BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25447_g7_i2 len=1475 path=[20260:0-914 35679:915-916 25:917-957
35726:958-958 35727:959-969 4474:970-982 4487:983-995 4500:996-1206
21586:1207-1474]

Length=1475
                                                                      Score     E

ref|XP_007026515.1|  Radical SAM superfamily protein                    441   3e-148   
ref|XP_009133598.1|  PREDICTED: biotin synthase-like                    437   6e-147   
emb|CDX83485.1|  BnaA03g20210D                                          437   6e-147   
gb|KFK37171.1|  hypothetical protein AALP_AA4G223000                    434   1e-145   
ref|XP_009142928.1|  PREDICTED: biotin synthase                         432   9e-145   
ref|XP_002881898.1|  hypothetical protein ARALYDRAFT_903720             432   1e-144   
gb|ABI63585.1|  biotin synthase                                         432   1e-144   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_008804203.1|  PREDICTED: biotin synthase                         430   2e-144   
ref|XP_006294408.1|  hypothetical protein CARUB_v10023426mg             430   5e-144   
emb|CDX79828.1|  BnaA05g03280D                                          430   5e-144   
ref|XP_010517897.1|  PREDICTED: biotin synthase                         429   1e-143   
ref|XP_010508441.1|  PREDICTED: biotin synthase-like                    429   2e-143   
ref|NP_181864.1|  biotin synthase                                       429   2e-143   Arabidopsis thaliana [mouse-ear cress]
gb|KHG09165.1|  Biotin synthase -like protein                           428   3e-143   
ref|XP_010930184.1|  PREDICTED: biotin synthase                         427   4e-143   
ref|XP_010506206.1|  PREDICTED: biotin synthase-like                    427   6e-143   
ref|XP_006397502.1|  hypothetical protein EUTSA_v10001495mg             427   6e-143   
gb|EYU36695.1|  hypothetical protein MIMGU_mgv1a008492mg                427   8e-143   
ref|XP_011073966.1|  PREDICTED: biotin synthase                         427   9e-143   
ref|XP_006397503.1|  hypothetical protein EUTSA_v10001495mg             427   1e-142   
gb|AAO41898.1|  putative biotin synthase (Bio B)                        427   1e-142   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002529753.1|  biotin synthase, putative                          426   2e-142   Ricinus communis
ref|XP_011026381.1|  PREDICTED: biotin synthase-like                    426   4e-142   
ref|XP_007131558.1|  hypothetical protein PHAVU_011G023300g             422   4e-142   
ref|XP_002310445.1|  Biotin synthase family protein                     425   6e-142   Populus trichocarpa [western balsam poplar]
ref|XP_010057797.1|  PREDICTED: biotin synthase-like                    425   8e-142   
emb|CDP10023.1|  unnamed protein product                                424   2e-141   
ref|XP_006858652.1|  hypothetical protein AMTR_s00066p00060150          424   3e-141   
ref|XP_011037058.1|  PREDICTED: biotin synthase                         423   4e-141   
ref|XP_002263125.1|  PREDICTED: biotin synthase                         423   4e-141   Vitis vinifera
gb|KCW87859.1|  hypothetical protein EUGRSUZ_A00256                     426   4e-141   
ref|XP_010037365.1|  PREDICTED: biotin synthase-like                    423   7e-141   
ref|XP_009337448.1|  PREDICTED: biotin synthase-like                    422   7e-141   
emb|CDY17930.1|  BnaC04g02890D                                          427   8e-141   
ref|XP_009363682.1|  PREDICTED: biotin synthase-like isoform X2         420   9e-141   
gb|KDO41263.1|  hypothetical protein CISIN_1g016605mg                   419   1e-140   
ref|XP_004140874.1|  PREDICTED: biotin synthase-like                    422   1e-140   
ref|XP_008445703.1|  PREDICTED: biotin synthase                         422   1e-140   
gb|KDP42820.1|  hypothetical protein JCGZ_23762                         421   3e-140   
ref|XP_006659645.1|  PREDICTED: biotin synthase-like                    416   4e-140   
ref|NP_001132808.1|  uncharacterized protein LOC100194297               416   4e-140   Zea mays [maize]
ref|XP_009363681.1|  PREDICTED: biotin synthase-like isoform X1         420   5e-140   
gb|KCW87664.1|  hypothetical protein EUGRSUZ_A00054                     423   6e-140   
ref|XP_003537735.1|  PREDICTED: biotin synthase-like                    418   2e-139   
gb|KCW87858.1|  hypothetical protein EUGRSUZ_A00256                     421   2e-139   
ref|XP_006443087.1|  hypothetical protein CICLE_v10020553mg             418   3e-139   
ref|XP_008372053.1|  PREDICTED: biotin synthase                         416   3e-139   
ref|XP_007131557.1|  hypothetical protein PHAVU_011G023300g             417   4e-139   
ref|XP_010097490.1|  Biotin synthase                                    417   4e-139   
ref|XP_010525906.1|  PREDICTED: biotin synthase                         417   6e-139   
gb|EAZ07823.1|  hypothetical protein OsI_30080                          416   2e-138   Oryza sativa Indica Group [Indian rice]
ref|XP_007223123.1|  hypothetical protein PRUPE_ppa007144mg             416   2e-138   
ref|XP_009591983.1|  PREDICTED: biotin synthase                         416   2e-138   
ref|XP_009789036.1|  PREDICTED: biotin synthase                         415   3e-138   
gb|ACF82090.1|  unknown                                                 411   4e-138   Zea mays [maize]
ref|NP_001062381.1|  Os08g0540100                                       415   7e-138   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008222578.1|  PREDICTED: biotin synthase-like                    414   8e-138   
ref|XP_004241394.1|  PREDICTED: biotin synthase                         414   1e-137   
ref|XP_004505647.1|  PREDICTED: biotin synthase-like                    414   1e-137   
gb|KHN20632.1|  Biotin synthase                                         412   3e-137   
gb|ACU18888.1|  unknown                                                 412   3e-137   Glycine max [soybeans]
ref|XP_006347274.1|  PREDICTED: biotin synthase-like                    412   4e-137   
ref|XP_003607352.1|  Biotin synthase                                    412   4e-137   
ref|XP_004970356.1|  PREDICTED: biotin synthase-like                    413   4e-137   
ref|XP_006372914.1|  Biotin synthase family protein                     413   4e-137   
ref|XP_004956197.1|  PREDICTED: biotin synthase-like                    412   1e-136   
ref|XP_004296725.1|  PREDICTED: biotin synthase-like                    410   3e-136   
ref|XP_010258596.1|  PREDICTED: biotin synthase                         410   3e-136   
gb|AFK47900.1|  unknown                                                 410   3e-136   
ref|NP_001150188.1|  biotin synthase                                    410   7e-136   Zea mays [maize]
ref|XP_010671809.1|  PREDICTED: biotin synthase                         409   8e-136   
ref|XP_003574854.1|  PREDICTED: biotin synthase                         408   3e-135   
gb|ABK25474.1|  unknown                                                 406   2e-134   Picea sitchensis
ref|NP_001237227.1|  biotin synthase                                    404   9e-134   
ref|XP_008222617.1|  PREDICTED: LOW QUALITY PROTEIN: biotin synthase    401   1e-132   
ref|XP_001765903.1|  predicted protein                                  402   3e-132   
ref|XP_001763744.1|  predicted protein                                  399   2e-131   
ref|XP_002963208.1|  hypothetical protein SELMODRAFT_165887             390   4e-128   
ref|XP_009382923.1|  PREDICTED: biotin synthase-like                    385   4e-126   
ref|XP_006443094.1|  hypothetical protein CICLE_v10024495mg             379   5e-124   
ref|XP_002981584.1|  hypothetical protein SELMODRAFT_114715             379   1e-123   
gb|EPS62502.1|  hypothetical protein M569_12287                         376   6e-123   
gb|EXX73954.1|  biotin synthase                                         372   3e-121   
gb|ESA20822.1|  hypothetical protein GLOINDRAFT_92179                   371   9e-121   
gb|AAX28926.1|  biotin synthase                                         360   6e-119   Raphanus sativus
gb|EPB90860.1|  biotin synthetase                                       362   3e-117   
emb|CAN60576.1|  hypothetical protein VITISV_034772                     354   1e-116   Vitis vinifera
gb|EMT17431.1|  Biotin synthase                                         360   1e-116   
ref|XP_006494187.1|  PREDICTED: biotin synthase-like                    354   1e-116   
emb|CDH52375.1|  biotin synthase                                        360   2e-116   
emb|CDS08184.1|  Putative Biotin synthase                               360   2e-116   
emb|CEG65136.1|  Putative Biotin synthetase                             360   3e-116   
emb|CEI92026.1|  Putative Biotin synthetase                             359   3e-116   
ref|XP_006682484.1|  hypothetical protein BATDEDRAFT_92155              357   7e-115   
gb|EIE79238.1|  biotin synthase                                         354   3e-114   
gb|KFH73793.1|  biotin synthase                                         353   1e-113   
gb|EMS58861.1|  Biotin synthase                                         357   3e-113   
ref|XP_006494195.1|  PREDICTED: biotin synthase-like isoform X1         345   4e-113   
ref|XP_006494201.1|  PREDICTED: biotin synthase-like                    342   5e-112   
tpg|DAA48311.1|  TPA: hypothetical protein ZEAMMB73_910136              346   7e-112   
emb|CEI89543.1|  Putative Biotin synthase                               343   1e-111   
ref|XP_006443095.1|  hypothetical protein CICLE_v10024062mg             340   2e-110   
emb|CDH52376.1|  biotin synthase                                        343   4e-110   
ref|XP_005708404.1|  biotin synthetase                                  325   7e-103   
gb|EFW43202.2|  biotin synthase                                         325   6e-102   
ref|WP_007657919.1|  biotin synthase                                    318   4e-101   
ref|WP_018479104.1|  biotin synthase                                    317   1e-100   
ref|WP_025604264.1|  biotin synthase                                    315   1e-99    
ref|XP_004349766.1|  biotin synthase                                    316   2e-99    
dbj|GAL84226.1|  biotin synthase                                        313   5e-99    
emb|CBN74306.1|  biotin synthase                                        315   1e-98    
ref|WP_019948907.1|  biotin synthase                                    312   2e-98    
ref|WP_022823353.1|  biotin synthase                                    312   2e-98    
gb|AII50630.1|  biotin synthase                                         311   3e-98    
gb|AHJ97171.1|  biotin synthase                                         310   6e-98    
ref|WP_027001110.1|  biotin synthase                                    310   8e-98    
ref|WP_028981645.1|  biotin synthase                                    310   8e-98    
ref|WP_014219895.1|  biotin synthase                                    310   9e-98    
ref|WP_009193496.1|  Biotin synthase                                    310   1e-97    
ref|WP_025538819.1|  biotin synthase                                    309   2e-97    
ref|WP_038114156.1|  biotin synthase                                    308   3e-97    
ref|WP_018343604.1|  biotin synthase                                    308   5e-97    
ref|WP_009583686.1|  Biotin synthase                                    307   9e-97    
ref|WP_035726594.1|  biotin synthase                                    306   1e-96    
ref|WP_026261968.1|  biotin synthase                                    307   2e-96    
ref|WP_027302930.1|  biotin synthase                                    307   2e-96    
ref|WP_011585834.1|  biotin synthase                                    306   2e-96    
ref|WP_028663710.1|  biotin synthase                                    306   3e-96    
ref|WP_012926960.1|  biotin synthase                                    306   4e-96    
ref|WP_018473322.1|  biotin synthase                                    305   4e-96    
ref|WP_009280732.1|  biotin synthase                                    306   5e-96    
ref|WP_015331117.1|  biotin synthase                                    306   8e-96    
ref|WP_017731753.1|  biotin synthase                                    304   2e-95    
ref|WP_014797147.1|  biotin synthase                                    303   6e-95    
ref|WP_018620609.1|  biotin synthase                                    302   1e-94    
ref|WP_038028898.1|  biotin synthase                                    301   1e-94    
ref|WP_015266361.1|  biotin synthetase                                  301   1e-94    
ref|WP_026465026.1|  biotin synthase                                    301   2e-94    
ref|WP_039128407.1|  biotin synthase                                    301   3e-94    
ref|WP_020532011.1|  biotin synthase                                    300   4e-94    
ref|WP_039141956.1|  biotin synthase                                    300   7e-94    
ref|WP_020601818.1|  biotin synthase                                    300   7e-94    
ref|XP_005713576.1|  biotin synthetase                                  301   1e-93    
ref|WP_006341945.1|  biotin synthase                                    299   1e-93    
ref|WP_013925054.1|  biotin synthase                                    298   4e-93    
ref|WP_038104366.1|  biotin synthase                                    298   4e-93    
gb|KIA77733.1|  Biotin synthase                                         298   5e-93    
ref|WP_039751343.1|  biotin synthase                                    296   9e-93    
dbj|GAA97873.1|  hypothetical protein E5Q_04553                         300   1e-92    
ref|XP_003889641.1|  biotin synthase                                    299   1e-92    
gb|KEI37736.1|  hypothetical protein L969DRAFT_89705                    300   2e-92    
ref|WP_015249572.1|  biotin synthase                                    295   3e-92    
ref|XP_002479458.1|  biotin synthase, putative                          298   3e-92    Talaromyces stipitatus ATCC 10500
ref|WP_018126511.1|  hypothetical protein                               295   4e-92    
ref|XP_002291078.1|  biotin synthase, BioB                              295   6e-92    Thalassiosira pseudonana CCMP1335
ref|WP_018611323.1|  hypothetical protein                               295   8e-92    
ref|WP_037327009.1|  biotin synthase                                    295   8e-92    
dbj|GAM40110.1|  Bio2 homolog                                           295   2e-91    
ref|WP_037361450.1|  biotin synthase                                    293   3e-91    
ref|WP_013453234.1|  biotin synthase                                    293   3e-91    
gb|EJU00998.1|  biotin synthase                                         294   3e-91    
gb|EUC67119.1|  biotin synthase                                         294   7e-91    
ref|XP_007265898.1|  biotin synthase                                    294   8e-91    
gb|KEP55586.1|  biotin synthase                                         293   8e-91    
gb|EJK70128.1|  hypothetical protein THAOC_08542                        295   1e-90    
ref|WP_016194428.1|  Biotin synthase                                    292   1e-90    
gb|KDO30987.1|  hypothetical protein SPRG_04175                         293   1e-90    
ref|WP_015694036.1|  biotin synthase                                    291   1e-90    
ref|XP_001731769.1|  hypothetical protein MGL_1037                      293   1e-90    Malassezia globosa CBS 7966
ref|XP_008605759.1|  biotin synthetase                                  292   2e-90    
ref|XP_009829629.1|  biotin synthase                                    293   2e-90    
ref|XP_008873321.1|  biotin synthase                                    293   2e-90    
ref|WP_002660339.1|  biotin synthase                                    291   2e-90    
ref|XP_001558101.1|  hypothetical protein BC1G_03133                    289   2e-90    Botrytis cinerea B05.10
gb|ELU44645.1|  biotin synthase                                         292   3e-90    
ref|XP_002143161.1|  biotin synthase, putative                          293   3e-90    Talaromyces marneffei ATCC 18224
emb|CCF46810.1|  biotin synthase                                        289   3e-90    
gb|ETS63560.1|  hypothetical protein PaG_01857                          293   4e-90    
ref|WP_008989946.1|  biotin synthase                                    291   4e-90    
ref|XP_007737163.1|  biotin synthetase                                  293   5e-90    
ref|WP_029270996.1|  biotin synthase                                    291   6e-90    
ref|XP_002899794.1|  biotin synthase                                    291   6e-90    
dbj|GAK62357.1|  biotin synthase                                        293   6e-90    
ref|XP_007861248.1|  biotin synthase                                    291   7e-90    
ref|XP_571682.1|  biotin synthase                                       291   9e-90    Cryptococcus neoformans var. neoformans JEC21
ref|WP_026714352.1|  biotin synthase                                    290   1e-89    
ref|WP_035135358.1|  biotin synthase                                    290   1e-89    
ref|WP_026898538.1|  biotin synthase                                    288   2e-89    
ref|WP_027421042.1|  biotin synthase                                    290   2e-89    
dbj|GAC95584.1|  hypothetical protein PHSY_003160                       292   2e-89    
gb|EST09931.1|  biotin synthase                                         291   2e-89    
ref|WP_028870751.1|  biotin synthase                                    289   2e-89    
dbj|GAC73543.1|  biotin synthase                                        295   2e-89    
ref|WP_013992744.1|  biotin synthase                                    289   3e-89    
ref|XP_009536581.1|  hypothetical protein PHYSODRAFT_526228             290   3e-89    
ref|WP_027138232.1|  biotin synthase                                    289   3e-89    
emb|CCF54041.1|  probable biotin synthase                               291   3e-89    
ref|XP_007879379.1|  hypothetical protein PFL1_03669                    292   3e-89    
ref|WP_026983703.1|  biotin synthase                                    289   3e-89    
ref|WP_007807625.1|  biotin synthase                                    289   3e-89    
ref|XP_756462.1|  hypothetical protein UM00315.1                        291   4e-89    Ustilago maydis 521
emb|CBQ67716.1|  probable biotin synthase                               291   4e-89    
gb|KGB76106.1|  biotin synthase                                         289   4e-89    
ref|XP_007586851.1|  putative biotin synthase protein                   290   4e-89    
ref|WP_014389463.1|  biotin synthase                                    288   4e-89    
gb|KEF63152.1|  biotin synthetase                                       290   5e-89    
ref|XP_001590701.1|  hypothetical protein SS1G_08441                    290   6e-89    Sclerotinia sclerotiorum 1980 UF-70
ref|WP_023578699.1|  biotin synthase                                    288   6e-89    
emb|CCA68823.1|  probable biotin synthase                               289   6e-89    
ref|WP_018279337.1|  biotin synthase                                    288   6e-89    
ref|WP_026980516.1|  biotin synthase                                    288   6e-89    
ref|XP_003194662.1|  biotin synthase                                    289   7e-89    
ref|XP_007720430.1|  biotin synthetase                                  290   7e-89    
gb|ESZ95534.1|  hypothetical protein SBOR_4087                          290   8e-89    
gb|ETK88376.1|  biotin synthase                                         288   8e-89    
ref|XP_007378536.1|  biotin synthase                                    288   8e-89    
gb|ESU23746.1|  biotin synthase                                         287   9e-89    
ref|XP_008904154.1|  biotin synthase                                    288   9e-89    
gb|KDN40514.1|  biotin synthase                                         291   1e-88    
gb|AFR95906.1|  biotin synthase                                         288   1e-88    
gb|EPS99112.1|  hypothetical protein FOMPIDRAFT_1164351                 288   1e-88    
gb|KDB14206.1|  putative biotin synthase                                289   1e-88    
ref|WP_028890014.1|  biotin synthase                                    288   1e-88    
gb|KDR84807.1|  hypothetical protein GALMADRAFT_233182                  288   1e-88    
ref|WP_026775474.1|  biotin synthase                                    287   1e-88    
ref|WP_013998458.1|  biotin synthase                                    287   1e-88    
ref|WP_026706039.1|  biotin synthase                                    287   2e-88    
ref|XP_009854465.1|  biotin synthase                                    290   2e-88    
ref|WP_035630262.1|  biotin synthase                                    287   2e-88    
ref|WP_026904826.1|  biotin synthase                                    286   2e-88    
ref|WP_002704409.1|  biotin synthase                                    286   2e-88    
emb|CCD52022.1|  similar to biotin synthase                             288   2e-88    
ref|XP_001828414.2|  biotin synthase                                    286   2e-88    Coprinopsis cinerea okayama7#130
ref|WP_036121363.1|  biotin synthase                                    286   2e-88    
ref|XP_007821645.1|  biotin synthase, putative                          288   3e-88    
ref|WP_038267410.1|  biotin synthase                                    286   3e-88    
ref|WP_023570443.1|  biotin synthase                                    286   3e-88    
ref|WP_039110475.1|  biotin synthase                                    286   3e-88    
ref|WP_016991098.1|  biotin synthase                                    286   3e-88    
ref|XP_956564.1|  biotin synthase                                       289   4e-88    Neurospora crassa OR74A
gb|KFG78056.1|  putative biotin synthase                                288   4e-88    
ref|XP_007325395.1|  hypothetical protein AGABI1DRAFT_110110            286   4e-88    
ref|XP_009268729.1|  Biotin synthase                                    287   4e-88    
ref|XP_009536616.1|  hypothetical protein PHYSODRAFT_340219             286   4e-88    
ref|WP_039113228.1|  MULTISPECIES: biotin synthase                      286   4e-88    
