
Sbjct  308   VVREKEKSKLPTKFEEDTSEYGLVVPWCSQLEVLNHRAVGCFVTHCGWNSTLEALSLGVS  367

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAG-ENGMVTREEVERCLVEVMKGERGVMLKEN  254
             +V +PQW+DQPTNAK +  VW+VG+R     E G+V  EE+ERCL EVM+G RG  +++N
Sbjct  368   MVGIPQWSDQPTNAKCVESVWEVGVRAKVDIEKGIVRGEEIERCLKEVMEGVRGETIRKN  427

Query  253   AAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +WK+LAK+A+D GGSSDKNI+EF+  +
Sbjct  428   TTRWKELAKKALDAGGSSDKNIEEFLDHL  456



>ref|XP_009119126.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Brassica rapa]
Length=453

 Score =   425 bits (1093),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 212/448 (47%), Positives = 297/448 (66%), Gaps = 11/448 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESIPDGV  1313
             SHV+V+P+P+ GH+TPM Q  KRLAS+G+  T V+     S   +  ++ I V  IP G 
Sbjct  5     SHVIVLPFPVQGHLTPMFQFCKRLASKGLTSTLVLVSDKPSPPYKTENNAITVFPIPSGS  64

Query  1312  K----PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
             +    P    D   D +   +  +L E++  +         +VYDS +PW+ D+ H  GL
Sbjct  65    QEGKDPLQDLDDYIDRVYTSIKKHLPELIQDMKLLENPPRALVYDSTLPWLLDVAHDHGL  124

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPTE----GSTVSLPSMPPLGLNDLPSFVRNKSSY  977
             + A+F +Q   V  +Y+H  + + + P+      +  S P+ P L  NDLPS+V   SSY
Sbjct  125   KGASFYTQPWLVSVIYYHVHKGSFSVPSTKHGPSTLASFPAFPMLSANDLPSYVCESSSY  184

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
               +LR V+ +  N  + D LL NTFD LE+++L+W+ S +P  V+ IGP +PSMYLDKR+
Sbjct  185   PKILRIVVEQLSNIDRVDILLCNTFDNLEEKLLKWVKSLWP--VLNIGPTVPSMYLDKRL  242

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              +D +YG SLF   + +CMEWL+ ++  SVVYVSFGSL  LK++QM E+A+GL QS C F
Sbjct  243   SEDKSYGFSLFTAKSTECMEWLNLKKPHSVVYVSFGSLVILKEDQMMELAEGLKQSGCFF  302

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR +E +K+P ++  +    G+  +W PQL+VL+H++VGCF+THCGWNSTLE LSLG
Sbjct  303   LWVVRETEMNKIPKSYVEEIGEKGLFVSWSPQLEVLAHESVGCFLTHCGWNSTLEGLSLG  362

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP++ MP WTDQPTNAK++ DVW VG+RV A  +G V R+E+ RC+ EVM+GE+G  ++ 
Sbjct  363   VPMIGMPHWTDQPTNAKFMEDVWKVGVRVKAEADGFVRRDEIVRCVGEVMEGEKGKEMRR  422

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
             NA KWK LA EAV EGGSSDK+I EFVS
Sbjct  423   NAEKWKVLALEAVSEGGSSDKSIDEFVS  450



>ref|XP_008236257.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=459

 Score =   425 bits (1093),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 221/458 (48%), Positives = 310/458 (68%), Gaps = 11/458 (2%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS---L  1343
             E  + +   H LV+PYP  GHI PM+Q +K L+ +GV VT++T       +  S+S    
Sbjct  2     ERGQRAYKGHCLVLPYPSQGHINPMLQFAKLLSHKGVKVTLVTTRYIHKTMYGSASSCIA  61

Query  1342  IRVESIPDGV----KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPW  1175
             + +E+I DG     + ++  DA  +      S  LAE++ K++ SG  +  VVYD+ MPW
Sbjct  62    LDLETISDGYDEAGRGEASIDAYLESFWKEGSKTLAELLEKLSSSGPPVDCVVYDAFMPW  121

Query  1174  VADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMPPLGLNDLPS  1001
               D+  + G+  A F +QSCAV  +Y+H  +  L  P   + S +SLP +PPL   DLPS
Sbjct  122   PLDVARKFGIAGATFFTQSCAVSNIYYHVHKGLLKVPLADDQSLISLPGLPPLDPLDLPS  181

Query  1000  FVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLP  821
             FV +     +  R V+ +  N  KADW+L NTF ELE++V++W+A  +PL+ +  GP +P
Sbjct  182   FVYDLEYCPAFYRVVVGQFSNVDKADWVLCNTFYELEEQVVDWLAKFWPLRTV--GPTIP  239

Query  820   SMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQG  641
             S YLD+R+ DD  YG++LFK +N+ C++WL+ +  GSV YVSFGS A L DEQM E+A+G
Sbjct  240   SKYLDERLEDDKEYGVNLFKSDNDACIKWLNERPKGSVAYVSFGSAAKLDDEQMEELARG  299

Query  640   LIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNS  461
             L +SK  FLWVVR+SE +K+P  F  + S  G++ +WC Q++VL H+AVGCF+THCGWNS
Sbjct  300   LRRSKSNFLWVVRASEAAKVPKGFIEETSEKGLVVSWCSQMEVLVHEAVGCFVTHCGWNS  359

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             TLEALSLGVP++AMPQWTDQ TNAK+++DVW +GI   + E G V +E VE C+ E+M+G
Sbjct  360   TLEALSLGVPMLAMPQWTDQRTNAKFIMDVWKIGITAPSDEKGKVRQEVVEHCISEIMEG  419

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ERG  +K NA KWK+LA++AVDEGGSSDKNI EF+S +
Sbjct  420   ERGKEMKINALKWKKLARKAVDEGGSSDKNIDEFISKL  457



>ref|XP_004287162.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Fragaria vesca 
subsp. vesca]
Length=483

 Score =   426 bits (1094),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 219/462 (47%), Positives = 305/462 (66%), Gaps = 15/462 (3%)
 Frame = -3

Query  1507  AEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVES  1328
             + +S  + +LV P P  GH++PM+Q SKRLAS+GV VT++  T++S  IQ  ++  +VE 
Sbjct  20    SAVSDQTQILVFPSPGQGHMSPMIQFSKRLASKGVRVTLVITTTSSNSIQTHANSFKVEV  79

Query  1327  IPDGVKP-DSGFDAISDWL---KDLVSNNLAE-IMSKVTGSGCL-------LTTVVYDSI  1184
             I DG +  +   + I ++L   + + ++ LA  I++K+  S C            VYDS 
Sbjct  80    ISDGSEQGNKKSETIEEYLERFRRVTTHTLANLIITKIKTSTCTPGASESEFKLFVYDSS  139

Query  1183  MPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQEN-LTAPTEGSTVSLPSMPPLGLNDL  1007
             MPW++D+  Q G+  A F +QSCAV A+YH   Q   +T P+  +T+ LP +PPLG+ D+
Sbjct  140   MPWLSDVAQQHGIAFAPFFTQSCAVTAIYHQFHQGAFMTEPSATATMLLPCLPPLGIKDV  199

Query  1006  PSFVRNKS-SYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGP  830
             PSF+ + + SY SL      +  N  +A  LL+NTFD LE EVLEWM S     ++ IGP
Sbjct  200   PSFLYDHAKSYPSLFNSSRDQFSNLSEAKCLLWNTFDLLEDEVLEWMTSTLSRSIMTIGP  259

Query  829   LLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEV  650
              +PSM+LDKR  DD +Y  +L+ PN + CM+WLD QE GSVVYVSFGS A+   +QM E+
Sbjct  260   TIPSMFLDKRFEDDLDYSFNLYSPNVDACMKWLDCQENGSVVYVSFGSYASPSKDQMEEI  319

Query  649   AQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCG  470
             A GL  S    LWVV+ SE+ KLP NF    S  G++ +WC QL VL+H+AVGCF+THCG
Sbjct  320   AWGLKNSNYNILWVVKQSEKEKLPINFVEGISEKGLVVSWCSQLQVLAHKAVGCFVTHCG  379

Query  469   WNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGEN-GMVTREEVERCLVE  293
             WNS LEALSLGVP+VAMPQW+DQ TNAK++ DVW  G+RV   E  G+ TR+E+  C+  
Sbjct  380   WNSILEALSLGVPMVAMPQWSDQTTNAKFIEDVWKTGVRVKVNEKLGVATRDEIAWCITT  439

Query  292   VMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             V++   G+ +++ + KWK+LAKEAVD GGSSDKN+ E V+ +
Sbjct  440   VLEEGSGMEMRKASLKWKRLAKEAVDVGGSSDKNMDELVAKL  481



>ref|XP_010069225.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=467

 Score =   425 bits (1092),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 227/465 (49%), Positives = 302/465 (65%), Gaps = 35/465 (8%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ-VSSSLIRVESIPDGVK  1310
             HVLV+ +P+ GHI PM+Q SKRLAS+G+ VT + P ST   +  V++S I+VE I DG  
Sbjct  8     HVLVLAHPVQGHINPMLQFSKRLASKGLKVTFLIPISTKKSLNLVNASSIQVEYISDG--  65

Query  1309  PDSGFDAI-------SDWLKDL---VSNNLAEIMSKVTGSGCL---LTTVVYDSIMPWVA  1169
                 FD +        ++L+     VS +L++ + K     C       ++YDS   W  
Sbjct  66    ----FDTVEADKLSTKEYLEHFRLSVSQSLSDFIQK--HQSCQENPAKVLIYDSFDSWAL  119

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP---TEGSTVSL---PSMPPLGLNDL  1007
             D+  + G+  A+F +QSC V  +Y+   Q  +  P    +G    L   P M  LGLND 
Sbjct  120   DVAIKHGMHGASFFTQSCVVSCIYYLVHQGTVKLPLDAVDGQGRVLCDPPVMSVLGLNDF  179

Query  1006  PSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPL  827
             PSFV +   Y  +L  VL +  N +KA WLLFNTF ELE+E++ WM +Q+ +  + +GP 
Sbjct  180   PSFVADVHKYPGVLDIVLGQFSNFRKAKWLLFNTFTELEEELVNWMGNQWSM--MTVGPT  237

Query  826   LPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVA  647
             +PS+Y+DKR+ DD  YGLSLFKP    C+ WLDS+   S VYVSFGSLA+L ++QM E+A
Sbjct  238   IPSVYMDKRLEDDTGYGLSLFKPEAEACLRWLDSKPPCSTVYVSFGSLASLGEDQMEELA  297

Query  646   QGLIQSKCKFLWVVRSSEQSKLPSNFWP----DKSGAGIITNWCPQLDVLSHQAVGCFIT  479
              GL   K  FLWVVR SE+ KLP NF      D    G++  W  QL VLSH +VGCF+T
Sbjct  298   SGLRSMKSHFLWVVRESEEKKLPRNFLQELGLDDDKKGLVVRWSNQLQVLSHVSVGCFMT  357

Query  478   HCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCL  299
             HCGWNSTLEALSLGVP+V MPQWTDQPTNA ++V+VW VG+RV A E G+VT EE+E C+
Sbjct  358   HCGWNSTLEALSLGVPMVVMPQWTDQPTNATFIVEVWKVGLRVRANERGVVTGEEIESCV  417

Query  298   VEVMK-GERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              E+M+ GERG  ++EN+  WK+LAK A+DEGGSS+KNI+EFVS +
Sbjct  418   NEIMEGGERGKEIRENSLGWKELAKRAIDEGGSSEKNIQEFVSNV  462



>ref|XP_010037078.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW48702.1| hypothetical protein EUGRSUZ_K02353 [Eucalyptus grandis]
Length=458

 Score =   424 bits (1090),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 211/456 (46%), Positives = 301/456 (66%), Gaps = 10/456 (2%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS--LI  1340
             E +  S   H LV+ +P  GHI PM+Q SKRL  +G GVT +T    S  +   SS   I
Sbjct  2     EDSRKSHKPHCLVLSFPAQGHINPMLQFSKRLIHKGAGVTFVTTRFMSKTLHGLSSNPSI  61

Query  1339  RVESIPDG-----VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPW  1175
              +ESI DG     +K  S  +A  +    +    L+E++ ++  SG   + +VY+S +PW
Sbjct  62    SLESISDGFDDGGMKAASSREAYLERFWKIGPETLSELVERLISSGRPPSCIVYNSFLPW  121

Query  1174  VADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFV  995
               D+  + GL  A F + SCAV +V++H  +  L  P     V LP MPPL   D+PS+V
Sbjct  122   ALDVAQKYGLVGAVFFTMSCAVSSVFYHCQKGLLEVPVR-KQVLLPGMPPLEPQDMPSYV  180

Query  994   RNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSM  815
              +  SY + L  ++ +  N  K DW+L NT  ELE+E+++W     P +   IGP +PS 
Sbjct  181   SDPESYPANLGVLVGQFSNLDKVDWVLCNTVYELEQELVDWFMKVMPFR--TIGPTVPSS  238

Query  814   YLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             YLD R+  D  YGLS+F+P ++  M+WL ++  GSVVYVSFGS+A LK +QM E+A GL 
Sbjct  239   YLDNRLEQDTEYGLSIFQPEHDTTMKWLSTKPKGSVVYVSFGSVAELKIDQMQEIAMGLK  298

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTL  455
             +S   FLWVVRSSE+ KLP ++  + +  G+I  WCPQL+VL+H+A+G F+THCGWNSTL
Sbjct  299   RSNRYFLWVVRSSEEDKLPQDYAKETAQKGLIVTWCPQLEVLAHEALGLFLTHCGWNSTL  358

Query  454   EALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGER  275
             EAL+LGVP++A+PQWTDQPTNAK+++DVW +G+R    E G+V  E++E C+ E+M+GER
Sbjct  359   EALTLGVPMMAIPQWTDQPTNAKHIMDVWKMGLRPPVDERGVVRSEDIENCIREIMEGER  418

Query  274   GVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             G  ++ENA KW+++ KEAV EGGSSD+NI+EFV+++
Sbjct  419   GKEMRENAGKWRKIIKEAVSEGGSSDRNIEEFVASL  454



>emb|CDP06918.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   424 bits (1090),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 211/451 (47%), Positives = 297/451 (66%), Gaps = 10/451 (2%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS-SSLIRVESIP  1322
             ST  HVLV+PYP  GHI P++Q  KRL ++GV  T +     S  I     S I  E+I 
Sbjct  4     STKVHVLVLPYPAQGHINPLLQFCKRLVAKGVKTTFVNSVFVSNSIPADPKSAINFEAIS  63

Query  1321  DGVKPDSGFDAISD---WLKDLV---SNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLV  1160
             DG   + G+ A      +L+ L    S  LA+++ K+   G  +  V+YDS++ W  D+ 
Sbjct  64    DG-HDEGGYAAAESTGAYLEKLATFGSKKLADLIRKLEDKGEPVQAVIYDSLLTWALDVA  122

Query  1159  HQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSS  980
              Q GL  A+F +Q+CAV ++Y++     L  P   S +SLP +P L   + PSFV    S
Sbjct  123   KQFGLVTASFFTQTCAVNSIYYNVYHGLLPVPLSDSPISLPGLPLLQPKETPSFVYLPDS  182

Query  979   YSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKR  800
               + L  ++++  N  +ADW++ N F +LE++ L WMA  +  +VI +GP +PS+YLDKR
Sbjct  183   SPAFLHLLVNQFSNIDQADWVILNNFHKLEEDALNWMAKLW--RVITVGPTVPSIYLDKR  240

Query  799   VRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCK  620
             + DD  YG++LFKP ++ C+ WL+SQ   SVVYV+FGS   +  EQM E+A  L ++  K
Sbjct  241   LEDDIGYGINLFKPESSLCINWLNSQPKDSVVYVAFGSWTEIDVEQMEEIASALKETGFK  300

Query  619   FLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             FLWVVR+ E+ KLPS F  + S  G++  W PQL+VL+H++V CF+THCG+NS LEALSL
Sbjct  301   FLWVVRAFEKEKLPSKFAEETSEKGLVVTWSPQLEVLAHESVACFVTHCGFNSVLEALSL  360

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
             GVPVVA PQWTDQPTNAK+LVD+W VG++  A + G+V RE +  C+ E+M+GE+G  +K
Sbjct  361   GVPVVAAPQWTDQPTNAKFLVDIWGVGVKADADDRGIVRRETLVSCISEIMEGEKGKQIK  420

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ENA +WK LAKEA+D+GGSSDKNI EFV+ +
Sbjct  421   ENAIEWKALAKEAIDDGGSSDKNIDEFVAGL  451



>ref|XP_010037076.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
 gb|KCW48701.1| hypothetical protein EUGRSUZ_K02352 [Eucalyptus grandis]
Length=458

 Score =   424 bits (1090),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 211/457 (46%), Positives = 298/457 (65%), Gaps = 12/457 (3%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS--LI  1340
             E +  S   H LV+ +P  GHI PM+Q SKRL  +G GVT +T    S  +   SS   I
Sbjct  2     EASRKSHKPHCLVLSFPAQGHINPMLQFSKRLIHKGAGVTFVTTRFMSKTLHGLSSNPSI  61

Query  1339  RVESIPDGVKPDSGFDAIS------DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMP  1178
              +ESI DG   D G  A S      +    +    L+E++ ++  SG   + +VY+S +P
Sbjct  62    SLESISDGFD-DGGMKAASSPEAYLERFWKIGPETLSELVERLISSGRPPSCIVYNSFLP  120

Query  1177  WVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSF  998
             WV D+  + GL  A F + SCAV +V++H  +  L  P     V LP MPPL   D+PS+
Sbjct  121   WVLDVAQKYGLVGAVFFTMSCAVSSVFYHCQKGLLEVPVR-KQVLLPGMPPLEPQDMPSY  179

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
             V +  SY + L  ++ +  N  K DW+L NT  ELE+E+++W     P +   IGP +PS
Sbjct  180   VSDPESYPAYLGMLVGQFSNLDKVDWVLCNTVYELEQELVDWFMKVMPFR--TIGPTVPS  237

Query  817   MYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGL  638
              YLD R+  D  YGLS+F+P ++  M+WL ++  GSVVYVSFGS+A LK +QM E+A GL
Sbjct  238   FYLDNRLEQDREYGLSIFQPEHDTTMKWLSTKPKGSVVYVSFGSVAELKIDQMQELAMGL  297

Query  637   IQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNST  458
              +S   FLWVVRS E+ KLP ++  + +  G+I  WCPQL+VL+H+A+G F+THCGWNST
Sbjct  298   KRSNRYFLWVVRSFEEDKLPQDYAKETAQKGLIVTWCPQLEVLAHEALGIFLTHCGWNST  357

Query  457   LEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGE  278
             LEAL+LGVP++A+PQWTDQP NAK+++DVW +G+R    E G+V  E++E C+ E+M+GE
Sbjct  358   LEALTLGVPMMAIPQWTDQPMNAKHIMDVWKMGLRPPVDERGVVRHEDIENCIREIMEGE  417

Query  277   RGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             RG  ++ENA KW+++ KEAV EGGSSD+NI+EFV+ +
Sbjct  418   RGKEMRENAGKWRKITKEAVSEGGSSDRNIEEFVAKL  454



>gb|EYU20869.1| hypothetical protein MIMGU_mgv1a005301mg [Erythranthe guttata]
Length=490

 Score =   425 bits (1093),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 222/455 (49%), Positives = 289/455 (64%), Gaps = 26/455 (6%)
 Frame = -3

Query  1507  AEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ-VSSSLIRVE  1331
             AE    +H L++P+P  GHI P++Q +KRL  + + +T+     T       S   I   
Sbjct  47    AEKENGAHCLILPHPTQGHINPILQFAKRLTHKRIKITLALTKFTLKTTTGFSGGSISTR  106

Query  1330  SIPDGVKPDSGFDAISD-------WLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWV  1172
             SI DG   D G  A ++         + +    LAE++  + GSG  +  VVYD  +PWV
Sbjct  107   SISDGF--DEGGRAHANSSEEYQARFQQVGRETLAELLQDLAGSGRPVDCVVYDPFIPWV  164

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR  992
              D+    GL AAAF +QSCA            L  P  G  V +P +PP+   ++PSF+ 
Sbjct  165   LDVAKGFGLLAAAFFTQSCA------------LKLPLSGGEVVVPGLPPMKPEEMPSFIH  212

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
             +  SY    + +L++  N  KADW+L NTFD+LE+EVLEWM S+F  +V AIGP +PSMY
Sbjct  213   DHGSYPGTFQMLLNQFRNVDKADWILINTFDKLEQEVLEWM-SRF-WRVKAIGPTIPSMY  270

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LDKR++DD  YGL++F P  N CM WLD+QE  SV+Y SFGSLA L   Q  E+A  L  
Sbjct  271   LDKRLQDDKEYGLNMFNPMTNTCMNWLDNQEPKSVIYASFGSLAQLTARQTKELAYALTT  330

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             S   FLWVVRS+E+SKLP +F   KS  G++  W PQL+VLSH AVGCF+THCGWNSTLE
Sbjct  331   SNKPFLWVVRSTEESKLPEDF--SKSRKGLVVTWAPQLEVLSHMAVGCFVTHCGWNSTLE  388

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
              LSLGVP+VAMPQWTDQ TNAK + DVW VG+R  A  NG+V+REE+  C+  VM+ E G
Sbjct  389   GLSLGVPLVAMPQWTDQSTNAKLVTDVWGVGVRARADCNGIVSREEIVSCVKSVMESEDG  448

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +  NA KWK +A+EA+D GGSSDKNI+EFV+ I
Sbjct  449   KRIGSNAVKWKGIAREALDLGGSSDKNIEEFVTEI  483



>ref|XP_006307470.1| hypothetical protein CARUB_v10009096mg [Capsella rubella]
 gb|EOA40368.1| hypothetical protein CARUB_v10009096mg [Capsella rubella]
Length=454

 Score =   424 bits (1090),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 211/448 (47%), Positives = 300/448 (67%), Gaps = 11/448 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTV-ITPTSTSACIQVSSSLIRVESIPDGV  1313
             SHV+V+P+P  GHITPM Q  KRLAS+G+  T+ +     +   +     + V  IP+G 
Sbjct  6     SHVIVLPFPGQGHITPMSQFCKRLASKGLKPTLFLVSDKPTPPYKTEHDSVTVFPIPNGF  65

Query  1312  K----PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
             +    P    D   + ++  + N+L +++  +  SG     +VYDS MPW+ D+ H  GL
Sbjct  66    QEGEEPLQDLDDYMERVETSIKNSLPKLIEDMKLSGNRPKALVYDSTMPWLLDVAHSYGL  125

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRNKSSY  977
             R A F +Q   V A+Y+H  + + + P       +  S PS P L  NDLPSF+   SSY
Sbjct  126   RGAVFFTQPWLVTAIYYHVFKGSYSVPPTKYGHSTLASFPSFPMLNSNDLPSFLCESSSY  185

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
              ++LR V+ +  N  + D +L NTFD+LE++VL+W+ S +P  V+ IGP++PSM+LDKR+
Sbjct  186   PNILRIVVDQLSNIDRVDIVLCNTFDKLEEKVLKWVQSLWP--VLNIGPMVPSMFLDKRL  243

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              +D NYG SLF     +C+EWL+S++  SVVYVSFGSL  LK++QM E+A GL Q++  F
Sbjct  244   SEDKNYGFSLFNAKFTECIEWLNSKQPNSVVYVSFGSLVVLKEDQMMELAAGLKQTERFF  303

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR +E  K+P NF  +    G+I +W PQL+VL+H+++GCF+THCGWNS  E LSLG
Sbjct  304   LWVVRETETDKIPRNFVEEIGEKGLIVSWSPQLEVLAHKSIGCFLTHCGWNSMSEGLSLG  363

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP++ MP WTDQPTN K++ DVW VG+RV A ++G+V REE+ + + EVM+GE+G  +++
Sbjct  364   VPMIGMPHWTDQPTNTKFMEDVWKVGVRVKAEDDGLVRREEIVKRVGEVMEGEKGKEMRK  423

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
             NA KWK LA+EAV EGGSSDK+I EFVS
Sbjct  424   NAEKWKVLAREAVSEGGSSDKSINEFVS  451



>ref|XP_010485192.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Camelina sativa]
Length=452

 Score =   424 bits (1089),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 215/452 (48%), Positives = 300/452 (66%), Gaps = 11/452 (2%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESI  1325
             M   SHV+V+P+P  GHITPM Q  KRLAS+G+ +T V+     +   +     I V  I
Sbjct  1     MREGSHVIVLPFPGQGHITPMSQFCKRLASKGLQLTLVLVSDKPTPPYKTEHDSITVFPI  60

Query  1324  PDGVK----PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             P+G +    P    D   + ++  + N+L +++  +  S      +VYDS MPW+ D+ H
Sbjct  61    PNGFQEGEEPLEDLDDYMERVETSIKNSLPKLIEDMKLSRNHPRALVYDSTMPWLLDVAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRN  989
               GLR A F +Q   V A+Y+H    + + P       +  S PS P L  NDLPSF+  
Sbjct  121   NHGLRGAVFFTQPWLVTAIYYHVFNGSFSVPPTKYGHSTLASFPSFPMLSANDLPSFLCE  180

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
              SSY ++LR V+ +  N  + D LL NTFD+LE++VL+W+ S +P  V+ IGP++PSM+L
Sbjct  181   SSSYPNILRIVVDQLSNIDRVDILLCNTFDKLEEKVLKWVQSLWP--VLNIGPMVPSMFL  238

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR+ +D +YG SLF     +C++WL+S++  SVVYVSFGSL  LK++QM E+A GL Q+
Sbjct  239   DKRLSEDKSYGFSLFNAKVTECIDWLNSKQPNSVVYVSFGSLVILKEDQMMELAAGLKQT  298

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
                FLWVVR +E  K+PSNF  +    G+I +W PQL+VL+H+++GCF+THCGWNS  E 
Sbjct  299   GRFFLWVVRETETDKIPSNFEEETGEKGLIVSWSPQLEVLAHKSIGCFLTHCGWNSMSEG  358

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LSLGVP++ MP WTDQPTNAK++ DVW VG+RV A  +G+V REE+ R + EVM+GE+G 
Sbjct  359   LSLGVPMIGMPHWTDQPTNAKFMEDVWKVGVRVKAEGDGLVRREEIVRRVGEVMEGEKGK  418

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
              +++NA KWK LA+EAV EGGSSDK+I EFVS
Sbjct  419   EIRKNAEKWKVLAQEAVSEGGSSDKSIDEFVS  450



>gb|AEM42999.1| UDP-glucosyltransferase [Siraitia grosvenorii]
Length=454

 Score =   423 bits (1088),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 209/447 (47%), Positives = 298/447 (67%), Gaps = 7/447 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS---SSLIRVESIPD  1319
             +H+LV P+P  GHI P++QLSKRL ++G+ V+++T    S  +Q+    S+ +++E I D
Sbjct  6     THILVFPFPSQGHINPLLQLSKRLIAKGIKVSLVTTLHVSNHLQLQGAYSNSVKIEVISD  65

Query  1318  GVKPDSGFDAIS---DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
             G +     D +    D  +  ++ NL + + K   S      ++YDS MPWV ++  + G
Sbjct  66    GSEDRLETDTMRQTLDRFRQKMTKNLEDFLQKAMVSSNPPKFILYDSTMPWVLEVAKEFG  125

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             L  A F +QSCA+ ++ +H     L  P E  T+SLPSMP L  +DLP++  + +S  ++
Sbjct  126   LDRAPFYTQSCALNSINYHVLHGQLKLPPETPTISLPSMPLLRPSDLPAYDFDPASTDTI  185

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
             +  + S+  N Q A+ L  NTFD+LE E+++WM +     V  +GP +PS YLDKRV +D
Sbjct  186   IDLLTSQYSNIQDANLLFCNTFDKLEGEIIQWMET-LGRPVKTVGPTVPSAYLDKRVEND  244

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
              +YGLSLFKPN + C++WLDS+ +GSV+YVS+GSL  + +EQ+ E+A G+ ++   FLWV
Sbjct  245   KHYGLSLFKPNEDVCLKWLDSKPSGSVLYVSYGSLVEMGEEQLKELALGIKETGKFFLWV  304

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             VR +E  KLP NF    +  G++ +WC QL+VL+H +VGCF THCGWNSTLEAL LGVPV
Sbjct  305   VRDTEAEKLPPNFVESVAEKGLVVSWCSQLEVLAHPSVGCFFTHCGWNSTLEALCLGVPV  364

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             VA PQW DQ TNAK+L DVW VG RV   E  + ++EEV  C+ EVM+GER    K N+ 
Sbjct  365   VAFPQWADQVTNAKFLEDVWKVGKRVKRNEQRLASKEEVRSCIWEVMEGERASEFKSNSM  424

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +WK+ AKEAVDEGGSSDKNI+EFV+ +
Sbjct  425   EWKKWAKEAVDEGGSSDKNIEEFVAML  451



>ref|XP_007201011.1| hypothetical protein PRUPE_ppa005386mg [Prunus persica]
 gb|EMJ02210.1| hypothetical protein PRUPE_ppa005386mg [Prunus persica]
Length=463

 Score =   424 bits (1089),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 216/456 (47%), Positives = 296/456 (65%), Gaps = 17/456 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL---------IR  1337
             +H LV+ YP  GHI P++Q SKRL  +G+ VT IT  S    +               I 
Sbjct  7     AHCLVLFYPSQGHINPLLQFSKRLEHKGLKVTFITTRSVLKAMHGGGGGGQSPSSFSSIA  66

Query  1336  VESIPDGVKPDSG-----FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWV  1172
             +E+I DG            +A  D  +++ S  LAE++ +++GSG     +VYDS M W 
Sbjct  67    LETISDGYDEGGASQAESIEAYLDRFREIGSQTLAELIEEISGSGHPADCLVYDSCMSWA  126

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP-TEGSTVSLPSMPPLGLNDLPSFV  995
              D+  ++G+  AAF + SCAV  +Y       L  P   GS + LP +PPL  +D PSFV
Sbjct  127   LDVAKRVGIAGAAFFTFSCAVTNIYSLVQNGLLKVPLNPGSEILLPGLPPLQPSDTPSFV  186

Query  994   RNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSM  815
                 SY +  + +L +  N  KADW+L NTF ELE+E ++WMA  +PL+ I  GP +PSM
Sbjct  187   YVSGSYPAFFKLILDQFSNLDKADWVLCNTFHELEQEAVDWMAKFWPLRTI--GPTIPSM  244

Query  814   YLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             Y+DKR  D+  YGLSL KPN++ CM+WL+ +  GSV YVSFGS+A + +EQM E+  GL 
Sbjct  245   YMDKRHEDNWEYGLSLLKPNSDACMKWLNVKPKGSVAYVSFGSVAEIGEEQMEELGLGLR  304

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTL  455
             +SK  FLWVVR  E +KLP  F  + S  G++ +WCPQL+VL+H+AVGCF+THCGWNSTL
Sbjct  305   RSKSYFLWVVREKEAAKLPKGFVEETSEKGLVVSWCPQLEVLAHKAVGCFVTHCGWNSTL  364

Query  454   EALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGER  275
             E LSLGVP+VA+PQWTDQ TNA++++DVW  G++  A + G+V  EE+  CL E++ GER
Sbjct  365   EGLSLGVPMVAVPQWTDQSTNARFIMDVWKTGLKAQADKKGIVRGEEITHCLREILDGER  424

Query  274   GVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             G  +++N +KWK LAK AVDEGGSSDKNI EF++ +
Sbjct  425   GKEIRKNTSKWKALAKNAVDEGGSSDKNIDEFIAKL  460



>ref|XP_010069224.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Eucalyptus grandis]
Length=467

 Score =   424 bits (1089),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 226/465 (49%), Positives = 302/465 (65%), Gaps = 35/465 (8%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ-VSSSLIRVESIPDGVK  1310
             HVLV+ +P+ GHI PM+Q SKRLAS+G+ VT + P ST   +  V++S I+VE I DG  
Sbjct  8     HVLVLAHPVQGHINPMLQFSKRLASKGLKVTFLIPISTKKSLNLVNASSIQVEYISDG--  65

Query  1309  PDSGFDAI-------SDWLKDL---VSNNLAEIMSKVTGSGCL---LTTVVYDSIMPWVA  1169
                 FD +        ++L+     VS +L++ + K     C       ++YDS   W  
Sbjct  66    ----FDTVEADKLSTKEYLEHFRLSVSQSLSDFIQK--HQSCQENPAKVLIYDSFDSWAL  119

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP---TEGSTVSL---PSMPPLGLNDL  1007
             D+  + G+  A+F +QSC V  +Y+   Q  +  P    +G    L   P M  LG+ND 
Sbjct  120   DVAIEHGMHGASFFTQSCVVSCIYYLVHQGTVKLPLDAVDGQGRVLCDPPVMSVLGMNDF  179

Query  1006  PSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPL  827
             PSFV +   Y  +L  VL +  N +KA WLLFNTF ELE+E++ WM +Q+ +  + +GP 
Sbjct  180   PSFVADVHKYPGVLDIVLGQFSNFRKAKWLLFNTFTELEEELVNWMGNQWSM--MTVGPT  237

Query  826   LPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVA  647
             +PS+Y+DKR+ DD  YGLSLFKP    C+ WLDS+   S VYVSFGSLA+L ++QM E+A
Sbjct  238   IPSVYMDKRLEDDTGYGLSLFKPEAEACLRWLDSKPPCSTVYVSFGSLASLGEDQMEELA  297

Query  646   QGLIQSKCKFLWVVRSSEQSKLPSNFWP----DKSGAGIITNWCPQLDVLSHQAVGCFIT  479
              GL   K  FLWVVR SE+ KLP NF      D    G++  W  QL VLSH +VGCF+T
Sbjct  298   SGLRSMKSHFLWVVRESEEKKLPRNFLQELGLDDDKKGLVVRWSNQLQVLSHVSVGCFMT  357

Query  478   HCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCL  299
             HCGWNSTLEALSLGVP+V MPQWTDQPTNA ++V+VW VG+RV A E G+VT EE+E C+
Sbjct  358   HCGWNSTLEALSLGVPMVVMPQWTDQPTNATFIVEVWKVGLRVRANERGVVTGEEIESCV  417