ref|XP_006454758.1|  hypothetical protein AGABI2DRAFT_189996            286   4e-88    
ref|XP_007803846.1|  Biotin synthase                                    287   4e-88    
ref|WP_036157176.1|  biotin synthase                                    286   4e-88    
gb|EXV04565.1|  biotin synthase domain protein                          288   4e-88    
ref|XP_002181331.1|  biotin synthase                                    288   4e-88    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007808077.1|  biotin synthase, putative                          288   4e-88    
gb|KID90524.1|  Biotin synthase                                         288   4e-88    
emb|CDO70279.1|  hypothetical protein BN946_scf184942.g79               286   4e-88    
gb|KID99736.1|  Biotin synthase                                         288   4e-88    
ref|WP_007647003.1|  Biotin synthase                                    286   4e-88    
ref|WP_027311052.1|  biotin synthase                                    286   5e-88    
ref|WP_026977480.1|  biotin synthase                                    286   5e-88    
emb|CDI51263.1|  probable biotin synthase                               288   5e-88    
ref|WP_035674047.1|  biotin synthase                                    286   6e-88    
ref|XP_006960174.1|  biotin synthase                                    286   6e-88    
ref|WP_026990098.1|  biotin synthase                                    285   7e-88    
gb|EHA24567.1|  biotin synthase                                         286   7e-88    
ref|WP_036380402.1|  biotin synthase                                    285   7e-88    
ref|WP_035681332.1|  biotin synthase                                    285   7e-88    
ref|WP_026728201.1|  biotin synthase                                    285   7e-88    
gb|EFQ34380.1|  biotin synthase                                         287   8e-88    
ref|WP_035633484.1|  biotin synthase                                    285   8e-88    
ref|XP_005536842.1|  biotin synthetase                                  286   8e-88    
ref|XP_001396739.1|  biotin synthase                                    286   9e-88    Aspergillus niger CBS 513.88
ref|WP_035617764.1|  biotin synthase                                    285   9e-88    
ref|XP_003664858.1|  hypothetical protein MYCTH_2119779                 285   1e-87    
ref|XP_001257572.1|  biotin synthase, putative                          286   1e-87    Aspergillus fischeri NRRL 181
ref|XP_007006994.1|  hypothetical protein TREMEDRAFT_34298              286   1e-87    
gb|EQB55405.1|  biotin synthase                                         286   1e-87    
ref|WP_031455003.1|  biotin synthase                                    285   1e-87    
gb|KDN68936.1|  putative biotin synthase                                286   1e-87    
ref|XP_007284534.1|  biotin synthase                                    286   1e-87    
ref|XP_009541434.1|  hypothetical protein HETIRDRAFT_437988             285   1e-87    
dbj|GAA90586.1|  biotin synthase                                        285   1e-87    
ref|WP_035656680.1|  biotin synthase                                    285   1e-87    
emb|CCM01654.1|  predicted protein                                      285   2e-87    
ref|WP_014201720.1|  biotin synthase                                    284   2e-87    
emb|CEJ91777.1|  Putative Biotin synthase                               285   2e-87    
ref|WP_035652916.1|  biotin synthase                                    285   2e-87    
ref|WP_007095522.1|  biotin synthase                                    285   2e-87    
ref|XP_002945814.1|  hypothetical protein VOLCADRAFT_102782             285   2e-87    
ref|WP_033959783.1|  biotin synthase                                    285   2e-87    
ref|XP_007832233.1|  Biotin synthase                                    286   2e-87    
gb|ESU05438.1|  biotin synthase                                         286   2e-87    
ref|WP_020213831.1|  biotin synthase                                    285   2e-87    
ref|WP_029037355.1|  biotin synthase                                    284   2e-87    
ref|WP_017497387.1|  biotin synthase                                    284   2e-87    
gb|EMD41666.1|  hypothetical protein CERSUDRAFT_110241                  285   2e-87    
gb|ENH88116.1|  biotin synthase                                         286   2e-87    
ref|WP_026707833.1|  biotin synthase                                    284   2e-87    
ref|XP_009255748.1|  hypothetical protein FPSE_04355                    286   2e-87    
ref|WP_010516453.1|  biotin synthase                                    284   2e-87    
ref|XP_008033167.1|  biotin synthase                                    285   3e-87    
ref|WP_008270133.1|  biotin synthase                                    284   3e-87    
gb|KHJ37687.1|  biotin synthase                                         283   3e-87    
gb|KEY76898.1|  biotin synthase                                         285   3e-87    
ref|WP_017258278.1|  biotin synthase                                    283   3e-87    
ref|WP_039452630.1|  biotin synthase                                    283   3e-87    
gb|KHN94341.1|  Biotin synthase                                         285   3e-87    
ref|XP_380454.1|  hypothetical protein FG00278.1                        286   4e-87    
ref|WP_034042700.1|  biotin synthase                                    283   4e-87    
ref|WP_023575696.1|  biotin synthase                                    283   4e-87    
ref|XP_001270184.1|  biotin synthase, putative                          285   5e-87    
ref|WP_014085333.1|  biotin synthase                                    283   5e-87    
ref|XP_009152614.1|  biotin synthetase                                  285   5e-87    
ref|XP_007842414.1|  biotin synthase                                    284   5e-87    
ref|WP_038694932.1|  biotin synthase                                    282   5e-87    
gb|EMS25777.1|  biotin synthase                                         285   5e-87    
ref|WP_027394786.1|  biotin synthase                                    283   5e-87    
ref|XP_007416994.1|  hypothetical protein MELLADRAFT_73336              285   6e-87    
gb|KID80409.1|  Biotin synthase                                         285   6e-87    
emb|CCE29417.1|  probable biotin synthase                               286   6e-87    
ref|XP_747710.1|  biotin synthase                                       285   6e-87    
ref|WP_013620609.1|  MULTISPECIES: biotin synthase                      283   6e-87    
ref|WP_013869475.1|  biotin synthase                                    283   6e-87    
ref|WP_013186306.1|  biotin synthase                                    283   6e-87    
ref|WP_014166105.1|  biotin synthase                                    283   7e-87    
ref|XP_005848118.1|  hypothetical protein CHLNCDRAFT_22943              283   7e-87    
gb|KDE04103.1|  biotin synthase                                         285   7e-87    
gb|EEH17390.2|  biotin synthase                                         283   8e-87    
ref|WP_035124892.1|  biotin synthase                                    283   8e-87    
ref|WP_024768305.1|  biotin synthase                                    283   8e-87    
ref|WP_019669146.1|  biotin synthase                                    283   8e-87    
emb|CCU98114.1|  unnamed protein product                                283   8e-87    
ref|WP_008611896.1|  biotin synthase                                    283   9e-87    
ref|XP_010763808.1|  biotin synthase                                    283   1e-86    
ref|WP_026814644.1|  biotin synthase                                    282   1e-86    
ref|WP_036583571.1|  biotin synthase                                    282   1e-86    
gb|EGU13505.1|  Biotin synthase, BioB                                   284   1e-86    
ref|WP_013073860.1|  biotin synthase                                    282   1e-86    
ref|WP_033564562.1|  biotin synthase                                    281   1e-86    
ref|XP_003654709.1|  hypothetical protein THITE_2117874                 284   1e-86    
ref|WP_026753847.1|  biotin synthase                                    282   1e-86    
ref|WP_026913956.1|  biotin synthase                                    282   1e-86    
ref|XP_007915287.1|  putative biotin synthase protein                   283   2e-86    
gb|EMT61190.1|  Biotin synthase, mitochondrial                          283   2e-86    
ref|WP_034918369.1|  biotin synthase                                    282   2e-86    
gb|KEZ40622.1|  Biotin synthase                                         282   2e-86    
gb|EGU76518.1|  hypothetical protein FOXB_12969                         283   2e-86    
gb|EWG36222.1|  biotin synthetase                                       283   2e-86    
gb|EXM30700.1|  biotin synthetase                                       283   2e-86    
ref|WP_027411937.1|  biotin synthase                                    282   2e-86    
gb|KDQ12783.1|  hypothetical protein BOTBODRAFT_34241                   282   2e-86    
emb|CDT16577.1|  biotin synthase                                        280   2e-86    
ref|XP_001873632.1|  biotin synthase, BioB                              283   2e-86    
ref|WP_027065808.1|  biotin synthase                                    281   2e-86    
ref|WP_024979848.1|  biotin synthase                                    281   3e-86    
ref|WP_007137028.1|  biotin synthase                                    281   3e-86    
ref|WP_026836659.1|  biotin synthase                                    281   3e-86    
ref|XP_002541727.1|  biotin synthase                                    283   3e-86    
ref|XP_003065870.1|  biotin synthase, mitochondrial precursor, pu...    283   3e-86    
ref|XP_001247545.1|  biotin synthase                                    283   3e-86    
ref|WP_013564004.1|  biotin synthase                                    281   3e-86    
ref|WP_012022889.1|  biotin synthase                                    281   3e-86    
ref|XP_003054593.1|  predicted protein                                  281   3e-86    
ref|XP_007599616.1|  biotin synthase                                    283   3e-86    
ref|XP_005652129.1|  biotin synthase                                    283   3e-86    
gb|KFA63837.1|  hypothetical protein S40285_04467                       283   4e-86    
dbj|GAK95829.1|  biotin synthase                                        281   4e-86    
ref|XP_007751066.1|  biotin synthetase                                  282   4e-86    
gb|EWZ86801.1|  biotin synthetase                                       282   4e-86    
gb|EFX04774.1|  biotin synthase                                         282   4e-86    
ref|WP_038986459.1|  biotin synthase                                    279   5e-86    
ref|WP_006796314.1|  biotin synthase                                    281   5e-86    
ref|WP_026996010.1|  biotin synthase                                    280   6e-86    
ref|WP_022828970.1|  biotin synthase                                    280   6e-86    
ref|XP_664247.1|  hypothetical protein AN6643.2                         281   6e-86    
ref|WP_038236083.1|  biotin synthase                                    280   6e-86    
ref|XP_007788310.1|  putative biotin synthase protein                   281   7e-86    
ref|XP_007390305.1|  hypothetical protein PHACADRAFT_247061             281   7e-86    
ref|WP_011962410.1|  biotin synthase                                    280   7e-86    
ref|WP_013687309.1|  biotin synthase                                    280   9e-86    
ref|XP_011125925.1|  hypothetical protein AOL_s00169g266                281   9e-86    
ref|XP_002627361.1|  biotin synthase                                    280   1e-85    
ref|WP_026933199.1|  biotin synthase                                    280   1e-85    
ref|XP_007298070.1|  biotin synthase BioB                               280   1e-85    
ref|WP_034260276.1|  biotin synthase                                    280   1e-85    
ref|WP_021189255.1|  biotin synthase                                    278   1e-85    
ref|WP_025664501.1|  biotin synthase                                    280   1e-85    
gb|KDQ54759.1|  hypothetical protein JAAARDRAFT_37859                   280   1e-85    
ref|WP_026462679.1|  biotin synthase                                    278   1e-85    
gb|KDQ30514.1|  hypothetical protein PLEOSDRAFT_1074857                 280   2e-85    
ref|XP_009656525.1|  biotin synthase                                    281   2e-85    
dbj|BAO75778.1|  biotin synthase                                        279   2e-85    
dbj|BAO54711.1|  biotin synthase                                        279   2e-85    
gb|EKG10556.1|  Biotin synthase                                         280   2e-85    
ref|XP_003007159.1|  biotin synthase                                    281   2e-85    
gb|EGE77424.1|  biotin synthase                                         280   2e-85    
gb|KFM29079.1|  Biotin synthase                                         281   2e-85    
ref|WP_022829848.1|  biotin synthase                                    278   2e-85    
ref|XP_002383035.1|  biotin synthase, putative                          280   2e-85    
ref|XP_008724233.1|  biotin synthase                                    280   2e-85    
ref|WP_006259406.1|  biotin synthase                                    278   2e-85    
ref|WP_010135653.1|  biotin synthase                                    279   2e-85    
ref|XP_007360037.1|  biotin synthase                                    280   3e-85    
gb|EEH38430.2|  biotin synthase                                         280   3e-85    
ref|WP_026357662.1|  biotin synthase                                    278   3e-85    
ref|XP_001903514.1|  hypothetical protein                               280   3e-85    
ref|WP_009778548.1|  biotin synthase                                    278   3e-85    
ref|XP_007336757.1|  biotin synthase, BioB                              278   3e-85    
dbj|GAL60692.1|  biotin synthase                                        276   4e-85    
ref|XP_001228027.1|  hypothetical protein CHGG_10100                    280   4e-85    
ref|XP_008602790.1|  biotin synthase                                    280   5e-85    
ref|WP_025742636.1|  biotin synthase                                    278   5e-85    
ref|WP_034239814.1|  biotin synthase                                    278   6e-85    
ref|XP_002850428.1|  biotin synthase                                    279   7e-85    
ref|WP_013634353.1|  biotin synthase                                    276   8e-85    
ref|XP_007312856.1|  hypothetical protein SERLADRAFT_455421             278   8e-85    
ref|WP_015753592.1|  biotin synthase                                    277   1e-84    
gb|KGQ07508.1|  Biotin synthase                                         278   1e-84    
ref|XP_007754024.1|  hypothetical protein A1O7_01798                    279   1e-84    
gb|EZF70201.1|  biotin synthase                                         278   1e-84    
gb|EKV12366.1|  Biotin synthase                                         278   1e-84    
ref|WP_037317654.1|  biotin synthase                                    277   1e-84    
ref|WP_031445637.1|  biotin synthase                                    277   1e-84    
emb|CCX04346.1|  Similar to Biotin synthase, mitochondrial; acc. ...    277   1e-84    
ref|WP_035068612.1|  biotin synthase                                    276   1e-84    
emb|CCA18560.1|  biotin synthase putative                               279   2e-84    
ref|XP_005836985.1|  hypothetical protein GUITHDRAFT_104403             278   2e-84    
ref|WP_029489833.1|  biotin synthase                                    276   2e-84    
ref|XP_003021130.1|  hypothetical protein TRV_04744                     278   2e-84    
ref|XP_003011719.1|  hypothetical protein ARB_01947                     278   2e-84    
ref|XP_003038481.1|  hypothetical protein SCHCODRAFT_64183              277   2e-84    
ref|WP_025613888.1|  MULTISPECIES: biotin synthase                      276   2e-84    
ref|WP_002664393.1|  biotin synthase                                    276   2e-84    
ref|WP_006278033.1|  biotin synthase                                    275   2e-84    
gb|KCW87665.1|  hypothetical protein EUGRSUZ_A00054                     253   2e-84    
ref|XP_002389375.1|  hypothetical protein MPER_11502                    273   2e-84    
gb|EKQ67234.1|  biotin synthase                                         275   2e-84    
ref|WP_002687488.1|  biotin synthase                                    276   3e-84    
ref|WP_024479172.1|  biotin synthase                                    276   3e-84    
gb|EHK46983.1|  hypothetical protein TRIATDRAFT_316966                  277   3e-84    
gb|EPX71770.1|  biotin synthase                                         276   3e-84    
ref|WP_028376890.1|  biotin synthase                                    276   3e-84    
gb|KEY72123.1|  hypothetical protein S7711_00135                        278   4e-84    
ref|XP_001209787.1|  biotin synthase                                    276   4e-84    
emb|CCI46495.1|  unnamed protein product                                276   4e-84    
ref|XP_002789903.1|  biotin synthase                                    276   4e-84    
ref|WP_036617614.1|  biotin synthase                                    274   4e-84    
gb|EPS28544.1|  hypothetical protein PDE_03490                          276   5e-84    
ref|WP_015361820.1|  biotin synthase                                    275   5e-84    
ref|WP_011711405.1|  biotin synthase                                    275   5e-84    
ref|WP_014937603.1|  biotin synthase                                    276   5e-84    
ref|WP_013767599.1|  biotin synthase                                    275   5e-84    
gb|EEH09482.1|  biotin synthase                                         276   5e-84    
gb|EGC49323.1|  biotin synthase                                         276   5e-84    
ref|WP_003003728.1|  biotin synthase                                    274   6e-84    
gb|EPY50060.1|  biotin synthase                                         276   6e-84    
ref|XP_002563827.1|  Pc20g13470                                         276   6e-84    
gb|EHK18496.1|  hypothetical protein TRIVIDRAFT_58473                   274   7e-84    
ref|XP_003177352.1|  biotin synthase                                    276   7e-84    
gb|EGE07805.1|  biotin synthase                                         276   8e-84    
dbj|GAD91586.1|  biotin synthase, putative                              276   8e-84    
gb|EGD98941.1|  biotin synthase                                         276   8e-84    
ref|WP_017289795.1|  hypothetical protein                               273   8e-84    
ref|WP_014680129.1|  biotin synthase                                    274   8e-84    
gb|KFF74645.1|  biotin synthase                                         273   9e-84    
gb|KGO49121.1|  Elongator protein 3/MiaB/NifB                           276   9e-84    
ref|XP_007763229.1|  biotin synthase                                    275   9e-84    
gb|KGO69584.1|  Elongator protein 3/MiaB/NifB                           275   1e-83    
ref|XP_006673807.1|  biotin synthase, putative                          276   1e-83    
ref|WP_013549909.1|  biotin synthase                                    275   1e-83    
ref|WP_020536269.1|  hypothetical protein                               275   1e-83    
gb|EZF35734.1|  biotin synthase                                         276   1e-83    
ref|WP_034698110.1|  biotin synthase                                    273   1e-83    
ref|WP_009392439.1|  biotin synthase                                    275   1e-83    
ref|WP_003000962.1|  biotin synthase                                    273   1e-83    
ref|XP_003238082.1|  biotin synthase                                    276   1e-83    
ref|WP_039201191.1|  biotin synthase                                    273   1e-83    
dbj|GAL78470.1|  biotin synthase                                        274   1e-83    
ref|WP_008469150.1|  biotin synthase                                    273   1e-83    
ref|WP_010996085.1|  biotin synthase                                    273   1e-83    
ref|WP_029033981.1|  biotin synthase                                    274   2e-83    
ref|WP_031427024.1|  biotin synthase                                    274   2e-83    
ref|WP_008504287.1|  biotin synthase                                    273   2e-83    
emb|CEJ69346.1|  Biotin synthase                                        273   2e-83    
ref|WP_019037272.1|  biotin synthase                                    274   2e-83    
ref|XP_007297205.1|  biotin synthase                                    275   2e-83    
ref|WP_018675434.1|  biotin synthase                                    274   2e-83    
ref|WP_027885045.1|  biotin synthase                                    274   2e-83    
ref|WP_002675483.1|  MULTISPECIES: biotin synthase                      274   2e-83    
ref|WP_004916302.1|  biotin synthase                                    274   2e-83    
ref|WP_026734676.1|  biotin synthase                                    273   2e-83    
ref|WP_034725590.1|  biotin synthase                                    273   2e-83    
ref|WP_015782540.1|  biotin synthase                                    274   2e-83    
gb|KFA90355.1|  biotin synthase                                         273   2e-83    
ref|WP_035372147.1|  biotin synthase                                    273   2e-83    
dbj|BAP31626.1|  biotin synthase                                        272   2e-83    
gb|KHJ34759.1|  putative biotin synthase                                275   2e-83    
ref|WP_009420621.1|  biotin synthase                                    274   2e-83    
ref|WP_035081419.1|  biotin synthase                                    273   2e-83    
ref|WP_009417015.1|  biotin synthase                                    274   3e-83    
ref|WP_035367914.1|  biotin synthase                                    273   3e-83    
ref|XP_002173167.1|  biotin synthase                                    274   3e-83    
gb|EME48682.1|  hypothetical protein DOTSEDRAFT_67652                   275   3e-83    



>ref|XP_007026515.1| Radical SAM superfamily protein [Theobroma cacao]
 gb|EOY07017.1| Radical SAM superfamily protein [Theobroma cacao]
Length=375

 Score =   441 bits (1134),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 222/253 (88%), Positives = 240/253 (95%), Gaps = 4/253 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+YVKQIR MGMEVCCTLGMLEKQQALELKKA
Sbjct  123  AKEAGSTRFCMGAAWRDTVGRKTNFNQILEYVKQIRDMGMEVCCTLGMLEKQQALELKKA  182

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RLETL++VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  183  GLTAYNHNLDTSREYYPNIITTRTYDERLETLQHVREAGINVCSGGIIGLGEAEEDRVGL  242

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINALVAVKGTPL+DQKPVEIW+MIRMIATARI MP++MVRLSAGR
Sbjct  243  LHTLATLPSHPESVPINALVAVKGTPLQDQKPVEIWEMIRMIATARIAMPKSMVRLSAGR  302

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED----S  252
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGLIPK P F E+    S
Sbjct  303  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKILGLIPKAPSFSEEAAKTS  362

Query  251  EGENTEEALSSSG  213
            E EN EEALSSSG
Sbjct  363  EAENCEEALSSSG  375


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R IREGPR+DWTR +IKSIYDSP+LDLLFHGAQVHR+  NF+EVQ CTLL
Sbjct  32    RTIREGPRNDWTRQQIKSIYDSPVLDLLFHGAQVHRYAHNFREVQQCTLL  81



>ref|XP_009133598.1| PREDICTED: biotin synthase-like [Brassica rapa]
Length=380

 Score =   437 bits (1125),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 219/249 (88%), Positives = 238/249 (96%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQILDY+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  131  AKEAGSTRFCMGAAWRDTIGRKTNFNQILDYIKEIRGMGMEVCCTLGMIEKQQALELKKA  190

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YDDRLETLE+VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  191  GLTAYNHNLDTSREYYPNVITTRSYDDRLETLEHVREAGINVCSGGIIGLGEAEEDRVGL  250

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  251  LHTLATLPSHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  310

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRF+MPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGLIPKPP F E DSE E
Sbjct  311  VRFTMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLIPKPPSFSEDDSESE  370

Query  242  NTEEALSSS  216
            N E+  S+S
Sbjct  371  NCEKVASAS  379


 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREG R+DW+R EIK++YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  40    RTIREGARNDWSRDEIKAVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLS  90



>emb|CDX83485.1| BnaA03g20210D [Brassica napus]
Length=380

 Score =   437 bits (1125),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 219/249 (88%), Positives = 238/249 (96%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQILDY+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  131  AKEAGSTRFCMGAAWRDTIGRKTNFNQILDYIKEIRGMGMEVCCTLGMIEKQQALELKKA  190

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YDDRLETLE+VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  191  GLTAYNHNLDTSREYYPNVITTRSYDDRLETLEHVREAGINVCSGGIIGLGEAEEDRVGL  250

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  251  LHTLATLPSHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  310

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRF+MPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGLIPKPP F E DSE E
Sbjct  311  VRFTMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLIPKPPSFSEDDSESE  370

Query  242  NTEEALSSS  216
            N E+  S+S
Sbjct  371  NCEKVASAS  379


 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREG R+DW+R EIK++YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  40    RTIREGARNDWSRDEIKAVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLS  90



>gb|KFK37171.1| hypothetical protein AALP_AA4G223000 [Arabis alpina]
Length=375

 Score =   434 bits (1117),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 217/249 (87%), Positives = 237/249 (95%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+Y+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  126  AKEAGSTRFCMGAAWRDTVGRKTNFNQILEYIKEIRGMGMEVCCTLGMIEKQQALELKKA  185

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YDDRLETLE+VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  186  GLTAYNHNLDTSREYYPNVITTRSYDDRLETLEHVREAGINVCSGGIIGLGEAEEDRVGL  245

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  246  LHTLATLPSHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  305

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGL PKPP F E DSE E
Sbjct  306  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLTPKPPSFSEDDSESE  365

Query  242  NTEEALSSS  216
            N E+  S+S
Sbjct  366  NCEKVASAS  374


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREG R+DW++ EIK++YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  35    RTIREGSRNDWSKDEIKAVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLS  85



>ref|XP_009142928.1| PREDICTED: biotin synthase [Brassica rapa]
Length=375

 Score =   432 bits (1111),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 217/248 (88%), Positives = 237/248 (96%), Gaps = 1/248 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQIL+Y+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  127  AKEAGSTRFCMGAAWRDTIGRKTNFNQILEYIKEIRGMGMEVCCTLGMIEKQQALELKKA  186

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YD+RLETLE+VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  187  GLTAYNHNLDTSREYYPNVITTRSYDERLETLEHVRDAGINVCSGGIIGLGEAEEDRVGL  246

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  247  LHTLATLPSHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  306

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGLIPKPP F E DSE E
Sbjct  307  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLIPKPPSFSEDDSESE  366

Query  242  NTEEALSS  219
            N E+  SS
Sbjct  367  NCEKVASS  374


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW++ EIK++YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  36    RTIREGPRNDWSKDEIKAVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLS  86



>ref|XP_002881898.1| hypothetical protein ARALYDRAFT_903720 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58157.1| hypothetical protein ARALYDRAFT_903720 [Arabidopsis lyrata subsp. 
lyrata]
Length=377

 Score =   432 bits (1110),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/249 (87%), Positives = 236/249 (95%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQIL+Y+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  128  AKEAGSTRFCMGAAWRDTIGRKTNFNQILEYIKEIRGMGMEVCCTLGMIEKQQALELKKA  187

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YDDRLETLE+VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  188  GLTAYNHNLDTSREYYPNVITTRSYDDRLETLEHVREAGINVCSGGIIGLGEAEEDRVGL  247

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  248  LHTLATLPMHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  307

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED-SEGE  243
            VRFSM EQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGLIPKPP F ED SE E
Sbjct  308  VRFSMAEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLIPKPPSFSEDNSEAE  367

Query  242  NTEEALSSS  216
            N ++  S+S
Sbjct  368  NCDKVASAS  376


 Score = 89.0 bits (219),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW++ EIKS+YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  37    RTIREGPRNDWSKDEIKSVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLS  87



>gb|ABI63585.1| biotin synthase [Brassica rapa subsp. pekinensis]
Length=375

 Score =   432 bits (1110),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 217/248 (88%), Positives = 237/248 (96%), Gaps = 1/248 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQIL+Y+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  127  AKEAGSTRFCMGAAWRDTIGRKTNFNQILEYIKEIRGMGMEVCCTLGMIEKQQALELKKA  186

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YD+RLETLE+VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  187  GLTAYNHNLDTSREYYPNVITTRSYDERLETLEHVRDAGINVCSGGIIGLGEAEEDRVGL  246

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  247  LHTLATLPSHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  306

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGLIPKPP F E DSE E
Sbjct  307  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLIPKPPSFSEDDSESE  366

Query  242  NTEEALSS  219
            N E+  SS
Sbjct  367  NCEKVASS  374


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW++ EIK++YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  36    RTIREGPRNDWSKDEIKAVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLS  86



>ref|XP_008804203.1| PREDICTED: biotin synthase [Phoenix dactylifera]
Length=341

 Score =   430 bits (1105),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 219/252 (87%), Positives = 237/252 (94%), Gaps = 3/252 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+YVK+IR MGMEVCCTLGMLEKQQA+ELKKA
Sbjct  90   AKEAGSTRFCMGAAWRDTVGRKTNFNQILEYVKEIRSMGMEVCCTLGMLEKQQAMELKKA  149

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YD+RLETL+ VREAGISVCSGGIIGLGEA++DR+GL
Sbjct  150  GLTAYNHNLDTSREYYPNIITTRSYDERLETLQYVREAGISVCSGGIIGLGEAEEDRVGL  209

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALVAVKGTPL+DQKPVEIW+MIRMIATARIVMP AMVRLSAGR
Sbjct  210  LHTLATLPTHPESVPINALVAVKGTPLQDQKPVEIWEMIRMIATARIVMPRAMVRLSAGR  269

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDS---E  249
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGL PK P F E++   E
Sbjct  270  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKILGLTPKAPSFSEEAKACE  329

Query  248  GENTEEALSSSG  213
             E  EEA+SSSG
Sbjct  330  LERCEEAVSSSG  341


 Score = 78.6 bits (192),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = -2

Query  1090  PRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             PR DW+R EIKS+YDSP+LDLLFHGAQVHRH   F+EVQ CTLL
Sbjct  5     PRKDWSREEIKSVYDSPILDLLFHGAQVHRHVHKFREVQQCTLL  48



>ref|XP_006294408.1| hypothetical protein CARUB_v10023426mg [Capsella rubella]
 gb|EOA27306.1| hypothetical protein CARUB_v10023426mg [Capsella rubella]
Length=380

 Score =   430 bits (1106),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 217/249 (87%), Positives = 236/249 (95%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQILDY+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  131  AKEAGSTRFCMGAAWRDTIGRKTNFNQILDYIKEIRGMGMEVCCTLGMIEKQQALELKKA  190

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YDDRLETL +VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  191  GLTAYNHNLDTSREYYPNVITTRSYDDRLETLGHVRDAGINVCSGGIIGLGEAEEDRVGL  250

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  251  LHTLATLPSHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  310

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGL PKPP F E DSE E
Sbjct  311  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLTPKPPSFSEDDSESE  370

Query  242  NTEEALSSS  216
            N E+  S+S
Sbjct  371  NCEKVASAS  379


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW++ EIK++YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  40    RTIREGPRNDWSKDEIKAVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLS  90



>emb|CDX79828.1| BnaA05g03280D [Brassica napus]
Length=375

 Score =   430 bits (1106),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 216/248 (87%), Positives = 236/248 (95%), Gaps = 1/248 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQIL+Y+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  127  AKEAGSTRFCMGAAWRDTIGRKTNFNQILEYIKEIRGMGMEVCCTLGMIEKQQALELKKA  186

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YD+RLETLE+VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  187  GLTAYNHNLDTSREYYPNVITTRSYDERLETLEHVRDAGINVCSGGIIGLGEAEEDRVGL  246

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  247  LHTLATLPSHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  306

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGL PKPP F E DSE E
Sbjct  307  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLTPKPPSFSEDDSESE  366

Query  242  NTEEALSS  219
            N E+  SS
Sbjct  367  NCEKVASS  374


 Score = 87.8 bits (216),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW++ EIK++YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  36    RTIREGPRNDWSKDEIKAVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLS  86



>ref|XP_010517897.1| PREDICTED: biotin synthase [Camelina sativa]
Length=381

 Score =   429 bits (1104),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 215/249 (86%), Positives = 237/249 (95%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNF+QIL+Y+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  132  AKEAGSTRFCMGAAWRDTIGRKTNFSQILEYIKEIRGMGMEVCCTLGMIEKQQALELKKA  191

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YDDRLETLE+VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  192  GLTAYNHNLDTSREYYPNVITTRSYDDRLETLEHVRDAGINVCSGGIIGLGEAEEDRVGL  251

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLE+QKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  252  LHTLATLPSHPESVPINALLAVKGTPLENQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  311

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGL PKPP F E DSE E
Sbjct  312  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLTPKPPSFSEDDSESE  371

Query  242  NTEEALSSS  216
            N EE  S++
Sbjct  372  NFEEVASAT  380


 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW+R EIK++YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  41    RTIREGPRNDWSREEIKAVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLS  91



>ref|XP_010508441.1| PREDICTED: biotin synthase-like [Camelina sativa]
Length=381

 Score =   429 bits (1103),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 216/249 (87%), Positives = 236/249 (95%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNF+QIL+Y+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  132  AKEAGSTRFCMGAAWRDTIGRKTNFSQILEYIKEIRGMGMEVCCTLGMIEKQQALELKKA  191

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YDDRLETLE+VR AGI+VCSGGIIGLGEA++DR+GL
Sbjct  192  GLTAYNHNLDTSREYYPNVITTRSYDDRLETLEHVRGAGINVCSGGIIGLGEAEEDRVGL  251

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLE+QKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  252  LHTLATLPSHPESVPINALLAVKGTPLENQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  311

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNNDYDADQLM K LGLIPKPP F E DSE E
Sbjct  312  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDYDADQLMLKTLGLIPKPPSFSEDDSESE  371

Query  242  NTEEALSSS  216
            N EE  S++
Sbjct  372  NFEEVASAT  380


 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I+EGPR++W+R EIK++YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  41    RTIKEGPRNNWSREEIKAVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLS  91



>ref|NP_181864.1| biotin synthase [Arabidopsis thaliana]
 sp|P54967.1|BIOB_ARATH RecName: Full=Biotin synthase [Arabidopsis thaliana]
 gb|AAA80226.1| biotin sythase [Arabidopsis thaliana]
 gb|AAC49445.1| BIO2 protein [Arabidopsis thaliana]
 gb|AAB39953.1| biotin synthase [Arabidopsis thaliana]
 gb|AAB64312.1| biotin synthase (Bio B) [Arabidopsis thaliana]
 gb|ABD85170.1| At2g43360 [Arabidopsis thaliana]
 gb|AEC10256.1| biotin synthase [Arabidopsis thaliana]
 prf||2209438A biotin synthase
Length=378