Query  298   VEVMK-GERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              E+M+ GERG  ++EN+  WK+LAK A+DEGGSS+KNI+EFVS +
Sbjct  418   NEIMEGGERGKEIRENSLGWKELAKRAIDEGGSSEKNIQEFVSNV  462



>ref|XP_011082052.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Sesamum indicum]
Length=457

 Score =   423 bits (1088),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 208/443 (47%), Positives = 298/443 (67%), Gaps = 6/443 (1%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGV--  1313
             H LV+P+PI GHI PM+Q SKRL+ +G+ +T+          Q  S  I VE+I DG   
Sbjct  12    HCLVLPFPIQGHINPMLQFSKRLSHKGIRITLAATKHLFKTTQQFSGSISVETISDGFDE  71

Query  1312  -KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAA  1136
              K D   D      + + +  L+E++ K+  SG  +  V+YD  +PW   +  + GL  A
Sbjct  72    GKADVDLDPYLARFEQVGTETLSELLDKLRDSGRPVDCVIYDPFLPWAVVVAKKHGLVGA  131

Query  1135  AFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFV  956
             AF +QS +V ++Y++  +  L  P     +++  +P L ++D+PSFVR++ S+      V
Sbjct  132   AFFTQSSSVNSIYYNVYKGQLKVPLLDKEIAVAGLPLLEISDVPSFVRDQDSHPGSFELV  191

Query  955   LSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYG  776
             L++  N ++AD++  N+F ELE+EV + MA   P+K   IGP  PSMYLDKR+ +D +Y 
Sbjct  192   LNQFRNVEEADFVFVNSFYELEEEVTDLMAKILPVK--TIGPTTPSMYLDKRLTEDKDYD  249

Query  775   LSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSS  596
             LS+FKP N+ CM+WL+ +   SV+YVSFGS+A L+ EQM E+A GL  +   FLWVVRSS
Sbjct  250   LSIFKPVNS-CMKWLEERTNKSVIYVSFGSMAKLEGEQMEELALGLKMTNKYFLWVVRSS  308

Query  595   EQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMP  416
             E+SKLP +F  +    G+I +WCPQL+VL+H A+GCFITHCGWNSTLEALSLGVP+VA+P
Sbjct  309   EESKLPKSFVQETQEKGLIVSWCPQLEVLAHDAIGCFITHCGWNSTLEALSLGVPMVAVP  368

Query  415   QWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQ  236
              W+DQ TNAK ++DVW +GIR       +V REE+ RC+  VM+GE G  +++NA KW++
Sbjct  369   WWSDQSTNAKLVMDVWKMGIRARPDVKDIVGREEIVRCIKHVMEGEEGNEVRKNAKKWRE  428

Query  235   LAKEAVDEGGSSDKNIKEFVSAI  167
             LA++AVDEGGSSD+NI+EF+S +
Sbjct  429   LARKAVDEGGSSDRNIQEFLSTL  451



>emb|CDP03995.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   423 bits (1088),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 210/451 (47%), Positives = 295/451 (65%), Gaps = 10/451 (2%)
 Frame = -3

Query  1498  STVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS-SSLIRVESIP  1322
             S+  HVLV+PYP  GHI PM+Q  KRL ++GV  T +     S  I     S I  E+I 
Sbjct  5     SSKVHVLVLPYPGQGHINPMLQFCKRLVAKGVKTTFVNSVFISKSIPADPKSAINFETIS  64

Query  1321  DGVKPDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLV  1160
             DG   + G+      +A  + L    S  LA+++ K+   G  +  V+YDS + W  D+ 
Sbjct  65    DG-HDEGGYAAAESPEAYLEKLATFGSKALADLIRKLEDKGEPVQAVIYDSFLTWALDVA  123

Query  1159  HQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSS  980
              Q GL  AAF +Q+CAV ++Y++     L  P   S +SLP +P L   + PSFV    S
Sbjct  124   KQFGLVTAAFFTQTCAVNSIYYNVYHGLLPVPLSDSPISLPGLPLLQPKETPSFVYLPDS  183

Query  979   YSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKR  800
             Y + L  ++++  N  +ADW++ N F +LE++ + W+A  +  +VI +GP +PS+YLDKR
Sbjct  184   YPAFLHMLVNQFSNVDQADWVILNNFHKLEEDAVNWIAKLW--RVITVGPTVPSIYLDKR  241

Query  799   VRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCK  620
             + DD  YG++LFKP+++ C+ WL+SQ   SVVYVSFGS   +  EQ+ E+A  L +S  K
Sbjct  242   LEDDIGYGINLFKPDSSLCINWLNSQPKDSVVYVSFGSWTEIDVEQVEEIASALKESGFK  301

Query  619   FLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             FLWVVR+ E+ KLP  F  + S  G++  W PQL+VL+H++V CF+THCG+NS LEALSL
Sbjct  302   FLWVVRAFEKEKLPRKFAEETSEKGLVVTWSPQLEVLAHESVACFVTHCGFNSVLEALSL  361

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
             GVPVVA PQWTDQPTNAK+L D+W VG++  A E G+V RE +  C+ E+M+GE+G  +K
Sbjct  362   GVPVVAAPQWTDQPTNAKFLADIWGVGVKADADEKGIVRRETLVSCIREIMEGEKGKQIK  421

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ENA +WK LAKEA+D+GGSSDKNI EFV+ +
Sbjct  422   ENAIEWKALAKEAIDDGGSSDKNIDEFVAGL  452



>gb|KCW57503.1| hypothetical protein EUGRSUZ_H00275 [Eucalyptus grandis]
Length=483

 Score =   424 bits (1090),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 227/465 (49%), Positives = 302/465 (65%), Gaps = 35/465 (8%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ-VSSSLIRVESIPDGVK  1310
             HVLV+ +P+ GHI PM+Q SKRLAS+G+ VT + P ST   +  V++S I+VE I DG  
Sbjct  24    HVLVLAHPVQGHINPMLQFSKRLASKGLKVTFLIPISTKKSLNLVNASSIQVEYISDG--  81

Query  1309  PDSGFDAI-------SDWLKDL---VSNNLAEIMSKVTGSGCL---LTTVVYDSIMPWVA  1169
                 FD +        ++L+     VS +L++ + K     C       ++YDS   W  
Sbjct  82    ----FDTVEADKLSTKEYLEHFRLSVSQSLSDFIQK--HQSCQENPAKVLIYDSFDSWAL  135

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP---TEGSTVSL---PSMPPLGLNDL  1007
             D+  + G+  A+F +QSC V  +Y+   Q  +  P    +G    L   P M  LGLND 
Sbjct  136   DVAIKHGMHGASFFTQSCVVSCIYYLVHQGTVKLPLDAVDGQGRVLCDPPVMSVLGLNDF  195

Query  1006  PSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPL  827
             PSFV +   Y  +L  VL +  N +KA WLLFNTF ELE+E++ WM +Q+ +  + +GP 
Sbjct  196   PSFVADVHKYPGVLDIVLGQFSNFRKAKWLLFNTFTELEEELVNWMGNQWSM--MTVGPT  253

Query  826   LPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVA  647
             +PS+Y+DKR+ DD  YGLSLFKP    C+ WLDS+   S VYVSFGSLA+L ++QM E+A
Sbjct  254   IPSVYMDKRLEDDTGYGLSLFKPEAEACLRWLDSKPPCSTVYVSFGSLASLGEDQMEELA  313

Query  646   QGLIQSKCKFLWVVRSSEQSKLPSNFWP----DKSGAGIITNWCPQLDVLSHQAVGCFIT  479
              GL   K  FLWVVR SE+ KLP NF      D    G++  W  QL VLSH +VGCF+T
Sbjct  314   SGLRSMKSHFLWVVRESEEKKLPRNFLQELGLDDDKKGLVVRWSNQLQVLSHVSVGCFMT  373

Query  478   HCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCL  299
             HCGWNSTLEALSLGVP+V MPQWTDQPTNA ++V+VW VG+RV A E G+VT EE+E C+
Sbjct  374   HCGWNSTLEALSLGVPMVVMPQWTDQPTNATFIVEVWKVGLRVRANERGVVTGEEIESCV  433

Query  298   VEVMK-GERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              E+M+ GERG  ++EN+  WK+LAK A+DEGGSS+KNI+EFVS +
Sbjct  434   NEIMEGGERGKEIRENSLGWKELAKRAIDEGGSSEKNIQEFVSNV  478



>ref|XP_007201501.1| hypothetical protein PRUPE_ppa016883mg [Prunus persica]
 gb|EMJ02700.1| hypothetical protein PRUPE_ppa016883mg [Prunus persica]
Length=466

 Score =   423 bits (1088),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 217/463 (47%), Positives = 301/463 (65%), Gaps = 16/463 (3%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ-------V  1355
             E  E +  +H LV+PYP  GHI PM+Q SK L  +G+ +T+         IQ        
Sbjct  2     EKGERAYKAHCLVLPYPSQGHINPMLQFSKLLNHKGIKITLANTIFVHNTIQKISSSSSS  61

Query  1354  SSSLIRVESIPDG-----VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYD  1190
             SS+ I  E+I DG     +      +A  D  + + +  L E++ +++GSG  +  +VYD
Sbjct  62    SSTSIAFETISDGYDEGGITQAESIEAYLDRFRKIGTKTLIELIDRLSGSGNPVDCIVYD  121

Query  1189  SIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTE-GSTVSLPSMPPLGLN  1013
             + MPW  D+  + G+  A F +QSC+V  +++H  Q  L  P    S + LP +PPL  +
Sbjct  122   AFMPWPLDVAKKFGIVGAVFFTQSCSVDNIFYHVHQGLLKLPLPPDSEILLPGLPPLQPS  181

Query  1012  DLPSFVRNKSSYSSLLRFVLSRNL-NTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAI  836
             D+PSF+    SY +    V+     N  KADW+  NTF ELE+EV++ MA  +PL+ I  
Sbjct  182   DMPSFIYVYGSYPAFFTMVVDGQFYNVDKADWVFCNTFYELEEEVVDCMAKLWPLRTI--  239

Query  835   GPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMC  656
             GP +PSMYLDKR  DD  YG SLF PN++ C+ WL+++  GSV YVSFGSLA L + QM 
Sbjct  240   GPTIPSMYLDKRREDDREYGFSLFNPNSDACLTWLNAKPKGSVAYVSFGSLAELGENQME  299

Query  655   EVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITH  476
             E+  GL  S   FLWVVR  E +KLP  F  + SG G++ +WCPQLDVL+++AVGCF+TH
Sbjct  300   ELGWGLRNSNNYFLWVVREKEAAKLPQGFVEETSGKGLVVSWCPQLDVLANEAVGCFVTH  359

Query  475   CGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLV  296
             CGWNSTLEALSLGVP+VA+PQWTDQ TNA+++ DVW +G++  A E G+V REE+  C+ 
Sbjct  360   CGWNSTLEALSLGVPMVAVPQWTDQSTNARFIQDVWKMGLKAQADEKGIVRREEIANCVR  419

Query  295   EVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             E+++GERG  +++N +KWK+LAK AVDEGGSSDKNI EF++ +
Sbjct  420   EILEGERGKEIRKNTSKWKELAKNAVDEGGSSDKNIDEFIAKL  462



>ref|XP_008237299.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Prunus mume]
Length=471

 Score =   423 bits (1088),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 222/460 (48%), Positives = 311/460 (68%), Gaps = 13/460 (3%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPI-HGHITPMVQLSKRLASRGVGVTVITPTSTSACI---QVSSS  1346
             E A+    +H LV+P+PI  GH+ PM+Q SK L  +G+ VT++T       +      SS
Sbjct  2     EKAQRDRKAHCLVLPFPILQGHVNPMLQFSKLLHHKGIKVTLVTTIFVHNTLMHGSSGSS  61

Query  1345  LIRVESIPDGV-----KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIM  1181
              I +E+I DG      +   G DA  +    +    L +++ K++ SG  +  +VYDS++
Sbjct  62    GIALETISDGYDQGWREEAEGIDAYLERFWQVGPQTLGQLIEKLSSSGFPVDCIVYDSMV  121

Query  1180  PWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPT--EGSTVSLPSMPPLGLNDL  1007
             PW  D+  + G+  A+F +QSCAV  + +H  +  L  P   + S +SLP +PPL L DL
Sbjct  122   PWSLDVAKKYGIAGASFLTQSCAVDNILYHVHKGLLKLPVIDDQSEISLPGLPPLELLDL  181

Query  1006  PSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPL  827
             PSFV +  SY  + + V+ +  N  KADW+L N+F ELE++V++WMA+  PLK I  GP 
Sbjct  182   PSFVHDFGSYPGIYKVVVGQFSNIHKADWVLCNSFYELEEQVVDWMATFLPLKTI--GPT  239

Query  826   LPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVA  647
             +PS YLDKR+ DD  YG+SLF  NN+ CM+WL+ Q  GSV YV+FGS A L  EQM E+A
Sbjct  240   IPSHYLDKRLEDDKQYGVSLFDTNNDACMKWLNEQPKGSVAYVAFGSAAQLGVEQMEELA  299

Query  646   QGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGW  467
              GL +SK KFLWVVR +E +KLP  F  + S  G++ +WCPQL+VL+++AVGCFI+HCGW
Sbjct  300   WGLRRSKSKFLWVVREAEAAKLPKGFVEETSEKGLVVSWCPQLEVLANEAVGCFISHCGW  359

Query  466   NSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM  287
             NSTLEA SLGVPVVA+PQWTDQ TNAK+++DVW +G++ +A E G+V +EEVE C+ E+M
Sbjct  360   NSTLEAFSLGVPVVALPQWTDQSTNAKFIMDVWKIGVKALADEKGVVRQEEVEHCISEIM  419

Query  286   KGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +GERG  ++  A +WK+LA++AVDEGGSS  NI EF+S +
Sbjct  420   EGERGKEMQRKALEWKELARKAVDEGGSSSNNIDEFISKL  459



>ref|XP_006357100.1| PREDICTED: UDP-glycosyltransferase 74E1-like [Solanum tuberosum]
Length=457

 Score =   423 bits (1087),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 207/451 (46%), Positives = 299/451 (66%), Gaps = 14/451 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP+ GHI PM+Q SKRL S+ V + + T       ++   + + +E+I DG  
Sbjct  7     THCLILPYPVQGHINPMLQFSKRLQSKRVEIIIATTKYLLKNMKELPTSVSIEAISDGYD  66

Query  1309  PDSGFDAISDW------LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              D G D    +       K++ S+ L++++ K+  SGC +  +VYD  + W  ++  + G
Sbjct  67    -DGGRDQAGSFVAYVTRFKEVGSDTLSQLIQKLANSGCPVNCIVYDPYLNWAVEVATKFG  125

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMP-PLGLNDLPSFVRNKSSY  977
             L +AAF +Q+CAV  +Y+H  +  +  P       + +P    P+  +D+PSFV    + 
Sbjct  126   LVSAAFFTQNCAVDNIYYHVHKGVIKFPPTQNDKEIIIPGFSCPIEASDVPSFVFRPEA-  184

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
               ++  ++++  N  K DW+L N+F ELEKEV++WM+  +P+K   IGP +PSMYLDKR+
Sbjct  185   ERIIEMMVNQFSNLDKVDWVLINSFYELEKEVIDWMSKIYPIK--TIGPTIPSMYLDKRL  242

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              DD  YGLS+FKP  N+C+ WL+ Q   SVVYVSFGSLA L+ +QM E+A GL  S   F
Sbjct  243   HDDKEYGLSIFKPMTNECLNWLNHQPISSVVYVSFGSLAKLEAKQMEELAWGLKNSNNNF  302

Query  616   LWVVRSSEQSKLPSNFWPDKS-GAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             LWVVRS+E+SKL   F  + +   G++ +WCPQL VL H++ GCF+THCGWNSTLEA+SL
Sbjct  303   LWVVRSTEESKLTKTFIEELTIEKGLVVSWCPQLQVLEHESTGCFLTHCGWNSTLEAISL  362

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
             GVP+V MPQWTDQ TNAK + DVW++G+R    E G+V RE +E C+  VM+ ERG +++
Sbjct  363   GVPMVTMPQWTDQTTNAKLVKDVWEIGVRAKQDEKGIVRREAIEECIKLVMEEERGKLIR  422

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             E+A KWK+LA+  VDEGGSSDKNI+EFVS +
Sbjct  423   EHAKKWKELARNVVDEGGSSDKNIEEFVSKL  453



>emb|CDY10139.1| BnaC05g03820D [Brassica napus]
Length=453

 Score =   422 bits (1086),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 212/448 (47%), Positives = 292/448 (65%), Gaps = 11/448 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESIPDGV  1313
             SHV+V+P+P+ GH+TPM Q  KRLAS+G+  T V+     S   +  +  I V  IP G 
Sbjct  5     SHVIVLPFPVQGHLTPMFQFCKRLASKGLTSTLVLVSDKPSPPYKTENDSISVFPIPSGS  64

Query  1312  K----PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
             +    P    D   D +   + N+L E++  +         +VYDS +PW+ D+ H  GL
Sbjct  65    QEGKDPLQDLDDYIDRVYTSIKNHLPELIQDMKLLENPPRALVYDSTLPWLLDVAHDHGL  124

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRNKSSY  977
             R AAF +Q   V  +Y+H  + + + P+      +  S P+ P L  NDLPS++   SSY
Sbjct  125   RGAAFFTQPWLVSVIYYHAHKGSFSVPSSKHGHSTLASFPAFPMLSANDLPSYLCESSSY  184

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
               +LR V  +  N  + D L+ NTFD LE+++L+W+   +   V+ IGP +PSMYLDKR+
Sbjct  185   PKILRIVTEQLSNIDRVDILVCNTFDNLEEKLLKWVKRMW--SVLNIGPTVPSMYLDKRL  242

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              +D NYG S F   + +CMEWL+S++  SVVYVSFGSL  LKD+QM E+A+GL QS C F
Sbjct  243   SEDKNYGFSFFTAKSAECMEWLNSKQPNSVVYVSFGSLVILKDDQMMELAEGLKQSGCFF  302

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR +E +K+P ++  +    G+  +W PQL+VL+H++VGCF+THCGWNSTLE LSLG
Sbjct  303   LWVVRETEMNKIPISYVEEIGEKGLFVSWSPQLEVLAHESVGCFLTHCGWNSTLEGLSLG  362

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP++ MP WTDQPTNAK++ DVW VG+RV A  +G V R+E+ RC+ EVM  E+G  ++ 
Sbjct  363   VPMIGMPHWTDQPTNAKFMEDVWKVGVRVKAEADGFVRRDEIVRCVGEVMGEEKGKEMRR  422

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
             NA KWK LA EAV EGGSSDK+I EFVS
Sbjct  423   NAEKWKVLALEAVSEGGSSDKSIDEFVS  450



>gb|KCW57502.1| hypothetical protein EUGRSUZ_H00273 [Eucalyptus grandis]
Length=483

 Score =   423 bits (1088),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 226/465 (49%), Positives = 302/465 (65%), Gaps = 35/465 (8%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ-VSSSLIRVESIPDGVK  1310
             HVLV+ +P+ GHI PM+Q SKRLAS+G+ VT + P ST   +  V++S I+VE I DG  
Sbjct  24    HVLVLAHPVQGHINPMLQFSKRLASKGLKVTFLIPISTKKSLNLVNASSIQVEYISDG--  81

Query  1309  PDSGFDAI-------SDWLKDL---VSNNLAEIMSKVTGSGCL---LTTVVYDSIMPWVA  1169
                 FD +        ++L+     VS +L++ + K     C       ++YDS   W  
Sbjct  82    ----FDTVEADKLSTKEYLEHFRLSVSQSLSDFIQK--HQSCQENPAKVLIYDSFDSWAL  135

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP---TEGSTVSL---PSMPPLGLNDL  1007
             D+  + G+  A+F +QSC V  +Y+   Q  +  P    +G    L   P M  LG+ND 
Sbjct  136   DVAIEHGMHGASFFTQSCVVSCIYYLVHQGTVKLPLDAVDGQGRVLCDPPVMSVLGMNDF  195

Query  1006  PSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPL  827
             PSFV +   Y  +L  VL +  N +KA WLLFNTF ELE+E++ WM +Q+ +  + +GP 
Sbjct  196   PSFVADVHKYPGVLDIVLGQFSNFRKAKWLLFNTFTELEEELVNWMGNQWSM--MTVGPT  253

Query  826   LPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVA  647
             +PS+Y+DKR+ DD  YGLSLFKP    C+ WLDS+   S VYVSFGSLA+L ++QM E+A
Sbjct  254   IPSVYMDKRLEDDTGYGLSLFKPEAEACLRWLDSKPPCSTVYVSFGSLASLGEDQMEELA  313

Query  646   QGLIQSKCKFLWVVRSSEQSKLPSNFWP----DKSGAGIITNWCPQLDVLSHQAVGCFIT  479
              GL   K  FLWVVR SE+ KLP NF      D    G++  W  QL VLSH +VGCF+T
Sbjct  314   SGLRSMKSHFLWVVRESEEKKLPRNFLQELGLDDDKKGLVVRWSNQLQVLSHVSVGCFMT  373

Query  478   HCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCL  299
             HCGWNSTLEALSLGVP+V MPQWTDQPTNA ++V+VW VG+RV A E G+VT EE+E C+
Sbjct  374   HCGWNSTLEALSLGVPMVVMPQWTDQPTNATFIVEVWKVGLRVRANERGVVTGEEIESCV  433

Query  298   VEVMK-GERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              E+M+ GERG  ++EN+  WK+LAK A+DEGGSS+KNI+EFVS +
Sbjct  434   NEIMEGGERGKEIRENSLGWKELAKRAIDEGGSSEKNIQEFVSNV  478



>gb|KEH25944.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=456

 Score =   421 bits (1083),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 214/448 (48%), Positives = 296/448 (66%), Gaps = 13/448 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSS-SLIRVESIPDGVK  1310
             H L++PYP  GH+ PM+Q SKRL  +GV +T+IT TS    I   + + I VESI DG  
Sbjct  11    HCLILPYPAQGHMNPMIQFSKRLIEKGVKITLITVTSFWKVISNKNLTSIDVESISDGY-  69

Query  1309  PDSGFDAISDWLKD-------LVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
              D G    ++ L+D       + S  L+E++ K++ S      V++D+ +PWV D+    
Sbjct  70    -DEGGLLAAESLEDYKETFWKVGSQTLSELLHKLSSSENPPNCVIFDAFLPWVLDVGKSF  128

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             GL   AF +QSC+V +VY+HT ++ +  P   S   LP +P L   DLPSF+    SY  
Sbjct  129   GLVGVAFFTQSCSVNSVYYHTHEKLIELPLTQSEYLLPGLPKLAPGDLPSFLYKYGSYPG  188

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
                 V+++  N  KADW+L N+  ELE EV++W+   +PLK   IGP +PSM LDKR++D
Sbjct  189   YFDIVVNQFANIGKADWILANSIYELEPEVVDWLVKIWPLK--TIGPSVPSMLLDKRLKD  246

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D  YG+SL  PN   C++WL+ +  GSVVY SFGS+A L +EQ  E+A GL  S+  FLW
Sbjct  247   DKEYGVSLSDPNTEFCIKWLNDKPKGSVVYASFGSMAGLSEEQTQELALGLKDSESYFLW  306

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             VVR  EQ+KLP  +  + S  G+I  WCPQL VL+H+A+GCF+THCGWNSTLEALS+GVP
Sbjct  307   VVREYEQNKLPKGY-VESSKKGLIVTWCPQLLVLTHEALGCFVTHCGWNSTLEALSIGVP  365

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             ++AMP WTDQ TNAK + DVW +G+R +A E  +V  E ++ C+ E+++ E+G  +K+NA
Sbjct  366   LIAMPLWTDQVTNAKLIADVWKMGVRAVADEKEIVRSETIKNCIKEIIETEKGNEIKKNA  425

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              KWK LAK +VDEGG SDKNI+EFV+A+
Sbjct  426   LKWKNLAKSSVDEGGRSDKNIEEFVAAL  453



>emb|CDP03926.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   421 bits (1083),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 208/455 (46%), Positives = 295/455 (65%), Gaps = 10/455 (2%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL-IRV  1334
             M   S+  HVL +P+P+ GHI P++Q  KRL ++GV VT     S S  +       I  
Sbjct  1     MTMASSKVHVLALPFPVQGHINPLLQFCKRLEAKGVKVTFANTVSLSKSMHADPKRSINF  60

Query  1333  ESIPDGVKPDSG------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWV  1172
             E+I DG   D G      F+A  +    + S  LA++++K+   G  +  V+YD  + W 
Sbjct  61    ETISDGYD-DGGYAAAESFEAYVEKFATVGSKTLADLITKLKDDGEPVQAVIYDPHLTWA  119

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR  992
              D+  + GL  AAF +Q+CAV ++Y+H     L  P   S +SLP +P L   + PSF+ 
Sbjct  120   LDVAKRFGLVTAAFFTQTCAVNSIYYHVYHGLLPVPLSDSPISLPGLPLLQPKETPSFIY  179

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
                SY +    +L++  N  +ADW++ + F +LE++VL WMA  +  +V  +GP +PSMY
Sbjct  180   LPDSYPAFRHILLNQFSNVDQADWVILSNFHKLEEDVLNWMARLW--RVKTVGPTVPSMY  237

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LDKR+ DD  YG++LFKP+++ C+ WLD+Q   SVVYV+FGS   ++ EQ+ E+A  L++
Sbjct  238   LDKRLEDDTGYGINLFKPDSSLCINWLDNQPKDSVVYVAFGSWIGIEAEQVEEIASALME  297

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
                +FLWVVR+ E+ KLPSNF  + S  G++  W PQL+VL+H++V CF+THCG NS +E
Sbjct  298   IGYRFLWVVRALEKEKLPSNFVGETSEKGLVVTWSPQLEVLAHESVACFVTHCGLNSAME  357

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             ALSLGVPVVA PQ TDQPTNAK++ DVW VG+R  A E G+V RE +  C+ E+M+GERG
Sbjct  358   ALSLGVPVVAAPQLTDQPTNAKFIEDVWGVGVRAAADEKGIVRRETLVSCIREIMEGERG  417

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +KEN  KWK LAKEA+DEGGSSD+NI EFV+ +
Sbjct  418   KQIKENGIKWKTLAKEAIDEGGSSDRNIDEFVAEL  452



>ref|XP_009590532.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Nicotiana tomentosiformis]
Length=460

 Score =   421 bits (1083),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 211/460 (46%), Positives = 302/460 (66%), Gaps = 19/460 (4%)
 Frame = -3

Query  1501  MSTV--SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVES  1328
             MST   +H L++PYP+ GHI PM+Q SKRL S+GV +T+    S    +Q     + +E+
Sbjct  1     MSTTHKAHCLLLPYPLQGHINPMLQFSKRLQSKGVKITIAATKSLLKTMQELPISVSIEA  60

Query  1327  IPDGVKPDSGFDAISDWL------KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVAD  1166
             I DG   D G D    +L      K++ S+ L +++ K+  S C +  +VYD  +PW  +
Sbjct  61    ISDGYD-DGGIDQAKSFLAYITRFKEVGSDTLTQLIKKLENSECPVNCIVYDPFLPWAVE  119

Query  1165  LVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTE--GSTVSLPSMPP-LGLNDLPSFV  995
             +    GL +AAF +Q+C V  +Y+H  +  L  P       + +P +   +  +D+PSF 
Sbjct  120   VAKDFGLVSAAFFTQNCVVDNIYYHVHKGILKLPPTQVDGEILIPGLSSTIESSDVPSFE  179

Query  994   RNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSM  815
              +  S   L+  ++++  N +K DW+L N+F ELEKEV++WMA  +P+K   IGP +PSM
Sbjct  180   SSPQS-DKLVEMLVNQFSNLEKVDWILINSFYELEKEVIDWMAKFYPIK--TIGPTIPSM  236

Query  814   YLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             YLDKR+ +D  YGLSLFKP   +C+ WL+ Q   SVVYVSFGS+A L+ EQM E+A GL 
Sbjct  237   YLDKRLPNDKEYGLSLFKPMAKECLNWLNHQTISSVVYVSFGSMAKLEAEQMEELAWGLK  296

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPD----KSGAGIITNWCPQLDVLSHQAVGCFITHCGW  467
              S   FLWVVRS+E+S LP NF  +        G++ +WCPQL VL H+++GCF+THCGW
Sbjct  297   NSNKNFLWVVRSTEESNLPKNFIEELKLASENKGLVVSWCPQLQVLEHKSIGCFLTHCGW  356

Query  466   NSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM  287
             NSTLEA+SLGVP+V MPQW+DQPTNAK + DVW++G+R    + G+V RE +E  +  VM
Sbjct  357   NSTLEAISLGVPMVTMPQWSDQPTNAKLVQDVWEMGVRAKQDDKGIVRREIIEESIKLVM  416

Query  286   KGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             + E+G ++++NA KWK+ ++ AVDEGGSSDKNI+EFVS +
Sbjct  417   EEEKGKVIRKNAKKWKEFSRNAVDEGGSSDKNIEEFVSNL  456



>emb|CBI24721.3| unnamed protein product [Vitis vinifera]
Length=717

 Score =   430 bits (1105),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 218/441 (49%), Positives = 289/441 (66%), Gaps = 67/441 (15%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +HVLVIPYP+ GHI PM+Q SKRLAS+G+ VT+IT T                       
Sbjct  31    THVLVIPYPVQGHINPMLQFSKRLASKGLKVTLITTT-----------------------  67

Query  1309  PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAF  1130
             P +  D   +  K +VS++L E++ +  GS   +  +VYDS+M W  D+V +L +  A F
Sbjct  68    PTNNLDDYLERFKLIVSSSLVELIGRYNGSEYPVRVLVYDSVMSWAQDIVERLSVDGAPF  127

Query  1129  NSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLS  950
              +QSCAV  +Y+H +Q     P EG TVS+PSMP LG+NDLPSF+ + SSY +L   V +
Sbjct  128   FTQSCAVSTIYYHVNQGAFKIPLEGPTVSIPSMPILGVNDLPSFINDTSSYPTLWSLVKT  187

Query  949   RNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLS  770
             +  N +K +W+ FNTF ELE EV++W+AS+ P+K   IGP +PSMYLD+R+ DD++YGLS
Sbjct  188   QFSNFEKVNWVFFNTFCELEDEVVKWLASKRPIK--TIGPTIPSMYLDRRIDDDEDYGLS  245

Query  769   LFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQ  590
             LFKPN + C+ WLD+++T SVVYVSFGSLA+L +EQM E+A GL +S  +FLWVVR  E+
Sbjct  246   LFKPNADACITWLDTKDTVSVVYVSFGSLASLGEEQMEELAWGLKRSNSQFLWVVRELEK  305

Query  589   SKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQW  410
              KLPSNF  + S  G++ +WCPQL+VL+H+AVGCF+THCGWNSTLEALSLGVP+VAMPQW
Sbjct  306   KKLPSNFVEETSEKGLVVSWCPQLEVLAHKAVGCFMTHCGWNSTLEALSLGVPMVAMPQW  365

Query  409   TDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLA  230
             TDQ TNAK++ DVW                                           +LA
Sbjct  366   TDQTTNAKFIEDVWG------------------------------------------ELA  383

Query  229   KEAVDEGGSSDKNIKEFVSAI  167
             KEAV+EGGSSD NI+EFV+ +
Sbjct  384   KEAVNEGGSSDNNIEEFVARL  404


 Score =   221 bits (564),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 152/224 (68%), Gaps = 6/224 (3%)
 Frame = -3

Query  1276  LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAVY  1097
              + + S +LAE++ K + S      +VYDS+MPW  D+   LGL    F +QSCAV  +Y
Sbjct  424   FRMVASQSLAELIKKHSRSSHPAKFLVYDSMMPWAQDVAEPLGLDGVPFFTQSCAVSTIY  483

Query  1096  HHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADWL  917
             +H +Q  L  P EG TVS+PSMP L +NDLPSF+ +K    ++L F+L +  N QK  W+
Sbjct  484   YHFNQGKLKTPLEGYTVSIPSMPLLCINDLPSFINDK----TILGFLLKQFSNFQKVKWI  539

Query  916   LFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCME  737
             LFNTFD+LE+EV++WMAS  P+K   IGP +PSMYLDKR+ +D  YGLSLFK N +  + 
Sbjct  540   LFNTFDKLEEEVMKWMASLRPIK--TIGPTVPSMYLDKRLEEDKEYGLSLFKQNVDAYIA  597

Query  736   WLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVV  605
             WLD +  GSVVY SFGS+A+L +EQM E+A GL ++   F+W +
Sbjct  598   WLDLKGIGSVVYASFGSMASLGEEQMEEIAWGLKRNNTHFMWFI  641


 Score = 95.9 bits (237),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = -3

Query  385  YLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDEGG  206
            ++ DVW VG+RV   E G+V REE+E C+ E+M+GERG  ++ NA  WK+LAKEAV EGG
Sbjct  640  FIEDVWGVGVRVKPDEKGLVKREEIEMCIREMMQGERGNEMRRNAEMWKELAKEAVTEGG  699

Query  205  SSDKNIKEFVSAI  167
            +SDKNI+EFV+ I
Sbjct  700  TSDKNIEEFVAEI  712



>ref|NP_001184915.1| UDP-Glycosyltransferase superfamily protein [Arabidopsis thaliana]
 sp|P0C7P7.1|U74E1_ARATH RecName: Full=UDP-glycosyltransferase 74E1 [Arabidopsis thaliana]
 gb|AEE27875.1| UDP-Glycosyltransferase superfamily protein [Arabidopsis thaliana]
Length=453

 Score =   421 bits (1082),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 214/452 (47%), Positives = 293/452 (65%), Gaps = 11/452 (2%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESI  1325
             M   SHV+V+P+P  GHITPM Q  KRLAS+ + +T V+     S   +     I V  I
Sbjct  1     MREGSHVIVLPFPAQGHITPMSQFCKRLASKSLKITLVLVSDKPSPPYKTEHDTITVVPI  60

Query  1324  PDGVKP----DSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
              +G +         D   + ++  + N L +++  +  SG     +VYDS MPW+ D+ H
Sbjct  61    SNGFQEGQERSEDLDEYMERVESSIKNRLPKLIEDMKLSGNPPRALVYDSTMPWLLDVAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRN  989
               GL  A F +Q   V A+Y+H  + + + P+      +  S PS+P L  NDLPSF+  
Sbjct  121   SYGLSGAVFFTQPWLVSAIYYHVFKGSFSVPSTKYGHSTLASFPSLPILNANDLPSFLCE  180