 Score =   429 bits (1102),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 216/249 (87%), Positives = 236/249 (95%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNF+QIL+Y+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  129  AKEAGSTRFCMGAAWRDTIGRKTNFSQILEYIKEIRGMGMEVCCTLGMIEKQQALELKKA  188

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YDDRLETL +VR+AGI+VCSGGIIGLGEA++DRIGL
Sbjct  189  GLTAYNHNLDTSREYYPNVITTRSYDDRLETLSHVRDAGINVCSGGIIGLGEAEEDRIGL  248

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  249  LHTLATLPSHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  308

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSM EQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGLIPKPP F E DSE E
Sbjct  309  VRFSMSEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLIPKPPSFSEDDSESE  368

Query  242  NTEEALSSS  216
            N E+  S+S
Sbjct  369  NCEKVASAS  377


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW+R EIKS+YDSPLLDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  38    RTIREGPRNDWSRDEIKSVYDSPLLDLLFHGAQVHRHVHNFREVQQCTLLS  88



>gb|KHG09165.1| Biotin synthase -like protein [Gossypium arboreum]
Length=373

 Score =   428 bits (1101),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 215/249 (86%), Positives = 238/249 (96%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFN IL+YVK+IR MGMEVCCTLGMLEKQQALELKKA
Sbjct  126  AKEAGSTRFCMGAAWRDTVGRKTNFNHILEYVKEIRDMGMEVCCTLGMLEKQQALELKKA  185

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTS+EYYPN+ITTRTYD+RLETL++VREAGI+VCSGGIIGLGEA +DR+GL
Sbjct  186  GLTAYNHNLDTSKEYYPNVITTRTYDERLETLQHVREAGINVCSGGIIGLGEAVEDRVGL  245

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALVAVKGTPL+DQKPVEIW+MIRMIA+ARIVMP++MVRLSAGR
Sbjct  246  LHTLATLPTHPESVPINALVAVKGTPLQDQKPVEIWEMIRMIASARIVMPKSMVRLSAGR  305

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNNDYDADQ+MFK+LGLIPK P F E+ E EN
Sbjct  306  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDYDADQVMFKILGLIPKAPSFSEE-EAEN  364

Query  239  TEEALSSSG  213
             +EA+S+SG
Sbjct  365  YDEAVSTSG  373


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DWTR +I SIY SPLLDLLFHGAQVHR   NF+EVQ CTLL 
Sbjct  35    RTIREGPRNDWTRQQIDSIYHSPLLDLLFHGAQVHRDAHNFREVQQCTLLS  85



>ref|XP_010930184.1| PREDICTED: biotin synthase [Elaeis guineensis]
Length=373

 Score =   427 bits (1099),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 216/252 (86%), Positives = 237/252 (94%), Gaps = 3/252 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+YVK+IRGMGMEVCCTLGMLE+QQA+ELKKA
Sbjct  122  AKEAGSTRFCMGAAWRDTVGRKTNFNQILEYVKEIRGMGMEVCCTLGMLEQQQAMELKKA  181

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YD+RLETL+ VREAGISVCSGGIIGLGEA++DR+GL
Sbjct  182  GLTAYNHNLDTSREYYPNIITTRSYDERLETLQYVREAGISVCSGGIIGLGEAEEDRVGL  241

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALVAVKGTPL+DQKPVE+W+MIRMIATARIVMP AMVRLSAGR
Sbjct  242  LHTLATLPTHPESVPINALVAVKGTPLQDQKPVEVWEMIRMIATARIVMPSAMVRLSAGR  301

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDS---E  249
            V+FSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGL PK P F E++   E
Sbjct  302  VKFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLTPKAPSFSEEAKACE  361

Query  248  GENTEEALSSSG  213
             E  +EA+SSSG
Sbjct  362  LERCKEAVSSSG  373


 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 0/50 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R IREGPR+DW R EIKSIYDSP+LDLLFHGA+VHRH   F+EVQ CTLL
Sbjct  31    RTIREGPRNDWRREEIKSIYDSPILDLLFHGAKVHRHVHKFREVQQCTLL  80



>ref|XP_010506206.1| PREDICTED: biotin synthase-like [Camelina sativa]
Length=381

 Score =   427 bits (1099),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 214/249 (86%), Positives = 237/249 (95%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNF+QIL+Y+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  132  AKEAGSTRFCMGAAWRDTIGRKTNFSQILEYIKEIRGMGMEVCCTLGMIEKQQALELKKA  191

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YDDRLETLE+VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  192  GLTAYNHNLDTSREYYPNVITTRSYDDRLETLEHVRDAGINVCSGGIIGLGEAEEDRVGL  251

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLE+QKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  252  LHTLATLPSHPESVPINALLAVKGTPLENQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  311

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGL PKPP F E DSE E
Sbjct  312  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLTPKPPSFSEDDSESE  371

Query  242  NTEEALSSS  216
            N E+  S++
Sbjct  372  NFEKVASAT  380


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW+R EIK++YDSP+LDLLFHGAQVHRH  NF EVQ CTLL 
Sbjct  41    RTIREGPRNDWSREEIKAVYDSPVLDLLFHGAQVHRHVHNFGEVQQCTLLS  91



>ref|XP_006397502.1| hypothetical protein EUTSA_v10001495mg [Eutrema salsugineum]
 ref|XP_006397504.1| hypothetical protein EUTSA_v10001495mg [Eutrema salsugineum]
 gb|ESQ38955.1| hypothetical protein EUTSA_v10001495mg [Eutrema salsugineum]
 gb|ESQ38957.1| hypothetical protein EUTSA_v10001495mg [Eutrema salsugineum]
Length=379

 Score =   427 bits (1099),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 214/249 (86%), Positives = 236/249 (95%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQILDY+K+IRGMGMEVCCTLGM+EKQQAL+LKKA
Sbjct  130  AKEAGSTRFCMGAAWRDTIGRKTNFNQILDYIKEIRGMGMEVCCTLGMIEKQQALQLKKA  189

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YD+RLETL++VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  190  GLTAYNHNLDTSREYYPNVITTRSYDERLETLDHVREAGINVCSGGIIGLGEAEEDRVGL  249

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  250  LHTLATLPSHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  309

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSM EQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGL PKPP F E DSE E
Sbjct  310  VRFSMAEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLTPKPPSFSEDDSESE  369

Query  242  NTEEALSSS  216
            + E+  S+S
Sbjct  370  SCEKVASAS  378


 Score = 85.9 bits (211),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW+R EIK++++SP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  39    RTIREGPRNDWSRDEIKAVFESPVLDLLFHGAQVHRHVHNFREVQQCTLLS  89



>gb|EYU36695.1| hypothetical protein MIMGU_mgv1a008492mg [Erythranthe guttata]
Length=372

 Score =   427 bits (1098),  Expect = 8e-143, Method: Compositional matrix adjust.
 Identities = 216/251 (86%), Positives = 238/251 (95%), Gaps = 1/251 (0%)
 Frame = -1

Query  962  SAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKK  783
            +AKEAGST FC+GAAWRDTIGRKTNF+QILDYVK+IRGMGMEVCCTLGMLEKQQALELKK
Sbjct  122  NAKEAGSTRFCMGAAWRDTIGRKTNFSQILDYVKEIRGMGMEVCCTLGMLEKQQALELKK  181

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE+VR+AGI+VCSGGIIGLGEA++DR+G
Sbjct  182  AGLTAYNHNLDTSREYYPNIITTRTYDERLQTLEHVRDAGINVCSGGIIGLGEAEEDRVG  241

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            LLHTLATLP HPESVPINAL+AV GTPLEDQKPVEIW+MIRMIATARI+MP+AMVRLSAG
Sbjct  242  LLHTLATLPAHPESVPINALLAVSGTPLEDQKPVEIWEMIRMIATARIIMPKAMVRLSAG  301

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED-SEG  246
            RVRFS+PEQ LCFLAGANSIFTGEKLLTTPNNDYDADQ MFK+LGLIPK P F ++ +E 
Sbjct  302  RVRFSIPEQALCFLAGANSIFTGEKLLTTPNNDYDADQTMFKLLGLIPKAPDFSQNLTEP  361

Query  245  ENTEEALSSSG  213
            +N E A SSSG
Sbjct  362  QNVEMAASSSG  372


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RC+REG R+DW R EIK IYDSP+LDLLFH AQVHRH  NF+EVQ CTLL 
Sbjct  32    RCVREGARNDWRREEIKDIYDSPVLDLLFHAAQVHRHAHNFREVQQCTLLS  82



>ref|XP_011073966.1| PREDICTED: biotin synthase [Sesamum indicum]
Length=377

 Score =   427 bits (1098),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 220/254 (87%), Positives = 237/254 (93%), Gaps = 5/254 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQIL+YVK+IR MGMEVCCTLGMLEKQQALELKKA
Sbjct  124  AKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKEIRDMGMEVCCTLGMLEKQQALELKKA  183

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YPNIITTRTYD+RL+TLE VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  184  GLTAYNHNLDTSREFYPNIITTRTYDERLQTLEYVRDAGINVCSGGIIGLGEAEEDRVGL  243

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINALVAVKGTPLEDQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  244  LHTLATLPSHPESVPINALVAVKGTPLEDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  303

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-----D  255
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNNDYDADQ MFK+LGLIPK P F E     +
Sbjct  304  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDYDADQTMFKLLGLIPKAPDFSERPAARE  363

Query  254  SEGENTEEALSSSG  213
             E ENTE A +SSG
Sbjct  364  FEPENTEVAAASSG  377


 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREG R+DW R EIKSIYDSP+LDLLFH AQVHRH  NF+EVQ CTLL 
Sbjct  33    RSIREGARNDWRREEIKSIYDSPILDLLFHAAQVHRHAHNFREVQQCTLLS  83



>ref|XP_006397503.1| hypothetical protein EUTSA_v10001495mg [Eutrema salsugineum]
 gb|ESQ38956.1| hypothetical protein EUTSA_v10001495mg [Eutrema salsugineum]
Length=377

 Score =   427 bits (1097),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 214/249 (86%), Positives = 236/249 (95%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQILDY+K+IRGMGMEVCCTLGM+EKQQAL+LKKA
Sbjct  128  AKEAGSTRFCMGAAWRDTIGRKTNFNQILDYIKEIRGMGMEVCCTLGMIEKQQALQLKKA  187

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YD+RLETL++VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  188  GLTAYNHNLDTSREYYPNVITTRSYDERLETLDHVREAGINVCSGGIIGLGEAEEDRVGL  247

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  248  LHTLATLPSHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  307

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSM EQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGL PKPP F E DSE E
Sbjct  308  VRFSMAEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLTPKPPSFSEDDSESE  367

Query  242  NTEEALSSS  216
            + E+  S+S
Sbjct  368  SCEKVASAS  376


 Score = 77.4 bits (189),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 43/51 (84%), Gaps = 2/51 (4%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW+R EIK++++SP+LDLLFHG  VHRH  NF+EVQ CTLL 
Sbjct  39    RTIREGPRNDWSRDEIKAVFESPVLDLLFHG--VHRHVHNFREVQQCTLLS  87



>gb|AAO41898.1| putative biotin synthase (Bio B) [Arabidopsis thaliana]
Length=378

 Score =   427 bits (1097),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 215/249 (86%), Positives = 236/249 (95%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNF+QIL+Y+K+IRGMGMEVCCTLGM+E+QQALELKKA
Sbjct  129  AKEAGSTRFCMGAAWRDTIGRKTNFSQILEYIKEIRGMGMEVCCTLGMIEEQQALELKKA  188

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YDDRLETL +VR+AGI+VCSGGIIGLGEA++DRIGL
Sbjct  189  GLTAYNHNLDTSREYYPNVITTRSYDDRLETLSHVRDAGINVCSGGIIGLGEAEEDRIGL  248

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  249  LHTLATLPSHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  308

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSM EQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGLIPKPP F E DSE E
Sbjct  309  VRFSMSEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLIPKPPSFSEDDSESE  368

Query  242  NTEEALSSS  216
            N E+  S+S
Sbjct  369  NCEKVASAS  377


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW+R EIKS+YDSPLLDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  38    RTIREGPRNDWSRDEIKSVYDSPLLDLLFHGAQVHRHVHNFREVQQCTLLS  88



>ref|XP_002529753.1| biotin synthase, putative [Ricinus communis]
 gb|EEF32619.1| biotin synthase, putative [Ricinus communis]
Length=375

 Score =   426 bits (1095),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 214/253 (85%), Positives = 236/253 (93%), Gaps = 4/253 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQILDYVK+IR MGMEVCCTLGMLEKQQA ELKKA
Sbjct  123  AKEAGSTRFCMGAAWRDTIGRKTNFNQILDYVKEIRDMGMEVCCTLGMLEKQQAAELKKA  182

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNII+TR+YD+RL+TLE+VRE GI+VCSGGIIGLGEA++DR+GL
Sbjct  183  GLTAYNHNLDTSREYYPNIISTRSYDERLKTLEHVREVGINVCSGGIIGLGEAEEDRVGL  242

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLP HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMIATARI+MP+AMVRLSAGR
Sbjct  243  LHTLSTLPMHPESVPINALIAVKGTPLEDQKPVEIWEMIRMIATARIIMPKAMVRLSAGR  302

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDS----  252
            VRFS+ EQ LCFL+GANSIFTGEKLLTTPNND+DADQLMFK+LGLIPK P F ED     
Sbjct  303  VRFSIAEQALCFLSGANSIFTGEKLLTTPNNDFDADQLMFKLLGLIPKAPSFPEDEERAL  362

Query  251  EGENTEEALSSSG  213
            E EN +EA+SSSG
Sbjct  363  ESENCQEAVSSSG  375


 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R I+EGPR+DWTR EIK++YDSPLLDLLFHGAQVHRH  NF+EVQ CTLL
Sbjct  32    RTIKEGPRNDWTRQEIKNVYDSPLLDLLFHGAQVHRHFQNFREVQQCTLL  81



>ref|XP_011026381.1| PREDICTED: biotin synthase-like [Populus euphratica]
 ref|XP_011014399.1| PREDICTED: biotin synthase-like [Populus euphratica]
Length=382

 Score =   426 bits (1094),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 217/254 (85%), Positives = 236/254 (93%), Gaps = 6/254 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQILDYVK+IR MGMEVCCTLGMLEKQQA+ELKKA
Sbjct  127  AKEAGSTRFCMGAAWRDTIGRKTNFNQILDYVKEIRDMGMEVCCTLGMLEKQQAVELKKA  186

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YD+RLETLE+VREAGISVCSGGIIGLGEA++DR+GL
Sbjct  187  GLTAYNHNLDTSREYYPNIITTRSYDERLETLEHVREAGISVCSGGIIGLGEAEEDRVGL  246

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALVAVKGTPL++QKPVEIW+MIRMI +ARIVMP+AMVRLSAGR
Sbjct  247  LHTLATLPTHPESVPINALVAVKGTPLQEQKPVEIWEMIRMIGSARIVMPKAMVRLSAGR  306

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED-----  255
            VRFSM EQ LCFLAGANSIFTGEKLLTTPNNDYDADQLMFK+LGLIPK P F  +     
Sbjct  307  VRFSMAEQALCFLAGANSIFTGEKLLTTPNNDYDADQLMFKVLGLIPKAPSFSAEEEKAC  366

Query  254  -SEGENTEEALSSS  216
              E E+ +EA+SSS
Sbjct  367  ACEAEHCQEAVSSS  380


 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             + I++GPR+DWTR EIK +YDSPLLD+LFHGAQVHR+  NF+EVQ CTLL
Sbjct  36    KTIKDGPRNDWTRQEIKEVYDSPLLDILFHGAQVHRYAHNFREVQQCTLL  85



>ref|XP_007131558.1| hypothetical protein PHAVU_011G023300g [Phaseolus vulgaris]
 gb|ESW03552.1| hypothetical protein PHAVU_011G023300g [Phaseolus vulgaris]
Length=280

 Score =   422 bits (1084),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 215/258 (83%), Positives = 238/258 (92%), Gaps = 2/258 (1%)
 Frame = -1

Query  983  RGTTLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQ  804
            +G  L   AKEAGST FC+GAAWRDT+GRKTNFNQIL+YVK IR MGMEVCCTLGMLEKQ
Sbjct  23   KGVILFLQAKEAGSTRFCMGAAWRDTLGRKTNFNQILEYVKDIREMGMEVCCTLGMLEKQ  82

Query  803  QALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGE  624
            QA+ELKKAGLTAYNHNLDTSREYYPNIITTRTYD+RLETLE VR+AGI+VCSGGIIGLGE
Sbjct  83   QAIELKKAGLTAYNHNLDTSREYYPNIITTRTYDERLETLEFVRDAGINVCSGGIIGLGE  142

Query  623  ADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEA  444
            A++DR+GLLHTL+TLPTHPESVPINAL+AVKGTPLE+QKPVEIW+MIRMI TARI+MP+A
Sbjct  143  AEEDRVGLLHTLSTLPTHPESVPINALIAVKGTPLENQKPVEIWEMIRMIGTARIIMPKA  202

Query  443  MVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKF  264
            MVRLSAGRVRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGL+PK P F
Sbjct  203  MVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLLPKAPSF  262

Query  263  L--EDSEGENTEEALSSS  216
               E +E E+ +EA SSS
Sbjct  263  HEGETNETEDYKEAASSS  280



>ref|XP_002310445.1| Biotin synthase family protein [Populus trichocarpa]
 gb|EEE90895.1| Biotin synthase family protein [Populus trichocarpa]
Length=382

 Score =   425 bits (1093),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 234/254 (92%), Gaps = 6/254 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQILDYVK+IRGMGMEVCCTLGMLEKQQA ELKKA
Sbjct  127  AKEAGSTRFCMGAAWRDTIGRKTNFNQILDYVKEIRGMGMEVCCTLGMLEKQQAAELKKA  186

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YD+RLETLE+VREAGISVCSGGIIGLGEA++DR+GL
Sbjct  187  GLTAYNHNLDTSREYYPNIITTRSYDERLETLEHVREAGISVCSGGIIGLGEAEEDRVGL  246

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALVAVKGTPL++QKPVEIW+MIRMI +ARIVMP+AMVRLSAGR
Sbjct  247  LHTLATLPTHPESVPINALVAVKGTPLQEQKPVEIWEMIRMIGSARIVMPKAMVRLSAGR  306

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED-----  255
            V FSM EQ LCFLAGANSIFTGEKLLTTPNNDYDADQLMFK+LGLIPK P F  D     
Sbjct  307  VSFSMAEQALCFLAGANSIFTGEKLLTTPNNDYDADQLMFKVLGLIPKAPSFSADEEKAC  366

Query  254  -SEGENTEEALSSS  216
              E E  +EA+SSS
Sbjct  367  ACEAERCQEAVSSS  380


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             + I++GPR+DWTR EIK +YDSPLLDLLFHGAQVHR+  NF+EVQ CTLL 
Sbjct  36    KTIKDGPRNDWTRQEIKEVYDSPLLDLLFHGAQVHRYAHNFREVQQCTLLS  86



>ref|XP_010057797.1| PREDICTED: biotin synthase-like [Eucalyptus grandis]
 ref|XP_010057867.1| PREDICTED: biotin synthase-like [Eucalyptus grandis]
Length=394

 Score =   425 bits (1093),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 216/253 (85%), Positives = 238/253 (94%), Gaps = 4/253 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNF+QIL+YVK+IR MGMEVCCTLGMLEKQQA+ELK A
Sbjct  142  AKEAGSTRFCMGAAWRDTVGRKTNFSQILEYVKEIREMGMEVCCTLGMLEKQQAIELKNA  201

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE+VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  202  GLTAYNHNLDTSREYYPNIITTRTYDERLKTLEHVRDAGINVCSGGIIGLGEAEEDRVGL  261

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  262  LHTLATLPTHPESVPINALIAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  321

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED----S  252
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFKMLGLIPK P F +D     
Sbjct  322  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKMLGLIPKAPSFDDDGAKHD  381

Query  251  EGENTEEALSSSG  213
              E+ EEA+SSSG
Sbjct  382  AAEHCEEAISSSG  394


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I EGPR+DW+R EIKSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  51    RTIIEGPRNDWSRDEIKSIYDSPVLDLLFHGAQVHRHAHNFREVQQCTLLS  101



>emb|CDP10023.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   424 bits (1090),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 216/255 (85%), Positives = 238/255 (93%), Gaps = 4/255 (2%)
 Frame = -1

Query  965  SSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELK  786
            + AKEAGST FC+GAAWRDTIGRKTNFNQIL+YVK+IR MGMEVCCTLGMLEKQQALELK
Sbjct  140  TKAKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKEIRNMGMEVCCTLGMLEKQQALELK  199

Query  785  KAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRI  606
            +AGLTAYNHNLDTSREYYPNIITTRTYD+RLETL+ VREAGI+VCSGGIIGLGEA++DR+
Sbjct  200  RAGLTAYNHNLDTSREYYPNIITTRTYDERLETLKYVREAGINVCSGGIIGLGEAEEDRV  259

Query  605  GllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            GLLHTLATLPTHPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIATARI+MP+AMVRLSA
Sbjct  260  GLLHTLATLPTHPESVPINALLAVKGTPLQDQKPVEIWEMIRMIATARIIMPKAMVRLSA  319

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPK----FLE  258
            GRVRFS+PEQ LCFLAGANSIFTGEKLLTTPNNDY+ADQ MFK+LGLIPK P      L+
Sbjct  320  GRVRFSIPEQALCFLAGANSIFTGEKLLTTPNNDYNADQYMFKLLGLIPKAPDSSELALK  379

Query  257  DSEGENTEEALSSSG  213
            D E E+ EE +SSSG
Sbjct  380  DVEAEDIEEVISSSG  394


 Score = 92.8 bits (229),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IR+GPR+DW+R EIKSIYDSPLLDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  51    RSIRDGPRNDWSRDEIKSIYDSPLLDLLFHGAQVHRHAQNFREVQQCTLLS  101



>ref|XP_006858652.1| hypothetical protein AMTR_s00066p00060150 [Amborella trichopoda]
 gb|ERN20119.1| hypothetical protein AMTR_s00066p00060150 [Amborella trichopoda]
Length=393

 Score =   424 bits (1089),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 215/251 (86%), Positives = 234/251 (93%), Gaps = 8/251 (3%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQILDYVK IR MGMEVCCTLGMLEKQQA ELKKA
Sbjct  133  AKEAGSTRFCMGAAWRDTVGRKTNFNQILDYVKAIRKMGMEVCCTLGMLEKQQAEELKKA  192

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYP II+TR+YDDRL+TLE VREAGISVCSGGIIGLGEA++DR+GL
Sbjct  193  GLTAYNHNLDTSREYYPKIISTRSYDDRLKTLEYVREAGISVCSGGIIGLGEAEEDRVGL  252

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  253  LHTLATLPSHPESVPINALLAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  312

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDS----  252
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNNDYDADQLMFK+LGLIPKPP F+++S    
Sbjct  313  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDYDADQLMFKILGLIPKPPNFVDESGCHG  372

Query  251  ----EGENTEE  231
                EG++ EE
Sbjct  373  CQAQEGDHAEE  383


 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I EGPR+ WT+  I +IYDSP+LDLLFHGAQVHRH   F+EVQ CTLL 
Sbjct  42    RSIAEGPRNHWTKESINAIYDSPILDLLFHGAQVHRHTQKFREVQQCTLLS  92



>ref|XP_011037058.1| PREDICTED: biotin synthase [Populus euphratica]
Length=379

 Score =   423 bits (1087),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 217/253 (86%), Positives = 234/253 (92%), Gaps = 4/253 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRK NFNQILDYVK IR MGMEVCCTLGMLEKQQA+ELKKA
Sbjct  127  AKEAGSTRFCMGAAWRDTIGRKANFNQILDYVKDIRDMGMEVCCTLGMLEKQQAVELKKA  186

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YD+RLETLE+VREAGISVCSGGIIGLGEA++DR+GL
Sbjct  187  GLTAYNHNLDTSREYYPNIITTRSYDERLETLEHVREAGISVCSGGIIGLGEAEEDRVGL  246

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALV+VKGTPL++QKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  247  LHTLATLPTHPESVPINALVSVKGTPLQEQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  306

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFL----EDS  252
            VRFSM EQ LCFLAGANSIFTGEKLLTTPNNDYDADQLMFK+LGLIPK P F     +  
Sbjct  307  VRFSMSEQALCFLAGANSIFTGEKLLTTPNNDYDADQLMFKVLGLIPKAPSFSGEEEKAC  366

Query  251  EGENTEEALSSSG  213
            E E  +EA+SSSG
Sbjct  367  EAEQCQEAVSSSG  379


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             + I++GPR+DWTR EIK +YDSPLLDLLFHGAQVHR+  NF+EVQ CTLL
Sbjct  36    KTIKDGPRNDWTREEIKDVYDSPLLDLLFHGAQVHRYAHNFREVQQCTLL  85



>ref|XP_002263125.1| PREDICTED: biotin synthase [Vitis vinifera]
 emb|CBI36640.3| unnamed protein product [Vitis vinifera]
Length=381

 Score =   423 bits (1087),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 215/253 (85%), Positives = 237/253 (94%), Gaps = 4/253 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+YVK+IR MGMEVCCTLGMLEKQQA+ELKKA
Sbjct  129  AKEAGSTRFCMGAAWRDTVGRKTNFNQILEYVKEIRDMGMEVCCTLGMLEKQQAIELKKA  188

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNII TR+YD+RLETL+ VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  189  GLTAYNHNLDTSREYYPNIIRTRSYDERLETLQLVREAGINVCSGGIIGLGEAEEDRVGL  248

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINAL+AVKGTPLEDQKPVEIW+M+RMIATARIVMP+AMVRLSAGR
Sbjct  249  LHTLATLPTHPESVPINALLAVKGTPLEDQKPVEIWEMVRMIATARIVMPKAMVRLSAGR  308

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED----S  252
            VRFS+PEQ LCFLAGANSIFTG+KLLTTPNND+DADQ MFK+LGLIPK P F ED    S
Sbjct  309  VRFSVPEQALCFLAGANSIFTGDKLLTTPNNDFDADQQMFKLLGLIPKAPSFDEDVAKTS  368

Query  251  EGENTEEALSSSG  213
            E EN E+A+S SG
Sbjct  369  EAENCEQAVSGSG  381


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             R IR+GPR+DWTRPEIKSIYDSPLLDLLFHGAQVHRH  NF+EVQ CTLL  +
Sbjct  38    RAIRDGPRNDWTRPEIKSIYDSPLLDLLFHGAQVHRHAHNFREVQQCTLLSVK  90



>gb|KCW87859.1| hypothetical protein EUGRSUZ_A00256 [Eucalyptus grandis]
 gb|KCW87860.1| hypothetical protein EUGRSUZ_A00256 [Eucalyptus grandis]
Length=460

 Score =   426 bits (1095),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 216/253 (85%), Positives = 238/253 (94%), Gaps = 4/253 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNF+QIL+YVK+IR MGMEVCCTLGMLEKQQA+ELK A
Sbjct  208  AKEAGSTRFCMGAAWRDTVGRKTNFSQILEYVKEIREMGMEVCCTLGMLEKQQAIELKNA  267

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE+VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  268  GLTAYNHNLDTSREYYPNIITTRTYDERLKTLEHVRDAGINVCSGGIIGLGEAEEDRVGL  327

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  328  LHTLATLPTHPESVPINALIAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  387

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED----S  252
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFKMLGLIPK P F +D     
Sbjct  388  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKMLGLIPKAPSFDDDGAKHD  447

Query  251  EGENTEEALSSSG  213
              E+ EEA+SSSG
Sbjct  448  AAEHCEEAISSSG  460


 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I EGPR+DW+R EIKSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  117   RTIIEGPRNDWSRDEIKSIYDSPVLDLLFHGAQVHRHAHNFREVQQCTLLS  167



>ref|XP_010037365.1| PREDICTED: biotin synthase-like [Eucalyptus grandis]
 ref|XP_010038119.1| PREDICTED: biotin synthase-like [Eucalyptus grandis]
Length=394

 Score =   423 bits (1087),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 216/253 (85%), Positives = 236/253 (93%), Gaps = 4/253 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNF QIL+YVK+IR MGMEVCCTLGMLEKQQA+ELK A
Sbjct  142  AKEAGSTRFCMGAAWRDTVGRKTNFGQILEYVKEIREMGMEVCCTLGMLEKQQAIELKNA  201

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  202  GLTAYNHNLDTSREYYPNIITTRTYDERLKTLEYVRDAGINVCSGGIIGLGEAEEDRVGL  261

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  262  LHTLATLPTHPESVPINALIAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  321

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED----S  252
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFKMLGLIPK P F +D     
Sbjct  322  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKMLGLIPKAPSFDDDGAKHD  381

Query  251  EGENTEEALSSSG  213
              E+ EEA+SSSG
Sbjct  382  AAEHCEEAISSSG  394


 Score = 88.6 bits (218),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I EGPR+DW+R EIKSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  51    RTIIEGPRNDWSRDEIKSIYDSPVLDLLFHGAQVHRHAHNFREVQQCTLLS  101



>ref|XP_009337448.1| PREDICTED: biotin synthase-like [Pyrus x bretschneideri]
Length=381

 Score =   422 bits (1085),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 237/254 (93%), Gaps = 5/254 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQIL+YVK IRGMGMEVCCTLGM+EKQQAL+LK+A
Sbjct  128  AKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKDIRGMGMEVCCTLGMIEKQQALKLKEA  187

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RLET+++VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  188  GLTAYNHNLDTSREYYPNIITTRTYDERLETIKHVRDAGINVCSGGIIGLGEAEEDRVGL  247

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALV+VKGTPL+DQKPVEIW+MIRMIATARIVMP AMVRLSAGR
Sbjct  248  LHTLATLPTHPESVPINALVSVKGTPLQDQKPVEIWEMIRMIATARIVMPNAMVRLSAGR  307

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED-----  255
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFKMLGLIPK P F ++     
Sbjct  308  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKMLGLIPKAPSFSDEPANAA  367

Query  254  SEGENTEEALSSSG  213
             E +  E A+SSSG
Sbjct  368  CEADACEVAVSSSG  381


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I +GPR+DWTR EIK +Y SP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  37    RTIAQGPRNDWTRDEIKGVYGSPVLDLLFHGAQVHRHAHNFREVQQCTLLS  87



>emb|CDY17930.1| BnaC04g02890D [Brassica napus]
Length=528

 Score =   427 bits (1099),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 215/248 (87%), Positives = 235/248 (95%), Gaps = 1/248 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNF QIL+Y+K+IRGMGMEVCCTLGM+EKQQALELKKA
Sbjct  280  AKEAGSTRFCMGAAWRDTIGRKTNFKQILEYIKEIRGMGMEVCCTLGMIEKQQALELKKA  339

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YD+RLETLE+VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  340  GLTAYNHNLDTSREYYPNVITTRSYDERLETLEHVRDAGINVCSGGIIGLGEAEEDRVGL  399

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL+AVKGTPLEDQKPVEIW+MIRMI TARIVMP+AMVRLSAGR
Sbjct  400  LHTLATLPSHPESVPINALLAVKGTPLEDQKPVEIWEMIRMIGTARIVMPKAMVRLSAGR  459

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE-DSEGE  243
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK LGL PKPP F E DSE E
Sbjct  460  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKTLGLTPKPPSFSEDDSESE  519

Query  242  NTEEALSS  219
            N E+  SS
Sbjct  520  NCEKVASS  527


 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW++ EIK++YDSP+LD+LFHGAQVHRH  NF+EVQ CTLL 
Sbjct  189   RTIREGPRNDWSKDEIKAVYDSPVLDILFHGAQVHRHVHNFREVQQCTLLS  239



>ref|XP_009363682.1| PREDICTED: biotin synthase-like isoform X2 [Pyrus x bretschneideri]
Length=321

 Score =   420 bits (1079),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 215/258 (83%), Positives = 237/258 (92%), Gaps = 5/258 (2%)
 Frame = -1

Query  971  LHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALE  792
            L   AKEAGST FC+GAAWRDTIGRKTNFNQIL+YVK IRGMGMEVCCTLGM+EKQQAL+
Sbjct  64   LFHGAKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKDIRGMGMEVCCTLGMIEKQQALK  123

Query  791  LKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDD  612
            LK+AGLTAYNHNLDTSREYYPNIITTRTYD+RLET+++VR+AGI+VCSGGIIGLGEA++D
Sbjct  124  LKEAGLTAYNHNLDTSREYYPNIITTRTYDERLETIKHVRDAGINVCSGGIIGLGEAEED  183

Query  611  RIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRL  432
            R+GLLHTLATLPTHPESVPINALV+VKGTPL+DQKPVEIW+MIRMIATARIVMP AMVRL
Sbjct  184  RVGLLHTLATLPTHPESVPINALVSVKGTPLQDQKPVEIWEMIRMIATARIVMPNAMVRL  243

Query  431  SAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED-  255
            SAGRVRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFKMLGLIPK P F ++ 
Sbjct  244  SAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKMLGLIPKAPSFSDEP  303

Query  254  ----SEGENTEEALSSSG  213
                 E +  E A+S SG
Sbjct  304  ANAACEADACEVAVSGSG  321


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQ  1010
             R I +GPR+DWTR EIK +Y SP+LDLLFHGA+
Sbjct  37    RTIAQGPRNDWTRDEIKGVYGSPVLDLLFHGAK  69



>gb|KDO41263.1| hypothetical protein CISIN_1g016605mg [Citrus sinensis]
Length=320

 Score =   419 bits (1078),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/253 (84%), Positives = 234/253 (92%), Gaps = 4/253 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQIL+YVK IR MGMEVCCTLGMLEK QA+ELKKA
Sbjct  68   AKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKDIRDMGMEVCCTLGMLEKHQAIELKKA  127

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+Y  IITTR+YD+RLETL++VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  128  GLTAYNHNLDTSREFYSKIITTRSYDERLETLKHVREAGINVCSGGIIGLGEAEEDRVGL  187

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  188  LHTLATLPTHPESVPINALLAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  247

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED----S  252
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGL PK P F E     S
Sbjct  248  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLTPKAPSFHEGEANVS  307

Query  251  EGENTEEALSSSG  213
            E E+ +EA+S SG
Sbjct  308  EAESCQEAVSHSG  320



>ref|XP_004140874.1| PREDICTED: biotin synthase-like [Cucumis sativus]
 gb|KGN45987.1| hypothetical protein Csa_6G041720 [Cucumis sativus]
Length=385

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/249 (85%), Positives = 234/249 (94%), Gaps = 0/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQILDYVK+IR MGMEVCCTLGM+EKQQA++LKKA
Sbjct  134  AKEAGSTRFCMGAAWRDTIGRKTNFNQILDYVKEIREMGMEVCCTLGMIEKQQAIDLKKA  193

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YD+RL+TLE VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  194  GLTAYNHNLDTSREYYPNIITTRSYDERLKTLEFVRDAGINVCSGGIIGLGEAEEDRVGL  253

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALVAVKGTPL+DQKPVEIW+MIRMIATARI MP+AMVRLSAGR
Sbjct  254  LHTLATLPTHPESVPINALVAVKGTPLQDQKPVEIWEMIRMIATARITMPKAMVRLSAGR  313