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
              SSY  +LR V+ +  N  + D +L NTFD+LE+++L+W+ S +P  V+ IGP +PSMYL
Sbjct  181   SSSYPYILRTVIDQLSNIDRVDIVLCNTFDKLEEKLLKWIKSVWP--VLNIGPTVPSMYL  238

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR+ +D NYG SLF     +CMEWL+S++  SVVYVSFGSL  LK +Q+ E+A GL QS
Sbjct  239   DKRLAEDKNYGFSLFGAKIAECMEWLNSKQPSSVVYVSFGSLVVLKKDQLIELAAGLKQS  298

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
                FLWVVR +E+ KLP N+  +    G+  +W PQL+VL+H+++GCF+THCGWNSTLE 
Sbjct  299   GHFFLWVVRETERRKLPENYIEEIGEKGLTVSWSPQLEVLTHKSIGCFVTHCGWNSTLEG  358

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LSLGVP++ MP W DQPTNAK++ DVW VG+RV A  +G V REE  R + EVM+ E+G 
Sbjct  359   LSLGVPMIGMPHWADQPTNAKFMEDVWKVGVRVKADSDGFVRREEFVRRVEEVMEAEQGK  418

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
              +++NA KWK LA+EAV EGGSSDKNI EFVS
Sbjct  419   EIRKNAEKWKVLAQEAVSEGGSSDKNINEFVS  450



>ref|XP_010457690.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Camelina sativa]
Length=453

 Score =   421 bits (1081),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 210/452 (46%), Positives = 296/452 (65%), Gaps = 11/452 (2%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVI----TPTSTSACIQVSSSLIRV  1334
             M   SHV+V+P+P  GHITPM Q  KRLAS+G+ +T+I     P+        S ++I +
Sbjct  1     MREGSHVIVLPFPAQGHITPMSQFCKRLASKGLKITLIIVSDKPSPPYKTEHDSITVIPI  60

Query  1333  ES-IPDGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
              +   +G +     D   + ++  +   L +++  +  SG     +VYDS MPW+ D+ H
Sbjct  61    SNGFQEGEERSQDLDDYMERVQTSIKTRLPKLIEDMKLSGNPPRALVYDSTMPWLLDVAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRN  989
               GLR A F +Q   V  +Y+H  + + + P+      +  S PS P L +NDLPSF+  
Sbjct  121   SYGLRGAVFFTQPWLVSTIYYHVTKGSFSVPSTKYGHSALASFPSFPMLNMNDLPSFLCE  180

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
              SSY ++LR V+ +  N  + D +L NTFD+LE+++L+W+ S +P  V+ IGP +PSMYL
Sbjct  181   SSSYPNILRVVIDQLSNIDRVDIVLCNTFDKLEEKLLKWVQSLWP--VLNIGPTVPSMYL  238

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR+ +D NYG SLF  N  +C+EWL+S++  SVVYVS GSL  LK++QM E+ +GL QS
Sbjct  239   DKRLSEDKNYGFSLFDANVAECVEWLNSKQPSSVVYVSLGSLVVLKEDQMMELVEGLKQS  298

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
                FLWVVR +E+ KLP N+  +    G+I +W PQLDVL+H++VGCF+THCGWNS LE 
Sbjct  299   GRFFLWVVRDTEKKKLPRNYVEETGEKGLIVSWSPQLDVLTHESVGCFLTHCGWNSMLEG  358

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LS GVP++ MP W DQPTNAK++ DVW VG+RV    NG V REE+ R + EVM+GE+G 
Sbjct  359   LSFGVPMIGMPHWADQPTNAKFMEDVWKVGVRVKEDVNGFVKREEIVRRVGEVMEGEKGK  418

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
              +++NA  WK LA+EA+ EGGSSD +I EFVS
Sbjct  419   EIRKNADNWKMLAREAISEGGSSDISINEFVS  450



>gb|KDP35132.1| hypothetical protein JCGZ_10666 [Jatropha curcas]
Length=457

 Score =   420 bits (1079),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/453 (47%), Positives = 299/453 (66%), Gaps = 9/453 (2%)
 Frame = -3

Query  1504  EMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL--IRVE  1331
             E S  +HVL++PYP  GHI PM+  S+RL SRG+  T++T    S  + + SS+  + + 
Sbjct  2     ENSYRAHVLLLPYPGQGHINPMLHFSRRLISRGIKATLVTSIFISKSMNLPSSIDSVHLA  61

Query  1330  SIPDGV-----KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVAD  1166
             +I DG      +  SG D     LK   S  L+E++ K   S      V+Y+  +PW  D
Sbjct  62    AISDGFDDGGYEKSSGVDYYLTRLKTEGSRTLSELIEKHKTSSDPFDCVIYEPFLPWALD  121

Query  1165  LVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNK  986
             +     L AAAF +Q  AV  +Y++   ++L+ P   + VS+PS+P L + D+PS V   
Sbjct  122   VAKDFRLFAAAFFTQPAAVDFIYYNIQCKSLSVPVSSTPVSIPSLPLLEIGDMPSAVSGP  181

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
              +Y +    + ++  N +KAD++L NTF +LEKEV++ M+   P  V+ IGP +PS YLD
Sbjct  182   EAYPAYTAMLFNQWSNIEKADYVLINTFYKLEKEVVDEMSKVCP--VLTIGPTIPSKYLD  239

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+ +DD+YGL LF    +  + W+ ++   SVVYV+FGSL+NL D+QM E+A GL +SK
Sbjct  240   KRIENDDDYGLDLFALEASFSLNWISNKPARSVVYVAFGSLSNLSDKQMEELAWGLKRSK  299

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
               FLWVVR++E SKLP +F  D    GII NW PQ+ +L ++A+GCF++HCGWNST+EAL
Sbjct  300   FYFLWVVRATEASKLPKSFLEDLGDKGIIVNWSPQVKLLQNEAIGCFLSHCGWNSTIEAL  359

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVM  266
             SLGVP+V MPQWTDQPTNAK + DVW  GIRV   E+G+VTREE+E C+ +VM+ E G  
Sbjct  360   SLGVPIVRMPQWTDQPTNAKLVEDVWKAGIRVKVNEDGIVTREEIEGCVRQVMESETGKE  419

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +++NA KW++LA EAV EGG+SDKNI EFVS +
Sbjct  420   MRKNAQKWRELAIEAVTEGGTSDKNIDEFVSKL  452



>ref|XP_006357047.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=456

 Score =   419 bits (1077),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 204/451 (45%), Positives = 300/451 (67%), Gaps = 14/451 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP  GHI PM+Q SK L S+ V +T+         ++  ++ + +E+I DG  
Sbjct  6     AHCLMLPYPFQGHINPMLQFSKCLQSKRVKITIALTKYLLKNMKELTTSVSIEAISDGYD  65

Query  1309  PDSGFDAISDW------LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              D G D    +       K++ S+ L++++ K+  S C +  +VYD  + WV ++  + G
Sbjct  66    -DGGRDQAGSFVAYVTRFKEVGSDTLSQLIQKLANSECPVNCIVYDPFLSWVVEVARKFG  124

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMP-PLGLNDLPSFVRNKSSY  977
             L +AAF +Q+CAV  +Y+H  +  +  P       + +P    P+  +D P++V  K   
Sbjct  125   LVSAAFFTQNCAVDNIYYHVHKGVIKLPPTQNDEKILIPGFSCPIEASDGPNYVM-KIEG  183

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
               +L +++++  N  K DW+L N+F ELEKE+++WM+  +P+K   IGP +PSMYLDKR+
Sbjct  184   PKILEYMVNQFSNLDKVDWVLINSFYELEKEIIDWMSKLYPIK--TIGPTIPSMYLDKRL  241

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              DD  YGLS+FKP  N+C+ WL+ Q   SV+YVSFGS A ++ EQM E+A GL  S   F
Sbjct  242   HDDKEYGLSIFKPMTNECLNWLNHQPISSVLYVSFGSFAIVEAEQMEELAWGLKNSNNNF  301

Query  616   LWVVRSSEQSKLPSNFWPDKS-GAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             LWVVRS+E+ KLP +F  + +   G++  WCPQL VL H+++GCF+THCGWNS LEA+SL
Sbjct  302   LWVVRSTEEPKLPKDFLEELTIEKGLVVPWCPQLQVLEHESIGCFLTHCGWNSILEAISL  361

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
             GVP+VAMPQWTDQPTNAK++ DVW++G+R    E G+V RE +E C+  VM+ E+G +++
Sbjct  362   GVPMVAMPQWTDQPTNAKFVKDVWEIGVRAKQDEKGIVRREVIEECIKLVMEEEKGKLIR  421

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ENA KWK+LA+  VDEGGSSDKNI+EFVS +
Sbjct  422   ENAKKWKELARNVVDEGGSSDKNIEEFVSKL  452



>dbj|BAG80538.1| UDP-glucose:glucosyltransferase [Lycium barbarum]
Length=461

 Score =   419 bits (1077),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 207/456 (45%), Positives = 302/456 (66%), Gaps = 19/456 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L++PYP+ GHI PM+Q SKRL S+GV +T+    S    +Q   + + +E+I DG  
Sbjct  6     AHCLILPYPLQGHINPMLQFSKRLQSKGVKITIAPTKSFLKTMQELPTSVSIEAISDGYD  65

Query  1309  PDSGFDAISDWL------KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              D G D    +L      K++ S+ L +++ K+T   C +  + YD  +PW  ++    G
Sbjct  66    -DGGIDQAESFLAYITRFKEVGSDTLTQLIQKLTNCECPVNCIGYDPFLPWAVEVAKNFG  124

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLT-APTE-GSTVSLPSMPPLGL--NDLPSFVRNKSS  980
             L +AAF +Q+C V  +Y+H  +  +   PTE    + +P +    +  +D+PSF  +  S
Sbjct  125   LVSAAFFTQNCTVDNIYYHVHKGVIKLPPTEVDEQILIPGLSSTTVESSDVPSFESSPQS  184

Query  979   YSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKR  800
                L+  ++++  N +K DW+L N+F +LEKEV++WMA  +P+K   IGP +PSMYLD+R
Sbjct  185   -DKLVELLVNQFSNLEKVDWVLINSFYKLEKEVIDWMAKLYPIK--TIGPTIPSMYLDRR  241

Query  799   VRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCK  620
             + +D  YGLSLFKP  N+C+ WL++Q   SVVYVSFGS+A ++ EQ+ EVA GL  S   
Sbjct  242   LPNDKEYGLSLFKPMANECLNWLNNQPISSVVYVSFGSMAKVEAEQLEEVAWGLKNSNKN  301

Query  619   FLWVVRSSEQSKLPSNFWPD-----KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTL  455
             FLWVVRS+E+ KLP N   +     ++  G++ +WCPQL VL H ++GCF+THCGWNSTL
Sbjct  302   FLWVVRSTEEPKLPKNLLEELKSTCENNKGLVVSWCPQLQVLEHNSIGCFLTHCGWNSTL  361

Query  454   EALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGER  275
             EA+SLGVP+V MPQW+DQPTNAK + DVW +G+R    E G+V R+ +E C+  VM+ E+
Sbjct  362   EAISLGVPMVTMPQWSDQPTNAKLVQDVWQMGVRAKQDEKGIVRRDIIEECIKLVMEEEK  421

Query  274   GVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             G ++ EN  KWK+LA+ A+DEGGSSDKNI+EFVS +
Sbjct  422   GKVIMENVKKWKELARNAMDEGGSSDKNIEEFVSKL  457



>ref|XP_006372895.1| hypothetical protein POPTR_0017s06080g [Populus trichocarpa]
 gb|ERP50692.1| hypothetical protein POPTR_0017s06080g [Populus trichocarpa]
Length=350

 Score =   415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 201/340 (59%), Positives = 258/340 (76%), Gaps = 3/340 (1%)
 Frame = -3

Query  1183  MPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLP  1004
             MPWV ++  QLGL  A+F +QSCAV +VY+   +  L  P E   VS+  +PPL +++LP
Sbjct  1     MPWVLEIARQLGLIGASFFTQSCAVNSVYYQIHEGQLKIPLEKFPVSVQGLPPLDVDELP  60

Query  1003  SFVRN-KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPL  827
             SFV + +S YSS+L  V+++  N + ADW+  N+F+ LE+EV+  +ASQ  +K   IGP+
Sbjct  61    SFVHDMESEYSSILTLVVNQFSNFRGADWIFVNSFNTLEEEVVNCLASQRSIK--PIGPM  118

Query  826   LPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVA  647
             +PS+YLD+++ DD  YGLSLFKP  + CMEWLDS+ETGSVVYVSFGSLA L +EQM E+A
Sbjct  119   IPSVYLDRQLEDDTEYGLSLFKPAVDGCMEWLDSKETGSVVYVSFGSLAALGEEQMAEIA  178

Query  646   QGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGW  467
              GL +S C FLWVVR SE+ KLP NF    S  G+I  W PQL+VLSH++VGCF+THCGW
Sbjct  179   WGLRRSDCYFLWVVRESEEKKLPCNFVEGSSEKGLIVTWSPQLEVLSHKSVGCFMTHCGW  238

Query  466   NSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM  287
             NSTLEALSLGVP+VAMPQWTDQPTNAKY+ DVW VG+RV A E G+VT+EE+E+   EVM
Sbjct  239   NSTLEALSLGVPMVAMPQWTDQPTNAKYIEDVWRVGVRVKANEKGIVTKEELEKFTREVM  298

Query  286   KGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +GERG  ++ N+ KWK+LAK A+ EGGSSDKNI EF + I
Sbjct  299   EGERGSEMRRNSEKWKKLAKTAMGEGGSSDKNITEFAAKI  338



>ref|XP_008236255.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Prunus mume]
Length=459

 Score =   419 bits (1076),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 214/458 (47%), Positives = 309/458 (67%), Gaps = 11/458 (2%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS---L  1343
             E  +++  +H LV+P+P  GHI PM+Q +K LA +GV VT++T       +  S+S    
Sbjct  2     EKGQIAYKAHCLVLPFPGQGHINPMLQFAKLLAHKGVKVTLVTTRYIHKTMYGSASSCIA  61

Query  1342  IRVESIPDGV----KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPW  1175
             + +E+I DG     + ++  DA  +    + S  LAE++ K++ SG  +  V+YD+ M W
Sbjct  62    LDLETISDGYDEAGRGETSIDAYLESFWKVGSKTLAELLEKLSSSGSPVDCVIYDAFMTW  121

Query  1174  VADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMPPLGLNDLPS  1001
               D+  + G+  A F +QSCAV  +Y+H  +  L  P   + S +S P +PPL   DLPS
Sbjct  122   PLDIARKFGISGAVFFTQSCAVENIYYHIHEGLLKLPLADDQSQISFPGLPPLEPLDLPS  181

Query  1000  FVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLP  821
             F+ +  SY +    ++ +  N  KADW+L NTF ELE++V++W+A  +PL+ +  GP +P
Sbjct  182   FLYDFGSYPAFYEVLVGQFSNVDKADWILSNTFYELEEQVVDWLAKFWPLRTV--GPTIP  239

Query  820   SMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQG  641
             S YLD+R+ DD  YG++LFK +N+ C++WL+ +  GSV YVSFGS A L  EQM E+A G
Sbjct  240   SKYLDERLEDDKEYGVNLFKSDNDACIKWLNERPKGSVAYVSFGSAARLGIEQMEELAWG  299

Query  640   LIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNS  461
             L + K  FLWVVR+SE +K+P  F  + S  G++ +WC Q++VL+H+AVGCF+THCGWNS
Sbjct  300   LRRGKSNFLWVVRASEAAKVPKGFVEETSEKGLVVSWCSQMEVLAHEAVGCFVTHCGWNS  359

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             TLEALSLGVP++AMPQWTDQ TNAK+++DVW +G+   + E G+V  E VE C+ E+M+G
Sbjct  360   TLEALSLGVPMLAMPQWTDQTTNAKFIMDVWKIGLTAPSDEKGLVGPEVVEHCISEIMEG  419

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ERG  +K NA KWK+LAK+AV EGGSSDKNI EF+S +
Sbjct  420   ERGKEMKINALKWKELAKKAVAEGGSSDKNIDEFISKL  457



>ref|XP_009776061.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana sylvestris]
Length=459

 Score =   419 bits (1076),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 211/460 (46%), Positives = 301/460 (65%), Gaps = 20/460 (4%)
 Frame = -3

Query  1501  MSTV--SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVES  1328
             MST   +H L++PYP+ GHI PM+Q SKRL S+GV +T+    S    +Q   + + +E+
Sbjct  1     MSTTHKAHCLILPYPVQGHINPMLQFSKRLQSKGVKITISPTKSFLKTMQELPTSVSIEA  60

Query  1327  IPDGVKPDSGFDAISDWL------KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVAD  1166
             I DG   + G D    +L      K++ S+ L +++ K+    C +  +VYD  +PW  +
Sbjct  61    ISDGY--NGGIDQAESFLAYITRFKEVGSDTLTQLIKKLENCECPVNCIVYDPFLPWAVE  118

Query  1165  LVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTE--GSTVSLPSMPP-LGLNDLPSFV  995
             +    GL +AAF +Q+C V  +Y+H  +  L  P       + +P +   +  +D+PSF 
Sbjct  119   VAKDFGLVSAAFFTQNCVVDNIYYHVHKGVLKLPPTQVDGEILIPGLSSTIESSDVPSFE  178

Query  994   RNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSM  815
              +  S   L+  ++++  N +K DW+L N+F ELEKEV++WMA  +P+K   IGP +PSM
Sbjct  179   SSPQS-EKLVEMLVNQFSNLEKVDWVLINSFYELEKEVIDWMAKLYPIK--TIGPTIPSM  235

Query  814   YLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             YLDKR+ +D  YGLSLFKP   +C+ WL+ Q   SVVYVSFGS+A L+ EQM E+A GL 
Sbjct  236   YLDKRLPNDKEYGLSLFKPMAKECLNWLNHQPISSVVYVSFGSMAKLEAEQMEELAWGLK  295

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPD----KSGAGIITNWCPQLDVLSHQAVGCFITHCGW  467
              S   FLWVVRS+E+SKLP NF  +        G + +WCPQL VL H+++GCF+TH GW
Sbjct  296   NSNKNFLWVVRSTEESKLPKNFIEELKLASENKGFVVSWCPQLQVLEHKSIGCFLTHSGW  355

Query  466   NSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM  287
             NSTLEA+SLGVP+V MPQW+DQPTNAK + DVW++G+R    + G+V RE +E  +  VM
Sbjct  356   NSTLEAISLGVPMVTMPQWSDQPTNAKLVHDVWEMGVRAKQDDKGIVRREIIEENIKLVM  415

Query  286   KGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             + E+G +++ENA KWK+ A+ AVDEGGSSDKNI+EFVS +
Sbjct  416   EEEKGKVIRENAKKWKEFARNAVDEGGSSDKNIEEFVSNL  455



>ref|XP_007151915.1| hypothetical protein PHAVU_004G086500g [Phaseolus vulgaris]
 gb|ESW23909.1| hypothetical protein PHAVU_004G086500g [Phaseolus vulgaris]
Length=460

 Score =   418 bits (1074),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 210/448 (47%), Positives = 280/448 (63%), Gaps = 9/448 (2%)
 Frame = -3

Query  1492  VSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSS-SLIRVESIPDG  1316
             V+H LV+PYP  GHI PM+Q SKRL  RGV +T+I   S    I   + + I VESI DG
Sbjct  8     VAHCLVLPYPAQGHINPMLQFSKRLVQRGVKITLIAVVSNWKAISNKNFTSIEVESISDG  67

Query  1315  -----VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
                  +K     +   D    + S  LAE++ K+  S      V+YD+ +PW  D+    
Sbjct  68    YDDGGLKAAESLEVYLDTFCRVGSQTLAELLQKLAESSHPPDCVIYDAFLPWALDVAKDF  127

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             GL  A F +Q+C    +Y H  ++ L  P   +   LP +P L   DLPSF+    +Y  
Sbjct  128   GLLGATFFTQTCTTNNIYFHAYKKWLELPLTQTEYLLPGLPKLAAGDLPSFLNKYGTYPG  187

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
                 V+++  N  KADW+L NTF ELE+ V++W+   +PLK   IGP LPSMYLDKRV+D
Sbjct  188   YFAVVMNQFANIDKADWVLANTFYELEQGVVDWLVKIWPLK--PIGPTLPSMYLDKRVQD  245

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D +YG+ ++ P +  C++WLD +  GSVVYVSFGS+A L +EQ  E+A GL      F+W
Sbjct  246   DKDYGVDMYIPKSEACIKWLDDKPKGSVVYVSFGSMAGLSEEQTEELAWGLRDGGSYFIW  305

Query  610   VVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVP  431
             V+R SEQ KLP  F  D S  G+I  WCPQL VL+H+A+GCF THCGWNSTLEALSLGVP
Sbjct  306   VIRDSEQGKLPKEFL-DTSEKGLIVTWCPQLQVLTHEALGCFFTHCGWNSTLEALSLGVP  364

Query  430   VVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENA  251
             V+AMP WTDQ TNAK + DVW +G++ +A E  +V RE +  C+ ++++ E    +K+N 
Sbjct  365   VIAMPLWTDQITNAKLIKDVWKIGVKAVADEKDIVRRETITHCIKQILETETRNEIKKNC  424

Query  250   AKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              KWK LAK  VDEGG+SDKN  EFV  +
Sbjct  425   IKWKNLAKSNVDEGGNSDKNTAEFVDEL  452



>ref|XP_007033647.1| UDP-glycosyltransferase 74 F1, putative [Theobroma cacao]
 gb|EOY04573.1| UDP-glycosyltransferase 74 F1, putative [Theobroma cacao]
Length=458

 Score =   417 bits (1073),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 216/450 (48%), Positives = 300/450 (67%), Gaps = 14/450 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQV-SSSLIRVESIPDGVK  1310
             HV+V+PYP  GHI PM Q SKRLAS+G   T+      S  +++ SS  +++++I DG  
Sbjct  9     HVIVLPYPAQGHINPMFQFSKRLASKGFKATLAITVFISNTMKLESSGSVQIDTISDGY-  67

Query  1309  PDSGFDAISDWLKDLV-------SNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
              D+G  A S  ++  +       S  LAE++ K   +   +  ++YD+ MPW  D+  Q 
Sbjct  68    -DAGGLASSGGIQHYLPRQEAIGSKTLAELIIKHKRTSRPIDCIIYDAAMPWALDVAKQY  126

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFV-RNKSSYS  974
             GL  AAF +Q CAV  +Y++   + L  P   + +S+P +P L   DLPSFV  ++ SY 
Sbjct  127   GLHGAAFFTQMCAVNYIYYNVHHKLLNLPICSTPISIPGLPLLQPGDLPSFVCSSEGSYI  186

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVR  794
             + L  VL++  N  KAD++L NTF +LE E +E M+  +P  V+ IGP +PS+YLDK V 
Sbjct  187   AYLGRVLNQFKNIDKADFILINTFYKLENEAVESMSKVYP--VLTIGPTVPSIYLDKPVE  244

Query  793   DDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             +D  YGL LF  N++   +WL ++  GSV+ VSFGS+ ++  +QM E+A+GL  S   FL
Sbjct  245   NDKAYGLDLFDFNSSTSTDWLSTKPPGSVICVSFGSVTSISSKQMEEIARGLNNSNFYFL  304

Query  613   WVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGV  434
             WVVR+SE++KLP  F  +    G+I NW PQLDVLS++AVGCF THCGWNST EALSLGV
Sbjct  305   WVVRASEEAKLPKGFKEESGEKGLIVNWSPQLDVLSNEAVGCFFTHCGWNSTTEALSLGV  364

Query  433   PVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGE-NGMVTREEVERCLVEVMKGERGVMLKE  257
             P+VAMPQWTDQPT  KY+ DVW VG+RV   + +G+V REE+E C+ +VM+GERG  +KE
Sbjct  365   PMVAMPQWTDQPTVGKYIEDVWKVGVRVKIDDVSGIVNREEIESCIRQVMEGERGKEIKE  424

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA KW++LA EAV EGG+SD+NI EF+S +
Sbjct  425   NAKKWRELALEAVGEGGTSDRNIDEFMSKL  454



>ref|XP_010522243.1| PREDICTED: UDP-glycosyltransferase 74E2 [Tarenaya hassleriana]
Length=455

 Score =   417 bits (1073),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 213/447 (48%), Positives = 293/447 (66%), Gaps = 11/447 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +HVL +PYP  GHITPM+QL KRLAS+ V VT++  +   +    +   I V +I +G +
Sbjct  4     AHVLALPYPAQGHITPMLQLCKRLASKSVKVTLVIVSDKPSKPYRTQHDITVVTIWNGFR  63

Query  1309  ----PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLR  1142
                 P    D   D ++  +SN+L  ++ ++  S     ++VYDS +PWV D+    GL 
Sbjct  64    EGEEPLRDLDEYMDRVERSISNHLPLLIDELKSSEFPPKSLVYDSSIPWVLDIAKSNGLY  123

Query  1141  AAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRNKSSYS  974
              A   +Q   V  VY+H  + +   P+      +  S PS+P L  +DLPSF+    SY 
Sbjct  124   GAVLFTQPWFVTVVYYHVRKGSFCVPSRRDDHPTLASFPSLPLLSPSDLPSFLCESGSYP  183

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQF-PLKVIAIGPLLPSMYLDKRV  797
             SLL  VL++  N +KAD +L NTFD+LE++V++WM     P+K   IGP +PS+YLDKR+
Sbjct  184   SLLEVVLNQLSNIEKADLVLCNTFDKLEEKVMKWMEENLWPVK--NIGPTVPSLYLDKRL  241

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
               D +YGLSLF P  ++C+ WLD++E  SVVYVSFGSL  LKDE M E+A GL Q+   F
Sbjct  242   PGDKDYGLSLFNPKVDECLTWLDTKEPNSVVYVSFGSLVVLKDEHMHELAAGLKQTGHSF  301

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR +E  KLP N+  + S  G++  W PQL VL+H++VGCF+THCGWNSTLEA+SLG
Sbjct  302   LWVVRETETDKLPRNYLQEVSEKGLVVTWSPQLQVLAHKSVGCFVTHCGWNSTLEAMSLG  361

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP++ MP WTDQPTNAK++ DVW VG+RV A  +G V REE+ERC+ E+M+G +G  ++ 
Sbjct  362   VPMIGMPHWTDQPTNAKFIEDVWKVGVRVKADRDGFVRREEIERCVGEIMEGVKGQEIRR  421

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFV  176
             +  KWK  A+EAV EGGSSD+NI   V
Sbjct  422   SVDKWKDFAREAVSEGGSSDRNIDVLV  448



>ref|XP_008235864.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=461

 Score =   417 bits (1073),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 215/454 (47%), Positives = 295/454 (65%), Gaps = 15/454 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ-------VSSSLIRVE  1331
             SH LV+ YP  GHI P++Q SKRL  +G+ VT IT  S    +         S S I +E
Sbjct  7     SHCLVLFYPSQGHINPLLQFSKRLEHKGLKVTFITTRSVLKAMHGGGGQSPSSFSSIALE  66

Query  1330  SIPDGVKPDSG-----FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVAD  1166
             +I DG            +A  D  +++ S  LAE++ +++GSG     +VYDS M W  D
Sbjct  67    TISDGYDEGGASQAESIEAYLDRFREIGSQTLAELIEEISGSGHPADCLVYDSCMSWALD  126

Query  1165  LVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP-TEGSTVSLPSMPPLGLNDLPSFVRN  989
             +  + G+  AAF + SCAV  +Y       L  P   GS + LP +PPL  +D PSFV +
Sbjct  127   VAKRAGIAGAAFFTFSCAVTNIYSLVQNGLLKVPLNPGSEILLPGLPPLQPSDTPSFVYD  186

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
               SY +  + +L +  N  KADW+L NTF ELE+E ++ MA  +PL+ I  GP +PSMY+
Sbjct  187   SGSYPAFFKLILDQFSNLDKADWVLCNTFHELEQEAVDRMAKFWPLRTI--GPTIPSMYM  244

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR  D+  YGLSL KPN++ CM+WL+ +  GSV YVSFGS+A + +EQM E+  GL +S
Sbjct  245   DKRHEDNWEYGLSLLKPNSDACMKWLNVKPKGSVAYVSFGSVAEIGEEQMEEMGLGLRRS  304

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
             K  FLWVVR  E +KLP  F  + S  G++ +WCPQL+VL+H+ VGCF+THCGWNSTLE 
Sbjct  305   KSYFLWVVREKEAAKLPKGFVEETSEKGLVVSWCPQLEVLAHETVGCFVTHCGWNSTLEG  364

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LSLGVP++A+PQWTDQ TNA+++VDVW  G++  A + G+V  EE+  C+ E++ GE G 
Sbjct  365   LSLGVPMLAVPQWTDQSTNARFIVDVWKTGVKAQADKKGIVRGEEIAHCVREILDGEIGK  424

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              +++N +KWK LAK AVDEGGSSDKNI EF++ +
Sbjct  425   EIRKNTSKWKALAKNAVDEGGSSDKNIDEFIAKL  458



>gb|AGR44631.1| UDP-glucosyltransferase 74A1 [Panax ginseng]
Length=451

 Score =   417 bits (1072),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 208/452 (46%), Positives = 307/452 (68%), Gaps = 11/452 (2%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIP  1322
             M + +H++ IP+P  GH++PM+Q +KRLA +GV +T++ P      +Q+++SLI  E I 
Sbjct  1     MLSKTHIMFIPFPAQGHMSPMMQFAKRLAWKGVRITIVLPAQIRDSMQITNSLINTECIS  60

Query  1321  DGVKPDSGF----DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQ  1154
                  D G      A    +K  V+N L++++ K   +G  +  +V DS+ P   ++ HQ
Sbjct  61    FDFDKDDGMPYSMQAYMGVVKLKVTNKLSDLLEKQKTNGYPVNLLVVDSLYPSRVEMCHQ  120

Query  1153  LGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEG--STVSLPSMPPLGLNDLPSFVRNKSS  980
             LG++ A F + SCAV A+Y++     L  P E   ++VSLPS+P LG +DLP  +    +
Sbjct  121   LGVKGAPFFTHSCAVGAIYYNAHLGKLKIPPEEGLTSVSLPSIPLLGRDDLP--IIRTGT  178

Query  979   YSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKR  800
             +  L   + ++  +  KADW+ FNTFD+LE E  +W++SQ+P  + +IGPL+PSMYLDK+
Sbjct  179   FPDLFEHLGNQFSDLDKADWIFFNTFDKLENEEAKWLSSQWP--ITSIGPLIPSMYLDKQ  236

Query  799   VRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLA-NLKDEQMCEVAQGLIQSKC  623
             + +D   G++L+K +   C++WLD+++ GSVVY SFGS+  N  D+ M EVA GL+ SK 
Sbjct  237   LPNDKGNGINLYKADVGSCIKWLDAKDPGSVVYASFGSVKHNFGDDYMDEVAWGLLHSKY  296

Query  622   KFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALS  443
              F+WVV   E++KL S+F  +    G+I +WCPQL+VLSH+++G F+THCGWNST+EALS
Sbjct  297   NFIWVVIEPERTKLSSDFLAEAEEKGLIVSWCPQLEVLSHKSIGSFMTHCGWNSTVEALS  356

Query  442   LGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVML  263
             LGVP+VA+PQ  DQP NAKY+VDVW +G+RV  GE+G+V R EV  C+ +VM+GE G  L
Sbjct  357   LGVPMVAVPQQFDQPVNAKYIVDVWQIGVRVPIGEDGVVLRGEVANCIKDVMEGEIGDEL  416

Query  262   KENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             + NA KWK LA EA+++GGSSDKNI EF+S +
Sbjct  417   RGNALKWKGLAVEAMEKGGSSDKNIDEFISKL  448



>ref|XP_008235865.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Prunus mume]
Length=464

 Score =   417 bits (1073),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 220/457 (48%), Positives = 299/457 (65%), Gaps = 18/457 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ--------VSSSLIRV  1334
             +H LV   PI GHI PM+Q SKRL  +G+ VT+IT  S               S S I +
Sbjct  7     AHCLVFFCPIQGHINPMLQFSKRLEHKGLEVTLITTLSVHKATHEGGEEQSTTSFSSIAL  66

Query  1333  ESIPDGVKPDSG------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWV  1172
             E+I DG   + G        A  D ++++ S  LAE++ K++ SG     +VYD + PW 
Sbjct  67    ETISDGFDGEGGSAQAESVQAYRDRVREIGSQTLAELIDKLSASGHPADCLVYDPVFPWA  126

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP-TEGSTVSLPSMPPLGLNDLPSFV  995
              D+  ++G+ AAAF + SCAV  ++       L  P    S + LP +PPL  +D PSF+
Sbjct  127   LDVAKRVGIAAAAFVTVSCAVTNIFSLVHNGLLKLPLNPNSQILLPGLPPLQPSDTPSFI  186

Query  994   RNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLE-WMASQFPLKVIAIGPLLPS  818
                 SY + L+  +    N  KADW+  NTF ELE+EV+E WM   + L+ I  GP +PS
Sbjct  187   HVPESYPAFLKLSVDLFSNLCKADWVFCNTFYELEQEVIEYWMTKFWTLRTI--GPTIPS  244

Query  817   MYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGL  638
             MYLDKR  D++ YGLSL K N++ CM+WL+++  GSV Y+SFGSLA L +EQM E+  GL
Sbjct  245   MYLDKRHEDNNEYGLSLLKLNSDPCMKWLNAKPKGSVAYMSFGSLAELGEEQMEELGLGL  304

Query  637   IQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNST  458
              +SK  FLWVVR+SE  KLP  F  + S  G++ +WCPQL+VL+H+AVGCF+THCGWNST
Sbjct  305   RRSKRYFLWVVRTSESVKLPKGFAEETSEKGLVVSWCPQLEVLAHEAVGCFVTHCGWNST  364