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            V+FS+PEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFKMLGLIPK P F ED+E   
Sbjct  314  VKFSVPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKMLGLIPKAPSFTEDAEKAP  373

Query  239  TEEALSSSG  213
             EE+L  + 
Sbjct  374  EEESLQEAA  382


 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R +R+GPR+DWTR +I+ IYDSPLLDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  43    RLLRDGPRNDWTRQQIRDIYDSPLLDLLFHGAQVHRHTHNFREVQQCTLLS  93



>ref|XP_008445703.1| PREDICTED: biotin synthase [Cucumis melo]
Length=383

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 212/249 (85%), Positives = 234/249 (94%), Gaps = 0/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQILDYVK+IR MGMEVCCTLGM+EKQQA++LKKA
Sbjct  134  AKEAGSTRFCMGAAWRDTIGRKTNFNQILDYVKEIREMGMEVCCTLGMIEKQQAIDLKKA  193

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YD+RL+TLE VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  194  GLTAYNHNLDTSREYYPNIITTRSYDERLKTLEFVRDAGINVCSGGIIGLGEAEEDRVGL  253

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALVAVKGTPL+DQKPVEIW+MIRMIATARI MP+AMVRLSAGR
Sbjct  254  LHTLATLPTHPESVPINALVAVKGTPLQDQKPVEIWEMIRMIATARITMPKAMVRLSAGR  313

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            V+FS+PEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFKMLGLIPK P F ED+E   
Sbjct  314  VKFSVPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKMLGLIPKAPSFTEDAEKAP  373

Query  239  TEEALSSSG  213
             EE+L  + 
Sbjct  374  EEESLQEAA  382


 Score = 87.0 bits (214),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R +R+GPR+DWTR +I+ IYDSPLLDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  43    RLLRDGPRNDWTRQQIRDIYDSPLLDLLFHGAQVHRHAHNFREVQQCTLLS  93



>gb|KDP42820.1| hypothetical protein JCGZ_23762 [Jatropha curcas]
Length=380

 Score =   421 bits (1082),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 217/253 (86%), Positives = 234/253 (92%), Gaps = 5/253 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GR TNFNQILDYVK+IR MGMEVCCTLGMLEKQQA ELKKA
Sbjct  129  AKEAGSTRFCMGAAWRDTVGRNTNFNQILDYVKEIRDMGMEVCCTLGMLEKQQAQELKKA  188

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  189  GLTAYNHNLDTSREYYPNIITTRTYDERLQTLEYVREAGINVCSGGIIGLGEAEEDRVGL  248

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALV+VKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  249  LHTLATLPTHPESVPINALVSVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  308

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDS----  252
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+D DQ MFK+LGLIPK P F ED     
Sbjct  309  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDVDQQMFKVLGLIPKAPSFSEDEEIAF  368

Query  251  EGENTEEALSSSG  213
            E EN  +A+SSSG
Sbjct  369  ESENC-QAVSSSG  380


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R I+EGPR+DWTR EIK +YDSPLLDLLFHGAQVHRH  NF+EVQ CTLL
Sbjct  38    RTIKEGPRNDWTRHEIKDVYDSPLLDLLFHGAQVHRHAQNFREVQQCTLL  87



>ref|XP_006659645.1| PREDICTED: biotin synthase-like [Oryza brachyantha]
Length=264

 Score =   416 bits (1069),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 207/232 (89%), Positives = 223/232 (96%), Gaps = 0/232 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+TIGRKTNFNQIL+YVK+IRGMGMEVCCTLGMLEKQQA ELKKA
Sbjct  13   AKEAGSTRFCMGAAWRETIGRKTNFNQILEYVKEIRGMGMEVCCTLGMLEKQQAEELKKA  72

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YDDRL+TLE+VREAGIS+CSGGIIGLGEA++DR+GL
Sbjct  73   GLTAYNHNLDTSREYYPNIITTRSYDDRLQTLEHVREAGISICSGGIIGLGEAEEDRVGL  132

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVPINALVAVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  133  LHTLATLPAHPESVPINALVAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  192

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKF  264
            VRFSMPEQ LCFLAGANSIF GEKLLTT NND+DADQ MFK+LGLIPK P F
Sbjct  193  VRFSMPEQALCFLAGANSIFAGEKLLTTANNDFDADQAMFKILGLIPKAPSF  244



>ref|NP_001132808.1| uncharacterized protein LOC100194297 [Zea mays]
 gb|ACF81807.1| unknown [Zea mays]
Length=263

 Score =   416 bits (1069),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 211/256 (82%), Positives = 233/256 (91%), Gaps = 7/256 (3%)
 Frame = -1

Query  968  HSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALEL  789
               AKE+GST FC+GAAWR+TIGRK+NFNQIL+YVK+IRGMGMEVCCTLGM+EKQQA EL
Sbjct  7    QKKAKESGSTRFCMGAAWRETIGRKSNFNQILEYVKEIRGMGMEVCCTLGMIEKQQAEEL  66

Query  788  KKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDR  609
            KKAGLTAYNHNLDTSREYYPNIITTR+YDDRL+TLE+VREAGIS+CSGGIIGLGEA++DR
Sbjct  67   KKAGLTAYNHNLDTSREYYPNIITTRSYDDRLQTLEHVREAGISICSGGIIGLGEAEEDR  126

Query  608  IGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLS  429
            +GLLHTLATLPTHPESVPINALVAVKGTPLEDQKPVEIW+MIRMIATARI MP+AMVRLS
Sbjct  127  VGLLHTLATLPTHPESVPINALVAVKGTPLEDQKPVEIWEMIRMIATARITMPKAMVRLS  186

Query  428  AGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED--  255
            AGRVRFSMPEQ LCFLAGANSIF GEKLLTT NND+DADQ MFK+LGLIPK P F E+  
Sbjct  187  AGRVRFSMPEQALCFLAGANSIFAGEKLLTTANNDFDADQAMFKILGLIPKAPSFGEEEA  246

Query  254  -----SEGENTEEALS  222
                 +E E +E+A S
Sbjct  247  SAAAPTESERSEQAAS  262



>ref|XP_009363681.1| PREDICTED: biotin synthase-like isoform X1 [Pyrus x bretschneideri]
Length=381

 Score =   420 bits (1080),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 236/254 (93%), Gaps = 5/254 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQIL+YVK IRGMGMEVCCTLGM+EKQQAL+LK+A
Sbjct  128  AKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKDIRGMGMEVCCTLGMIEKQQALKLKEA  187

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RLET+++VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  188  GLTAYNHNLDTSREYYPNIITTRTYDERLETIKHVRDAGINVCSGGIIGLGEAEEDRVGL  247

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALV+VKGTPL+DQKPVEIW+MIRMIATARIVMP AMVRLSAGR
Sbjct  248  LHTLATLPTHPESVPINALVSVKGTPLQDQKPVEIWEMIRMIATARIVMPNAMVRLSAGR  307

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED-----  255
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFKMLGLIPK P F ++     
Sbjct  308  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKMLGLIPKAPSFSDEPANAA  367

Query  254  SEGENTEEALSSSG  213
             E +  E A+S SG
Sbjct  368  CEADACEVAVSGSG  381


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I +GPR+DWTR EIK +Y SP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  37    RTIAQGPRNDWTRDEIKGVYGSPVLDLLFHGAQVHRHAHNFREVQQCTLLS  87



>gb|KCW87664.1| hypothetical protein EUGRSUZ_A00054 [Eucalyptus grandis]
Length=473

 Score =   423 bits (1088),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 216/253 (85%), Positives = 236/253 (93%), Gaps = 4/253 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNF QIL+YVK+IR MGMEVCCTLGMLEKQQA+ELK A
Sbjct  221  AKEAGSTRFCMGAAWRDTVGRKTNFGQILEYVKEIREMGMEVCCTLGMLEKQQAIELKNA  280

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  281  GLTAYNHNLDTSREYYPNIITTRTYDERLKTLEYVRDAGINVCSGGIIGLGEAEEDRVGL  340

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  341  LHTLATLPTHPESVPINALIAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  400

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED----S  252
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFKMLGLIPK P F +D     
Sbjct  401  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKMLGLIPKAPSFDDDGAKHD  460

Query  251  EGENTEEALSSSG  213
              E+ EEA+SSSG
Sbjct  461  AAEHCEEAISSSG  473


 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I EGPR+DW+R EIKSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  130   RTIIEGPRNDWSRDEIKSIYDSPVLDLLFHGAQVHRHAHNFREVQQCTLLS  180



>ref|XP_003537735.1| PREDICTED: biotin synthase-like [Glycine max]
 gb|KHN05508.1| Biotin synthase [Glycine soja]
Length=374

 Score =   418 bits (1075),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 215/250 (86%), Positives = 234/250 (94%), Gaps = 2/250 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+YVK IR MGMEVCCTLGMLEKQQA+ELKKA
Sbjct  125  AKEAGSTRFCMGAAWRDTLGRKTNFNQILEYVKDIRDMGMEVCCTLGMLEKQQAVELKKA  184

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  185  GLTAYNHNLDTSREYYPNIITTRTYDERLQTLEFVRDAGINVCSGGIIGLGEAEEDRVGL  244

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLPTHPESVPINALVAVKGTPLEDQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  245  LHTLSTLPTHPESVPINALVAVKGTPLEDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  304

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFL--EDSEG  246
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGL+PK P     E S  
Sbjct  305  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLLPKAPSLHEGETSVT  364

Query  245  ENTEEALSSS  216
            E+ +EA SSS
Sbjct  365  EDYKEAASSS  374


 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I+EGPR+DW+R ++KSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  34    RAIKEGPRNDWSRDQVKSIYDSPILDLLFHGAQVHRHAHNFREVQQCTLLS  84



>gb|KCW87858.1| hypothetical protein EUGRSUZ_A00256 [Eucalyptus grandis]
Length=461

 Score =   421 bits (1083),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 238/254 (94%), Gaps = 5/254 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQI-RGMGMEVCCTLGMLEKQQALELKK  783
            AKEAGST FC+GAAWRDT+GRKTNF+QIL+YVK+I R MGMEVCCTLGMLEKQQA+ELK 
Sbjct  208  AKEAGSTRFCMGAAWRDTVGRKTNFSQILEYVKEISREMGMEVCCTLGMLEKQQAIELKN  267

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE+VR+AGI+VCSGGIIGLGEA++DR+G
Sbjct  268  AGLTAYNHNLDTSREYYPNIITTRTYDERLKTLEHVRDAGINVCSGGIIGLGEAEEDRVG  327

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            LLHTLATLPTHPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAG
Sbjct  328  LLHTLATLPTHPESVPINALIAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAG  387

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED----  255
            RVRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFKMLGLIPK P F +D    
Sbjct  388  RVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKMLGLIPKAPSFDDDGAKH  447

Query  254  SEGENTEEALSSSG  213
               E+ EEA+SSSG
Sbjct  448  DAAEHCEEAISSSG  461


 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I EGPR+DW+R EIKSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  117   RTIIEGPRNDWSRDEIKSIYDSPVLDLLFHGAQVHRHAHNFREVQQCTLLS  167



>ref|XP_006443087.1| hypothetical protein CICLE_v10020553mg [Citrus clementina]
 ref|XP_006443088.1| hypothetical protein CICLE_v10020553mg [Citrus clementina]
 gb|ESR56327.1| hypothetical protein CICLE_v10020553mg [Citrus clementina]
 gb|ESR56328.1| hypothetical protein CICLE_v10020553mg [Citrus clementina]
 gb|KDO41260.1| hypothetical protein CISIN_1g016605mg [Citrus sinensis]
 gb|KDO41261.1| hypothetical protein CISIN_1g016605mg [Citrus sinensis]
Length=386

 Score =   418 bits (1075),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 213/253 (84%), Positives = 234/253 (92%), Gaps = 4/253 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQIL+YVK IR MGMEVCCTLGMLEK QA+ELKKA
Sbjct  134  AKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKDIRDMGMEVCCTLGMLEKHQAIELKKA  193

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+Y  IITTR+YD+RLETL++VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  194  GLTAYNHNLDTSREFYSKIITTRSYDERLETLKHVREAGINVCSGGIIGLGEAEEDRVGL  253

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  254  LHTLATLPTHPESVPINALLAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  313

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED----S  252
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGL PK P F E     S
Sbjct  314  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLTPKAPSFHEGEANVS  373

Query  251  EGENTEEALSSSG  213
            E E+ +EA+S SG
Sbjct  374  EAESCQEAVSHSG  386


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPRHDW++ +IKSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  43    RTIREGPRHDWSKDDIKSIYDSPVLDLLFHGAQVHRHAHNFREVQQCTLLS  93



>ref|XP_008372053.1| PREDICTED: biotin synthase [Malus domestica]
Length=322

 Score =   416 bits (1069),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 208/239 (87%), Positives = 229/239 (96%), Gaps = 0/239 (0%)
 Frame = -1

Query  971  LHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALE  792
            L   AKEAGST FC+GAAWRDTIGRKTNFNQIL+YVK IRGMGMEVCCTLGM+EKQQAL+
Sbjct  65   LFHGAKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKDIRGMGMEVCCTLGMIEKQQALK  124

Query  791  LKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDD  612
            LK+AGLTAYNHNLDTSREYYPNIITTRTYD+RLET+++VR+AGI+VCSGGIIGLGEA++D
Sbjct  125  LKEAGLTAYNHNLDTSREYYPNIITTRTYDERLETIKHVRDAGINVCSGGIIGLGEAEED  184

Query  611  RIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRL  432
            R+GLLHTLATLPTHPESVPINALV+VKGTPL+DQKPVEIW+MIRMIATARIVMP AMVRL
Sbjct  185  RVGLLHTLATLPTHPESVPINALVSVKGTPLQDQKPVEIWEMIRMIATARIVMPNAMVRL  244

Query  431  SAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED  255
            SAGRV+FSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFKMLGLIPK P F ++
Sbjct  245  SAGRVKFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKMLGLIPKAPSFSDE  303


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQ  1010
             R I +GPR+DWTR EIK +Y SP+LDLLFHGA+
Sbjct  38    RTIAQGPRNDWTRDEIKDVYGSPVLDLLFHGAK  70



>ref|XP_007131557.1| hypothetical protein PHAVU_011G023300g [Phaseolus vulgaris]
 gb|ESW03551.1| hypothetical protein PHAVU_011G023300g [Phaseolus vulgaris]
Length=374

 Score =   417 bits (1073),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 213/250 (85%), Positives = 235/250 (94%), Gaps = 2/250 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+YVK IR MGMEVCCTLGMLEKQQA+ELKKA
Sbjct  125  AKEAGSTRFCMGAAWRDTLGRKTNFNQILEYVKDIREMGMEVCCTLGMLEKQQAIELKKA  184

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RLETLE VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  185  GLTAYNHNLDTSREYYPNIITTRTYDERLETLEFVRDAGINVCSGGIIGLGEAEEDRVGL  244

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLPTHPESVPINAL+AVKGTPLE+QKPVEIW+MIRMI TARI+MP+AMVRLSAGR
Sbjct  245  LHTLSTLPTHPESVPINALIAVKGTPLENQKPVEIWEMIRMIGTARIIMPKAMVRLSAGR  304

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFL--EDSEG  246
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGL+PK P F   E +E 
Sbjct  305  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLLPKAPSFHEGETNET  364

Query  245  ENTEEALSSS  216
            E+ +EA SSS
Sbjct  365  EDYKEAASSS  374


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I+EGPR+DW+R E+KSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  34    RTIKEGPRNDWSRDEVKSIYDSPVLDLLFHGAQVHRHAHNFREVQQCTLLS  84



>ref|XP_010097490.1| Biotin synthase [Morus notabilis]
 gb|EXB68681.1| Biotin synthase [Morus notabilis]
Length=376

 Score =   417 bits (1073),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 210/253 (83%), Positives = 235/253 (93%), Gaps = 4/253 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+T+GRKTNFNQIL+YVK+IRGMGMEVCCTLGM+EK QA+ELKKA
Sbjct  124  AKEAGSTRFCMGAAWRETVGRKTNFNQILEYVKEIRGMGMEVCCTLGMIEKHQAVELKKA  183

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYDDRL+TL+ VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  184  GLTAYNHNLDTSREYYPNIITTRTYDDRLQTLQYVRDAGINVCSGGIIGLGEAEEDRVGL  243

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINAL+AVKGTPL+DQKPVEIW+MIRMI+TARIVMP+AMVRLSAGR
Sbjct  244  LHTLATLPTHPESVPINALIAVKGTPLQDQKPVEIWEMIRMISTARIVMPKAMVRLSAGR  303

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDS----  252
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGL PK P F ++S    
Sbjct  304  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKLLGLTPKSPSFPQESSTVE  363

Query  251  EGENTEEALSSSG  213
            E E  +EA S + 
Sbjct  364  ESEACQEAASGAA  376


 Score = 89.0 bits (219),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R +++GPR+DWTR EIK++YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL
Sbjct  33    RTVKDGPRNDWTRDEIKAVYDSPILDLLFHGAQVHRHAHNFREVQQCTLL  82



>ref|XP_010525906.1| PREDICTED: biotin synthase [Tarenaya hassleriana]
Length=376

 Score =   417 bits (1072),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 212/248 (85%), Positives = 232/248 (94%), Gaps = 3/248 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQIL+YVK+IR MGMEVCCTLGMLEKQQALELKKA
Sbjct  130  AKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKEIRDMGMEVCCTLGMLEKQQALELKKA  189

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YD+RLETL +VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  190  GLTAYNHNLDTSREYYPNIITTRSYDERLETLNHVREAGINVCSGGIIGLGEAEEDRVGL  249

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINAL+AV+GTPL+DQKPVEIW+MIRMIATARI MP +MVRLSAGR
Sbjct  250  LHTLATLPTHPESVPINALIAVEGTPLQDQKPVEIWEMIRMIATARIAMPRSMVRLSAGR  309