Query  457   LEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGE  278
             LEALSLGVP+VA+PQW DQ TNAK+++DVW +G++  A E G+V  EE+  C+ E++ GE
Sbjct  365   LEALSLGVPMVAVPQWADQSTNAKFIMDVWKIGLKAQADEKGIVRGEEIAHCVREILDGE  424

Query  277   RGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             RG  +++NA+KWK LAK AVDEGGSSDKNI EF++ +
Sbjct  425   RGEEIRKNASKWKALAKNAVDEGGSSDKNIDEFIAKL  461



>ref|XP_008788244.1| PREDICTED: crocetin glucosyltransferase 2-like isoform X2 [Phoenix 
dactylifera]
Length=456

 Score =   417 bits (1072),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 217/455 (48%), Positives = 293/455 (64%), Gaps = 13/455 (3%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVE  1331
             M   S   HVLV+PYP  GHI PM+Q +KRL+SRG+  T+ T     +  +     + + 
Sbjct  1     MENGSHQPHVLVLPYPSQGHINPMLQFAKRLSSRGLLATLATTRFVLSTTRPEPGPVALA  60

Query  1330  SIPDGVKPDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVA  1169
             +I DG     GF      +A  D ++ + S  L E++     +G  +  +VYDS  PW  
Sbjct  61    TISDGFD-QGGFASADSIEAYLDRVESVGSATLDELIRSERAAGRPVRALVYDSFFPWAR  119

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN  989
             ++  + GL  AAF +Q C V  VY H ++  L  P     VSLP +P L  +D+PSFV  
Sbjct  120   EVGERRGLATAAFFTQPCGVNIVYGHVNERRLGIPVT-EPVSLPGLPRLEPDDMPSFVSQ  178

Query  988   KSS--YSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSM  815
               +  ++S L+ VL +  N  KAD +  N+F ELE E   +MAS +  +   +GP +PS 
Sbjct  179   ADAGLFASYLKLVLEQYKNLDKADAVFVNSFYELEPEEAGYMASTW--RATTMGPTVPSS  236

Query  814   YLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             YLD R+  D +YG  L+ P+ + CM+WLDS  + SVVYVSFGS+  L  EQM E+A GL+
Sbjct  237   YLDNRLPSDSHYGFDLYTPSVDLCMQWLDSLPSNSVVYVSFGSMTPLGPEQMAELAFGLL  296

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDKSGA-GIITNWCPQLDVLSHQAVGCFITHCGWNST  458
              S  +FLWVVRSSE SKLP NF  D S   G++ +W PQ+ VLSH+AVGCF+THCGWNST
Sbjct  297   GSGKRFLWVVRSSEASKLPENFAEDLSPERGLVVSWSPQMAVLSHEAVGCFLTHCGWNST  356

Query  457   LEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGE  278
             +E +SLGVP+V +PQWTDQPTNAKY+ DVW VG+R  AGE G+V REEVERC+  VM+GE
Sbjct  357   MEGISLGVPMVGVPQWTDQPTNAKYVEDVWRVGVRARAGERGLVGREEVERCVRVVMEGE  416

Query  277   RGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
             R   ++ N++KW++LAK+AV EGGSSD+NI EFV+
Sbjct  417   RSEEIRRNSSKWRELAKKAVAEGGSSDRNILEFVA  451



>ref|XP_002269003.2| PREDICTED: UDP-glycosyltransferase 74E2 [Vitis vinifera]
Length=456

 Score =   417 bits (1072),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 213/447 (48%), Positives = 284/447 (64%), Gaps = 9/447 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             SH +V+PYP  GHI PM+Q SKRL   G  VT++     S  +   S  I +E+I DG  
Sbjct  10    SHCIVLPYPSQGHINPMLQFSKRLVHNGAKVTLVPTCFISKSLLGDSGPITIETISDGYD  69

Query  1309  PDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              + GF       A  +  + + S  L  ++ K+  SGC +  VVYD+ +PW  D+  + G
Sbjct  70    -EGGFAQAESGGAYMERFRVVGSETLGSLIEKLKSSGCPVDCVVYDAFLPWALDVAKKFG  128

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             L  A F +QSC V  +Y+H  Q  LT P     V +P + PL   DLPS V    SY   
Sbjct  129   LVGAVFFTQSCTVNNIYYHVHQGMLTLPLSEPEVVVPGLFPLQACDLPSLVYLYGSYPDF  188

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
                ++++  N +K DW+  NTF +LE++V++WMA   PL+ I  GP LPS YLDKR+ DD
Sbjct  189   FNMLVNQFSNIEKVDWVFCNTFYKLEEKVVDWMAKICPLRTI--GPTLPSAYLDKRLGDD  246

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
              +YGL++ KP    CMEWLDS+  GSVVY S+GS A L+ EQM E+A GL +S   FL V
Sbjct  247   KDYGLNMLKPVTGACMEWLDSKPNGSVVYASYGSFAKLEPEQMEELAWGLRRSNAYFLMV  306

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             VR SEQ+KLP  F  + +  G++ +WCPQL+VL+H+A+GCF+TH GWNSTLEALSLGVP+
Sbjct  307   VRESEQAKLPQKFKEETAEKGLVVSWCPQLEVLAHRAIGCFLTHGGWNSTLEALSLGVPM  366

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             V  P W DQPTNAK++ DV  VG+R  A + G+V RE +E C+ +VM  +    +K NA 
Sbjct  367   VVAPLWIDQPTNAKFVEDVCGVGLRARADDKGIVRREVLEDCIGKVMGSDGLKEIKNNAL  426

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             KWK LA+EAVDEGGSSDK I EFV+ +
Sbjct  427   KWKNLAREAVDEGGSSDKCIDEFVAKL  453



>ref|XP_004245060.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Solanum lycopersicum]
Length=460

 Score =   417 bits (1071),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/443 (45%), Positives = 287/443 (65%), Gaps = 7/443 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKP  1307
             H+L +PYP  GHI PM+Q  KRL S+G+  T+      S+  + +S ++ ++++ DG   
Sbjct  12    HILALPYPSQGHINPMLQFCKRLVSKGLKTTLAITNFISSSTRPNSGIVGIDTVSDGFDK  71

Query  1306  DSGFDAIS-----DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLR  1142
                 DA S     +  + + S +LA+++ K   S   +T ++YD+ MPW  D+  + GL 
Sbjct  72    GGYADADSIAAYLERFEQIGSKSLADLIKKYEKSEFPITCIMYDAFMPWALDVAKKYGLI  131

Query  1141  AAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLR  962
              A F +Q+CAV  +Y++     LT P   + V +  +  L L D+PSF+    +Y +   
Sbjct  132   GACFFTQACAVNYIYYYIHHGKLTLPISSTNVKISGLSELELRDMPSFIYVHGTYPAYFE  191

Query  961   FVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDN  782
              VL++  N  KAD++  N+F +LE EV + M+   PL    IGP LPS Y+D RV +D  
Sbjct  192   MVLNQFTNVDKADYVFVNSFYKLEAEVADTMSKISPLS--TIGPTLPSFYMDNRVENDIE  249

Query  781   YGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVR  602
             YGL+LF  +++ C+ WL+++  GSVVY +FGS++   D+QM E+A+GL  S   FLWVV+
Sbjct  250   YGLNLFHVDSSTCINWLNTKPEGSVVYAAFGSMSTFDDKQMEEIAEGLKASSSYFLWVVK  309

Query  601   SSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVA  422
              SEQSK+P     + S  G+I NW PQL VLS++A+GCF +H GWNST+EALS GVP+V 
Sbjct  310   ISEQSKIPKKIINENSEKGLIINWSPQLQVLSNKAIGCFFSHGGWNSTVEALSFGVPMVV  369

Query  421   MPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKW  242
             MPQWTDQ TNAK++ DVW VG+RV   ENG+V REE+E C+  V++GE G  +K+NA KW
Sbjct  370   MPQWTDQTTNAKFVQDVWSVGVRVKVNENGIVGREEIEECVRTVLQGEEGKEMKKNALKW  429

Query  241   KQLAKEAVDEGGSSDKNIKEFVS  173
             K LAKEAV EGG+SDKN+++FVS
Sbjct  430   KDLAKEAVQEGGTSDKNVEDFVS  452



>ref|XP_004489724.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Cicer arietinum]
 gb|AGU14099.1| UDP-glycosyltransferase [Cicer arietinum]
Length=458

 Score =   416 bits (1070),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 211/450 (47%), Positives = 290/450 (64%), Gaps = 11/450 (2%)
 Frame = -3

Query  1492  VSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS--SSLIRVESIPD  1319
             V H L++PYP  GH+ PM+Q S RL  + V VT+IT  S    I     SS I+VE+I D
Sbjct  9     VPHCLILPYPAQGHMNPMIQFSNRLIQKQVKVTLITVVSLWKTITNKNLSSNIQVETISD  68

Query  1318  GVKPDSGFDA---ISDWLK---DLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             G   D GF++   + D+ +    + S  L++++ K+  S      V++D+ +PWV D+  
Sbjct  69    GYD-DGGFESAKTVEDYKQTFWSVGSKTLSQLLHKLASSNNPPNCVIFDAFLPWVLDVSK  127

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSY  977
               GL   AF +QSC+V ++Y+HT Q+ +  P   S   LP +P L  +DLPSF+    SY
Sbjct  128   TFGLLGVAFFTQSCSVNSIYYHTHQKLIELPLSKSDYLLPGLPKLHQSDLPSFLYKYGSY  187

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
                   V+++  N  KADW+L NT  ELE EV++W+   +PLK   IGP +PSM LDKR+
Sbjct  188   PGYFDIVVNQFANIGKADWILANTIYELEPEVVDWLVKIWPLK--TIGPSVPSMLLDKRL  245

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
             +DD  YG+S+  PN   C++WL+ +  GSVVYVSFGS+A L ++Q  E+A GL  S   F
Sbjct  246   KDDKEYGVSISNPNTEVCIKWLNEKPKGSVVYVSFGSMAGLSEDQTIELAYGLKDSDTFF  305

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             LWVVR  EQ KLP  F       G+I  WCPQL VL+H+++GCF+THCGWNSTLEALSLG
Sbjct  306   LWVVRDCEQVKLPKGFVESSLEKGLIVTWCPQLQVLTHESLGCFVTHCGWNSTLEALSLG  365

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             V V+AMP WTDQ TNAK + DVW  G++  A E  +V RE V+ C+ E+++ E+G  LK+
Sbjct  366   VVVIAMPLWTDQVTNAKLIADVWKTGVKAFADEKEIVRRETVKNCIKEIIETEKGNELKK  425

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA KW  +AK++VDEGG SD+NI EFV+ +
Sbjct  426   NAMKWMSIAKDSVDEGGRSDQNIAEFVAVL  455



>ref|XP_010069228.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Eucalyptus grandis]
 gb|KCW57506.1| hypothetical protein EUGRSUZ_H00279 [Eucalyptus grandis]
Length=469

 Score =   417 bits (1071),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 220/459 (48%), Positives = 297/459 (65%), Gaps = 23/459 (5%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS-LIRVESIPDGVK  1310
             HVL++PYP  GHI PM+Q SKRLAS+G+  T  T       ++  +S L+ +++I DG  
Sbjct  10    HVLLVPYPSQGHINPMLQFSKRLASKGLKATFATTVFIFNSMKADTSPLVGLDTISDGY-  68

Query  1309  PDSGFDAISDWLKDLV-------SNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
              DSG  A ++ +   +       S  L++++ K   +   +  +VYDSI+PW  D+  + 
Sbjct  69    -DSGGFAEAESIHTYITRLEAAGSKTLSDLIVKYQSTDHPVDCIVYDSILPWALDVAKEF  127

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             GL  A F +Q+CAV  +Y+     +L  P E   V +P +PPL L D+PSF+    SY +
Sbjct  128   GLVGAPFFTQACAVNYIYYLVHHGHLRVPVESLPVCMPGLPPLELRDMPSFIYVAGSYPA  187

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
                 VL + LNT KADW+L NTF ELE EV++ M+   P  V  IGP +PSMYLDKRV D
Sbjct  188   YFEMVLHQFLNTDKADWVLVNTFYELEAEVVDTMSKLCP--VSTIGPTIPSMYLDKRVED  245

Query  790   DDNYGLSLFKPNNNDCM-EWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             D  YGL+LF  + +  + +WL S+   SVVYVSFGSL++L   QM E+A GL QS  +FL
Sbjct  246   DIEYGLNLFTLDKSTLITDWLRSKPPSSVVYVSFGSLSSLGRIQMEELAWGLKQSGFQFL  305

Query  613   WVVRSSEQSKLPSNFWP----------DKSGAGIITNWCPQLDVLSHQAVGCFITHCGWN  464
             WVVR+SE+ K+P +             +KS   +I NWCPQL+VLS++A+GCF THCGWN
Sbjct  306   WVVRASEEDKVPKHMLKLEADDGADHDEKSEKSLIVNWCPQLEVLSNEAIGCFFTHCGWN  365

Query  463   STLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK  284
             ST+EALS+GVP+V MPQWTDQ T+AK + DVW+VG+RV   E+G+V R E+E C+ EVM 
Sbjct  366   STVEALSVGVPMVGMPQWTDQTTDAKLIQDVWEVGVRVRVDEDGVVRRGEIEGCIREVMD  425

Query  283   GERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              ERG  ++ NA KWK L +EA+ EGGSSDKNI  FVS I
Sbjct  426   SERGKEMRRNARKWKALGREAMIEGGSSDKNIDAFVSKI  464



>ref|XP_010101352.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
 gb|EXB88299.1| UDP-glycosyltransferase 74E2 [Morus notabilis]
Length=649

 Score =   422 bits (1085),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 211/426 (50%), Positives = 293/426 (69%), Gaps = 7/426 (2%)
 Frame = -3

Query  1435  QLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKPDSGFDAISDWLKD---L  1265
             + +KRL S+G+ +T++T    +  IQ  +  I +E+I D  + D        +LK+   L
Sbjct  221   EFAKRLVSKGLKITLVTAFINAESIQARAGEIEIENISDTTEVDRDVSNAEAFLKEFHEL  280

Query  1264  VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTD  1085
             VS  L +++ K+  +G     ++YDS+ P   D+  QLGL  A F +QSCAV  ++++  
Sbjct  281   VSLKLPQVIEKLKYTGNPAGYLIYDSVAPQALDIAKQLGLPGAPFFTQSCAVNVLFYNMP  340

Query  1084  QENLTAPTEGST--VSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLF  911
             Q  L  P E     +S+  +P L L DLPSFV +  SY SLL  + ++  N ++AD + F
Sbjct  341   QGLLRVPVEDKEPPMSMTGLPQLELFDLPSFVYDMVSYPSLLANLANQFSNFREADCIFF  400

Query  910   NTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWL  731
             NTF+ LE+EV+ W ASQ+P+K   IGP +PSMYLDKR++DD +YGLSLFKP    C +WL
Sbjct  401   NTFESLEEEVVSWAASQWPVK--NIGPTIPSMYLDKRLQDDKDYGLSLFKPEAETCRKWL  458

Query  730   DSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSG  551
             DS++  SVVYV+FGSLA L ++QM  +A+GL +S   FLWVVR +E  KLPSNF      
Sbjct  459   DSKDDKSVVYVAFGSLAALGEDQMEAIARGLKRSNRHFLWVVRETELKKLPSNFMEGTVE  518

Query  550   AGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDV  371
              G++  W  QL+VL+H+AVGCF+THC WNST EALSLGVP+VA+PQW+DQPTNAK+++DV
Sbjct  519   KGLVVTWSHQLEVLAHKAVGCFVTHCSWNSTTEALSLGVPMVAIPQWSDQPTNAKFVMDV  578

Query  370   WDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKN  191
             W VG+R    + G++T EE+E C+ EVM+GERG+ +K N+ KWKQLAK AVDEGGSSDKN
Sbjct  579   WRVGLRAKVDQRGLITSEEIELCIREVMEGERGLEIKRNSEKWKQLAKAAVDEGGSSDKN  638

Query  190   IKEFVS  173
             I++FV+
Sbjct  639   IEDFVA  644


 Score =   135 bits (340),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/223 (35%), Positives = 119/223 (53%), Gaps = 16/223 (7%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL---------IR  1337
             +H+LVIPYP+ GHI PM+Q SKRLAS+   +  IT  +T +   +  S          + 
Sbjct  10    THILVIPYPVQGHINPMLQFSKRLASKNRRLIRITLLATESISNIQDSSSSSSDHISNVH  69

Query  1336  VESIPDGVK----PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVA  1169
             + ++PD  K         DA    LK  VS++L +I+ K          V+YDSI+ W  
Sbjct  70    IHNLPDPPKELHEKFGNIDAYLHHLKAAVSHSLPDIIHKNRDET---EVVIYDSILTWAL  126

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN  989
             D+  +  L+AA F +QSC+  A+Y+H  Q  ++ P     VSLPS+P   +ND+PSF+  
Sbjct  127   DVAREFDLQAAPFFTQSCSNLAIYYHLYQATISIPLLEPAVSLPSLPRFQINDMPSFISV  186

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQ  860
               SY  +L+ +     +  +  W+  NTFD LE+E  + + S+
Sbjct  187   PGSYPDILKTIFDGFPHFHQVKWIFCNTFDMLEEEFAKRLVSK  229



>ref|XP_010069229.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74F2-like 
[Eucalyptus grandis]
Length=469

 Score =   416 bits (1069),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 218/458 (48%), Positives = 297/458 (65%), Gaps = 21/458 (5%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS-LIRVESIPDGVK  1310
             HVL++PYP  GHI PM+Q SKRLAS+G+  T+ T       ++  +S L+ +++I DG  
Sbjct  10    HVLLVPYPSQGHINPMLQFSKRLASKGLKATLATTVFIFNSMKPDTSPLVGLDTISDG-H  68

Query  1309  PDSGF---DAISDWLKDLV---SNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
                GF   ++I  ++  L    S  L++++ K   +   +  +VYDS +PW  D+    G
Sbjct  69    DSGGFTEAESIHTYIARLEAAGSKTLSDLIIKYQSTDHPVDCIVYDSFLPWALDVAKGFG  128

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             L  A F +Q CAV  +Y+     +L  P E   V +P +PPL L D+PSF+    SY + 
Sbjct  129   LIGAPFFTQXCAVNYIYYLVHHGHLKVPVESFPVCVPGLPPLELRDMPSFIYVAGSYPAY  188

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
                VL + LNT KADW+L NTF ELE EV++ M+   P  V  IGP +PSMYLDKRV +D
Sbjct  189   FEMVLHQFLNTDKADWVLVNTFYELEAEVVDTMSKLCP--VTTIGPTIPSMYLDKRVEND  246

Query  787   DNYGLSLFKPNNNDCM-EWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
               YGL+LF  + +  + +WL S+   SVVYVSFGS+++L  +QM E+A GL QS  +FLW
Sbjct  247   IEYGLNLFTLDKSTLITDWLRSKPPSSVVYVSFGSMSSLGHQQMEELAWGLKQSGFQFLW  306

Query  610   VVRSSEQSKLPSNFWP----------DKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNS  461
             VVR+SE+ K+P +             +KS  G+I NWCPQL+VLS++A+GCF THCGWNS
Sbjct  307   VVRASEEDKVPKHILKLEADDEADHKEKSKKGLIVNWCPQLEVLSNEAIGCFFTHCGWNS  366

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             T+EALS+GVP+V MPQWTDQ T+AK + DVW VG+RV   E+G+V R E+E C+ EVM  
Sbjct  367   TVEALSVGVPMVGMPQWTDQTTDAKLIQDVWKVGVRVRVDEDGVVRRGEIEGCIREVMDS  426

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ERG  ++ NA KWK L +EA+ EGGSSDKNI  FVS+I
Sbjct  427   ERGKEMRRNAKKWKALGREAMSEGGSSDKNIDAFVSSI  464



>ref|XP_009599369.1| PREDICTED: LOW QUALITY PROTEIN: UDP-glycosyltransferase 74F2-like 
[Nicotiana tomentosiformis]
Length=456

 Score =   414 bits (1065),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 199/445 (45%), Positives = 295/445 (66%), Gaps = 9/445 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H+L +PYP  GHI PM+Q  KRL S+G+  T+      S  +++ S+++ +++I DG  
Sbjct  11    AHILALPYPSQGHINPMLQFCKRLVSKGLKTTLAITNFLSHSVRLISNMVGIDTISDGFD  70

Query  1309  PDSGF---DAISDWL---KDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLG  1148
              + G+   D++  +L   K + S  LA+++ K   S   +T V+YDS MPW  D+    G
Sbjct  71    -EGGYAEADSVVTYLERFKKIGSQTLADLIKKYEKSEFPITCVIYDSFMPWALDVAKDHG  129

Query  1147  LRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             L  A F +Q+CAV  +Y++     LT P     V +  +P L L D+PSF+    +Y + 
Sbjct  130   LIGACFFTQACAVNYIYYYVHHGKLTLPISSPPVRILGLPELELRDMPSFIYVHGTYPAY  189

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
                VL++ +N  KAD++  N+F +LE EV++ M+   PL    IGP +PS+YLD R  +D
Sbjct  190   FELVLNQFINGDKADYVFVNSFYKLEAEVVDTMSKVTPLS--TIGPTVPSLYLDNRAEND  247

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
               YGL L++ + + C+ WL+++  GSVVYV+FGS++ L ++QM E+A GL  + C FLWV
Sbjct  248   IEYGLXLYQVDASTCINWLNTKAEGSVVYVAFGSMSTLDEKQMKEIAWGLKATNCYFLWV  307

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             VR+S+++K+P +F  + S  G++ NW PQL VLS++A+GCF +H GWNST EALS GVP+
Sbjct  308   VRTSDEAKIPKSFIEETSEKGLVINWSPQLQVLSNKAIGCFFSHGGWNSTTEALSFGVPM  367

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             V MP WTDQ TNAK + DVW VG+RV   E G+V REE+E+C+  V++ ++G  +K+NA 
Sbjct  368   VVMPLWTDQTTNAKLVQDVWSVGVRVNVNEKGLVGREEIEKCVRTVIEEDKGKEMKKNAL  427

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVS  173
             KWK LAKEAV+EGG+SDKNI+EFVS
Sbjct  428   KWKDLAKEAVNEGGTSDKNIEEFVS  452



>ref|XP_007208259.1| hypothetical protein PRUPE_ppa016486mg, partial [Prunus persica]
 gb|EMJ09458.1| hypothetical protein PRUPE_ppa016486mg, partial [Prunus persica]
Length=448

 Score =   414 bits (1063),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 208/455 (46%), Positives = 298/455 (65%), Gaps = 25/455 (5%)
 Frame = -3

Query  1498  STVSHVLVIPYPIH-GHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS----LIRV  1334
             S  +H LV+P+P   GHI PM+Q SK L  +GV +T++T       I   SS       +
Sbjct  2     SYKAHCLVLPFPTQQGHINPMLQFSKLLNQKGVKITLVTTIFDYNTIMEKSSGSDSYNAL  61

Query  1333  ESIPD-----GVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGC-LLTTVVYDSIMPWV  1172
             E+I D     G++     +A  + L  + S  LA+++ K++ SGC ++  +VYD+ + W 
Sbjct  62    ETISDCYDQGGIRHAQSVEAYLESLCQVGSQTLAQLLVKLSSSGCPVIDCIVYDAFLHWP  121

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR  992
              D+ ++ G+  A F +QSCAV  + +H  +  L  P   S + LP +P L  +D+PS+V 
Sbjct  122   LDVANKFGIFGAIFFTQSCAVNNILYHVYKGELKLPLSQSQILLPGLPRLVPSDMPSYVY  181

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
                +Y ++ + ++ +  N +KADW            V++WMA+  PLK I  GP +PS Y
Sbjct  182   ELGTYPAVYKMLVGQFPNVEKADW------------VVDWMATFLPLKTI--GPTIPSHY  227

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LDKR+ DD  YG+SLF  NN+ CM+WL+ Q  GSV YV+FGS A L  EQM E+A GL +
Sbjct  228   LDKRLEDDKQYGVSLFNTNNDACMKWLNEQPKGSVAYVAFGSAAQLGVEQMEELAWGLRR  287

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             SK KFLWVVR +E +KLP  F  + S  G++ +WCPQL+VL+++AVGCFI+HCGWNSTLE
Sbjct  288   SKSKFLWVVREAEAAKLPKGFVEETSEKGLVVSWCPQLEVLANEAVGCFISHCGWNSTLE  347

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             A SLGVPVVA+PQWTDQ TNAK+++DVW +G++ +A E G+V +EEVE C+ E+M+GERG
Sbjct  348   AFSLGVPVVALPQWTDQSTNAKFIMDVWKIGVKALADEKGVVRQEEVEHCISEIMEGERG  407

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               ++  A +WK+LA++AVDEGGSS  NI EF+S +
Sbjct  408   KEMQRKALEWKELARKAVDEGGSSSNNIDEFISKL  442



>ref|XP_002532443.1| UDP-glucosyltransferase, putative [Ricinus communis]
 gb|EEF29929.1| UDP-glucosyltransferase, putative [Ricinus communis]
Length=406

 Score =   411 bits (1057),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 198/397 (50%), Positives = 271/397 (68%), Gaps = 7/397 (2%)
 Frame = -3

Query  1342  IRVESIPDGVKPDSGFDAIS-----DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMP  1178
             I +E+I DG        A S       L+ + + +LA ++ K+  S C +T ++YD  MP
Sbjct  9     IDIETISDGFDEGGSAQAESIEVYLSTLRIVGAKSLANLIKKLNESDCPVTAIIYDGFMP  68

Query  1177  WVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSF  998
             W  D+  Q G+ A AF +Q+CAV   Y+H  +  L  P    TVSLP +P L +++LPS 
Sbjct  69    WALDVAKQYGILAVAFLTQACAVNNAYYHVQRSFLPVPVSSPTVSLPGLPMLQVSELPSL  128

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
             + +  SY      ++ +  N   ADW+L NTF  LE+EV++WMA  + L    IGP +PS
Sbjct  129   ISDCGSYPGFRYLLVDQFRNIDGADWVLCNTFYRLEEEVVDWMAKSWRLG--TIGPTVPS  186

Query  817   MYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGL  638
              YLDKR+ DD +YG++LFKP+++ CM WL ++ + SVVYVSFGS+  L  EQ+ E+A GL
Sbjct  187   RYLDKRLEDDKDYGINLFKPDSSTCMNWLKTKPSSSVVYVSFGSMVELGTEQIEELALGL  246

Query  637   IQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNST  458
               S C FLWVVR+SE+SKLP NF  + S  G++ +WCPQL++L+ + +GCF+THCG+NS 
Sbjct  247   KGSNCYFLWVVRTSERSKLPENFIEETSEKGLVVSWCPQLEILAQEVIGCFVTHCGFNSI  306

Query  457   LEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGE  278
             LEALSLGVP+VAMPQWTDQPTNAKY+ DVW VGIR    E G+V RE VE C+ EVM+G+
Sbjct  307   LEALSLGVPIVAMPQWTDQPTNAKYVEDVWKVGIRARRNEKGIVRRETVELCIREVMEGQ  366

Query  277   RGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +G  +K+NA KWK+LAKEA+DEGG+SDKNI E V+ +
Sbjct  367   KGKEIKKNANKWKELAKEAIDEGGTSDKNIDELVTKL  403



>ref|XP_009765329.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Nicotiana sylvestris]
Length=453

 Score =   413 bits (1062),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 224/457 (49%), Positives = 302/457 (66%), Gaps = 19/457 (4%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTST-SACIQVSSSLIRV  1334
             M E+++ +HVLV+P P+ GHI P+VQ SK LAS+ V VT++T      A +     LI +
Sbjct  1     MEEINSKTHVLVLPCPVQGHINPIVQFSKILASKEVKVTILTIDFVCKAMLLDCGPLINI  60

Query  1333  ESIPDGVKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQ  1154
             ESIP    P  G +   +W + L+    + I+ K   S   +  VV DSI+ W+ DL H+
Sbjct  61    ESIPHEAIP-VGLENFLEWFQTLMLEKFSGIVEKFGDSEYPVKVVVIDSIISWIIDLAHE  119

Query  1153  LGLRAAAFNSQSCAVFAVYHHTDQENLT--APTEGST-VSLPSMPPLGLNDLPSFVRNKS  983
             LGL+ AA ++Q  A+  +Y+H DQE+ T   P E S  VSL S+P L   DLPSF+    
Sbjct  120   LGLKVAALHTQPVALSVLYYHIDQEDSTNKIPFECSVPVSLSSLPLLEKEDLPSFICETH  179

Query  982   SYSSLLRFVLSRNLNTQKADWLLFNTFD------ELEKEVLEWMASQFPLKVIAIGPLLP  821
             +Y  + R    +N N +KADWL    FD        EK V+ W+ +Q+ +K   IGP++ 
Sbjct  180   AYPIVKRLAFGQNFNFKKADWLYMTVFDWSRIKFNKEKRVVNWLRTQYSIK--TIGPVVL  237

Query  820   SMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQG  641
             S+YLDK       Y  SL KP+   C +WLDS+E GSV+YVSFGSL +L+++QM E+A G
Sbjct  238   SIYLDKE------YDSSLTKPHYETCKKWLDSREIGSVIYVSFGSLVSLREKQMEELAFG  291

Query  640   LIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNS  461
             LI S   FLWVVR +E++KLP+ F    S  G+I +W PQLDVL+H+++GCF THCGWNS
Sbjct  292   LIMSNSYFLWVVRDTEENKLPNEFKSKASEKGLIVDWSPQLDVLAHKSIGCFFTHCGWNS  351

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             TLEAL LGVP+V MPQW DQPTNAK++ D+W  GIRV AG++G++TREE+   + EVM  
Sbjct  352   TLEALILGVPMVCMPQWVDQPTNAKFISDIWRTGIRVKAGKDGVITREEIASSIKEVMVE  411

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSA  170
             ++GVMLKENA KWK LAKEA+D+GGSS KNI+EF+ A
Sbjct  412   KKGVMLKENAIKWKILAKEAIDKGGSSYKNIEEFIEA  448



>emb|CDP03994.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   413 bits (1061),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 204/455 (45%), Positives = 291/455 (64%), Gaps = 10/455 (2%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL-IRV  1334
             M   S+  HVL +P P+ GHI P++Q  KRL ++GV VT     S S  +       I  
Sbjct  1     MTMASSKVHVLALPLPVQGHINPLLQFCKRLEAKGVKVTFANTVSLSKSMHADPKRSINF  60

Query  1333  ESIPDGVKPDSG------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWV  1172
             E+I DG   D G      F+A  +    + S  LA++++K+   G  +  V+YD  + W 
Sbjct  61    ETISDGYD-DGGYAAAESFEAYVEKFATVGSKTLADLITKLEDDGEPVQAVIYDPHLTWA  119

Query  1171  ADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR  992
              D+  + GL  AAF +Q+CAV ++Y+H     L  P   S +SLP +P L   + PSF+ 
Sbjct  120   LDVAKRFGLVTAAFFTQTCAVNSIYYHVYHGLLPVPLSDSPISLPGLPLLQPKETPSFIY  179

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
                SY      ++++  N  +ADW++ + F +LE++ + WMA  +  +V  +GP +PSMY
Sbjct  180   LPDSYPDFRHILVNQFSNVDQADWVILSNFHKLEEDAVNWMARLW--RVKTVGPTVPSMY  237

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LDKR+ DD  YG++LFKP+++ C+ WLD+Q   SVVYV+FGS   ++ EQ+ E+A  L++
Sbjct  238   LDKRLEDDTGYGINLFKPDSSLCINWLDNQPKDSVVYVAFGSWIGIEAEQVEEIASALME  297

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
                +FLWVVR+ E+ KLPSNF  + S  G++  W PQL+VL+H++V CF+THCG NS +E
Sbjct  298   IGFRFLWVVRALEKEKLPSNFVDETSERGLVVTWSPQLEVLAHESVACFVTHCGLNSVME  357

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERG  272
             ALSLGVPVVA PQ  DQPTNAK++ DVW VG+R  A E G+V RE +  C+ E+M+GERG
Sbjct  358   ALSLGVPVVAAPQLADQPTNAKFIEDVWGVGVRAAADEKGIVRRETLVSCIREIMEGERG  417

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +KEN  KWK LAKEA+DEGGSSD+NI EFV+ +
Sbjct  418   KRIKENGIKWKTLAKEAIDEGGSSDRNIDEFVAEL  452



>ref|XP_008788243.1| PREDICTED: crocetin glucosyltransferase 2-like isoform X1 [Phoenix 
dactylifera]
Length=457

 Score =   412 bits (1060),  Expect = 8e-135, Method: Compositional matrix adjust.
 Identities = 217/456 (48%), Positives = 293/456 (64%), Gaps = 14/456 (3%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVE  1331
             M   S   HVLV+PYP  GHI PM+Q +KRL+SRG+  T+ T     +  +     + + 
Sbjct  1     MENGSHQPHVLVLPYPSQGHINPMLQFAKRLSSRGLLATLATTRFVLSTTRPEPGPVALA  60

Query  1330  SIPDGVKPDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVA  1169
             +I DG     GF      +A  D ++ + S  L E++     +G  +  +VYDS  PW  
Sbjct  61    TISDGFD-QGGFASADSIEAYLDRVESVGSATLDELIRSERAAGRPVRALVYDSFFPWAR  119

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN  989
             ++  + GL  AAF +Q C V  VY H ++  L  P     VSLP +P L  +D+PSFV  
Sbjct  120   EVGERRGLATAAFFTQPCGVNIVYGHVNERRLGIPVT-EPVSLPGLPRLEPDDMPSFVSQ  178

Query  988   KSS--YSSLLRFVLSRNLNTQKADWLLFNTFDELEKEV-LEWMASQFPLKVIAIGPLLPS  818
               +  ++S L+ VL +  N  KAD +  N+F ELE E    +MAS +  +   +GP +PS
Sbjct  179   ADAGLFASYLKLVLEQYKNLDKADAVFVNSFYELEPEQEAGYMASTW--RATTMGPTVPS  236

Query  817   MYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGL  638
              YLD R+  D +YG  L+ P+ + CM+WLDS  + SVVYVSFGS+  L  EQM E+A GL
Sbjct  237   SYLDNRLPSDSHYGFDLYTPSVDLCMQWLDSLPSNSVVYVSFGSMTPLGPEQMAELAFGL  296

Query  637   IQSKCKFLWVVRSSEQSKLPSNFWPDKSGA-GIITNWCPQLDVLSHQAVGCFITHCGWNS  461
             + S  +FLWVVRSSE SKLP NF  D S   G++ +W PQ+ VLSH+AVGCF+THCGWNS
Sbjct  297   LGSGKRFLWVVRSSEASKLPENFAEDLSPERGLVVSWSPQMAVLSHEAVGCFLTHCGWNS  356

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             T+E +SLGVP+V +PQWTDQPTNAKY+ DVW VG+R  AGE G+V REEVERC+  VM+G
Sbjct  357   TMEGISLGVPMVGVPQWTDQPTNAKYVEDVWRVGVRARAGERGLVGREEVERCVRVVMEG  416

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
             ER   ++ N++KW++LAK+AV EGGSSD+NI EFV+
Sbjct  417   ERSEEIRRNSSKWRELAKKAVAEGGSSDRNILEFVA  452



>ref|XP_010908661.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Elaeis guineensis]
Length=461

 Score =   412 bits (1059),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 203/450 (45%), Positives = 301/450 (67%), Gaps = 7/450 (2%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIP  1322
             M+  +HVLV+PYP  GHI PM+Q +K L+ RG+  T++   +T+  +    S + +E+I 
Sbjct  1     MACKAHVLVLPYPRQGHINPMLQFAKLLSHRGLKTTLVLTVATTKSMHGELSSVGIETIS  60

Query  1321  DGV-----KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             DG      K     +AI   L+ + S  LAE++ ++ GSG  ++ +VYD+++PW  D+  
Sbjct  61    DGYDDEHEKEKDTTEAILQRLRAVGSRTLAELIERMKGSGHPVSCIVYDAVLPWPLDVAR  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSY  977
             +LG+  AAF +Q C V AVY+H  + +L  P  GST  L  +P +G +D+PSFV      
Sbjct  121   ELGVLGAAFLTQPCIVDAVYYHVYRGSLAVPLVGSTFRLTGLPEIGASDMPSFVSVPGYS  180

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
              + L+ ++++  N + ADW+L NTF ELE EV+ WMA+  P+K  AIGP++PS  +++ +
Sbjct  181   PTHLKILVNQFSNMETADWVLCNTFQELENEVINWMANYMPMK--AIGPMVPSTCINEHL  238

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
               D NYG+ L+K N   CM WLD +E  SVVYVSFGS++ +  EQM E+A GL +S   F
Sbjct  239   DGDKNYGVDLWKANGGVCMNWLDKREPQSVVYVSFGSISKVGSEQMEELAWGLSKSSYYF  298

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             L VVR+ E+ KLP+ F  +    G++  WCPQ +VL+H+A+GCF+THCGWNSTLEA+SL 
Sbjct  299   LLVVRTVEEDKLPTKFMEETKEKGLVVPWCPQPEVLAHKAIGCFVTHCGWNSTLEAISLS  358

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP+VA+PQWTDQPTNAK + D+W VG+R    E+G+V R+E+E C+  VM+GE+ + +  
Sbjct  359   VPMVAVPQWTDQPTNAKCVEDIWRVGVRARVDESGIVRRDEIEGCIKMVMEGEKAIEING  418

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA KW++LA +A+ E G S+KNI +FV+ +
Sbjct  419   NARKWRELAVKALMEDGPSNKNINDFVARV  448



>ref|XP_007201692.1| hypothetical protein PRUPE_ppa016444mg [Prunus persica]
 gb|EMJ02891.1| hypothetical protein PRUPE_ppa016444mg [Prunus persica]
Length=464

 Score =   412 bits (1058),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 216/461 (47%), Positives = 296/461 (64%), Gaps = 16/461 (3%)
 Frame = -3

Query  1504  EMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ--------VSS  1349
             E +  +H LV   PI GHI PM+Q SKRL  +G+ VT+IT  S    +          S 
Sbjct  2     EKTEKAHCLVFFCPIQGHINPMLQFSKRLEHKGLKVTLITTRSVHKAMHEGGGEQSTTSF  61

Query  1348  SLIRVESIPDGVKPDSG------FDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDS  1187
             S I +E+I DG   + G        A  D ++++ S  LAE++ K++ SG     +VYD 
Sbjct  62    SSIALETISDGFDGEGGSAQAESIQAYRDRVREIGSQTLAELIDKLSASGHPADCLVYDP  121

Query  1186  IMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP-TEGSTVSLPSMPPLGLND  1010
             + PW  D+  ++G+ AAAF + SCAV  +Y       L  P    S + LP +PPL  +D
Sbjct  122   VFPWALDVAKRVGIAAAAFFTVSCAVTNIYSLVHNGLLKLPLNPDSEILLPGLPPLQPSD  181

Query  1009  LPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGP  830
              PSF+    SY   L+  +    N  KADW+  NTF ELE+EV+E+  ++F      IGP
Sbjct  182   TPSFIYVPESYPDFLKLSVDLFSNLCKADWVFCNTFYELEQEVIEYWTTKF-WTFRTIGP  240

Query  829   LLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEV  650
              +PSMYLDKR  D+  YGLSL K  ++ CM+WL+++  GSV Y+SFGS+A   +EQM E+
Sbjct  241   TIPSMYLDKRHEDNKEYGLSLLKLKSDACMKWLNAKPKGSVAYMSFGSMAEQGEEQMEEL  300

Query  649   AQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCG  470
               GL +SK  FLWVVR+SE  KLP  F  + S  G++ +WCPQL+VL+H+AVGCF+THCG
Sbjct  301   GLGLKRSKRYFLWVVRTSESVKLPKGFAEETSEKGLVVSWCPQLEVLAHEAVGCFVTHCG  360

Query  469   WNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEV  290
             WNSTLEALSLGVP+VA+PQW DQ TNAK+++DVW +G++  A E G+V  EE+  C+ E+
Sbjct  361   WNSTLEALSLGVPMVAVPQWADQSTNAKFIMDVWKIGLKAQADEKGIVRGEEIANCVREI  420

Query  289   MKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             + GERG  +++NA+ WK LAK AVDEGGSSDKNI EF++ +
Sbjct  421   LDGERGKEIRKNASNWKALAKSAVDEGGSSDKNIDEFIAKL  461



>gb|AGI44003.1| UDP-glucose glucosyltransferase [Rhodiola crenulata]
 gb|AGI44004.1| UDP-glucose glucosyltransferase [Rhodiola crenulata]
Length=450

 Score =   410 bits (1055),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 205/451 (45%), Positives = 296/451 (66%), Gaps = 17/451 (4%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGV--TVITPTSTSACIQVSSSLIRVESIPDG  1316
             +H+L++PYP  GHI PM+Q +KRLAS+      T++ PTS +  I      I ++ I DG
Sbjct  6     THILILPYPSQGHINPMLQFAKRLASKSDNFIFTLLLPTSQTKSITPRIGSINIQPISDG  65

Query  1315  VKPDSGFDAISDWLKDL---VSNNLAEIMSKVTGSGCLL--TTVVYDSIMPWVADLVHQL  1151
                   F++   + +     V  +L E++ +    G       ++YDS +PW  D+ H  
Sbjct  66    ALEGQNFESAEAYFRQFRSVVPGSLDELIRREFDRGDEFQPKVIIYDSFLPWALDVAHGN  125

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             GL  A F +Q C+V ++Y    +  L+     S+  L  +P L   DLPSF+R+K S S 
Sbjct  126   GLDGAPFFTQFCSVSSLYFLYKEGKLS-----SSELLYGLPRLEPRDLPSFIRDKESSSC  180

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
             LL  ++ +  N  KA+++ FNTFD+LE +++EWM+SQ+P  V+ +GP +PSMYLDK + D
Sbjct  181   LLEMLVDQFSNLDKAEYVFFNTFDKLESQMVEWMSSQWP--VLTVGPTIPSMYLDKYIED  238

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D +YGL+LFKPN   C +WL  +++GSV+YVSFGS+A L+ +Q+CE+AQ L   +  F+W
Sbjct  239   DTSYGLNLFKPNRQTCQDWLSERKSGSVIYVSFGSMAILEQDQVCEIAQCLENLQTHFIW  298

Query  610   VVRSSEQSKLPSNF--WPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             VVR +E +KLP+ F  W  +SG G++  WC QLDVL+H+AVGCF+THCGWNSTLEAL  G
Sbjct  299   VVRETEMTKLPTEFVEWNLRSGLGLVVTWCNQLDVLAHEAVGCFVTHCGWNSTLEALCFG  358

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM-KGERGVMLK  260
             VP+V MP W+DQPTNAK++ DVW VG+R M  ENG+VT  E+E+C+  V+ KGE+G  ++
Sbjct  359   VPMVGMPNWSDQPTNAKFVEDVWGVGVRTMEDENGIVTGLELEKCVRAVLEKGEKGDEIR  418

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              NA K K  A +A++  GSSD NI +FVS +
Sbjct  419   RNAEKMKDWALKAIEIDGSSDCNIVKFVSGL  449



>ref|XP_006351615.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Solanum tuberosum]
Length=461

 Score =   410 bits (1055),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 195/443 (44%), Positives = 285/443 (64%), Gaps = 7/443 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKP  1307
             H+L +PYP  GHI PM+Q  KRL S+G+  T+      S     +  ++ ++++ DG   
Sbjct  12    HILALPYPSQGHINPMLQFCKRLVSKGLKTTLAITNFISNSTHPNLGIVSIDTVSDGFDK  71

Query  1306  DSGFDAIS-----DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLR  1142
                 DA S     +  + + S +LA+++ K   S   +T ++YD+ +PW  D+  + GL 
Sbjct  72    GGYADADSVAAYLERFEQIGSKSLADLIKKYEKSELPITCIMYDAFVPWALDVAKKHGLI  131

Query  1141  AAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLR  962
              A F +Q+CAV  +Y++     LT P   + V +  +P L L D+PSF     +Y +   
Sbjct  132   GACFFTQACAVNYIYYYVHHGKLTLPISSTPVKISGLPELELQDMPSFFYVHGTYPAYFE  191

Query  961   FVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDN  782
              VL++  N  KAD++  N+F +LE EV + M+   PL    IGP LPS Y+D RV +D  
Sbjct  192   MVLNQFTNVDKADYVFVNSFYKLEAEVADTMSKISPLS--TIGPTLPSFYMDNRVENDIE  249

Query  781   YGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVR  602
             YGL+LF  +++ C+ WL+++  GSVVY +FGS++   D+QM E+A+GL  +   FLWVV+
Sbjct  250   YGLNLFHVDSSTCINWLNTKPEGSVVYAAFGSMSTFDDKQMEEIAEGLKATNSYFLWVVK  309

Query  601   SSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVA  422
             +S++SK+P  F  + S  G++ NW PQL VLS++A+GCF +H GWNST+EAL  GVP+V 
Sbjct  310   TSQESKIPKKFIEENSENGLVINWSPQLQVLSNKAIGCFFSHGGWNSTVEALVFGVPMVV  369

Query  421   MPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKW  242
             MPQWTDQ TNAK++ DVW VG+RV   ENG+V REE+E C+  V++GE G  +K+NA KW
Sbjct  370   MPQWTDQTTNAKFVQDVWSVGVRVKVNENGIVGREEIEECVRIVLQGEEGKEMKKNALKW  429

Query  241   KQLAKEAVDEGGSSDKNIKEFVS  173
             K LAKEAV EGG+SDKN++EFVS
Sbjct  430   KDLAKEAVQEGGTSDKNVEEFVS  452



>gb|KCW48703.1| hypothetical protein EUGRSUZ_K02355 [Eucalyptus grandis]
Length=461

 Score =   410 bits (1053),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 212/451 (47%), Positives = 291/451 (65%), Gaps = 15/451 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL--IRVESIPDGV  1313
             H LV+ YP  GH+ P +Q  KRL  +GV VT++T  S S  +  SSS   I +E+I DG 
Sbjct  11    HCLVLSYPTQGHMNPTLQFCKRLLHKGVKVTLVTAKSMSKTLHGSSSCTSIALEAISDGF  70

Query  1312  KPDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
               D G       +A  +    +    L+E++ ++  SG   T +VYDS +PW  D+    
Sbjct  71    D-DGGIGAAGSPEAYIERFWKVGPETLSELVKRLISSGPPPTCIVYDSFLPWALDVARNF  129

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             GL AAAF + SCAV +V++H  +  L  P +   V LP +PPL   D+PS V +  +Y +
Sbjct  130   GLVAAAFFTMSCAVNSVFYHCQKGWLEVPVK-KQVLLPGVPPLEPQDMPSLVCDVGTYPA  188

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
                 ++++  N  K DW+L NT  EL+ EV +W     P + I  GP +PS YLD R+  
Sbjct  189   FTGMLVNQFSNLDKVDWVLCNTVYELDPEVADWFMKILPFRTI--GPTVPSTYLDSRLEQ  246

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D  YG S+F+P+++  M WL ++  GSVVYVSFGS+A LK +QM E+A GL +S C FLW
Sbjct  247   DKEYGFSIFEPDHDTTMRWLSTKPKGSVVYVSFGSMAELKTDQMHELAMGLKRSNCYFLW  306

Query  610   VVRSSEQSKLPSNF--WPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             VVRSSE  KLP  F    + S  G+I  WCPQL+VL+H A+G F+THCGWNSTLEALSLG
Sbjct  307   VVRSSEAEKLPQGFANCTETSQKGLIVTWCPQLEVLAHGALGLFVTHCGWNSTLEALSLG  366

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAG-ENGMVTREEVERCLVEVMKGERGVMLK  260
             VP++A+PQWTDQ TNAKY++DVW +G+R +   E G+VT EE+E CL +VM+ E    +K
Sbjct  367   VPMLAIPQWTDQATNAKYIMDVWKMGLRPLVDEERGVVTSEEIEHCLRKVMEEETRKKMK  426

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ENA KW+++ K+AV EGGSSD+NI+EFV+ +
Sbjct  427   ENAGKWRKITKDAVGEGGSSDRNIEEFVAKL  457



>emb|CDY70064.1| BnaC08g46320D, partial [Brassica napus]
Length=416

 Score =   407 bits (1047),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 204/431 (47%), Positives = 280/431 (65%), Gaps = 20/431 (5%)
 Frame = -3

Query  1447  TPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKPDSGFDAISDWLKD  1268
             TP+ Q SKRLAS+      + P S                  +G  P    D   D ++ 
Sbjct  1     TPLSQFSKRLASKDNDSITVFPISNG--------------FQEGEDPLQDLDDYMDRVET  46

Query  1267  LVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHT  1088
              +   L E++  +  SG     +VYDS MPW+ D+ H  GLR AAF +Q   V  +Y+H 
Sbjct  47    SIKKRLPELIKDMKLSGSTPKALVYDSTMPWLLDVAHDHGLRGAAFFTQPWLVSIIYYHV  106

Query  1087  DQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADW  920
              +   + P+      +  S PS P L  NDLPSF+   SSY ++LR V+ +  N ++ D 
Sbjct  107   FKGTFSVPSTKYGHSTLASFPSFPMLNANDLPSFLCESSSYPNILRIVVDQLSNIERVDI  166

Query  919   LLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCM  740
             +L NTFD+LE+++L+W+ S +P  V+ IGP LPSMYLDKR+ +D NYG SLF   + +C+
Sbjct  167   VLCNTFDKLEEKLLKWVKSMWP--VLNIGPTLPSMYLDKRLSEDKNYGFSLFTAKSTECI  224

Query  739   EWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPD  560
             EWL+S++  SVVYVSFGSL  L ++QM E+A GL QS C FLWVVR +E  K+P ++  +
Sbjct  225   EWLNSKQPSSVVYVSFGSLVILNEDQMMELATGLKQSGCFFLWVVRETETDKIPKHYVEE  284

Query  559   KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYL  380
                 G+I +W PQL+VL+H++VG F+THCGWNSTLE LSLGVP++ MP WTDQPTNAK++
Sbjct  285   IGEKGLIVSWSPQLEVLAHESVGSFLTHCGWNSTLEGLSLGVPMIGMPHWTDQPTNAKFV  344

Query  379   VDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDEGGSS  200
              DVW VG+RV A  +G V +EE+ RC+ EVM+GE+G  +++NA KWK LA+EAV EGGSS
Sbjct  345   EDVWKVGVRVKAEADGFVRKEEIVRCVGEVMEGEKGKEIRKNAEKWKVLAREAVSEGGSS  404

Query  199   DKNIKEFVSAI  167
             DK+I EFVS +
Sbjct  405   DKSIDEFVSMV  415



>ref|XP_004144268.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Cucumis sativus]
 ref|XP_004163949.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Cucumis sativus]
 gb|KGN47627.1| hypothetical protein Csa_6G366250 [Cucumis sativus]
Length=462

 Score =   409 bits (1051),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 205/447 (46%), Positives = 284/447 (64%), Gaps = 8/447 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS---SSLIRVESIPDG  1316
             H++  P+P  GHI P +Q +KRL S G+ +T++T    S  +++    S+  ++E I DG
Sbjct  14    HIIAFPFPSQGHINPQLQFAKRLISHGIKLTLLTTLHVSQHLKLQGDYSNSFKIEVISDG  73

Query  1315  VKPDSGFDAIS---DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
              +     D +    D  +  ++ NL   + K   S      ++YDS MPWV D+  + G+
Sbjct  74    SENRQETDTMKQTLDRFQHKMTTNLQNYLHKAMDSSNPPRFILYDSTMPWVLDVAKEFGI  133

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLL  965
               A   +QSCA+ ++ +H     L  P E S +SLPSMPPL  NDLP++  + +S  +++
Sbjct  134   AKAPVYTQSCALNSINYHVLHGQLKLPPESSIISLPSMPPLSANDLPAYDYDPASADTII  193

Query  964   RFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDD  785
              F+ S+  N + AD L  NTFD+LE E+++WM S +   V AIGP +PS YLDKR+ +D 
Sbjct  194   EFLTSQYSNIEDADLLFCNTFDKLEGEIIKWMES-WGRPVKAIGPTIPSAYLDKRIENDK  252

Query  784   NYGLSLFKPNNND-CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
              YGLSLF PN +D  ++WL ++   SV+YVS+GS+  + +EQ+  +A G+ QS   FLWV
Sbjct  253   YYGLSLFDPNQDDHLIKWLQTKPPSSVLYVSYGSIVEISEEQLKNLAFGIKQSDKFFLWV  312

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             VR +E  KLP NF       GI+ +WC QLDVL+H A+GCF THCGWNSTLEAL LGVPV
Sbjct  313   VRETEARKLPPNFIESVGEKGIVVSWCSQLDVLAHPAIGCFFTHCGWNSTLEALCLGVPV  372

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             VA PQW DQ TNAK++ DVW VG RV   E  M + EE+  C+ EVM+ ERG   K+N+ 
Sbjct  373   VAFPQWADQVTNAKFMEDVWKVGKRVKVDEKRMASEEEIRNCICEVMEEERGSEFKKNSL  432

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +WKQ AKEA++EGGSS  NI EFVS I
Sbjct  433   EWKQWAKEAMEEGGSSYNNIMEFVSMI  459



>emb|CDY51326.1| BnaA10g03470D [Brassica napus]
Length=456

 Score =   409 bits (1050),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 209/451 (46%), Positives = 293/451 (65%), Gaps = 14/451 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESIPDGV  1313
             SHV+V+P+P+ GH++PM Q  KRLAS+G+  T V+     S   +  ++ I V  IP G 
Sbjct  5     SHVIVLPFPVQGHLSPMFQFCKRLASKGLTSTLVLVSDKPSPPYKTENNAITVFPIPSGS  64

Query  1312  K----PDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
             +    P    D   D +   +  +L E++  +         +VYDS +PW+ D+ H  GL
Sbjct  65    QEGKDPLQDLDDYIDRVYTSIKKHLPELIQDMKLLENPPRALVYDSTLPWLLDVAHDHGL  124

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRNKSSY  977
             R A+F +Q   V  +Y+H  + + + P+      +  S P+ P L  NDLPS+V   SSY
Sbjct  125   RGASFFTQPWLVSVIYYHVHKGSFSVPSTKHGHSTLASFPAFPMLSANDLPSYVCESSSY  184

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
               +LR V+ +  N  + D LL NTFD LE+++L+W+ S +P  V+ IGP +PSMYLDKR 
Sbjct  185   PKILRIVVEQLSNIDRVDILLCNTFDNLEEKLLKWVKSLWP--VLNIGPTVPSMYLDKRQ  242

Query  796   RDDDNYGLSLFKPN---NNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
               D +YG +    N   + +CMEWL+ ++  SVVYVSFGSL  LK++QM E+A+GL QS 
Sbjct  243   SKDKSYGFNGSPRNLSKSTECMEWLNLKKRQSVVYVSFGSLVILKEDQMMELAEGLKQSG  302

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
             C FLWVVR +E +K+P ++  +    G+  +W PQL+VL+H++VGCF+THCGWNSTLE L
Sbjct  303   CFFLWVVRETEMNKIPKSYVEEIGEKGLFVSWSPQLEVLAHESVGCFLTHCGWNSTLEGL  362

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVM  266
             SLGVP++ MP WTDQPTNAK++ DVW VG+RV A  +G V R+E+ RC+ EVM+ E+G  
Sbjct  363   SLGVPMIGMPHWTDQPTNAKFMEDVWKVGVRVKAEADGFVRRDEIVRCVGEVMEREKGKE  422

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
             ++ NA KWK LA EAV EGGSSDK+I EFVS
Sbjct  423   MRRNAEKWKVLALEAVSEGGSSDKSIDEFVS  453



>ref|XP_011047630.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Populus euphratica]
Length=421

 Score =   406 bits (1043),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 204/383 (53%), Positives = 268/383 (70%), Gaps = 9/383 (2%)
 Frame = -3

Query  1294  DAISDWLKDLVSNNLAEIMSKVTGS-GCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQS  1118
             D  S   +  V+  L E+++++  S G  +  ++YDS +PW+ D   QLGL  A+  +QS
Sbjct  29    DDYSKQFRAAVTRKLPELVAELNNSSGHPINCLLYDSHLPWLLDTARQLGLTGASLFTQS  88

Query  1117  CAVFAVYHHTDQENLTAPTEGSTVSL---PSMPPLGLNDLPSFVR---NKSSYSSLLRFV  956
             CAV  VY++  +  L  P E   V+L   P++ PL + DLPSFV+   ++S YS LL  V
Sbjct  89    CAVDNVYYNVHEMQLKIPPEKLLVTLSRLPALSPLEITDLPSFVQGMDSESEYSFLLNHV  148

Query  955   LSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYG  776
             + +  N ++ADW+  NTF  LE+E + W+ASQ  +K   IGPL+PS YLDK++ DD  YG
Sbjct  149   VGQFSNFREADWVFVNTFSALEEEAVNWLASQRSIK--PIGPLIPSFYLDKQLEDDKEYG  206

Query  775   LSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSS  596
              SLFKPN + C EWLDS+E GSV Y+SFGS+A L +EQM E+A GL +S C FLWVVR S
Sbjct  207   PSLFKPNPDGCNEWLDSKENGSVGYLSFGSMAALGEEQMAEIAWGLKRSDCCFLWVVRES  266

Query  595   EQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMP  416
             E+ KLPSNF  + S   ++  W PQL+VL+H++VGCF+THCGWNS LEALSLGVP+VAMP
Sbjct  267   ERKKLPSNFVEESSKKSLLVTWSPQLEVLAHKSVGCFMTHCGWNSKLEALSLGVPMVAMP  326

Query  415   QWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQ  236
              WTDQPTNAK + DVW  GIRV   E G+VT+EEVE C+ EVM+GERG  ++ N+ KW +
Sbjct  327   HWTDQPTNAKCIADVWHAGIRVKENEKGIVTKEEVEGCIREVMEGERGNKIRRNSEKWMK  386

Query  235   LAKEAVDEGGSSDKNIKEFVSAI  167
             LAK AVDEGGSSDKNI EF + +
Sbjct  387   LAKTAVDEGGSSDKNITEFAAEL  409



>ref|XP_010037080.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Eucalyptus grandis]
Length=461

 Score =   407 bits (1046),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 213/461 (46%), Positives = 293/461 (64%), Gaps = 17/461 (4%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL--I  1340
             E + M    H L++ YP  GHI PM+Q +KRL  +GV VT++T  S S  +  SS+   I
Sbjct  2     EESSMPLKPHCLILSYPSQGHINPMLQFAKRLLHKGVKVTLVTTKSISKTLHGSSTCTSI  61

Query  1339  RVESIPDGVKPDSGF-------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIM  1181
              +E I DG   DSG        +A  +    +    L+E++ ++   G   T +VYDS +
Sbjct  62    PLEVISDGF--DSGGIGAAGSPEAYLERFWKVGPETLSELVERLIFRGPPPTCIVYDSFL  119

Query  1180  PWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPS  1001
             PW  D+  +  L  AAF + SCAV +V++H  +  L  P +   V LP MPPL   D+PS
Sbjct  120   PWALDVARKFKLVGAAFFTMSCAVNSVFYHCQKGWLEVPVK-KQVLLPGMPPLEPQDMPS  178

Query  1000  FVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLP  821
              V +  +Y      ++++  N  K DW+L NT  EL+ EV +W     P + I  GP +P
Sbjct  179   LVCDLGTYPGFTGMLVNQFSNLDKVDWMLCNTVYELDPEVADWFMKILPFRTI--GPTVP  236

Query  820   SMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQG  641
             S YLD R+  D  YG S+F+P+++  M WL ++  GSVVYVSFGS+A LK +QM E+A G
Sbjct  237   STYLDSRLEQDKEYGFSIFEPDHDTTMRWLSTKPKGSVVYVSFGSMAELKTDQMHELAMG  296

Query  640   LIQSKCKFLWVVRSSEQSKLPSNF--WPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGW  467
             L +S C FLWVVRSSE  KLP  F    + S  G+I  WCPQL+VL+H A+G F+THCGW
Sbjct  297   LKRSNCYFLWVVRSSEAEKLPQGFANCTETSQKGLIVTWCPQLEVLAHGALGLFVTHCGW  356

Query  466   NSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAG-ENGMVTREEVERCLVEV  290
             NSTLEALSLGVP++A+PQWTDQ TNAKY++DVW +G+R +   E G+VT EE+E CL +V
Sbjct  357   NSTLEALSLGVPMLAIPQWTDQATNAKYIMDVWKMGLRPLVDEERGVVTSEEIEHCLRKV  416

Query  289   MKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             M+ E    +KENA KW+++ K+AV EGGSSD+NI+EFV+ +
Sbjct  417   MEEETRKKMKENAGKWRKITKDAVGEGGSSDRNIEEFVAKL  457



>gb|KFK31187.1| hypothetical protein AALP_AA6G079800 [Arabis alpina]
Length=456

 Score =   407 bits (1045),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 214/459 (47%), Positives = 296/459 (64%), Gaps = 16/459 (3%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVE  1331
             M E S  ++VLV  +PI GHI P++Q SKRL S+ V VT +T +ST   I   +      
Sbjct  1     MGEESK-ANVLVFSFPIQGHINPLLQFSKRLISKNVTVTFLTTSSTHNTILGRAVAGGAT  59

Query  1330  SIPDGVKP-DSGF-------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPW  1175
             ++P    P D GF       D+  ++ K+   N    + + ++        +VYDS MPW
Sbjct  60    ALPLTFLPLDDGFEEGHPSTDSSPEYFKNFEENVSKSLSNLISTMDPKPNAIVYDSCMPW  119

Query  1174  VADLVHQL-GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSF  998
               D+  +  G+ AA+F +Q   V A+Y H  +       +   V LP+MPPL  +DLP F
Sbjct  120   ALDVCRKHPGVAAASFFTQCSTVNAIYIHFLRGEFKEFQD--DVVLPAMPPLKGSDLPVF  177

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
             + + S   SL   + S+ +N    D+ L N+FDELE EVLEWM +Q+P+K   IGP++PS
Sbjct  178   LYDNSICRSLFELISSQFVNVDDIDFFLVNSFDELEFEVLEWMKNQWPVK--NIGPMIPS  235

Query  817   MYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGL  638
             MYLDKR+  D +YG+SLF    N+C+ WLDS+  GSV+YVSFGSLA  KD+QM EVA GL
Sbjct  236   MYLDKRITGDKDYGISLFNAQTNECLNWLDSKPPGSVIYVSFGSLAVFKDDQMIEVAAGL  295

Query  637   IQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNST  458
              Q    FLWVVR +E  KLPSN+  +    G+I NW PQL VL+H+++GCF+THCGWNST
Sbjct  296   KQIGHNFLWVVRETETKKLPSNYIEEIGEKGLIVNWSPQLQVLAHKSIGCFMTHCGWNST  355

Query  457   LEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM--K  284
             LEALSLGV ++ MP ++DQPTNAK++ DVW+VG+RV A ++G VT+EE+ RC+ EVM  K
Sbjct  356   LEALSLGVALIGMPAYSDQPTNAKFIEDVWNVGVRVKADKDGFVTKEEIVRCVDEVMEEK  415

Query  283   GERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              E+G  +++NA +  + AK+A  EGG+SDKNI EF++ I
Sbjct  416   SEKGKEIRKNAERLMEFAKKAPSEGGNSDKNIDEFIAKI  454



>gb|EPS69486.1| glycosyltransferase [Genlisea aurea]
Length=453

 Score =   406 bits (1043),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 215/447 (48%), Positives = 296/447 (66%), Gaps = 11/447 (2%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H L+ P+PI GHI PM+Q +KRL  +G+ VT+I     +      S  I VE+I +G+ 
Sbjct  4     AHCLIFPFPIQGHINPMLQFAKRLVHKGLRVTLILTRYLAKTSPFHSPTIAVETISNGLD  63

Query  1309  PDS--GFDAISDWLKDLVSNNLA---EIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
                  GF  +S +L  L  + +A   E + ++   G   T +VYD  + WV +L  + G+
Sbjct  64    DGEPHGF-PVSSYLSLLKEHGMASLREALHRLIRCGRPATCIVYDPFITWVPELAGEYGI  122

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLT-APTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             + AAF +QSCAV  +YH     +L     E   + LP +PPL   DLPSFV    SY SL
Sbjct  123   KTAAFFTQSCAVDYIYHRLYSGDLKIGEEEEKAIELPGLPPLLPADLPSFVTLPESYPSL  182

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
                V  +  + +  DW+  NT  ELEKEV+++MA   P+K  AIGP +PSMYLD+++ DD
Sbjct  183   RDMVTDQFKHIENVDWVFCNTLYELEKEVIDFMAEHAPVK--AIGPTIPSMYLDRKLADD  240

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
              +YGLS+F+P    CM+WL+ QE GSV+YVSFGSLA L + Q  E+A GL +SK  FLWV
Sbjct  241   TDYGLSVFRPEARLCMDWLNRQEPGSVIYVSFGSLAKLSEAQTAELAHGLKRSKRPFLWV  300

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             VR++EQ KLP  F  ++   G++ +WCPQLDVL+H AV CF+THCGWNSTLEAL LGVP+
Sbjct  301   VRAAEQGKLPEGFAAEEV-PGLVISWCPQLDVLAHDAVACFVTHCGWNSTLEALCLGVPM  359

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             V MPQWTDQ TN+K++ DVW  G+R + G+ G+V RE +E+C+ EVM+GE+G  +++N +
Sbjct  360   VGMPQWTDQTTNSKFVADVWGTGVRAV-GDGGIVGRESIEKCIREVMEGEKGEEIRKNVS  418

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             KWK+LA  AV EGGSSD+NI +FVS +
Sbjct  419   KWKELAVAAVSEGGSSDRNIDDFVSTL  445



>ref|XP_009141176.1| PREDICTED: UDP-glycosyltransferase 74D1 [Brassica rapa]
Length=456

 Score =   406 bits (1043),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 214/457 (47%), Positives = 300/457 (66%), Gaps = 21/457 (5%)
 Frame = -3

Query  1495  TVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDG  1316
              ++ VLV  +PI GHI P++Q SKRL S+ V VT +T +ST   I   S+     ++P  
Sbjct  5     AIAKVLVFSFPIQGHINPLLQFSKRLISKNVSVTFLTTSSTHNNIIRRSTAGGATALPLS  64

Query  1315  VKP-DSGF-------DAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVA  1169
               P D GF       D   ++   L   VS +L++++S +         VVYDS  PW+ 
Sbjct  65    FVPLDDGFEEGHPSTDTSPEYFAKLEENVSRSLSQLISSMEPKP---NAVVYDSCSPWIL  121

Query  1168  DLVHQL-GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVR  992
             D+  +  G+ AA+F +QS  V A+Y H  +       +   V LP+MPPL  +DLP F+ 
Sbjct  122   DVCRKYPGVAAASFFTQSSIVNAIYIHFLRGEFKEFQD--DVVLPAMPPLKGSDLPVFLY  179

Query  991   NKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMY  812
             + +    L   + S+ +N    D+ L N+FDELE EVLEWM +Q+P+K   IGP++PSMY
Sbjct  180   DNNLCRPLFELISSQFVNVDDIDFFLVNSFDELEVEVLEWMKNQWPVK--NIGPMIPSMY  237

Query  811   LDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQ  632
             LDKR+  D +YG+SLF    N+C++WLDS+  GSV+YVSFGSLA LKD+QM E+A GL Q
Sbjct  238   LDKRLAGDKDYGISLFNAQVNECLDWLDSKPPGSVIYVSFGSLAVLKDDQMIELAAGLKQ  297

Query  631   SKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLE  452
             +   FLWVVR +E  KLPSN+  +    G+I NW PQL VL+H+++GCF+THCGWNSTLE
Sbjct  298   TGHNFLWVVRETETKKLPSNYIEEIGDRGLIVNWSPQLQVLAHKSIGCFMTHCGWNSTLE  357

Query  451   ALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK--GE  278
             ALSLGV ++ MP ++DQPTNAK++ DVW VG+RV A ++G VT+EE+ RC+ EVM+   +
Sbjct  358   ALSLGVALIGMPAYSDQPTNAKFIEDVWKVGVRVKADKDGFVTKEEIVRCVGEVMEETSK  417

Query  277   RGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +G  +++NA +  + AKEA+ EGG+SDKNI EFV+ I
Sbjct  418   KGKEIRKNALRLMEFAKEALAEGGNSDKNIDEFVAKI  454