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFSM EQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGL PKPP F ED   E+
Sbjct  310  VRFSMSEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKILGLNPKPPSFPED---ES  366

Query  239  TEEALSSS  216
              E L+S+
Sbjct  367  ESEQLASA  374


 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I EGPR+DWTR EIK++YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  39    RTISEGPRNDWTRDEIKAVYDSPVLDLLFHGAQVHRHAHNFREVQQCTLLS  89



>gb|EAZ07823.1| hypothetical protein OsI_30080 [Oryza sativa Indica Group]
Length=377

 Score =   416 bits (1069),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 208/242 (86%), Positives = 228/242 (94%), Gaps = 0/242 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+TIGRKTNFNQIL+YVK IRGMGMEVCCTLGMLEKQQA ELKKA
Sbjct  128  AKEAGSTRFCMGAAWRETIGRKTNFNQILEYVKDIRGMGMEVCCTLGMLEKQQAEELKKA  187

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNII+TR+YDDRL+TLE+VREAGIS+CSGGIIGLGEA++DR+GL
Sbjct  188  GLTAYNHNLDTSREYYPNIISTRSYDDRLQTLEHVREAGISICSGGIIGLGEAEEDRVGL  247

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVPINALVAVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  248  LHTLATLPAHPESVPINALVAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  307

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFSMPEQ LCFLAGANSIF GEKLLTT NND+DADQ MFK+LGLIPK P F +++   +
Sbjct  308  VRFSMPEQALCFLAGANSIFAGEKLLTTANNDFDADQAMFKILGLIPKAPSFGDEAPAAD  367

Query  239  TE  234
            TE
Sbjct  368  TE  369


 Score = 80.5 bits (197),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -2

Query  1096  EGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             +GPR+DW+RPEI+++YDSPLLDLLFHGAQVHR    F+EVQ CTLL 
Sbjct  41    DGPRNDWSRPEIQAVYDSPLLDLLFHGAQVHRSVHKFREVQQCTLLS  87



>ref|XP_007223123.1| hypothetical protein PRUPE_ppa007144mg [Prunus persica]
 gb|EMJ24322.1| hypothetical protein PRUPE_ppa007144mg [Prunus persica]
Length=380

 Score =   416 bits (1069),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 206/235 (88%), Positives = 228/235 (97%), Gaps = 0/235 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+YVK IRGMGMEVCCTLGMLEKQQAL+LK+A
Sbjct  128  AKEAGSTRFCMGAAWRDTVGRKTNFNQILEYVKDIRGMGMEVCCTLGMLEKQQALKLKEA  187

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTRTYD+RLET++ VR+AGISVCSGGIIGLGEA++DR+GL
Sbjct  188  GLTAYNHNLDTSREYYPNVITTRTYDERLETIKFVRDAGISVCSGGIIGLGEAEEDRVGL  247

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINALV+VKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  248  LHTLATLPSHPESVPINALVSVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  307

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED  255
            V+FSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGLIPK P F E+
Sbjct  308  VKFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLIPKAPSFSEE  362


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IR+GPR+DW R EIK++Y SP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  37    RTIRQGPRNDWNRDEIKAVYGSPVLDLLFHGAQVHRHTHNFREVQQCTLLS  87



>ref|XP_009591983.1| PREDICTED: biotin synthase [Nicotiana tomentosiformis]
Length=376

 Score =   416 bits (1068),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 213/248 (86%), Positives = 231/248 (93%), Gaps = 1/248 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTN NQI  YVK+IR MGMEVCCTLGMLEKQQALELKKA
Sbjct  129  AKEAGSTRFCMGAAWRDTIGRKTNMNQITKYVKEIRDMGMEVCCTLGMLEKQQALELKKA  188

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RLETL++VREAGI+VCSGGIIGLGEA++DRIGL
Sbjct  189  GLTAYNHNLDTSREYYPNIITTRTYDERLETLKHVREAGINVCSGGIIGLGEAEEDRIGL  248

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINAL+AVKGTPLEDQKPVEIWDMIRMI+TARI MP AMVRLSAGR
Sbjct  249  LHTLATLPTHPESVPINALIAVKGTPLEDQKPVEIWDMIRMISTARITMPSAMVRLSAGR  308

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFS+PEQ LCFLAGANSIFTG+KLLTTPNNDYDADQ MFK+LGL+PK P F ED E ++
Sbjct  309  VRFSIPEQALCFLAGANSIFTGDKLLTTPNNDYDADQNMFKLLGLVPKAPNFSED-EKDS  367

Query  239  TEEALSSS  216
             +E L +S
Sbjct  368  EDEKLEAS  375


 Score = 96.3 bits (238),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RCIREGPR+DW+R EIKSIYDSPLLDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  38    RCIREGPRNDWSRDEIKSIYDSPLLDLLFHGAQVHRHSHNFREVQQCTLLS  88



>ref|XP_009789036.1| PREDICTED: biotin synthase [Nicotiana sylvestris]
Length=376

 Score =   415 bits (1067),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 212/248 (85%), Positives = 231/248 (93%), Gaps = 1/248 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTN NQI  YVK+IR MGMEVCCTLGMLEKQQALELKKA
Sbjct  129  AKEAGSTRFCMGAAWRDTIGRKTNMNQITKYVKEIRDMGMEVCCTLGMLEKQQALELKKA  188

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTS+EYYPNIITTRTYD+RLETL++VREAGI+VCSGGIIGLGEA++DRIGL
Sbjct  189  GLTAYNHNLDTSKEYYPNIITTRTYDERLETLKHVREAGINVCSGGIIGLGEAEEDRIGL  248

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINAL+AVKGTPLEDQKPVEIWDMIRMI+TARI MP AMVRLSAGR
Sbjct  249  LHTLATLPTHPESVPINALIAVKGTPLEDQKPVEIWDMIRMISTARITMPSAMVRLSAGR  308

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFS+PEQ LCFLAGANSIFTG+KLLTTPNNDYDADQ MFK+LGL+PK P F ED E ++
Sbjct  309  VRFSIPEQALCFLAGANSIFTGDKLLTTPNNDYDADQYMFKLLGLVPKAPNFSED-EKDS  367

Query  239  TEEALSSS  216
             +E L +S
Sbjct  368  EDEKLEAS  375


 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RCIREGPR+DW+R EIKSIYDSPLLDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  38    RCIREGPRNDWSRDEIKSIYDSPLLDLLFHGAQVHRHSHNFREVQQCTLLS  88



>gb|ACF82090.1| unknown [Zea mays]
Length=269

 Score =   411 bits (1056),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 206/232 (89%), Positives = 222/232 (96%), Gaps = 0/232 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+TIGRKTNFNQIL+YVK+IRGMGMEVCCTLGM+EKQQA ELKKA
Sbjct  13   AKEAGSTRFCMGAAWRETIGRKTNFNQILEYVKEIRGMGMEVCCTLGMIEKQQAEELKKA  72

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YDDRL+TL++VREAGIS+CSGGIIGLGEA++DR+GL
Sbjct  73   GLTAYNHNLDTSREYYPNIITTRSYDDRLQTLQHVREAGISICSGGIIGLGEAEEDRVGL  132

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALVAVKGTPLEDQKPVEIW+MIRMIATARIVMP AMVRLSAGR
Sbjct  133  LHTLATLPTHPESVPINALVAVKGTPLEDQKPVEIWEMIRMIATARIVMPRAMVRLSAGR  192

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKF  264
            VRFSMPEQ LCFLAGANSIF GEKLLTT NND+DADQ MF +LGLIPK P F
Sbjct  193  VRFSMPEQALCFLAGANSIFAGEKLLTTANNDFDADQAMFNILGLIPKAPSF  244



>ref|NP_001062381.1| Os08g0540100 [Oryza sativa Japonica Group]
 dbj|BAD33149.1| putative biotin synthase [Oryza sativa Japonica Group]
 dbj|BAF24295.1| Os08g0540100 [Oryza sativa Japonica Group]
 gb|EAZ43503.1| hypothetical protein OsJ_28119 [Oryza sativa Japonica Group]
 dbj|BAG94969.1| unnamed protein product [Oryza sativa Japonica Group]
Length=381

 Score =   415 bits (1066),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 208/242 (86%), Positives = 228/242 (94%), Gaps = 0/242 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+TIGRKTNFNQIL+YVK IRGMGMEVCCTLGMLEKQQA ELKKA
Sbjct  132  AKEAGSTRFCMGAAWRETIGRKTNFNQILEYVKDIRGMGMEVCCTLGMLEKQQAEELKKA  191

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNII+TR+YDDRL+TLE+VREAGIS+CSGGIIGLGEA++DR+GL
Sbjct  192  GLTAYNHNLDTSREYYPNIISTRSYDDRLQTLEHVREAGISICSGGIIGLGEAEEDRVGL  251

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVPINALVAVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  252  LHTLATLPAHPESVPINALVAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  311

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFSMPEQ LCFLAGANSIF GEKLLTT NND+DADQ MFK+LGLIPK P F +++   +
Sbjct  312  VRFSMPEQALCFLAGANSIFAGEKLLTTTNNDFDADQAMFKILGLIPKAPSFGDEAPAAD  371

Query  239  TE  234
            TE
Sbjct  372  TE  373


 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 41/46 (89%), Gaps = 0/46 (0%)
 Frame = -2

Query  1096  EGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             +GPR+DW+RPEI+++YDSPLLDLLFHGAQVHR    F+EVQ CTLL
Sbjct  45    DGPRNDWSRPEIQAVYDSPLLDLLFHGAQVHRSVHKFREVQQCTLL  90



>ref|XP_008222578.1| PREDICTED: biotin synthase-like [Prunus mume]
Length=380

 Score =   414 bits (1065),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 205/235 (87%), Positives = 228/235 (97%), Gaps = 0/235 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+YVK IRGMGMEVCCTLGMLEKQQAL+LK+A
Sbjct  128  AKEAGSTRFCMGAAWRDTVGRKTNFNQILEYVKDIRGMGMEVCCTLGMLEKQQALKLKEA  187

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YPN+ITTRTYD+RLET++ VR+AGISVCSGGIIGLGEA++DR+GL
Sbjct  188  GLTAYNHNLDTSREFYPNVITTRTYDERLETIKFVRDAGISVCSGGIIGLGEAEEDRVGL  247

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINALV+VKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  248  LHTLATLPSHPESVPINALVSVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  307

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED  255
            V+FSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGLIPK P F E+
Sbjct  308  VKFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLIPKAPSFSEE  362


 Score = 85.1 bits (209),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IR+GPR+DW R EIK++Y SP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  37    RTIRQGPRNDWNRDEIKAVYGSPVLDLLFHGAQVHRHTHNFREVQQCTLLS  87



>ref|XP_004241394.1| PREDICTED: biotin synthase [Solanum lycopersicum]
Length=376

 Score =   414 bits (1063),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 210/248 (85%), Positives = 232/248 (94%), Gaps = 1/248 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRDTIGRKTN NQI++YVK+IR MGMEVCCTLGMLEKQQALELKKA
Sbjct  129  AKEGGSTRFCMGAAWRDTIGRKTNMNQIVEYVKEIRDMGMEVCCTLGMLEKQQALELKKA  188

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RLETL++VREAGI+VCSGGIIGLGEA++DRIGL
Sbjct  189  GLTAYNHNLDTSREYYPNIITTRTYDERLETLKHVREAGINVCSGGIIGLGEAEEDRIGL  248

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLPTHPESVPINAL+AVKGTPLEDQKPV+IWDMIRMI+TARI MP AMVRLSAGR
Sbjct  249  LHTLSTLPTHPESVPINALIAVKGTPLEDQKPVDIWDMIRMISTARITMPGAMVRLSAGR  308

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFS+PEQ LCFLAGANSIFTGEKLLTTPNNDYDADQ MFK+LGL+PK P F ED E ++
Sbjct  309  VRFSVPEQALCFLAGANSIFTGEKLLTTPNNDYDADQNMFKLLGLVPKAPNFSED-EKDS  367

Query  239  TEEALSSS  216
             +E + +S
Sbjct  368  EDEKMEAS  375


 Score = 94.7 bits (234),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/51 (82%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RCI+EGPR++WTR EIKSIYDSPLLDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  38    RCIKEGPRNNWTRDEIKSIYDSPLLDLLFHGAQVHRHSHNFREVQQCTLLS  88



>ref|XP_004505647.1| PREDICTED: biotin synthase-like [Cicer arietinum]
Length=380

 Score =   414 bits (1063),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/250 (85%), Positives = 233/250 (93%), Gaps = 1/250 (0%)
 Frame = -1

Query  965  SSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELK  786
            + AKEAGST FC+GAAWRDTIGRKTNFNQIL+YVK+I+GMGMEVCCTLGML+K QA ELK
Sbjct  132  TKAKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKEIKGMGMEVCCTLGMLDKDQAGELK  191

Query  785  KAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRI  606
            KAGLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE VR+AGI+VCSGGIIGLGEA++DRI
Sbjct  192  KAGLTAYNHNLDTSREYYPNIITTRTYDERLQTLEFVRDAGINVCSGGIIGLGEAEEDRI  251

Query  605  GllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            GLLHTL+TLP+HPESVPINALVAVKGTPLEDQKPVEIW+MIRMIATARI MP+AMVRLSA
Sbjct  252  GLLHTLSTLPSHPESVPINALVAVKGTPLEDQKPVEIWEMIRMIATARITMPKAMVRLSA  311

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEG  246
            GRVRFSMPEQ LCFLAGANSIF GEKLLTT NND+DADQLMFK+LGL+PK P   ED E 
Sbjct  312  GRVRFSMPEQALCFLAGANSIFAGEKLLTTANNDFDADQLMFKVLGLLPKAPSLNED-EA  370

Query  245  ENTEEALSSS  216
            E+ +EA SSS
Sbjct  371  EDFKEAASSS  380


 Score = 87.0 bits (214),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             + I +GPR+DWT+ E+KSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL  +
Sbjct  43    KTINQGPRNDWTKDEVKSIYDSPILDLLFHGAQVHRHAHNFREVQQCTLLSVK  95



>gb|KHN20632.1| Biotin synthase [Glycine soja]
Length=374

 Score =   412 bits (1060),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 212/250 (85%), Positives = 232/250 (93%), Gaps = 2/250 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+YVK IR MGMEVCCTLGMLEKQQA+ELKKA
Sbjct  125  AKEAGSTRFCMGAAWRDTLGRKTNFNQILEYVKDIRDMGMEVCCTLGMLEKQQAVELKKA  184

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  185  GLTAYNHNLDTSREYYPNIITTRTYDERLQTLEFVRDAGINVCSGGIIGLGEAEEDRVGL  244

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLPTHPESVPINALVAVKGTPLEDQKPVEIW+MIRMIATARI+MP+AMVRLSAGR
Sbjct  245  LHTLSTLPTHPESVPINALVAVKGTPLEDQKPVEIWEMIRMIATARIIMPKAMVRLSAGR  304

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEG--  246
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGL+PK P   E      
Sbjct  305  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLLPKAPSLNEGETNVT  364

Query  245  ENTEEALSSS  216
            E+ +EA  SS
Sbjct  365  EDYKEAAFSS  374


 Score = 85.9 bits (211),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I+E PR+DW+R ++KSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  34    RTIKERPRNDWSRDQVKSIYDSPILDLLFHGAQVHRHAHNFREVQQCTLLS  84



>gb|ACU18888.1| unknown [Glycine max]
Length=374

 Score =   412 bits (1060),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 212/250 (85%), Positives = 232/250 (93%), Gaps = 2/250 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+YVK IR MGMEVCCTLGMLEKQQA+ELKKA
Sbjct  125  AKEAGSTRFCMGAAWRDTLGRKTNFNQILEYVKDIRDMGMEVCCTLGMLEKQQAVELKKA  184

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE VR+AGI+VCSGGIIGLGEA++DR+GL
Sbjct  185  GLTAYNHNLDTSREYYPNIITTRTYDERLQTLEFVRDAGINVCSGGIIGLGEAEEDRVGL  244

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLPTHPESVPINALVAVKGTPLEDQKPVEIW+MIRMIATARI+MP+AMVRLSAGR
Sbjct  245  LHTLSTLPTHPESVPINALVAVKGTPLEDQKPVEIWEMIRMIATARIIMPKAMVRLSAGR  304

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEG--  246
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGL+PK P   E      
Sbjct  305  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLLPKAPSLNEGETNVT  364

Query  245  ENTEEALSSS  216
            E+ +EA  SS
Sbjct  365  EDYKEAAFSS  374


 Score = 89.4 bits (220),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I+EGPR+DW+R ++KSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  34    RTIKEGPRNDWSRDQVKSIYDSPILDLLFHGAQVHRHAHNFREVQQCTLLS  84



>ref|XP_006347274.1| PREDICTED: biotin synthase-like [Solanum tuberosum]
Length=376

 Score =   412 bits (1060),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 209/248 (84%), Positives = 232/248 (94%), Gaps = 1/248 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRDTIGRKTN NQI++YVK+IR MGMEVCCTLGMLEKQQALELKKA
Sbjct  129  AKEGGSTRFCMGAAWRDTIGRKTNMNQIVEYVKEIRDMGMEVCCTLGMLEKQQALELKKA  188

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RL+TL++VREAGI+VCSGGIIGLGEA++DRIGL
Sbjct  189  GLTAYNHNLDTSREYYPNIITTRTYDERLKTLKHVREAGINVCSGGIIGLGEAEEDRIGL  248

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLPTHPESVPINAL+AVKGTPLEDQKPV+IWDMIRMI+TARI MP AMVRLSAGR
Sbjct  249  LHTLSTLPTHPESVPINALIAVKGTPLEDQKPVDIWDMIRMISTARITMPGAMVRLSAGR  308