>ref|XP_008445485.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Cucumis melo]
 ref|XP_008445486.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Cucumis melo]
 ref|XP_008445487.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Cucumis melo]
Length=456

 Score =   406 bits (1043),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 207/453 (46%), Positives = 288/453 (64%), Gaps = 8/453 (2%)
 Frame = -3

Query  1504  EMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVS---SSLIRV  1334
             E+ +  H+L  P+P  GHI P +QL+KRL S G+ VT++T    S  +++    S+  ++
Sbjct  2     EIGSDPHILAFPFPSQGHINPQLQLAKRLISNGIKVTLLTTLHVSQHLKLQGDYSNSFKI  61

Query  1333  ESIPDGVKPDSGFDAIS---DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             E I DG +     D +    D  +  ++ NL   + K   S      ++YDS MPWV D+
Sbjct  62    EVISDGSENRQETDTMKQTLDRFQHKMTANLQHYLQKAMDSSNPPRFILYDSTMPWVLDV  121

Query  1162  VHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKS  983
               + G+  A   +QSCA+ ++ +H     L  P E ST+SLPSMP L  NDLP++  + +
Sbjct  122   AKEFGIARAPVYTQSCALNSINYHVLHGELKLPPESSTISLPSMPLLSANDLPAYDYDPA  181

Query  982   SYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDK  803
             S  +++ F+ S+  N + AD L  NTFD+LE E+++WM S +   V AIGP +PS YLDK
Sbjct  182   SADTIIEFLTSQYSNIEDADLLFCNTFDKLEGEIIKWMES-WGRPVKAIGPTIPSAYLDK  240

Query  802   RVRDDDNYGLSLFKPNNND-CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             R+ +D  YGLSLF PN +D  ++WL ++   SV+YVS+GS+  + +EQ+  +A G+ QS 
Sbjct  241   RIENDKYYGLSLFDPNQDDNLIKWLQTKPPSSVLYVSYGSIVEISEEQIKNLALGIKQSD  300

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
               FLWVVR +E  KLP NF       G++ +WC QLDVL+H A+GCF THCGWNSTLEAL
Sbjct  301   KFFLWVVRETEAKKLPPNFIESVGEKGLVVSWCSQLDVLAHPAIGCFFTHCGWNSTLEAL  360

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVM  266
              LGVPVVA PQW DQ TNAK+L DVW VG RV   E  M + EE+  C+ EVM+ ERG  
Sbjct  361   CLGVPVVAFPQWADQVTNAKFLEDVWKVGKRVKVDEKRMASEEEIRNCICEVMEEERGSE  420

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              K+N+ + K+ AKEA++EGGSS KNI EFV+ I
Sbjct  421   FKKNSLELKKWAKEAMEEGGSSYKNIMEFVAMI  453



>ref|XP_010542772.1| PREDICTED: UDP-glycosyltransferase 74D1 [Tarenaya hassleriana]
 ref|XP_010542773.1| PREDICTED: UDP-glycosyltransferase 74D1 [Tarenaya hassleriana]
Length=460

 Score =   406 bits (1043),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 217/449 (48%), Positives = 299/449 (67%), Gaps = 13/449 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACI--QVSSSLIRVESIPDGV  1313
             HVLV+P+PI GHI P++Q SKRL S+ V VT++T +ST   I  + SSSL    S+P   
Sbjct  12    HVLVLPFPIQGHINPLLQFSKRLISKNVAVTLLTTSSTHTTILRRASSSLSGRASLPLAF  71

Query  1312  KP-DSGFD------AISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQ  1154
              P D GF+      A +++L    +     +   ++        VVYDS +PW  D+  +
Sbjct  72    VPLDDGFEEGAPTGATAEYLAMFKNKVSLSLSDLISSMDPKPAAVVYDSCLPWALDVARR  131

Query  1153  LGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYS  974
              G+  A+F +QS  V A+YHH  +       +   V LP+MP L   DLP F+ ++S   
Sbjct  132   FGVAGASFFTQSSVVNALYHHFIEGRFREFQD--EVVLPAMPVLKGGDLPVFLYDRSICP  189

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVR  794
              L   + S+  N  +A + L N+F+ELE E+LEWM + +P+K   IGP +PSMYLDKR+ 
Sbjct  190   PLHDLICSQFCNVDEAQFFLVNSFEELEVEILEWMENVWPVK--NIGPTVPSMYLDKRLG  247

Query  793   DDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFL  614
             D+ +YGLSLF P  ++C+ WLD++   SVVYVSFGSLA LKD+QM E+A GL Q+   FL
Sbjct  248   DEKDYGLSLFNPKVDECLTWLDTKPPDSVVYVSFGSLAVLKDDQMNELASGLKQTGHFFL  307

Query  613   WVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGV  434
             WVVR +E SKL S++  + S  G+I  W PQL VL+H++VGCF+THCGWNSTLEALSLGV
Sbjct  308   WVVRETESSKLSSSYLEEISEKGLIVTWSPQLQVLAHKSVGCFVTHCGWNSTLEALSLGV  367

Query  433   PVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKEN  254
             P+V MPQ++DQPTNAK++ DVW VG+R  A + G VT++EV RC+ E+M+GE+   ++ N
Sbjct  368   PMVGMPQYSDQPTNAKFIEDVWKVGVRAKADKEGFVTKDEVVRCVGELMEGEKSRDVRRN  427

Query  253   AAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             A KW++ AKEAV EGGSSD+NI EFV+ +
Sbjct  428   AEKWRESAKEAVSEGGSSDRNIDEFVAKL  456



>ref|XP_006304660.1| hypothetical protein CARUB_v10011842mg [Capsella rubella]
 gb|EOA37558.1| hypothetical protein CARUB_v10011842mg [Capsella rubella]
Length=440

 Score =   405 bits (1040),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 209/452 (46%), Positives = 287/452 (63%), Gaps = 24/452 (5%)
 Frame = -3

Query  1501  MSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTST-SACIQVSSSLIRVESI  1325
             M   SHV+V+P+P  GHITPM Q  KRL S+G+ +T+I  +   S   +    LI V  I
Sbjct  1     MREGSHVIVLPFPAQGHITPMSQFCKRLVSKGLKITLILVSDKPSPPYRTEHDLITVVPI  60

Query  1324  PDGVKPD----SGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
              +G + D       D   + ++  +   L +++  +  SG     +VYDS MPW+ D+ H
Sbjct  61    SNGFQEDEEQSQDLDDYMERVETSIKTRLPKLIEDMKLSGNPPRALVYDSTMPWLLDVAH  120

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRN  989
               GLR A F +Q   V  +Y+H ++ + + P+      +  S PS P L   DLPSF+R 
Sbjct  121   SSGLRGAVFFTQPWLVSTIYYHVNKGSFSVPSTRHDHSALASFPSFPMLNSYDLPSFLRE  180

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
              SSY ++LR V+ +  N  + D +L NTFD+LE+++L+W+ S +P  V+ IGP +PSMYL
Sbjct  181   SSSYPNILRIVIDQLSNIDRVDIVLCNTFDKLEEKLLKWVQSLWP--VLNIGPTVPSMYL  238

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR+ +D NYG SLF  N   C+EWLDS++  SVVYVS GSL  LK++QM E+A GL QS
Sbjct  239   DKRLTEDKNYGFSLFDANVAKCIEWLDSKQPSSVVYVSLGSLVILKEDQMMELAAGLKQS  298

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
                FLWVVR +E++KLP N             W PQL+VL H+++GCF+THCGWNS LE 
Sbjct  299   GYFFLWVVRDTEKNKLPRN-------------WSPQLEVLRHESIGCFLTHCGWNSMLEG  345

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             LSLGVP++ MP W DQPTN K++ DVW VG+RV A  +G V  EE+ + + EVM+GE+G 
Sbjct  346   LSLGVPMIGMPHWADQPTNGKFMEDVWKVGVRVKADVDGFVRSEEIVKRVGEVMEGEKGK  405

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
              +++NA KWK L  EAV EGG SDK+I EFVS
Sbjct  406   EIRKNAEKWKLLTLEAVSEGGRSDKSINEFVS  437



>gb|AAM61249.1| putative glucosyltransferase [Arabidopsis thaliana]
Length=456

 Score =   405 bits (1042),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 214/455 (47%), Positives = 297/455 (65%), Gaps = 21/455 (5%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             ++VLV  +PI GHI P++Q SKRL S+ V VT +T +ST   I   +      ++P    
Sbjct  7     ANVLVFSFPIQGHINPLLQFSKRLLSKNVNVTFLTTSSTHNSILRRAITGGATALPLSFV  66

Query  1309  P-DSGF-------DAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             P D GF       D   D+       VS +L+E++S +         VVYDS +P+V D+
Sbjct  67    PIDDGFEEDHPSTDTSPDYFAKFQENVSRSLSELISSMDPKP---NAVVYDSCLPYVLDV  123

Query  1162  VHQL-GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNK  986
               +  G+ AA+F +QS  V A Y H  +         + V LP+MPPL  NDLP F+ + 
Sbjct  124   CRKHPGVAAASFFTQSSTVNATYIHFLRGEFKEFQ--NDVVLPAMPPLKGNDLPVFLYDN  181

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
             +    L   + S+ +N    D+ L N+FDELE EVL+WM +Q+P+K   IGP++PSMYLD
Sbjct  182   NLCRPLFELISSQFVNVDDIDFFLVNSFDELEVEVLQWMKNQWPVK--NIGPMIPSMYLD  239

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+  D +YG++LF    N+C++WLDS+  GSV+YVSFGSLA LKD+QM EVA GL Q+ 
Sbjct  240   KRLAGDKDYGINLFNAQVNECLDWLDSKPPGSVIYVSFGSLAVLKDDQMIEVAAGLKQTG  299

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
               FLWVVR +E  KLPSN+  D    G+I NW PQL VL+H+++GCF+THCGWNSTLEAL
Sbjct  300   HNFLWVVRETETKKLPSNYIEDIGEKGLIVNWSPQLQVLAHKSIGCFMTHCGWNSTLEAL  359

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK--GERG  272
             SLGV ++ MP ++DQPTNAK++ DVW VG+RV A +NG V +EE+ RC+ EVM+   E+G
Sbjct  360   SLGVALIGMPAYSDQPTNAKFIEDVWKVGVRVKADQNGFVPKEEIVRCVGEVMEDMSEKG  419

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +++NA +  + A+EA+ +GG+SDKNI EFV+ I
Sbjct  420   KEIRKNARRLMEFAREALSDGGNSDKNIDEFVAKI  454



>ref|XP_006294187.1| hypothetical protein CARUB_v10023181mg [Capsella rubella]
 gb|EOA27085.1| hypothetical protein CARUB_v10023181mg [Capsella rubella]
Length=456

 Score =   405 bits (1041),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 212/455 (47%), Positives = 300/455 (66%), Gaps = 21/455 (5%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             ++VLV  +PI GHI P++Q SKRL S+ V VT +T +ST   I   +      ++P    
Sbjct  7     ANVLVFSFPIQGHINPLLQFSKRLISKNVTVTFLTTSSTHNSILRRAIAGGATALPISFV  66

Query  1309  P-DSGF-------DAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             P D GF       D   D+       VS +L+E++S +         VVYDS +P+V D+
Sbjct  67    PIDDGFEEGHPSTDTSPDYFSKFQENVSRSLSELISSMDPKP---NAVVYDSCLPYVLDV  123

Query  1162  VHQL-GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNK  986
               +  G+ AA+F +QS  V A+Y H  +         + V+LP+MPPL  NDLP F+ + 
Sbjct  124   CRKHPGVAAASFFTQSSTVNAIYIHFLRGEFKEFQ--NDVALPAMPPLKGNDLPVFLYDN  181

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
             +    L   + S+ +N    D+ L N+FDELE EVLEWM +Q+P+K   IGP++PSMYLD
Sbjct  182   NICRPLFELISSQFINVDDIDFFLVNSFDELEVEVLEWMKNQWPVK--NIGPMIPSMYLD  239

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+  D +YG++LF P  N+C++WLDS+   SV+YVSFGSLA LKD+QM E+A GL Q+ 
Sbjct  240   KRLAGDKDYGINLFNPQVNECLDWLDSKPPSSVIYVSFGSLAVLKDDQMIEIAAGLKQTG  299

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
               FLWVVR +E++KLP+N+  +    G+I NW PQL VL+ +++GCF+THCGWNSTLEAL
Sbjct  300   HNFLWVVRETEKNKLPNNYIEEIGEKGLIVNWSPQLQVLAQKSIGCFMTHCGWNSTLEAL  359

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK--GERG  272
             SLGV ++ MP ++DQPTNAK++ DVW VG+RV A  NG V +EE+ RC+ EVM+   E+G
Sbjct  360   SLGVALIGMPAYSDQPTNAKFIEDVWKVGVRVKADHNGYVKKEEIVRCVGEVMEEMSEKG  419

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +++NA +  + A+EA+ EGG+SDKNI+EFV+ I
Sbjct  420   KEVRKNARRLMEFAREALSEGGNSDKNIEEFVAKI  454



>ref|NP_180734.1| UDP-glucosyl transferase 74D1 [Arabidopsis thaliana]
 sp|Q9SKC5.1|U74D1_ARATH RecName: Full=UDP-glycosyltransferase 74D1; AltName: Full=Jasmonate 
glucosyltransferase 1; Short=AtJGT1 [Arabidopsis thaliana]
 gb|AAD32297.1| putative glucosyltransferase [Arabidopsis thaliana]
 gb|AAM78098.1| At2g31750/F20M17.21 [Arabidopsis thaliana]
 gb|AAN38705.1| At2g31750/F20M17.21 [Arabidopsis thaliana]
 gb|ABA39729.1| jasmonic acid glucosyltransferase [Arabidopsis thaliana]
 gb|AEC08580.1| UDP-glucosyl transferase 74D1 [Arabidopsis thaliana]
 gb|AHL38825.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=456

 Score =   405 bits (1041),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 214/455 (47%), Positives = 297/455 (65%), Gaps = 21/455 (5%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             ++VLV  +PI GHI P++Q SKRL S+ V VT +T +ST   I   +      ++P    
Sbjct  7     ANVLVFSFPIQGHINPLLQFSKRLLSKNVNVTFLTTSSTHNSILRRAITGGATALPLSFV  66

Query  1309  P-DSGF-------DAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             P D GF       D   D+       VS +L+E++S +         VVYDS +P+V D+
Sbjct  67    PIDDGFEEDHPSTDTSPDYFAKFQENVSRSLSELISSMDPKP---NAVVYDSCLPYVLDV  123

Query  1162  VHQL-GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNK  986
               +  G+ AA+F +QS  V A Y H  +         + V LP+MPPL  NDLP F+ + 
Sbjct  124   CRKHPGVAAASFFTQSSTVNATYIHFLRGEFKEFQ--NDVVLPAMPPLKGNDLPVFLYDN  181

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
             +    L   + S+ +N    D+ L N+FDELE EVL+WM +Q+P+K   IGP++PSMYLD
Sbjct  182   NLCRPLFELISSQFVNVDDIDFFLVNSFDELEVEVLQWMKNQWPVK--NIGPMIPSMYLD  239

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+  D +YG++LF    N+C++WLDS+  GSV+YVSFGSLA LKD+QM EVA GL Q+ 
Sbjct  240   KRLAGDKDYGINLFNAQVNECLDWLDSKPPGSVIYVSFGSLAVLKDDQMIEVAAGLKQTG  299

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
               FLWVVR +E  KLPSN+  D    G+I NW PQL VL+H+++GCF+THCGWNSTLEAL
Sbjct  300   HNFLWVVRETETKKLPSNYIEDICDKGLIVNWSPQLQVLAHKSIGCFMTHCGWNSTLEAL  359

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK--GERG  272
             SLGV ++ MP ++DQPTNAK++ DVW VG+RV A +NG V +EE+ RC+ EVM+   E+G
Sbjct  360   SLGVALIGMPAYSDQPTNAKFIEDVWKVGVRVKADQNGFVPKEEIVRCVGEVMEDMSEKG  419

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +++NA +  + A+EA+ +GG+SDKNI EFV+ I
Sbjct  420   KEIRKNARRLMEFAREALSDGGNSDKNIDEFVAKI  454



>ref|XP_010510162.1| PREDICTED: UDP-glycosyltransferase 74D1-like [Camelina sativa]
Length=456

 Score =   405 bits (1041),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 212/455 (47%), Positives = 300/455 (66%), Gaps = 21/455 (5%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             ++VLV  +PI GHI P++Q SKRL S+ V VT +T +ST   I   +      ++P    
Sbjct  7     ANVLVFSFPIQGHINPLLQFSKRLISKNVTVTFLTTSSTHNSILRRAISGGATALPLSFV  66

Query  1309  P-DSGF-------DAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             P D GF       D   D+       VS +L+E++S +         VVYDS +P+V D+
Sbjct  67    PIDDGFEEGHPSTDTSPDYFSKFQENVSRSLSELISSMDPKP---NAVVYDSCLPYVLDV  123

Query  1162  VHQL-GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNK  986
               +  G+ AA+F +Q+  V A+Y H  +         + V LP+MPPL  NDLP F+ + 
Sbjct  124   CRKHPGVAAASFFTQNSTVNAIYVHFLRGEFKEFQ--NEVVLPAMPPLKGNDLPVFLYDN  181

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
             +    L   + S+ +N    D+ L N+FDELE EVL+WM +Q+P+K   IGP++PSMYLD
Sbjct  182   NICRPLFELISSQFINVDDIDFFLVNSFDELEVEVLQWMTNQWPVK--NIGPMIPSMYLD  239

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+  D +YG++LF    N+C++WLDS++  SV+YVSFGSLA LKD+QM EVA GL Q+ 
Sbjct  240   KRLAGDKDYGINLFNAQVNECLDWLDSKQPSSVIYVSFGSLAVLKDDQMIEVAAGLKQTG  299

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
               FLWVVR +E++KLPSN+  +    G+I NW PQL VL+H+++GCF+THCGWNSTLEAL
Sbjct  300   RNFLWVVRETEKNKLPSNYVEEIGEKGLIVNWSPQLQVLAHKSIGCFMTHCGWNSTLEAL  359

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK--GERG  272
             SLGV ++ MP ++DQPTNAK++ DVW VG+RV A +NG VT+EE+ RC+ EVM+   E+G
Sbjct  360   SLGVALIGMPAYSDQPTNAKFIEDVWKVGVRVKADQNGFVTKEEIVRCVGEVMEEMSEKG  419

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +++NA K  + A+EA+ EGG+SD NI EF++ I
Sbjct  420   KEVRKNARKLMEFAREALSEGGNSDNNIDEFIAKI  454



>ref|XP_010037079.1| PREDICTED: UDP-glycosyltransferase 74F1-like [Eucalyptus grandis]
Length=462

 Score =   405 bits (1040),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 209/451 (46%), Positives = 290/451 (64%), Gaps = 15/451 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL--IRVESIPDGV  1313
             H LV+ YP  GH+ P +Q  KRL  +GV VT++T  S S  +  SSS   I +E+I DG 
Sbjct  11    HCLVLSYPTQGHMNPTLQFCKRLLHKGVKVTLVTAKSMSKTLHGSSSCTSIALEAISDGF  70

Query  1312  KPDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
               D G       +A  +    +    L+E++ ++  SG   T +VYDS +PW  D+    
Sbjct  71    D-DGGIGAAGSPEAYIERFWKVGPETLSELVKRLISSGPPPTCIVYDSFLPWALDVARNF  129

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             GL AAAF + SCAV +V++H  +  L  P +   V LP +PPL   D+PS V +  +Y +
Sbjct  130   GLVAAAFFTMSCAVNSVFYHCQKGWLEVPVK-KQVLLPGVPPLEPQDMPSLVCDVGTYPA  188

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
                 ++++  N  K DW+L NT  EL+ EV +W     P + I  GP +PS YLD R+  
Sbjct  189   FTGMLVNQFSNLDKVDWVLCNTVYELDPEVADWFMKILPFRTI--GPTVPSAYLDNRLEQ  246

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D  YG S+F+P ++  M WL ++  GSVVYVSFGS+A LK +QM E+A GL +S C FLW
Sbjct  247   DQEYGFSIFQPEHDTTMRWLGTKPKGSVVYVSFGSMAELKIDQMHELAMGLKRSNCYFLW  306

Query  610   VVRSSEQSKLPSNF--WPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             VVRSSE  KLP +F    + S  G+I  WCPQL VL+H+A+G F+THCGWNSTLEALSLG
Sbjct  307   VVRSSEAEKLPQDFANGSETSQNGLIVTWCPQLKVLAHEALGLFVTHCGWNSTLEALSLG  366

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAG-ENGMVTREEVERCLVEVMKGERGVMLK  260
             VP++A+PQWTDQ TNAKY++DVW +G+R     E G+VT +E+E C+ +VM+GE    +K
Sbjct  367   VPMLAIPQWTDQATNAKYIMDVWKMGLRPQVDEERGVVTSDEIEHCIRKVMEGETWKKMK  426

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             E+A KW+++ K+AV EGGSSD+NI+EF + +
Sbjct  427   EHAGKWRKITKDAVGEGGSSDRNIEEFAAKM  457



>ref|XP_010414087.1| PREDICTED: UDP-glycosyltransferase 74D1-like [Camelina sativa]
Length=456

 Score =   404 bits (1039),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 213/455 (47%), Positives = 299/455 (66%), Gaps = 21/455 (5%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             ++VLV  +PI GHI P++Q SKRL S  V VT +T +ST   I   +      ++P    
Sbjct  7     ANVLVFSFPIQGHINPLLQFSKRLISINVTVTFLTTSSTHNSILRRAIAGGATALPLSFV  66

Query  1309  P-DSGF-------DAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             P D GF       D   D+       VS +L+E++S +         VVYDS +P+V D+
Sbjct  67    PIDDGFEEGHPSTDTSPDYFSKFQENVSRSLSELISSMDPKP---NAVVYDSCLPYVLDV  123

Query  1162  VHQL-GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNK  986
               +  G+ AA+F +QS  V A+Y H  +         + V LP+MPPL  NDLP F+ + 
Sbjct  124   CRKHPGVAAASFFTQSSTVNAIYVHFLRGEFKEFQ--NDVVLPAMPPLKGNDLPVFLYDN  181

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
             +    L   + S+ +N    D+ L N+FDELE EVL+WM +Q+P+K   IGP++PSMYLD
Sbjct  182   NICRPLFELISSQFINVDDIDFFLVNSFDELEVEVLQWMTNQWPVK--NIGPMIPSMYLD  239

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+  D +YG++LF    N+C++WLDS++  SV+YVSFGSLA LKD+QM EVA GL Q+ 
Sbjct  240   KRLAGDKDYGINLFNAQVNECLDWLDSKQPSSVIYVSFGSLAVLKDDQMIEVAAGLKQTG  299

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
               FLWVVR +E++KLPSN+  +    G+I NW PQL VL+H+++GCF+THCGWNSTLEAL
Sbjct  300   RNFLWVVRETEKNKLPSNYVEEIGEKGLIVNWSPQLQVLAHKSIGCFMTHCGWNSTLEAL  359

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK--GERG  272
             SLGV ++ MP ++DQPTNAK++ DVW VG+RV   +NG VT+EE+ RC+ EVM+   E+G
Sbjct  360   SLGVALIGMPAYSDQPTNAKFIEDVWKVGVRVKTDKNGFVTKEEIVRCVGEVMEEMSEKG  419

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +++NA K  + A+EA+ EGG+SDKNI EF++ I
Sbjct  420   KEVRKNARKLMEFAREALSEGGNSDKNIDEFIAKI  454



>ref|XP_011082053.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Sesamum indicum]
Length=458

 Score =   404 bits (1038),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 206/451 (46%), Positives = 283/451 (63%), Gaps = 17/451 (4%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL----IRVESIPD  1319
             H L++ +P+ GH+ PM+Q SKRL  +G   T IT   T + ++ +         VE+  D
Sbjct  11    HCLLVSFPLQGHVNPMLQFSKRLHHKGR--TRITLAVTKSFLKTAQDFPAISFPVEAFSD  68

Query  1318  GVKPDSGFDA------ISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             G   D GFD       I     ++ S  L +++ K+  SG  +  ++YD   PW  D+  
Sbjct  69    GF--DDGFDEKFGPEEIYKRCWEVGSATLVQLVEKLRSSGSGVDCLIYDPFYPWALDVAK  126

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPS-MPPLGLNDLPSFVRNKSS  980
             + GL AA F +QS +V ++Y H  +  L  P   + V +P  +P L   D PSF+R+  S
Sbjct  127   KFGLTAAMFFTQSNSVNSIYFHAHKGELKLPLSEAEVRIPGGLPALKPEDTPSFIRDYES  186

Query  979   YSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKR  800
                    +  +  N +  DW+  NTF ELE+EV +WMA   P++  AIGP +PSMY+DKR
Sbjct  187   DPVRSELMTQQFRNVEIVDWIFVNTFHELEQEVCDWMAKFLPVR--AIGPTIPSMYIDKR  244

Query  799   VRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCK  620
             + DD  YG+S FKP  + CM+WL +Q   SV+Y SFGS A    EQM E+A  L  S   
Sbjct  245   LPDDREYGISAFKPVTDPCMKWLKNQPNRSVIYASFGSFAQPGKEQMEELALALKMSNMN  304

Query  619   FLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             FLWVVR+SE++KLP N+  + S  G+I  WC QLDVL+H+A+GCF+THCGWNSTLE LSL
Sbjct  305   FLWVVRASEEAKLPKNYREETSEKGLIITWCNQLDVLAHEAIGCFVTHCGWNSTLETLSL  364

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
             GVP+VA+PQW+DQ TNAK + DVW VGIR    + G+V   E+ RCL  V++GE G  ++
Sbjct  365   GVPMVALPQWSDQSTNAKLVSDVWRVGIRAQPDDKGIVGNAEIVRCLKHVVEGETGEEIR  424

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              +A KWK+LA+EAVDEGGSSD+NI+EFVSA+
Sbjct  425   RSAMKWKKLAREAVDEGGSSDRNIEEFVSAL  455



>ref|XP_010469679.1| PREDICTED: UDP-glycosyltransferase 74D1 [Camelina sativa]
Length=456

 Score =   404 bits (1038),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 212/455 (47%), Positives = 300/455 (66%), Gaps = 21/455 (5%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             ++VLV  +PI GHI P++Q SKRL S+ V VT +T +ST   I   +      ++P    
Sbjct  7     ANVLVFSFPIQGHINPLLQFSKRLISKNVTVTFLTTSSTHKSILRRAIAGGATALPLSFV  66

Query  1309  P-DSGF-------DAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             P D GF       D   D+       VS +L+E++S +         VVYDS +P+V D+
Sbjct  67    PIDDGFEEGHPSTDTSPDYFSKFQENVSRSLSELISSMDPKP---NAVVYDSCLPYVLDV  123

Query  1162  VHQL-GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNK  986
               +  G+ AA+F +Q+  V A+Y H  +         + V LP+MPPL  NDLP F+ + 
Sbjct  124   CRKHPGVAAASFFTQNSTVNAIYVHFLRGEFKEFQ--NDVVLPAMPPLKGNDLPVFLYDN  181

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
             +    L   + S+ +N    D+ L N+FDELE EVL+WM +Q+P+K   IGP++PSMYLD
Sbjct  182   NLCRPLFELISSQFINVDDIDFFLVNSFDELEVEVLQWMKNQWPVK--NIGPMIPSMYLD  239

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+  D +YG++LF    N+C++WLDS+   SV+YVSFGSLA LKD+QM EVA GL Q+ 
Sbjct  240   KRLGGDKDYGINLFNAQVNECLDWLDSKPPSSVIYVSFGSLAVLKDDQMIEVAAGLKQTG  299

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
               FLWVVR +E++KLPSN+  +    G+I NW PQL VL+H+++GCF+THCGWNSTLEAL
Sbjct  300   HNFLWVVRETEKNKLPSNYIEEIGEKGLIVNWSPQLQVLAHKSIGCFMTHCGWNSTLEAL  359

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK--GERG  272
             SLGV ++ MP ++DQPTNAK++ DVW VG+RV A +NG VT+EE+ RC+ EV++   E+G
Sbjct  360   SLGVALIGMPAYSDQPTNAKFIEDVWKVGVRVKADQNGFVTKEEIVRCVGEVVEEMSEKG  419

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +++NA K  + A+EA+ EGG+SDKNI EF++ I
Sbjct  420   KEVRKNARKLMEFAREALSEGGNSDKNIDEFIAKI  454



>emb|CDY15551.1| BnaA08g28350D [Brassica napus]
Length=376

 Score =   400 bits (1029),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 192/370 (52%), Positives = 261/370 (71%), Gaps = 6/370 (2%)
 Frame = -3

Query  1264  VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTD  1085
             +   L E++  +  SG +   +VYDS MPW+ D+ H  GLR A+F +Q   V A+Y+H  
Sbjct  8     IKKRLPELIQDMKLSGNIPKALVYDSTMPWLLDVAHDHGLRGASFFTQPWLVSAIYYHVF  67

Query  1084  QENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADWL  917
             + + T P+      +  S PS P L  NDLPSF+   SSY ++LR V+ +  N  + D +
Sbjct  68    KGSFTVPSTKYGHSTLASFPSFPMLNANDLPSFLCESSSYPNILRVVVDQLSNIDRVDIV  127

Query  916   LFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCME  737
             L NTFD+LE+++L+W+ S +P  V+ +GP LPSMYLDKR+ +D NYG SLF   + +C+E
Sbjct  128   LCNTFDKLEEKLLKWVKSMWP--VLNVGPTLPSMYLDKRLSEDKNYGFSLFTAKSTECIE  185

Query  736   WLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDK  557
             WL+S++  SVVYVSFGSL  L ++QM E+A GL QS C FLWVVR +E  K+P N+  + 
Sbjct  186   WLNSKQPSSVVYVSFGSLVILNEDQMMELATGLKQSGCFFLWVVRETETDKIPKNYVEEI  245

Query  556   SGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLV  377
                G+I +W PQL+VL+H++VG F+THCGWNSTLE LSLGVP++ MP WTDQPTNAK++ 
Sbjct  246   GEKGLIVSWSPQLEVLAHESVGSFLTHCGWNSTLEGLSLGVPMIGMPHWTDQPTNAKFVE  305

Query  376   DVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDEGGSSD  197
             DVW VG+RV A  +G V REE+ RC+VEVM+GE+G  +++NA KWK L KEAV EGGSSD
Sbjct  306   DVWKVGVRVKAEGDGFVRREEIVRCVVEVMEGEKGKEIRKNAEKWKMLVKEAVSEGGSSD  365

Query  196   KNIKEFVSAI  167
             K+I EFVS +
Sbjct  366   KSIDEFVSIV  375



>ref|XP_007199830.1| hypothetical protein PRUPE_ppa005475mg [Prunus persica]
 gb|EMJ01029.1| hypothetical protein PRUPE_ppa005475mg [Prunus persica]
Length=459

 Score =   404 bits (1037),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 223/458 (49%), Positives = 310/458 (68%), Gaps = 11/458 (2%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSS---L  1343
             E  + +   H LV+PYP  GHI PM+Q +K L+ +GV VT++T       +  S+S    
Sbjct  2     ERGQRAYKGHCLVLPYPSQGHINPMLQFAKLLSHKGVKVTLVTTRYIHKTMYGSASSCIA  61

Query  1342  IRVESIPDGV-KPDSGFDAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPW  1175
             + +E+I DG  +   G  +I  +L+      S  LAE++ K++ SG  +  VVYD+ MPW
Sbjct  62    LDLETISDGYDEAGRGKASIDAYLESFWKEGSKTLAELLEKLSSSGPPVECVVYDAFMPW  121

Query  1174  VADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAP--TEGSTVSLPSMPPLGLNDLPS  1001
               D+  + G+  A F +QSCAV  +Y+H  +  L  P   + S +SLP +PPL   DLPS
Sbjct  122   PLDVARKFGIAGATFFTQSCAVSNIYYHVHKGLLKVPLADDQSLISLPGLPPLDPLDLPS  181

Query  1000  FVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLP  821
             FV +     +  R V+ +  N  KADW+L NTF ELE++V++W+A  +PL+ +  GP +P
Sbjct  182   FVYDLEYCPAFYRVVVGQFSNVDKADWVLCNTFYELEEQVVDWLAKFWPLRTV--GPTIP  239

Query  820   SMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQG  641
             S YLD+R+ DD  YG++LFK +N+ C++WL+ +  GSV YVSFGS A L DEQM E+A G
Sbjct  240   SKYLDERLEDDKEYGVNLFKSDNDACIKWLNERPKGSVAYVSFGSTAKLDDEQMEELAWG  299

Query  640   LIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNS  461
             L +SK  FLWVVR+SE +K+P  F  + S  G++ +WC Q++VL H+AVGCF+THCGWNS
Sbjct  300   LRRSKSNFLWVVRASEAAKVPKGFIEETSEKGLVVSWCSQMEVLVHEAVGCFVTHCGWNS  359

Query  460   TLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKG  281
             TLEALSLGVP++AMPQWTDQ TNAK+++DVW +GI   + E G V +E VE C+ E+M+G
Sbjct  360   TLEALSLGVPMLAMPQWTDQRTNAKFIMDVWKIGITAPSDEKGKVRQEVVEHCISEIMEG  419

Query  280   ERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             ERG  +K NA KWK+LAK+AVDEGGSSDKNI EF+S +
Sbjct  420   ERGKEMKINALKWKKLAKKAVDEGGSSDKNIDEFISKL  457



>gb|EYU36667.1| hypothetical protein MIMGU_mgv1a006023mg [Erythranthe guttata]
Length=461

 Score =   403 bits (1036),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 209/447 (47%), Positives = 293/447 (66%), Gaps = 9/447 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSS-SLIRVESIPDG--  1316
              +LV+PYP  GH+ P +  +K LAS+G+ +TVI  T+ S   + SS S I +E+I DG  
Sbjct  14    RILVVPYPAPGHLNPALAFAKYLASKGLSITVIITTNLSKSAKFSSCSSITIENISDGSE  73

Query  1315  -VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRA  1139
              VK     +     LK ++S NLA  + +    G     ++YDSIMPWV D+ H  GL  
Sbjct  74    EVKEPESIEGYFKRLKTVLSQNLANFIDEQKSRGSCAKLIMYDSIMPWVLDVAHVRGLLG  133

Query  1138  AAFNSQSCAVFAVYHHTDQENLTAPTE---GSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             A+F +Q+C V A+Y+H  Q +L  P +      +SLPS+P L   DLP F     +  ++
Sbjct  134   ASFFTQACGVCAIYYHMKQGSLRIPRDEEDSRLLSLPSLPTLETRDLPCFTGIGGASQTV  193

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
                +  +  N  + DW+ FNTFD LE EV++WMA  +P+K +  GP    +  D+++ D+
Sbjct  194   QTLLADQFSNLDQVDWIFFNTFDNLEYEVVDWMAKLWPIKTV--GPTFALLQKDEKLSDN  251

Query  787   DNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWV  608
              ++ +SLF+PN   C EWLDS+ET SVVYVSFGS+A+L+ EQM E+A GLI S   FLWV
Sbjct  252   KSHMISLFEPNTTTCKEWLDSKETASVVYVSFGSIASLRKEQMEELANGLIMSNRHFLWV  311

Query  607   VRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPV  428
             VR+SE  KLP NF    S  G+I  WC Q++VL+H+A+ CF+THCGWNSTLEAL  GVP+
Sbjct  312   VRASEMEKLPPNFTSLTSEKGLIVEWCHQMEVLAHRALACFMTHCGWNSTLEALINGVPL  371

Query  427   VAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAA  248
             +AM    DQ TN+K++ DVW VG+RV +GENG+V REE+  C+ EV +G++GV +K NA 
Sbjct  372   IAMAWQIDQTTNSKFIEDVWGVGVRVKSGENGIVGREEIATCIEEVTQGDKGVEIKTNAC  431

Query  247   KWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             KWK+LA EAV++GG+S  NI++FVS +
Sbjct  432   KWKELANEAVEKGGTSANNIEDFVSKL  458



>gb|EYU41208.1| hypothetical protein MIMGU_mgv1a025741mg [Erythranthe guttata]
Length=467

 Score =   403 bits (1035),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 204/462 (44%), Positives = 304/462 (66%), Gaps = 26/462 (6%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL---IRVESIPD  1319
             +H++V+PY   GH+ PM+Q SKRL+S+G+ +T+ T  S +  IQ  +SL   I  ESI D
Sbjct  9     AHIVVLPYHGQGHLNPMLQFSKRLSSKGIKITLATTLSNTKSIQEDASLFASIDFESIYD  68

Query  1318  -----GVKPDSGFDAISDWLKDLVSNNLAEIMSKVT----GSGCLLTTVVYDSIMPWVAD  1166
                  GV    GF    D  + + S NL +++ ++     G+ C+   ++YD+ + W ++
Sbjct  69    DLTHGGVAAPGGFKGFLDRFEAVGSRNLIDLIKRIQDSSDGNNCV-KCLIYDANISWASN  127

Query  1165  LVHQLG-LRAAAFNSQSCAVFAVYH--HTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFV  995
             + +++G +   AF +QSCA  A  +  H D   ++ P+ G   S+  +P L + +LPS  
Sbjct  128   VANEVGNIAMGAFFTQSCAFVAQCYPMHCDLFGVS-PSMGPLASIFDLPELHIPNLPSLG  186

Query  994   RNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSM  815
                  Y  ++R++L +  N +KADW+LFN+F  LE+EV+ WM+  +P++   IGP LPS+
Sbjct  187   AETGCYPPIIRYILRQFDNCEKADWILFNSFHHLEEEVINWMSKIWPVR--PIGPTLPSI  244

Query  814   YLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLI  635
             YLD RV+DD+NYG ++ KPN   CM+WLDS++T SV+Y+SFGS A+L  +Q+ E+A  L+
Sbjct  245   YLDNRVKDDNNYGFNIHKPNTETCMKWLDSKKTRSVIYISFGSAASLNADQISEIANALL  304

Query  634   QSKCKFLWVVRSSEQSKLPSNFWPDK------SGAGIITNWCPQLDVLSHQAVGCFITHC  473
             QSK  FLWVV+ SE+ KLP++F  D+      S  G++  W PQL VL H ++GCF++HC
Sbjct  305   QSKNSFLWVVKPSEEDKLPAHF-KDRIKNCFYSDKGLVVKWAPQLAVLRHGSIGCFVSHC  363

Query  472   GWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVE  293
             GWNST+EA+SLGV VVAMPQ+ DQ TNA ++  +W VGI     ENG   R+E+ RC+ E
Sbjct  364   GWNSTMEAISLGVGVVAMPQFLDQMTNAYFVEHIWHVGINPKTDENGCCARDEIHRCIEE  423

Query  292   VMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +M GERG ++K+N A+WK LAKEA+DEGGSSDK I E ++ +
Sbjct  424   IMHGERGEVIKKNVARWKALAKEAIDEGGSSDKCIDEIIARL  465



>ref|XP_002879339.1| hypothetical protein ARALYDRAFT_482098 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55598.1| hypothetical protein ARALYDRAFT_482098 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   402 bits (1033),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 213/455 (47%), Positives = 296/455 (65%), Gaps = 21/455 (5%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             ++VLV  +PI GHI P++Q SKRL S+ V VT +T +ST   I   +      ++P    
Sbjct  7     ANVLVFSFPIQGHINPLLQFSKRLLSKNVTVTFLTTSSTHNSILRRAIAGGATALPLSFV  66

Query  1309  P-DSGF-------DAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             P D GF       D   D+       VS +L+E++S +         VVYDS +P+V D+
Sbjct  67    PIDDGFEEGHPSTDTSPDYFAKFQENVSRSLSELISSMEPKP---NAVVYDSCLPYVLDV  123

Query  1162  VHQL-GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNK  986
               +  G+ AA+F +QS  V A+Y H  +         + V LP+MPPL  NDLP F+ + 
Sbjct  124   CRKHPGVAAASFFTQSSTVNAIYIHFLRGAFKEFQ--NDVVLPAMPPLKGNDLPVFLYDN  181

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
             +    L   + S+ +N    D+ L N+FDELE EVL+WM +Q+P+K   IGP++PSMYLD
Sbjct  182   NLCRPLFELISSQFVNVDDIDFFLVNSFDELEVEVLQWMKNQWPVK--NIGPMIPSMYLD  239

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+  D +YG++LF    N+C++WLDS+  GSV+YVSFGSLA LKD+QM EVA GL Q+ 
Sbjct  240   KRIAGDKDYGINLFNAQVNECLDWLDSKPPGSVIYVSFGSLAVLKDDQMIEVAAGLKQTG  299

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
               FLWVVR +E  KLPSN+  +    G+I NW PQL VL+H++VGCF+THCGWNSTLEAL
Sbjct  300   HNFLWVVRETETKKLPSNYIEEIGEKGLIVNWSPQLQVLAHKSVGCFMTHCGWNSTLEAL  359

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK--GERG  272
             SLGV ++ MP +++QPTNAK++ DVW VG+RV A +NG V +EE+ RC+ EVM+   E+G
Sbjct  360   SLGVALIGMPAYSEQPTNAKFIEDVWKVGVRVKADQNGFVMKEEIVRCVGEVMEDMSEKG  419

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               ++ NA +  + A+EA+ EGG+SD NI EFV+ I
Sbjct  420   KEIRTNARRLMEFAREALSEGGNSDMNIDEFVAKI  454



>ref|XP_007133505.1| hypothetical protein PHAVU_011G184600g [Phaseolus vulgaris]
 gb|ESW05499.1| hypothetical protein PHAVU_011G184600g [Phaseolus vulgaris]
Length=457

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 207/446 (46%), Positives = 286/446 (64%), Gaps = 14/446 (3%)
 Frame = -3

Query  1480  LVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKPDS  1301
             LV+ YP  GHI P++Q SKRL   GV VT++T       I    + I +E   DG   D 
Sbjct  15    LVLAYPHQGHINPLLQFSKRLQHDGVRVTLVTTHFYCKTIPKLPASITLEGFSDGF--DD  72

Query  1300  GFDAISDWLKDLVS-------NNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLR  1142
             G  A ++ +K  +          L+E++ ++  SG  +  VVYDS +PW  D+  + GL 
Sbjct  73    GGIAEAESIKAYLDRFWKVGPQTLSELLQRLITSGNPIHCVVYDSFLPWTLDIAKKHGLT  132

Query  1141  AAAFNSQSCAVFAVYHHTDQENLTAPTEGSTV-SLPSMPPLGLNDLPSFVRNKSSYSSLL  965
              A F +Q   V  VYHH  + NL  P E S V SLP +P L   DLPSF+ +  +YS+  
Sbjct  133   CAVFLTQPLFVNCVYHHVQKGNLKVPLENSNVISLPGLPLLQPFDLPSFIYSYGTYSASF  192

Query  964   RFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDD  785
               VL++  N ++A W+L NTF +LEKEV +W+   +P K+  IGP +PSM+LDKR +DDD
Sbjct  193   ELVLNQFSNIKEAHWVLCNTFYDLEKEVADWLMKIWP-KLKTIGPTIPSMFLDKRDKDDD  251

Query  784   NYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVV  605
              YG SLFK  + +C++W+D +  GS+VYVSFGS + L +EQM EVA GL +S C FLWVV
Sbjct  252   EYGFSLFK--SEECVKWMDEKPKGSIVYVSFGSFSTLSEEQMEEVAFGLQESGCNFLWVV  309

Query  604   RSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVV  425
             R++E  K+P  F    S  G++  WC QL VL H+AVGCF+THCGWNSTLEALSLGVP++
Sbjct  310   RATEMGKIPKGF-ERNSENGLVVTWCSQLKVLEHEAVGCFVTHCGWNSTLEALSLGVPMI  368

Query  424   AMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAK  245
             AMPQWTDQ TNAK + D+W +G+RV   + G+   E ++  + E+M+ E G  +K+ A +
Sbjct  369   AMPQWTDQTTNAKLIEDIWKIGLRVSPDDKGVFRGEALKHAIKEIMETEIGKEIKKKAIQ  428

Query  244   WKQLAKEAVDEGGSSDKNIKEFVSAI  167
             WK LA ++VDEGGSS  NI+EF+ ++
Sbjct  429   WKNLAAKSVDEGGSSHMNIREFIDSL  454



>ref|XP_004292062.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Fragaria vesca 
subsp. vesca]
Length=463

 Score =   402 bits (1033),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 206/459 (45%), Positives = 298/459 (65%), Gaps = 16/459 (3%)
 Frame = -3

Query  1504  EMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQV----SSSLIR  1337
             E +  +H LV+ YP  GHI PM+Q +K L  +G+ VT++T       +Q+    SS  + 
Sbjct  2     ERTHKAHCLVLTYPTQGHINPMLQFAKFLHHKGLKVTLVTTHFLLNTLQLHAGSSSCNVA  61

Query  1336  VESIPDGVKPDSGF------DAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPW  1175
             +E+I DG   + G+      DA  +   ++    L +++ +++ S   +  +VYD+ MPW
Sbjct  62    LETISDGYD-EGGYAAAESADAYLNRFWEIGPLTLTKLLERMSSSEYPVDCIVYDAFMPW  120

Query  1174  VADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEG--STVSLPSMP-PLGLNDLP  1004
               D+  + G+  A F +QSCAV  +Y+H  +  +  P  G    + +P +  PL   D P
Sbjct  121   SLDVAKKFGIFGAVFFTQSCAVGNIYYHAHKGLMKLPVSGDDGEILIPGLQLPLEAVDFP  180

Query  1003  SFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLL  824
             S + +  S  ++   V+ +  N  +ADW+L NTF ELE EV++WM+  +PLK I  GP +
Sbjct  181   SSLCDLGSNHAVYDMVVGQFSNVDEADWVLCNTFYELEPEVVDWMSKLWPLKTI--GPTI  238

Query  823   PSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQ  644
             PSMYLD R+++D  YG++LFK N++ CM+WL+ Q   SVVYVSFGS + L  EQM E+A 
Sbjct  239   PSMYLDNRLKEDKGYGVNLFKQNHDACMKWLNEQPKDSVVYVSFGSGSELGAEQMEELAW  298

Query  643   GLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWN  464
             GL  S+  FLWVVR SE  K+P  F  + S  G++ +WCPQL+VL+H+AVGCFITHCGWN
Sbjct  299   GLRISRSNFLWVVRESEAGKIPEGFVEEISEKGLVVSWCPQLEVLAHEAVGCFITHCGWN  358

Query  463   STLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMK  284
             STLEALSLGVP++AMPQWTDQ TNAKY++DVW  G+R +  ENG+V ++ VE C+ E+M+
Sbjct  359   STLEALSLGVPLLAMPQWTDQGTNAKYIMDVWKTGLRALPDENGIVKKDVVELCISELME  418

Query  283   GERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             GE G   + NA KWK++A+ A+ EGGSS KNI EF++ +
Sbjct  419   GEIGKESRRNAMKWKEVARSAMAEGGSSAKNIDEFIAKV  457



>gb|KEH25946.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=461

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 197/450 (44%), Positives = 289/450 (64%), Gaps = 12/450 (3%)
 Frame = -3

Query  1492  VSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSS--SLIRVESIPD  1319
             + H L+IPYP  GHI PM+Q SKRL  +G+ VT++   S+S   +  +  + I  E+I D
Sbjct  9     IPHCLIIPYPTQGHINPMLQFSKRLLQKGLKVTLVNTISSSKTFKTINLNTSIEFETISD  68

Query  1318  GVKPDSGFDAIS------DWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             G   D G  A        +  +   S  L +++ K+T S   +  V++D+ +PWV D+  
Sbjct  69    GFD-DGGLTAAKNIETYIETFRRTGSQTLTQLLHKLTKSNNSIDCVIHDAFLPWVVDVAK  127

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSY  977
             +  L  A F +Q+C V ++  H  +  L  P     + LP +P L   DLPSF+    ++
Sbjct  128   EFELYVAVFLTQACCVNSINFHAFKGWLDLPLLEKEIVLPGLPKLEAADLPSFLYKYGTH  187

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
                   + ++     + DW+L NTF ELE EV++W+   + LK   IGP +PSM+LD+R+
Sbjct  188   PGYFDILTNQFSMIDQVDWVLANTFYELEPEVVDWLKKIWSLK--TIGPCVPSMFLDRRI  245

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
             +DD++YG+++F PN+  C++WLD +  GSVVYVSFGS ++L ++Q  E+A GL      F
Sbjct  246   QDDNDYGINIFNPNSESCIKWLDDKPKGSVVYVSFGSRSSLSEDQTEEIAYGLKNCGRFF  305

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             +WVVR SE+SK+P  F  +    G+I  WC QL+V +H+AVGCF+THCGWNSTLEALSLG
Sbjct  306   IWVVRESEKSKIPKGF-SETLEKGLIVTWCQQLEVFAHEAVGCFVTHCGWNSTLEALSLG  364

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP++AMP WTDQ TNAK++VDVW + ++ +  E G+V RE +E C+ E+M+ E+G  LK 
Sbjct  365   VPMIAMPIWTDQITNAKFIVDVWKIAVKGVGDEKGVVRRESIEDCIREIMETEKGNELKN  424

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA KWK ++K++VDEGGSSDKNI EFV+ +
Sbjct  425   NAIKWKNVSKKSVDEGGSSDKNIVEFVNEL  454



>ref|XP_006342195.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Solanum tuberosum]
Length=468

 Score =   402 bits (1032),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 216/465 (46%), Positives = 293/465 (63%), Gaps = 26/465 (6%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ--VSSSLI  1340
             E   +    H++V+     GHI PM+Q SKRLAS+G+ +TV T  S +  ++  +S S+I
Sbjct  2     EQGRVEKAHHIVVLADQGQGHINPMLQFSKRLASKGIKITVATTLSNAKSMKTTLSYSMI  61

Query  1339  RVESIPD-----GVKPDSGFDAISDWLKDLVSNNLAE-IMSKVTGSGCLLTTVVYDSIMP  1178
               ESI D     GV    GF    D  +   S NL   I+       CL    VYD+ +P
Sbjct  62    TFESIYDDCSQGGVVGPGGFKGFLDRFQASGSTNLTRFILDHEHPVKCL----VYDANIP  117

Query  1177  WVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPS------MPPLGL  1016
             W + +  QLG+  AAF +QSCA  A Y+    E      E + +S+PS      +P L  
Sbjct  118   WASKITTQLGIAGAAFFTQSCATAATYYPMYCEVY----EKTPLSMPSFPVITGLPKLRF  173

Query  1015  NDLPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAI  836
              +LPS   +   Y  ++  +L +  N  KADW+LFN+FD+LE+EV+EWM   +   V+ I
Sbjct  174   PNLPSLGCSTGRYPPIIIHILGQFDNFGKADWVLFNSFDKLEEEVVEWMKKVW--NVVTI  231

Query  835   GPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMC  656
             GP LPS YLDKRV +D+ YG ++ KPN+++CMEWLDS++TGSVVYVSFGS ANL  EQ+ 
Sbjct  232   GPTLPSFYLDKRVENDNEYGFNIHKPNSSNCMEWLDSKKTGSVVYVSFGSAANLCAEQIT  291

Query  655   EVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITH  476
             E+A  L QS   FLWVV+  EQSKLP +F  + SG G++  WC QL+VL+H A+GCFI+H
Sbjct  292   ELADALRQSNIMFLWVVKPDEQSKLPIDFSKETSGKGLVVTWCSQLEVLAHHAIGCFISH  351

Query  475   CGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGEN--GMVTREEVERC  302
             CGWNSTLEA+S GVP+VAMPQ  DQ  NA +L  VW VG+   A E+  G+   EE+ RC
Sbjct  352   CGWNSTLEAISFGVPIVAMPQILDQIINAHFLEKVWSVGLIAKANEDEKGVTASEEIYRC  411

Query  301   LVEVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             + EV++GERG  +++N    K+LAKEA+D  GSSDK+I EF+S +
Sbjct  412   IREVLEGERGREIRKNITSLKELAKEAIDTSGSSDKHIDEFISQL  456



>ref|XP_010557055.1| PREDICTED: UDP-glycosyltransferase 74C1 [Tarenaya hassleriana]
Length=463

 Score =   401 bits (1031),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 202/448 (45%), Positives = 295/448 (66%), Gaps = 12/448 (3%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGV-K  1310
             HVLV PYPI GHI PM+QLSKRL+++G+ VT++  ++  +   V+   I + +I +G  +
Sbjct  15    HVLVFPYPIQGHINPMIQLSKRLSAKGLAVTLVVASNEQSDPYVAEYSISLRTIFNGFDQ  74

Query  1309  PDSGFDAI--SDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAA  1136
              D     +  +    D  S +L++ +     S      V+YD  MPW  D+   LGLRA 
Sbjct  75    HDHPLVMLRRTHRFNDCTSRSLSQFIQSEMLSERPPKAVIYDPFMPWALDVAKDLGLRAV  134

Query  1135  AFNSQSCAVFAVYHHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRNKSSYSSL  968
             A+ +Q  +V  +YHH ++     PT      +  S P++P L   DLPSF     SY  L
Sbjct  135   AYFTQPWSVNLIYHHINEGTYHVPTSRHDHPTLSSFPALPLLSQKDLPSFACESGSYPHL  194

Query  967   LRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDD  788
                V+S+  N ++AD +L NTFD+LE +V++WM  ++P+K   IGP++PS +LD R+ +D
Sbjct  195   FDLVVSQFSNFRRADCILCNTFDQLEDKVMKWMGKEWPVK--NIGPVVPSKFLDNRLPED  252

Query  787   DNYGLSLFKPN-NNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
              +YGL  F+P    D ++WL ++ + SVVYVS+G+LA L ++QM E+A G+ +S   FLW
Sbjct  253   KDYGLGHFRPKPGGDAIKWLQTKPSKSVVYVSYGTLAALDEKQMKEIAFGMRESGFSFLW  312

Query  610   VVRSSEQSKLPSNFWPD--KSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
              +R SE++KLP  F  +  K+  G++ NW  QL+VL+  +VGCF+THCGWNSTLEAL +G
Sbjct  313   SLRDSERNKLPHGFLEEVSKNDLGLVVNWTSQLEVLAQGSVGCFVTHCGWNSTLEALCMG  372

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             +P+V MPQWTDQPTNAK++ DVW VG+RV A ++G+V +EE+ RC+ EVM+GE G  +++
Sbjct  373   IPLVGMPQWTDQPTNAKFIEDVWKVGVRVKAEKDGLVKKEEISRCVREVMEGETGKEMRK  432

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
             NA KWK LA EAV EGGSSD+N+ EFV+
Sbjct  433   NAEKWKVLACEAVSEGGSSDRNLDEFVA  460



>ref|XP_006410305.1| hypothetical protein EUTSA_v10016638mg [Eutrema salsugineum]
 gb|ESQ51758.1| hypothetical protein EUTSA_v10016638mg [Eutrema salsugineum]
Length=456

 Score =   401 bits (1030),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 214/455 (47%), Positives = 293/455 (64%), Gaps = 21/455 (5%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             + VLV  +PI GHI P++Q SKRL S+ V VT +T +ST   I   +      ++P    
Sbjct  7     AKVLVFSFPIQGHINPLLQFSKRLISKNVAVTFLTTSSTHNTILRRAIAGGATALPLTFV  66

Query  1309  P-DSGF-------DAISDWLKDL---VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADL  1163
             P D GF       D   D+       VS +L++++S +         VVYDS  PWV D+
Sbjct  67    PIDDGFEEGHPSTDTSPDYFAKFEENVSRSLSQLISSMEPKP---NAVVYDSCTPWVLDV  123

Query  1162  VHQL-GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNK  986
               +  G+ AA+F +Q   V A+Y H  +       +   V L +MPPL  +DLP F+ + 
Sbjct  124   CRKHPGVAAASFFTQCSTVNAIYVHFLRGEFKEFQD--DVVLAAMPPLKGSDLPVFLYDN  181

Query  985   SSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLD  806
             +    L   + S+ +N    D+ L N+FDELE EVLEWM  Q+ +K   IGP++PSMYLD
Sbjct  182   NLCRPLFELISSQFVNVDDIDFFLVNSFDELEVEVLEWMKKQWQVK--NIGPMIPSMYLD  239

Query  805   KRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSK  626
             KR+  D  YG+SLF    N+C++WLDS+  GSV+YVSFGSLA LKD+QM EVA GL Q+K
Sbjct  240   KRLEGDKEYGISLFNAQVNECLDWLDSKPPGSVIYVSFGSLAVLKDDQMLEVAAGLKQTK  299

Query  625   CKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEAL  446
               FLWVVR +E  KLPSN+  +    G+I +W PQL VL+H+++GCF+THCGWNSTLEAL
Sbjct  300   HNFLWVVRETETKKLPSNYIEELGEKGLIVSWSPQLQVLAHKSIGCFMTHCGWNSTLEAL  359

Query  445   SLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM--KGERG  272
             SLGV ++ MP ++DQPTNAK++ DVW VG+RV A ++G VT+EE+ RC+ EVM  K E+G
Sbjct  360   SLGVALIGMPAYSDQPTNAKFIEDVWKVGVRVKADKDGFVTKEEILRCVGEVMEEKSEKG  419

Query  271   VMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
               +++NA +  + AKEA+ EGG+SDKNI EFV+ I
Sbjct  420   KEIRKNAERLMEFAKEALSEGGNSDKNIDEFVAKI  454



>gb|ACR10263.1| UDP-glucosyl transferase 74c1 [Brassica rapa subsp. pekinensis]
Length=456

 Score =   401 bits (1030),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 207/458 (45%), Positives = 293/458 (64%), Gaps = 17/458 (4%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL-IRV  1334
             M+E S   HVLV PYP  GHI PM+QLSKRL+ +G+ VT+I  ++       S    I V
Sbjct  1     MSEAS--GHVLVFPYPFQGHINPMIQLSKRLSKKGLTVTLIIASNNHREPYTSDVYSITV  58

Query  1333  ESIPDGV----KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVAD  1166
              +I DG      P + F+    ++    + +L + +S+   +      ++YD  MP+  D
Sbjct  59    HTIYDGFLSHEHPQTKFNEPQRFISS-TTRSLTDFISRDKLTSNPPKALIYDPFMPFALD  117

Query  1165  LVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTE----GSTVSLPSMPPLGLNDLPSF  998
             +  +LGL   A+++Q      VY+H ++     P +     +  S P+ P L  NDLPSF
Sbjct  118   VAKELGLYVVAYSTQPWLASLVYYHINEGTYDVPDDRHENPTLASFPAFPLLSQNDLPSF  177

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
              R K SY  L   V+S+  N ++AD +L NTFD+LE +V++WM+ Q+P+K   IGP++PS
Sbjct  178   AREKGSYPLLFELVVSQFSNLRRADLILCNTFDQLEPKVVKWMSDQWPVK--NIGPMVPS  235

Query  817   MYLDKRVRDDDNYGLSLFKPNNND-CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQG  641
              +LD R+ +D +Y L  FK   ++  + WL S+   SVVYV+FG+LA+L D+QM E A  
Sbjct  236   KFLDNRLLEDKDYDLGDFKTEPDESVLRWLASKPAKSVVYVAFGTLASLSDKQMKETAAA  295

Query  640   LIQSKCKFLWVVRSSEQSKLPSNFWPD--KSGAGIITNWCPQLDVLSHQAVGCFITHCGW  467
             + Q+   FLW VR SE+SKLPS F  +  +   G++  W PQL+VLSH + GCF+THCGW
Sbjct  296   IRQTGYSFLWSVRDSERSKLPSGFVEEALEKDYGLVAKWVPQLEVLSHDSTGCFVTHCGW  355

Query  466   NSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM  287
             NSTLEAL LGVP+V MPQWTDQPTNAK++ DVW +G+RV A E G V++EE+ RC+VEVM
Sbjct  356   NSTLEALCLGVPLVGMPQWTDQPTNAKFIEDVWKIGVRVKADEEGFVSKEEIARCVVEVM  415

Query  286   KGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
              GE+G  +++N  K K LA+EA+ EGG+SDKNI EFV+
Sbjct  416   DGEKGKEMRKNVEKLKVLAREAISEGGTSDKNIDEFVA  453



>ref|XP_009141182.1| PREDICTED: UDP-glycosyltransferase 74C1-like [Brassica rapa]
Length=456

 Score =   400 bits (1028),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 207/458 (45%), Positives = 292/458 (64%), Gaps = 17/458 (4%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL-IRV  1334
             M+E S   HVLV PYP  GHI PM+QLSKRL+ +G+ VT+I  ++       S    I V
Sbjct  1     MSEAS--GHVLVFPYPFQGHINPMIQLSKRLSKKGLTVTLIIASNNHREPYTSDVYSITV  58

Query  1333  ESIPDGV----KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVAD  1166
              +I DG      P + F+    ++    + +L + +S+   +      ++YD  MP+  D
Sbjct  59    HTIYDGFLSHEHPQTKFNEPQRFISS-TTRSLTDFISRDKLTSNPPKALIYDPFMPFALD  117

Query  1165  LVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTE----GSTVSLPSMPPLGLNDLPSF  998
             +  +LGL   A+++Q      VY+H ++     P +     +  S P+ P L  NDLPSF
Sbjct  118   VAKELGLYVVAYSTQPWLASLVYYHINEGTYDVPDDRHENPTLASFPAFPLLSQNDLPSF  177

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
              R K SY  L   V+S+  N ++AD +L NTFD+LE +V++WM+ Q+P+K   IGP++PS
Sbjct  178   AREKGSYPLLFELVVSQFSNLRRADLILCNTFDQLEPKVVKWMSDQWPVK--NIGPMVPS  235

Query  817   MYLDKRVRDDDNYGLSLFKPNNND-CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQG  641
              +LD R+ +D +Y L  FK   ++  + WL S+   SVVYV+FG+LA L D+QM E A  
Sbjct  236   KFLDNRLLEDKDYDLGDFKTEPDESVLRWLASKPAKSVVYVAFGTLAALSDKQMKETAAA  295

Query  640   LIQSKCKFLWVVRSSEQSKLPSNFWPD--KSGAGIITNWCPQLDVLSHQAVGCFITHCGW  467
             + Q+   FLW VR SE+SKLPS F  +  +   G++  W PQL+VLSH + GCF+THCGW
Sbjct  296   IRQTGYSFLWSVRDSERSKLPSGFVEEALEKDYGLVAKWVPQLEVLSHDSTGCFVTHCGW  355

Query  466   NSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM  287
             NSTLEAL LGVP+V MPQWTDQPTNAK++ DVW +G+RV A E G V++EE+ RC+VEVM
Sbjct  356   NSTLEALCLGVPLVGMPQWTDQPTNAKFIEDVWKIGVRVKADEEGFVSKEEIARCVVEVM  415

Query  286   KGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
              GE+G  +++N  K K LA+EA+ EGG+SDKNI EFV+
Sbjct  416   DGEKGKEMRKNVEKLKVLAREAISEGGTSDKNIDEFVA  453



>ref|XP_010679007.1| PREDICTED: UDP-glycosyltransferase 74E2-like [Beta vulgaris subsp. 
vulgaris]
Length=466

 Score =   400 bits (1029),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 212/465 (46%), Positives = 291/465 (63%), Gaps = 19/465 (4%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRV  1334
             E ++ +  +HVLV+P+P  GHI PM+Q SKRLAS+G+  T +TPT   A    ++++  +
Sbjct  2     EASKQAHKAHVLVVPFPGQGHINPMLQFSKRLASKGIKPT-LTPTVYIAKSMHTTTIPTL  60

Query  1333  ESIPDGVKPDS-GFD-----------AISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYD  1190
                P  ++P S G+D              D L+      L +++ K+   G  +  ++YD
Sbjct  61    YGPPIQLRPISDGYDDGGKNQAQSTAVYLDSLQVHGPKTLVQLVKKLIEEGDPVKAIIYD  120

Query  1189  SIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEG---STVSLPSMPPLG  1019
               +PW  D+  Q GL    F +QSC+V ++Y+H  +  +  P  G   STVS+P  P L 
Sbjct  121   GFLPWALDVAKQFGLLGVVFFTQSCSVNSIYYHVQRGLIQLPLLGPGPSTVSVPGAPELQ  180

Query  1018  LNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIA  839
               ++PSFV    SY      VL +  N  + DW+L N F ++EKEV++WMA  +  K+  
Sbjct  181   PWEVPSFVGQYGSYPFWFHVVLEQFSNIDQVDWVLCNIFYDMEKEVVDWMAKMW--KIRT  238

Query  838   IGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQM  659
             IGP +PS YLDKR+ DD +Y L  FKPN   C  WLDS+   SV+Y+SFGS A L +EQ 
Sbjct  239   IGPTVPSFYLDKRLEDDKDYNLQFFKPNTILCKNWLDSKPKHSVIYISFGSAAKLSEEQF  298

Query  658   CEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFIT  479
              E+AQGL  S   FLWVVR SEQ+KLP  F  + S  G++ +W  QL+VLSH+A  CF+T
Sbjct  299   EELAQGLKISNQTFLWVVRESEQAKLPKRFIDETSELGLVVSWASQLEVLSHEATCCFVT  358

Query  478   HCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGEN-GMVTREEVERC  302
             HCG+NS LEAL +GVPVV +PQ+TDQ TNAK++ DVW VGIR    EN G+V REEVE+C
Sbjct  359   HCGFNSVLEALCIGVPVVGVPQYTDQGTNAKFMEDVWRVGIRAKIDENKGIVRREEVEKC  418

Query  301   LVEVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             + E+M G++      N AKWK+LAK+A+DEGGSSDKNI EFV  +
Sbjct  419   IREMMGGKKKEEFMMNVAKWKKLAKQAMDEGGSSDKNIDEFVDYL  463



>ref|XP_009366234.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Pyrus x bretschneideri]
Length=469

 Score =   400 bits (1029),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 211/466 (45%), Positives = 303/466 (65%), Gaps = 34/466 (7%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ-VSSSLIRVESIPDGV  1313
             +HVLV+PYP  GHI P +Q SKR+AS+G+ VT+      +  +Q  SS  +  ++I DG 
Sbjct  9     AHVLVVPYPAQGHINPFLQFSKRVASKGIKVTLANTIFIANSLQPKSSGSVHFDTISDGY  68

Query  1312  KPDSGF---DAISDWLKDLV---SNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
               + GF   ++I ++L  +    S +LAE+++K   S   +  +VYD  +PW  ++  Q 
Sbjct  69    D-EGGFARAESIDEYLSRMEAVGSKSLAELITKHQNSPHPINCIVYDPFLPWALEVAKQF  127

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             G+ A AF +Q+C V  +Y+   +  LT        S+P +  L   DLPSF+    SY +
Sbjct  128   GVLAGAFFTQTCTVNYIYYLQHRGKLTVS------SIPGLHMLEPQDLPSFISVPGSYPA  181

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
                 VL++ LNT KAD++  NTF +LE+EV++ M+      ++ IGP +PS YLD  ++D
Sbjct  182   YFEMVLNQFLNTHKADFIFANTFYKLEQEVVDSMSKDCS-NLLTIGPTIPSAYLDNSIKD  240

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D +YGL LFK +++ C +WL+++  GSVVYV+FGS+ANL D+QM E+A GL +S   FLW
Sbjct  241   DKDYGLHLFK-SDSTCTDWLNTKPAGSVVYVAFGSMANLSDKQMEELAFGLKESGVHFLW  299

Query  610   VVRSSEQSKLPSNFWPDKS--GAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             VVR+SE++KLPS F  + S  G G++  W PQL+VLSH AVGCF TH GWNST+EALSLG
Sbjct  300   VVRASEEAKLPSKFVQETSNGGKGLVVKWSPQLEVLSHAAVGCFFTHGGWNSTIEALSLG  359

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMA---------------GENGMVTREEVERC  302
             VP++AMPQWTDQPTN+K +  VW VG+RV A                 NGMV REE++RC
Sbjct  360   VPMIAMPQWTDQPTNSKLVEAVWKVGVRVKAYHRDLYDQINDHDDENANGMVGREEIKRC  419

Query  301   LVEVMKGER-GVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             + +VM  ++ G  +K+NA KW++LA EAV +GG+SD NI++FVS +
Sbjct  420   IRKVMGDDKAGNEMKKNAKKWRELAIEAVSDGGTSDNNIQQFVSKL  465



>emb|CDY19104.1| BnaA04g18440D [Brassica napus]
Length=456

 Score =   400 bits (1027),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 206/458 (45%), Positives = 292/458 (64%), Gaps = 17/458 (4%)
 Frame = -3

Query  1510  MAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSL-IRV  1334
             M+E S   HVLV PYP  GHI PM+QLSKRL+ +G+ VT++  ++       S    I V
Sbjct  1     MSEAS--GHVLVFPYPFQGHINPMIQLSKRLSKKGLTVTLVIASNNHREPYTSDVYSITV  58

Query  1333  ESIPDGV----KPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVAD  1166
              +I DG      P + F+    ++    + +L + +S+   +      ++YD  MP+  D
Sbjct  59    HTIHDGFLSHEHPQTKFNEPQRFISS-TTRSLTDFISRDKLTSNPPKALIYDPFMPFALD  117

Query  1165  LVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTE----GSTVSLPSMPPLGLNDLPSF  998
             +  +LGL   A+++Q      VY+H ++     P +     +  S P+ P L  NDLPSF
Sbjct  118   VAKELGLYVVAYSTQPWLASLVYYHINEGTYDVPDDRHENPTLASFPAFPLLSQNDLPSF  177

Query  997   VRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPS  818
              R K SY  L   V+S+  N ++AD +L NTFD+LE +V++WM+ Q+P+K   IGP++PS
Sbjct  178   AREKGSYPLLFELVVSQFSNLRRADLILCNTFDQLEPKVVKWMSDQWPVK--NIGPMVPS  235

Query  817   MYLDKRVRDDDNYGLSLFKPNNND-CMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQG  641
              +LD R+ +D +Y L  FK   ++  + WL S+   SVVYV+FG+LA L D+QM E A  
Sbjct  236   KFLDNRLLEDKDYDLGDFKTEPDESVLRWLASKPAKSVVYVAFGTLAALSDKQMKETAAA  295

Query  640   LIQSKCKFLWVVRSSEQSKLPSNFWPD--KSGAGIITNWCPQLDVLSHQAVGCFITHCGW  467
             + Q+   FLW VR SE+SKLPS F  +  +   G++  W PQL+VLSH + GCF+THCGW
Sbjct  296   IKQTGYSFLWSVRDSERSKLPSGFVEEALEKDYGLVAKWVPQLEVLSHDSTGCFVTHCGW  355

Query  466   NSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVM  287
             NSTLEAL LGVP+V MPQWTDQPTNAK++ DVW +G+RV A E G V++EE+ RC+VEVM
Sbjct  356   NSTLEALCLGVPLVGMPQWTDQPTNAKFIEDVWKIGVRVKADEEGFVSKEEIARCVVEVM  415

Query  286   KGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
              GE+G  +++N  K K LA+EA+ EGG+SDKNI EFV+
Sbjct  416   DGEKGKEMRKNVEKLKVLAREAISEGGTSDKNIDEFVA  453



>ref|XP_010679010.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=464

 Score =   400 bits (1027),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 208/464 (45%), Positives = 287/464 (62%), Gaps = 18/464 (4%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSS-----  1349
             E A+    +HVLV+P+P  GHI PM Q SKRLAS+G+  T+      S  +Q  +     
Sbjct  2     EDAKQGQKAHVLVVPFPGQGHINPMFQFSKRLASKGIKPTLTPTIYISKSMQTHTIPTQY  61

Query  1348  -SLIRVESIPDGVKPDSGF---DAISDWLKDLV---SNNLAEIMSKVTGSGCLLTTVVYD  1190
                I++  I DG   D G+   ++   +L  +       LA+++ K+   G  +  V+YD
Sbjct  62    GPSIQIRPISDGYD-DGGYAQAESTKAYLDSIAIEGPKTLAQLIQKLAEEGDPVKAVIYD  120

Query  1189  SIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEG---STVSLPSMPPLG  1019
                PW  D+  + GL    F +QSC+V ++Y+H  +  +  P  G   +TVS+P +P L 
Sbjct  121   GFAPWALDVAKKFGLVGVLFFTQSCSVNSIYYHVQRGLIELPLLGPGPNTVSVPGVPELQ  180

Query  1018  LNDLPSFVRNKSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIA  839
               ++PSFV N  SY      V+ +  +  + DW+L N F ++E EV++WM+  +  KV  
Sbjct  181   PWEVPSFVENYGSYPFWFDAVMEQFSSIDQVDWVLCNIFYDMEIEVVDWMSKMW--KVKT  238

Query  838   IGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQM  659
             IGP +PS YLDKR+ DD +Y L LFKPN   C  WLDS+   SV+Y+SFGS A L +EQ 
Sbjct  239   IGPTVPSYYLDKRLEDDKDYSLQLFKPNTVLCKNWLDSKPKESVIYISFGSAAELSEEQF  298

Query  658   CEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFIT  479
              E++  L  S   FLWVVR  EQ+KLP  F  + S  G++  W  QLD+L+H+A GCF+T
Sbjct  299   EELSCSLRNSHNNFLWVVREKEQTKLPKRFIDETSKQGLVVGWASQLDILAHEATGCFVT  358

Query  478   HCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCL  299
             HCG+NS LE LSLGVPVVA+PQWTDQ TNAK++ DVW VG+R    E G+V +E +E C+
Sbjct  359   HCGFNSVLETLSLGVPVVAVPQWTDQGTNAKFVEDVWRVGVRAKVDEKGIVRKEMLEECI  418

Query  298   VEVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              EVM+GE     K+NAAKWK+LAKEA+ EGGSSDKNI EFV+ +
Sbjct  419   KEVMEGENREEFKKNAAKWKKLAKEAMYEGGSSDKNIDEFVAYV  462



>ref|XP_006447238.1| hypothetical protein CICLE_v10018164mg, partial [Citrus clementina]
 gb|ESR60478.1| hypothetical protein CICLE_v10018164mg, partial [Citrus clementina]
Length=428

 Score =   399 bits (1024),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 202/427 (47%), Positives = 276/427 (65%), Gaps = 19/427 (4%)
 Frame = -3

Query  1414  SRGVGVTVITPTSTSACIQ---VSSSLIRVESIPDGVKPDSGFDAISD-------WLKDL  1265
             ++ + VT++T    S  +     SS  I +E+I DG        A +D       W   L
Sbjct  4     AKEIKVTLVTTYFISKSLHRDPSSSISIPLETISDGYDEGRSAQAETDQAYVDRFWQIGL  63

Query  1264  VSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAVYHHTD  1085
                 L E++ ++    C    +VYDS +PW  D+  + GL  AAF +QSCAV  +YHH +
Sbjct  64    --QTLTELVERLNDVDC----IVYDSFLPWALDVAKKFGLIGAAFLTQSCAVAGIYHHMN  117

Query  1084  QENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNL-NTQKADWLLFN  908
             +  +  P  G  V +P + PL   D PSF+ + +SY +    +++R   N  KADW+L N
Sbjct  118   KGLIKLPLTGDQVLVPGLRPLDPQDTPSFINDSASYPAFFDMIITRQFSNIDKADWILCN  177

Query  907   TFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNNNDCMEWLD  728
             TF ELEKEV EW+   + L+ I  GP LPS+YLDK++ DD  YG S+F+P+    M+WL+
Sbjct  178   TFYELEKEVTEWLGKHWLLRTI--GPTLPSIYLDKQIEDDKEYGFSIFEPDIESSMKWLN  235

Query  727   SQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSNFWPDKSGA  548
              +  GSVVYVSFGS+A LK E+M E+  GL  S   FLWVVR SEQSKLP NF  + S  
Sbjct  236   DRANGSVVYVSFGSMATLKIEEMEELPCGLKASDKYFLWVVRESEQSKLPENFSDETSQK  295

Query  547   GIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTNAKYLVDVW  368
             G++ NWCPQL VL+H+A GCF+THCGWNSTLEALSLGVP+VAMP WTDQ TN+KY++DVW
Sbjct  296   GLVVNWCPQLGVLAHEATGCFLTHCGWNSTLEALSLGVPMVAMPLWTDQSTNSKYVMDVW  355

Query  367   DVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDEGGSSDKNI  188
              +G++V A E G+V RE +  C+ E+++G+R   +K+NA KW+  AKEAV +GGSSDKNI
Sbjct  356   KMGLKVPADEKGIVRREAIAHCISEILEGKRDKEIKQNADKWRNFAKEAVAKGGSSDKNI  415

Query  187   KEFVSAI  167
              +FV+ +
Sbjct  416   DDFVANL  422



>ref|XP_006442123.1| hypothetical protein CICLE_v10020092mg [Citrus clementina]
 gb|ESR55363.1| hypothetical protein CICLE_v10020092mg [Citrus clementina]
Length=457

 Score =   399 bits (1026),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 206/449 (46%), Positives = 295/449 (66%), Gaps = 14/449 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPT---STSACIQVSSSLIRVESIPD  1319
             +HVL++PYP  GHI P  Q +KRLAS+G+ +T+        T    Q S S +++++I D
Sbjct  9     AHVLIVPYPSQGHINPTFQFAKRLASKGLKITLAITNFIYKTKKPSQPSDS-VQIDTISD  67

Query  1318  GVKPDSGF---DAISDWLKDLV---SNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVH  1157
             G   D GF   ++I  +L+++    S  LAE+++K   S   +  VVYD+ + W  D+  
Sbjct  68    GYD-DGGFSEAESIDAYLQNMEVAGSKTLAELITKYKSSSNPIDCVVYDAFLYWALDVAK  126

Query  1156  QLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSY  977
               GL AAAF +Q+CAV  +Y+      L  P   + VS+P MP L L D+PSF+  +  Y
Sbjct  127   GFGLFAAAFFTQTCAVNFIYYLVHHGLLKLPVSTTPVSIPGMPLLELQDMPSFIGVQGQY  186

Query  976   SSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRV  797
              +    VL++  N  +AD +L NT+ +LE +V + M+   P+  + IGP LPS YLD R+
Sbjct  187   PAYFEMVLNQFSNADRADLVLVNTYYKLESQVADSMSKFCPM--VTIGPTLPSFYLDNRI  244

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              +D++Y L+LF  + +  M WL+++  GSVVYVSFGS+A L +EQ+ E+A GL +S   F
Sbjct  245   VNDNDYDLNLFTLDKSITMNWLNTKPEGSVVYVSFGSMACLANEQVEELAWGLKKSSFYF  304

Query  616   LWVVRSSEQS-KLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSL  440
             LWV+R +E++ KLP  F       G+I NW PQL+VLS++A+GCF +H GWNST+EALSL
Sbjct  305   LWVIRDTEETNKLPKGFVDGIGDKGLIVNWSPQLEVLSNKALGCFFSHAGWNSTIEALSL  364

Query  439   GVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLK  260
              VP+V MPQWTDQPT+AK++ DVW VG+RV   E+G+V R+E+ERC+ EVM+G+ G  ++
Sbjct  365   AVPMVVMPQWTDQPTDAKFVEDVWKVGVRVRVDEDGIVRRDEIERCIREVMEGQSGREMR  424

Query  259   ENAAKWKQLAKEAVDEGGSSDKNIKEFVS  173
              NA KW  LA EAV EGG+SDKNI EF+S
Sbjct  425   MNAKKWSDLAIEAVSEGGTSDKNIDEFIS  453



>ref|XP_008384038.1| PREDICTED: UDP-glycosyltransferase 74F2-like [Malus domestica]
Length=456

 Score =   399 bits (1025),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 207/453 (46%), Positives = 300/453 (66%), Gaps = 21/453 (5%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQ-VSSSLIRVESIPDGV  1313
             +HVLV+PYP  GHI P +Q SKR+AS+G+ VT+      +  +Q  SS  +  ++I DG 
Sbjct  9     AHVLVVPYPAQGHINPFLQFSKRVASKGIKVTLANTIFIANSLQPKSSGSVHFDTISDGY  68

Query  1312  KPDSGF---DAISDWLKDLV---SNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQL  1151
               + GF   ++I ++L  +    S  LAE+++K   S   +  +VYD  +PW  ++  Q 
Sbjct  69    D-EGGFARAESIDEYLSRMEAVGSKTLAELITKHQNSPHPINCIVYDPFLPWALEVAKQF  127

Query  1150  GLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSS  971
             G+ A AF +Q+C V  +Y+   +  LT        S+P +  L   DLPSF+    SY +
Sbjct  128   GVLAGAFFTQTCTVNYIYYLQHRGKLTVS------SIPGLHVLEPQDLPSFISVPGSYPA  181

Query  970   LLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRD  791
                 VL++ LNT KAD++  NTF +LE+EV++ M+      ++ IGP +PS YLD  ++D
Sbjct  182   YFEMVLNQFLNTHKADFIFANTFYKLEQEVVDSMSKDCS-NLLTIGPTVPSTYLDNSIKD  240

Query  790   DDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLW  611
             D +YGL LFK +++ C +WL+++  GSVVYV+FGS+ANL D+QM E+A GL +S   FLW
Sbjct  241   DKDYGLHLFK-SDSTCTDWLNTKPAGSVVYVAFGSMANLSDKQMXELAFGLKESGVHFLW  299

Query  610   VVRSSEQSKLPSNFWPDKS--GAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             VVR+SE++KLP  F  + S  G G++  W PQL+VLSH  VGCF TH GWNST+EALSLG
Sbjct  300   VVRASEEAKLPXKFVQETSNGGXGLVVKWSPQLEVLSHAXVGCFFTHGGWNSTIEALSLG  359

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGE--NGMVTREEVERCLVEVMKGER-GVM  266
             VP++AMPQWTDQPTN+K +  VW VG+RV   E  NG+V R+E++RC+ +VM  ++ G  
Sbjct  360   VPMIAMPQWTDQPTNSKLVEAVWKVGVRVKVDENANGIVGRDEIKRCIRKVMXDDKDGNE  419

Query  265   LKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             +K+NA KW++LA EAV +GG+SD NI++FVS +
Sbjct  420   MKKNAKKWRELAIEAVSDGGTSDNNIQQFVSKL  452



>ref|XP_010475279.1| PREDICTED: UDP-glycosyltransferase 74E2-like isoform X2 [Camelina 
sativa]
Length=433

 Score =   397 bits (1021),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 204/434 (47%), Positives = 280/434 (65%), Gaps = 11/434 (3%)
 Frame = -3

Query  1441  MVQLSKRLASRGVGVT-VITPTSTSACIQVSSSLIRVESIPDGV----KPDSGFDAISDW  1277
             M Q  KRLAS+G+ +T +I     S   +     I V  I +G     K     D I + 
Sbjct  1     MSQFCKRLASKGLKITLIIVSDKPSPPYKTEHDSITVVPISNGFQEGEKRSQDLDDIMER  60

Query  1276  LKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAVFAVY  1097
             ++  +   L +++  +  SG     +VYDS M W+ D+ H  GLR A F +Q   V  +Y
Sbjct  61    VQTSIKTRLPKLIEDMNLSGNPPRALVYDSTMSWLLDVAHSYGLRGAVFFTQPWLVSTIY  120

Query  1096  HHTDQENLTAPT----EGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLRFVLSRNLNTQK  929
             +H  + + + P+      +  S PS P L +NDLPSF+   SSY +LLR V+ +  N  +
Sbjct  121   YHVTKGSFSVPSTKYGHSALASFPSFPMLNMNDLPSFLCESSSYPNLLRVVIDQLSNIDR  180

Query  928   ADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKPNNN  749
              D +L NTF +LE+++L+W+ S +P  V+ IGP +PSMYLDKR+  D NYG SLF  N  
Sbjct  181   VDIILCNTFGKLEEKLLKWVQSLWP--VLNIGPTVPSMYLDKRLSSDKNYGFSLFDANVA  238

Query  748   DCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKLPSNF  569
             +C+EWL+S++  SVVYVS GSL  LK++QM E+A+GL QS   FLWVVR +E++KLP N+
Sbjct  239   ECVEWLNSKQPSSVVYVSLGSLVVLKEDQMMELAEGLRQSGHFFLWVVRETEKNKLPRNY  298

Query  568   WPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWTDQPTNA  389
               +    G+I +W PQLDVL+H++VGCF+THCGWNS LE LS GVP++ MP W DQPTNA
Sbjct  299   VEETGEKGLIVSWSPQLDVLTHESVGCFLTHCGWNSMLEGLSFGVPMIGMPHWADQPTNA  358

Query  388   KYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAKEAVDEG  209
             K++ DVW VG+RV A  NG V REE+ R + EVM+GE+G  +++N  KWK LA+EAV EG
Sbjct  359   KFMEDVWKVGVRVKADVNGFVRREEIVRRVGEVMEGEKGKEIRKNGEKWKVLAREAVSEG  418

Query  208   GSSDKNIKEFVSAI  167
             GSSDK+I EFVS  
Sbjct  419   GSSDKSINEFVSKF  432



>gb|AFJ52952.1| UDP-glycosyltransferase 1 [Linum usitatissimum]
Length=441

 Score =   397 bits (1020),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 208/440 (47%), Positives = 292/440 (66%), Gaps = 19/440 (4%)
 Frame = -3

Query  1441  MVQLSKRLASRGVGVTVITP--TSTSACIQVSSSLIRVESIPDGVKPDSGFDAISDWLKD  1268
             M+Q SKRL S+ + +T++     S +     S+S I +++I DG   D G  A ++  + 
Sbjct  1     MLQFSKRLLSKSIRITLVNTRFISKTISSTSSTSTINLDTISDGY--DDGGHAAAESTQA  58

Query  1267  LV-------SNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLRAAAFNSQSCAV  1109
              +       S  L+E++ K++ +      ++YD  +PW  D+  +LGL AA F +QSCAV
Sbjct  59    YLESFQKEGSKTLSELIQKLSKTEYPAHCIIYDPFLPWCLDVAKELGLFAAPFFTQSCAV  118

Query  1108  FAVYHHTDQENLTAPTEGSTVSL--PSMP-PLGLNDLPSFVRNKSSYSSLLRFVLSRNLN  938
              A+Y+H  + +L  P      SL  P +P PL  +D+PSF+ +  SY +    ++S+  N
Sbjct  119   DAIYYHVYKGSLKLPVTDQPQSLIIPGLPAPLEADDMPSFISDYGSYPAAFDMIISQFSN  178

Query  937   TQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDNYGLSLFKP  758
               KAD +L NT  +LE E  +W+++ +PL+ +  GP +PSMYLDK+++DD +YG S+FKP
Sbjct  179   IHKADCILCNTVYDLENETADWLSTIWPLRTV--GPTIPSMYLDKQLQDDRDYGFSIFKP  236

Query  757   NNNDCMEWLDSQE-TGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVRSSEQSKL  581
             NN  C+ WL++ +  GSV+YVSFGSLA+L  EQM E+A GL  S   FLWVVR+SE +KL
Sbjct  237   NNEACINWLNNNKPKGSVIYVSFGSLASLGAEQMEEIAHGLKNSNHYFLWVVRASEVAKL  296

Query  580   PSNFWPDKS--GAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVAMPQWT  407
             P NF  D    G G+I +WCPQL+VL H+AVGCF+THCGWNSTLE LSLGVP+VAMPQWT
Sbjct  297   PPNFAADVDIDGKGLIVSWCPQLEVLEHEAVGCFVTHCGWNSTLEGLSLGVPMVAMPQWT  356

Query  406   DQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKWKQLAK  227
             DQ TNAKY+ DVW +G+R    E G+V RE VE+CL  VM+GE G  +K NA KW+++ K
Sbjct  357   DQATNAKYIEDVWKMGVRCQKNEEGIVKREMVEKCLRGVMEGEEGKEMKRNADKWRKMMK  416

Query  226   EAVDEGGSSDKNIKEFVSAI  167
             EA  EGGSSD+NI +FV ++
Sbjct  417   EAAGEGGSSDRNISDFVDSL  436



>ref|XP_003624250.1| UDP-glucose glucosyltransferase [Medicago truncatula]
 gb|ABN08986.1| UDP-glucuronosyl/UDP-glucosyltransferase [Medicago truncatula]
 gb|AES80468.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=465

 Score =   398 bits (1022),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 199/445 (45%), Positives = 281/445 (63%), Gaps = 8/445 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDG---  1316
             H LV+PYP  GHI PM+Q SK L   G+ VT++T       +Q       +E+I DG   
Sbjct  11    HCLVLPYPAQGHINPMLQFSKDLQHEGIRVTLVTTLYHRKTLQSVPPSFTIETISDGFDN  70

Query  1315  --VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLR  1142
               V+   G+ A       +    LA+++ K    G  +  V+YDS  PW  D+  + G+ 
Sbjct  71    GGVEEAGGYKAYLGRFWQVGPKTLAQLIEKFGSLGDKVDCVIYDSFFPWALDVAKRFGIV  130

Query  1141  AAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLR  962
                + +Q+ +V ++Y+H   E L  P     +SLP +P L L D+ SF   K     LL 
Sbjct  131   GVTYLTQNMSVNSIYYHVHLEKLKVPLIEDVISLPLLPRLDLGDMSSFFSTKGENPVLLD  190

Query  961   FVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDN  782
              ++ +  N  KADW+L NTF ELEKEV++W    +P K   IGP +PSM+LD R +DD++
Sbjct  191   LLVGQFSNIDKADWVLCNTFYELEKEVVDWTMKIWP-KFRPIGPSIPSMFLDNRHKDDED  249

Query  781   YGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVR  602
             YG++ FK  N  CMEWL+ +  GSVVYVSFGS+ +L +EQ+ E+A GL  S   FLWVVR
Sbjct  250   YGVAQFK-YNEKCMEWLNDKPKGSVVYVSFGSMVSLDEEQIQELAYGLRDSGSYFLWVVR  308

Query  601   SSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVA  422
             +SE++KLP +F   +S   ++  WC QL VL+H+A+GCF+THCGWNSTLEALSLGVP +A
Sbjct  309   ASEENKLPKDF-EKESKKSLVVTWCSQLKVLAHEAIGCFVTHCGWNSTLEALSLGVPTIA  367

Query  421   MPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKW  242
             +PQW+DQ TNAK++ DVW +GIR    E  +V +++ + C++E+MKGE+G  +K NA +W
Sbjct  368   IPQWSDQRTNAKFIADVWKMGIRAPIDEKQIVRQDKFKDCILEIMKGEKGKEIKSNATQW  427

Query  241   KQLAKEAVDEGGSSDKNIKEFVSAI  167
             K LA  A +E GSS KNI EFV+++
Sbjct  428   KTLAVGAFEEHGSSQKNIIEFVTSL  452



>ref|XP_003624251.1| UDP-glucose glucosyltransferase [Medicago truncatula]
 gb|AES80469.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=457

 Score =   397 bits (1020),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 197/445 (44%), Positives = 282/445 (63%), Gaps = 8/445 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDG---  1316
             H LV+ YP+ GHI PM+Q SK L   GV VT++T       +Q       +E+I DG   
Sbjct  11    HCLVLSYPLQGHINPMLQFSKLLQHEGVRVTLVTTRYHRKTLQSVPPSFTIETISDGFDN  70

Query  1315  --VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGLR  1142
               V+   G  A  D    +    LA+++ K    G  +  V+Y+S  PW  D+  + G+ 
Sbjct  71    GGVEEAGGHKAYLDTFWQVGPKTLAQLIEKFGTLGNKVDCVIYNSFFPWALDVAKRFGIV  130

Query  1141  AAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLLR  962
               ++ +Q+  V ++Y+H  Q  L  P     +SLP +P + L D+PSF   K     LL 
Sbjct  131   GVSYLTQNMLVNSIYYHVHQGTLKVPLMEDEISLPLLPRIELGDMPSFFSTKGENQVLLD  190

Query  961   FVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDDN  782
              ++ +  N  KADW+L NTF E+EKEV++W    +P K + IGP +PS +LDKR++DD++
Sbjct  191   LLVGQFSNIDKADWILCNTFYEMEKEVVDWTIKIWP-KFMTIGPSIPSKFLDKRLKDDED  249

Query  781   YGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVVR  602
             YG + FK  N  CMEWL+ +  GSVVYVSFGS+ +L +EQ+ E+A GL  S   FLWVVR
Sbjct  250   YGAAQFK-TNEKCMEWLNDKPKGSVVYVSFGSMVSLDEEQIQELAYGLRDSGSYFLWVVR  308

Query  601   SSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVVA  422
             +SE++KLP +F   +S   ++  WC QL VL+H+A+GCF+THCGWNSTLEALSLGVP +A
Sbjct  309   ASEETKLPKDF-EKESKKSLVVTWCSQLKVLAHEAIGCFVTHCGWNSTLEALSLGVPTIA  367

Query  421   MPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAKW  242
             +PQW+DQ TNAK++ DVW +GIR    E  +V +++ + C++E+M+GE+G  +K NA +W
Sbjct  368   IPQWSDQRTNAKFIADVWKMGIRAPIDEKQIVRQDKFKDCIMEIMEGEKGKEIKSNATQW  427

Query  241   KQLAKEAVDEGGSSDKNIKEFVSAI  167
             K LA  A  E GSS KNI EFV+++
Sbjct  428   KTLAVGAFGEHGSSQKNIIEFVTSL  452



>emb|CAN70002.1| hypothetical protein VITISV_033171 [Vitis vinifera]
Length=459

 Score =   397 bits (1020),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 208/450 (46%), Positives = 282/450 (63%), Gaps = 12/450 (3%)
 Frame = -3

Query  1489  SHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVK  1310
             +H +V+P+P  GHI PM+Q SKRL   G  VT++     S  +   S  I +E+I DG  
Sbjct  10    AHCIVLPFPSQGHINPMLQFSKRLVHNGAKVTLVATHFISKSLLGDSGPIAIETISDGYD  69

Query  1309  PDSGF---DAISDWLKDL----VSNNLAEIMSKVTG-SGCLLTTVVYDSIMPWVADLVHQ  1154
              D GF    +   +L+        N  +  + K+    G  +  VVYD+ +PW  D+  +
Sbjct  70    -DGGFAQAGSGGTYLERFQVVGFRNXGSAFIEKLKSLQGVPVDCVVYDAFLPWALDVAKK  128

Query  1153  LGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYS  974
             LGL  A F +QSC V  +Y+H  Q  L  P     V +P + PL   DLPS V    SY 
Sbjct  129   LGLVGAVFFTQSCTVNNIYYHVHQGMLKLPHSEPEVVVPGLFPLQACDLPSLVYLYGSYP  188

Query  973   SLLRFVLSRNLNTQKADWLLFNTFDELEKEVLE-WMASQFPLKVIAIGPLLPSMYLDKRV  797
                  ++++  N +K DW+ +NTF +LE++V+E WMA   PL+   IGP LPS YL+KR+
Sbjct  189   DFFNMLVNQFSNIEKVDWVFYNTFYKLEEKVVEYWMAKICPLR--TIGPTLPSAYLNKRL  246

Query  796   RDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKF  617
              DD +YGL++ KP    CMEWLD +  GSVVY S+GS A L+ EQM EVA GL +S   F
Sbjct  247   GDDKDYGLNMLKPVTGACMEWLDGKPNGSVVYASYGSFAVLEPEQMEEVAWGLRRSNAYF  306

Query  616   LWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLG  437
             L VVR SEQ+KLP NF  +    G++ +WC QL+VL+H+A+GCF+TH GWNSTLEALSLG
Sbjct  307   LMVVRESEQAKLPQNFKGETEEKGLVVSWCQQLEVLAHRAIGCFLTHGGWNSTLEALSLG  366

Query  436   VPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKE  257
             VP+V  P +TDQPTNAK++ DVW +G+R  A + G+V RE +E C+ EVM  +    ++ 
Sbjct  367   VPMVVAPLFTDQPTNAKFVEDVWGIGLRARADDKGIVRREVLEHCIGEVMGSDGLKGIRS  426

Query  256   NAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
             NA KWK LA+EAV+EGGSSDK I EFV+ +
Sbjct  427   NAMKWKNLAREAVEEGGSSDKCIDEFVAKL  456



>ref|XP_003613351.1| N-hydroxythioamide S-beta-glucosyltransferase [Medicago truncatula]
 gb|AES96309.1| UDP-glucosyltransferase family protein [Medicago truncatula]
Length=466

 Score =   397 bits (1019),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 200/443 (45%), Positives = 283/443 (64%), Gaps = 11/443 (2%)
 Frame = -3

Query  1486  HVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRVESIPDGVKP  1307
             HVLVIPYP  GHI+P++Q SKRL S+G+  T  T   T   I   +  I VE I DG   
Sbjct  13    HVLVIPYPAQGHISPLIQFSKRLVSKGIKTTFATTHYTVKSITAPN--ISVEPISDGFD-  69

Query  1306  DSGFDAISD---WLKDLVSN---NLAEIMSKVTGSGCLLTTVVYDSIMPWVADLVHQLGL  1145
             +SGF    +   +L    +N    L+ ++ K   +   +T +VYDS +PW  D+  Q  +
Sbjct  70    ESGFSQAKNVELFLNSFKTNGSKTLSNLIQKHQKTSTPITCIVYDSFLPWALDVAKQHRI  129

Query  1144  RAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRNKSSYSSLL  965
               AAF + S AV  ++       +  P +   + +P +PPL   DLPSF+R   SY + +
Sbjct  130   YGAAFFTNSAAVCNIFCRIHHGLIETPVDELPLIVPGLPPLNSRDLPSFIRFPESYPAYM  189

Query  964   RFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYLDKRVRDDD  785
                L++  N  +ADW+  NTF+ LE EV++ +   FP K+I  GP++PS YLD R++ D 
Sbjct  190   AMKLNQFSNLNQADWMFVNTFEALEAEVVKGLTEMFPAKLI--GPMVPSAYLDGRIKGDK  247

Query  784   NYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQSKCKFLWVV  605
              YG +L+KP + DC+ WL+++ + SVVY+SFGS+ +L  EQ+ E+A GL +S+  FLWV+
Sbjct  248   GYGANLWKPLSEDCINWLNAKPSQSVVYISFGSMVSLTSEQIEELALGLKESEVNFLWVL  307

Query  604   RSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEALSLGVPVV  425
             R SEQ KLP  +       GII  WC QL++L+H AVGCF+THCGWNSTLE+LSLGVPVV
Sbjct  308   RESEQGKLPKGYKDSIKEKGIIVTWCNQLELLAHDAVGCFVTHCGWNSTLESLSLGVPVV  367

Query  424   AMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGVMLKENAAK  245
              +PQW DQ  +AK+L ++W+VG+R    ENG+V REE    L  VM+ ER  +++ NA++
Sbjct  368   CLPQWADQLPDAKFLEEIWEVGVRPKEDENGVVKREEFMLSLKVVMESERSEVIRRNASE  427

Query  244   WKQLAKEAVDEGGSSDKNIKEFV  176
             WK+LA++AV EGGSSDKNI +FV
Sbjct  428   WKKLARDAVCEGGSSDKNINQFV  450



>gb|AGZ84547.1| glycosyltransferase KGT18 [Pueraria montana var. lobata]
Length=454

 Score =   396 bits (1018),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 199/454 (44%), Positives = 285/454 (63%), Gaps = 9/454 (2%)
 Frame = -3

Query  1513  EMAEMSTVSHVLVIPYPIHGHITPMVQLSKRLASRGVGVTVITPTSTSACIQVSSSLIRV  1334
             E   +++ +H LV+PYP  GHI PM+Q SK L  +GV +T++T    S  +Q     I +
Sbjct  2     EKKSITSRAHCLVLPYPAQGHINPMLQFSKLLERQGVRITLVTTRFYSKNLQNLPPSIAL  61

Query  1333  ESIPDG-----VKPDSGFDAISDWLKDLVSNNLAEIMSKVTGSGCLLTTVVYDSIMPWVA  1169
             E+I DG     V     + A  D    +      E++ K+  S   +  V+YDS  PW  
Sbjct  62    ETISDGFDKGGVVEAGNYKAYIDRFWQVGPQTFHELLEKLGKSRDHVDCVIYDSFFPWAL  121

Query  1168  DLVHQLGLRAAAFNSQSCAVFAVYHHTDQENLTAPTEGSTVSLPSMPPLGLNDLPSFVRN  989
             D+  + G+  A + +Q+  V  +Y+H     L AP +   +SLP +P L   D+PSF   
Sbjct  122   DVTKRFGIVGAVYLTQNMTVNNIYYHVHLGRLQAPLKDHEISLPKLPKLQHEDMPSFFFT  181

Query  988   KSSYSSLLRFVLSRNLNTQKADWLLFNTFDELEKEVLEWMASQFPLKVIAIGPLLPSMYL  809
                  +LL FV+++  N  KADW+L NT+ EL+KE+++W+   +P K  +IGP +PS++L
Sbjct  182   YEQDPTLLDFVVAQFSNIDKADWILCNTYYELDKEIIDWIMEIWP-KFRSIGPNIPSLFL  240

Query  808   DKRVRDDDNYGLSLFKPNNNDCMEWLDSQETGSVVYVSFGSLANLKDEQMCEVAQGLIQS  629
             DKR  DD +YG++ FK  ++DCM+WLD +  GSVVYVSFGS+A   +EQM E+A  L + 
Sbjct  241   DKRYEDDQDYGITEFK--SDDCMKWLDDKPKGSVVYVSFGSIATFGEEQMEELACCLKEC  298

Query  628   KCKFLWVVRSSEQSKLPSNFWPDKSGAGIITNWCPQLDVLSHQAVGCFITHCGWNSTLEA  449
                FLWVVR+SE+ KLP +F   K+  G++  WC QL VL+H+AVGCF+THCGWNSTLE 
Sbjct  299   SAYFLWVVRASEEIKLPKDF-EKKTKKGLVVTWCSQLKVLAHEAVGCFVTHCGWNSTLET  357

Query  448   LSLGVPVVAMPQWTDQPTNAKYLVDVWDVGIRVMAGENGMVTREEVERCLVEVMKGERGV  269
             L LGVP+VA+P W+DQ TNAK + DVW  GIR    +N +V RE +++C+ EVM+ E+G 
Sbjct  358   LCLGVPIVAIPYWSDQSTNAKLMADVWKTGIRAPIDDNKVVRREALKQCIREVMENEKGT  417

Query  268   MLKENAAKWKQLAKEAVDEGGSSDKNIKEFVSAI  167
              +K NA +WK LA + V +GGSS KNI EF + +
Sbjct  418   KMKSNAIRWKTLAVKVVSDGGSSHKNILEFTNNL  451



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4909380504078