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFS+PEQ LCFLAGANSIFTGEKLLTTPNNDYDADQ MFK+LGL+PK P F ED E ++
Sbjct  309  VRFSVPEQALCFLAGANSIFTGEKLLTTPNNDYDADQNMFKLLGLVPKAPNFSED-EKDS  367

Query  239  TEEALSSS  216
             +E + +S
Sbjct  368  EDEKMEAS  375


 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RCI+EGPR++WTR EIKS+YDSPLLDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  38    RCIKEGPRNNWTREEIKSVYDSPLLDLLFHGAQVHRHSHNFREVQQCTLLS  88



>ref|XP_003607352.1| Biotin synthase [Medicago truncatula]
 gb|AES89549.1| biotin synthase [Medicago truncatula]
Length=377

 Score =   412 bits (1060),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 210/250 (84%), Positives = 233/250 (93%), Gaps = 2/250 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQIL+YVK+I+GMGMEVCCTLGML+K QA ELKKA
Sbjct  128  AKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKEIKGMGMEVCCTLGMLDKDQAGELKKA  187

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE VR+AGI+VCSGGIIGLGEA+DDR+GL
Sbjct  188  GLTAYNHNLDTSREYYPNIITTRTYDERLKTLEFVRDAGINVCSGGIIGLGEAEDDRVGL  247

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLPTHPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIATARI MP+AMVRLSAGR
Sbjct  248  LHTLSTLPTHPESVPINALIAVKGTPLQDQKPVEIWEMIRMIATARITMPKAMVRLSAGR  307

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED--SEG  246
            VRFS+PEQ LCFLAGANSIF GEKLLTT NND+DADQLMFK+LGL+PK P   +D  +E 
Sbjct  308  VRFSVPEQALCFLAGANSIFAGEKLLTTANNDFDADQLMFKVLGLLPKAPSLDDDETNEA  367

Query  245  ENTEEALSSS  216
            EN +EA SSS
Sbjct  368  ENYKEAASSS  377


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             + I+ GPR+DWT+ E+KSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL  +
Sbjct  37    KTIQNGPRNDWTKDEVKSIYDSPILDLLFHGAQVHRHAHNFREVQQCTLLSVK  89



>ref|XP_004970356.1| PREDICTED: biotin synthase-like [Setaria italica]
Length=383

 Score =   413 bits (1061),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 211/252 (84%), Positives = 232/252 (92%), Gaps = 6/252 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+TIGRKTNFNQIL YVK+IRGMGMEVCCTLGM+EKQQA ELKKA
Sbjct  131  AKEAGSTRFCMGAAWRETIGRKTNFNQILGYVKEIRGMGMEVCCTLGMIEKQQAEELKKA  190

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YDDRL+TL++VREAGIS+CSGGIIGLGEA++DR+GL
Sbjct  191  GLTAYNHNLDTSREYYPNIITTRSYDDRLQTLQHVREAGISICSGGIIGLGEAEEDRVGL  250

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALVAVKGTPLEDQKPVEIW+MIRM+ATARIVMP+AMVRLSAGR
Sbjct  251  LHTLATLPTHPESVPINALVAVKGTPLEDQKPVEIWEMIRMVATARIVMPKAMVRLSAGR  310

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLE------  258
            VRFSMPEQ LCFLAGANSIF GEKLLTT NND+DAD+ MFK+LGLIPK P F +      
Sbjct  311  VRFSMPEQALCFLAGANSIFAGEKLLTTANNDFDADKAMFKILGLIPKAPSFSDEEAAAP  370

Query  257  DSEGENTEEALS  222
            DS+ E  E+A S
Sbjct  371  DSDTERPEQAAS  382


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = -2

Query  1102  IREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             IR+GPR+DW+RPEI+++YDSPLLDLLFHGAQVHR+   F+EVQ CTLL 
Sbjct  42    IRDGPRNDWSRPEIQAVYDSPLLDLLFHGAQVHRNVHKFREVQQCTLLS  90



>ref|XP_006372914.1| Biotin synthase family protein [Populus trichocarpa]
 gb|ERP50711.1| Biotin synthase family protein [Populus trichocarpa]
Length=391

 Score =   413 bits (1061),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 216/265 (82%), Positives = 235/265 (89%), Gaps = 16/265 (6%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQILDYVK IR MGMEVCCTLGMLEKQQA+ELKKA
Sbjct  127  AKEAGSTRFCMGAAWRDTIGRKTNFNQILDYVKDIRDMGMEVCCTLGMLEKQQAVELKKA  186

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YD+RLETL++VREAGI+VCSGGIIGLGEA++DR+GL
Sbjct  187  GLTAYNHNLDTSREYYPNIITTRSYDERLETLQHVREAGINVCSGGIIGLGEAEEDRVGL  246

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQK------------PVEIWDMIRMIATARIV  456
            LHTLATLPTHPESVPINALV+VKGTPL++QK            PVEIW+MIRMI TARIV
Sbjct  247  LHTLATLPTHPESVPINALVSVKGTPLQEQKVLLIPVSYKFSMPVEIWEMIRMIGTARIV  306

Query  455  MPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            MP+AMVRLSAGRVRFSM EQ LCFLAGANSIFTGEKLLTTPNNDYDADQLMFK+LGLIPK
Sbjct  307  MPKAMVRLSAGRVRFSMSEQALCFLAGANSIFTGEKLLTTPNNDYDADQLMFKVLGLIPK  366

Query  275  PPKFL----EDSEGENTEEALSSSG  213
             P F     +  E E  +EA+SSSG
Sbjct  367  APSFSGEEEKACEAEQCQEAVSSSG  391


 Score = 87.0 bits (214),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             + I++GPR+DWTR EIK +YDSPLLDLLFHGAQVHR+  NF+EVQ CTLL
Sbjct  36    KTIKDGPRNDWTREEIKDVYDSPLLDLLFHGAQVHRYAHNFREVQQCTLL  85



>ref|XP_004956197.1| PREDICTED: biotin synthase-like [Setaria italica]
Length=385

 Score =   412 bits (1058),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 209/251 (83%), Positives = 232/251 (92%), Gaps = 5/251 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+TIGRKTNFNQIL+YVK+IRGMGMEVCCTLGM+EKQQA ELKKA
Sbjct  134  AKEAGSTRFCMGAAWRETIGRKTNFNQILEYVKEIRGMGMEVCCTLGMIEKQQAEELKKA  193

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YDDRL+TL++VREAGIS+CSGGIIGLGEA++DR+GL
Sbjct  194  GLTAYNHNLDTSREYYPNIITTRSYDDRLQTLQHVREAGISICSGGIIGLGEAEEDRVGL  253

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVPINALVAVKGTPL DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  254  LHTLATLPAHPESVPINALVAVKGTPLGDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  313

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED-----  255
            VRFSMPEQ LCFLAGANSIF GEKLLTT NND+DADQ MFK+LGLIPK P F ++     
Sbjct  314  VRFSMPEQALCFLAGANSIFAGEKLLTTANNDFDADQAMFKILGLIPKAPSFGDEEAPAP  373

Query  254  SEGENTEEALS  222
            ++ E +E+A S
Sbjct  374  ADTERSEQAAS  384


 Score = 89.4 bits (220),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DW+RPEI+++YDSPLLDLLFHGAQVHRH   F+EVQ CTLL 
Sbjct  43    RTIREGPRNDWSRPEIQAVYDSPLLDLLFHGAQVHRHVHRFREVQQCTLLS  93



>ref|XP_004296725.1| PREDICTED: biotin synthase-like [Fragaria vesca subsp. vesca]
Length=388

 Score =   410 bits (1055),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 202/232 (87%), Positives = 226/232 (97%), Gaps = 0/232 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+T+GRKTNFNQIL+YV +IR +GMEVCCTLGMLE+QQAL+LK+A
Sbjct  136  AKEAGSTRFCMGAAWRETVGRKTNFNQILEYVTEIRNLGMEVCCTLGMLEQQQALKLKEA  195

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYDDRLET++ VR+AGISVCSGGIIGLGEA++DR+GL
Sbjct  196  GLTAYNHNLDTSREYYPNIITTRTYDDRLETIKYVRDAGISVCSGGIIGLGEAEEDRVGL  255

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINAL++VKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  256  LHTLATLPSHPESVPINALISVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  315

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKF  264
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQ+MFK+LGLIPKPP F
Sbjct  316  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQVMFKVLGLIPKPPTF  367


 Score = 83.2 bits (204),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = -2

Query  1102  IREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             I +GPR+DWTR EI+++YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  47    ILQGPRNDWTRDEIRAVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLS  95



>ref|XP_010258596.1| PREDICTED: biotin synthase [Nelumbo nucifera]
Length=369

 Score =   410 bits (1053),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 207/249 (83%), Positives = 232/249 (93%), Gaps = 0/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+Y+K+IR MGMEVCCTLGMLEKQQA+ELKKA
Sbjct  121  AKEAGSTRFCMGAAWRDTVGRKTNFNQILEYIKEIRDMGMEVCCTLGMLEKQQAMELKKA  180

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYY  IITTR+YD+RL+TL++VREAGISVCSGGIIGLGEA++DR+GL
Sbjct  181  GLTAYNHNLDTSREYYSKIITTRSYDERLKTLDHVREAGISVCSGGIIGLGEAEEDRVGL  240

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVPIN+LVAVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMVRLSAGR
Sbjct  241  LHTLATLPAHPESVPINSLVAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVRLSAGR  300

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFSM EQ LCFLAGANSIFTGEKLLTTPNND+D DQLMFK+LGLIPK P F +++    
Sbjct  301  VRFSMAEQALCFLAGANSIFTGEKLLTTPNNDFDKDQLMFKVLGLIPKAPSFSDEAAETF  360

Query  239  TEEALSSSG  213
              EA+S+SG
Sbjct  361  EAEAMSNSG  369


 Score = 91.7 bits (226),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPR+DWTR EIKS+YDSP+LDLLFHGAQVHRH  NF+EVQ CTLL 
Sbjct  30    RTIREGPRNDWTREEIKSVYDSPVLDLLFHGAQVHRHVHNFREVQQCTLLS  80



>gb|AFK47900.1| unknown [Medicago truncatula]
Length=377

 Score =   410 bits (1054),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 209/250 (84%), Positives = 232/250 (93%), Gaps = 2/250 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDTIGRKTNFNQIL+YVK+I+GMGMEVCCT GML+K QA ELKKA
Sbjct  128  AKEAGSTRFCMGAAWRDTIGRKTNFNQILEYVKEIKGMGMEVCCTHGMLDKDQAGELKKA  187

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RL+TLE VR+AGI+VCSGGIIGLGEA+DDR+GL
Sbjct  188  GLTAYNHNLDTSREYYPNIITTRTYDERLKTLEFVRDAGINVCSGGIIGLGEAEDDRVGL  247

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLPTHPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIATARI MP+AMVRLSAGR
Sbjct  248  LHTLSTLPTHPESVPINALIAVKGTPLQDQKPVEIWEMIRMIATARITMPKAMVRLSAGR  307

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED--SEG  246
            VRFS+PEQ LCFLAGANSIF GEKLLTT NND+DADQLMFK+LGL+PK P   +D  +E 
Sbjct  308  VRFSVPEQALCFLAGANSIFAGEKLLTTANNDFDADQLMFKVLGLLPKAPSLDDDETNEA  367

Query  245  ENTEEALSSS  216
            EN +EA SSS
Sbjct  368  ENYKEAASSS  377


 Score = 87.4 bits (215),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             + I+ GPR+DWT+ E+KSIYDSP+LDLLFHGAQVHRH  NF+EVQ CTLL  +
Sbjct  37    KTIQNGPRNDWTKDEVKSIYDSPILDLLFHGAQVHRHAHNFREVQQCTLLSVK  89



>ref|NP_001150188.1| biotin synthase [Zea mays]
 gb|ACG38175.1| biotin synthase [Zea mays]
 gb|AFW64988.1| biotin synthase [Zea mays]
Length=386

 Score =   410 bits (1053),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 206/232 (89%), Positives = 222/232 (96%), Gaps = 0/232 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+TIGRKTNFNQIL+YVK+IRGMGMEVCCTLGM+EKQQA ELKKA
Sbjct  130  AKEAGSTRFCMGAAWRETIGRKTNFNQILEYVKEIRGMGMEVCCTLGMIEKQQAEELKKA  189

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YDDRL+TL++VREAGIS+CSGGIIGLGEA++DR+GL
Sbjct  190  GLTAYNHNLDTSREYYPNIITTRSYDDRLQTLQHVREAGISICSGGIIGLGEAEEDRVGL  249

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALVAVKGTPLEDQKPVEIW+MIRMIATARIVMP AMVRLSAGR
Sbjct  250  LHTLATLPTHPESVPINALVAVKGTPLEDQKPVEIWEMIRMIATARIVMPRAMVRLSAGR  309

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKF  264
            VRFSMPEQ LCFLAGANSIF GEKLLTT NND+DADQ MF +LGLIPK P F
Sbjct  310  VRFSMPEQALCFLAGANSIFAGEKLLTTANNDFDADQAMFNILGLIPKAPSF  361


 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IR+GPR+DW+RPEI+++YDSPLLDLLFHGAQVHR+   F+EVQ CTLL 
Sbjct  39    RSIRDGPRNDWSRPEIQAVYDSPLLDLLFHGAQVHRNVHKFREVQQCTLLS  89



>ref|XP_010671809.1| PREDICTED: biotin synthase [Beta vulgaris subsp. vulgaris]
Length=376

 Score =   409 bits (1051),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 208/249 (84%), Positives = 230/249 (92%), Gaps = 1/249 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQILDYVK+IR MGMEVCCTLGMLEKQQA +LKKA
Sbjct  129  AKEAGSTRFCMGAAWRDTVGRKTNFNQILDYVKEIREMGMEVCCTLGMLEKQQAQDLKKA  188

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YPNIITTR+YD+RL+TLE VR+AGI+VC GGIIGLGE  DDR+GL
Sbjct  189  GLTAYNHNLDTSREFYPNIITTRSYDERLQTLEFVRDAGINVCCGGIIGLGETADDRVGL  248

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP+HPESVPINALVAVKGTPLEDQKPVEIW+MIRMI TARIVMP AMVRLSAGR
Sbjct  249  LHTLATLPSHPESVPINALVAVKGTPLEDQKPVEIWEMIRMIGTARIVMPSAMVRLSAGR  308

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            +RFS+PEQ LCFLAGANSIFTGEKLLTT NND+DADQ MF++LGLIPKPP  ++DSE ++
Sbjct  309  IRFSIPEQALCFLAGANSIFTGEKLLTTANNDFDADQRMFEVLGLIPKPPS-VDDSEADD  367

Query  239  TEEALSSSG  213
             E   SSSG
Sbjct  368  CEVVASSSG  376


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I++GPRHDWTR EIKSIYDSP+LD+LFHGAQVHRH  NF+EVQ CTLL 
Sbjct  38    RTIKDGPRHDWTRQEIKSIYDSPVLDILFHGAQVHRHAHNFREVQQCTLLS  88



>ref|XP_003574854.1| PREDICTED: biotin synthase [Brachypodium distachyon]
Length=374

 Score =   408 bits (1048),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 209/253 (83%), Positives = 230/253 (91%), Gaps = 7/253 (3%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+TIGRKTNFNQIL+YVK IRGMGMEVCCTLGMLEKQQA +LK A
Sbjct  123  AKEAGSTRFCMGAAWRETIGRKTNFNQILEYVKDIRGMGMEVCCTLGMLEKQQAEQLKTA  182

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YDDRL+TL++VREAGISVCSGGIIGLGEA++DR+GL
Sbjct  183  GLTAYNHNLDTSREYYPNIITTRSYDDRLQTLQHVREAGISVCSGGIIGLGEAEEDRVGL  242

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIA+ARIVMP+AMVRLSAGR
Sbjct  243  LHTLATLPTHPESVPINALIAVKGTPLQDQKPVEIWEMIRMIASARIVMPKAMVRLSAGR  302

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFSMPEQ LCFLAGANSIF GEKLLTT NND+DADQ MFK+LGLIPK P F        
Sbjct  303  VRFSMPEQALCFLAGANSIFAGEKLLTTANNDFDADQAMFKILGLIPKAPNF-------G  355

Query  239  TEEALSSSG*D*C  201
             EEA S++  + C
Sbjct  356  DEEATSAASTESC  368


 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = -2

Query  1102  IREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             +R+GPR+DWTRPEI++IYDSPLLDLLFHGAQVHR+   F+EVQ CTLL
Sbjct  34    VRDGPRNDWTRPEIQAIYDSPLLDLLFHGAQVHRNVHKFREVQQCTLL  81



>gb|ABK25474.1| unknown [Picea sitchensis]
Length=401

 Score =   406 bits (1044),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 204/242 (84%), Positives = 225/242 (93%), Gaps = 0/242 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQILDYVK+IRGMGMEVCCTLGMLEKQQA +LKKA
Sbjct  141  AKEAGSTRFCMGAAWRDTVGRKTNFNQILDYVKEIRGMGMEVCCTLGMLEKQQAEDLKKA  200

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP+IITTR+YD+RL+TLE VREAGISVCSGGIIGLGE  +DR+GL
Sbjct  201  GLTAYNHNLDTSREFYPSIITTRSYDERLKTLELVREAGISVCSGGIIGLGEQVEDRVGL  260

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVPINAL+AVKGTPL+DQKPVEIW+MIRMIATARIVMP AMVRLSAGR
Sbjct  261  LHTLATLPEHPESVPINALLAVKGTPLQDQKPVEIWEMIRMIATARIVMPRAMVRLSAGR  320

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFS+PEQ LCFLAGANSIFTGEKLLTTPNND+DADQ MFK+LGLIPK    +++ + E 
Sbjct  321  VRFSLPEQALCFLAGANSIFTGEKLLTTPNNDFDADQQMFKVLGLIPKAASIVDEIKCEA  380

Query  239  TE  234
             E
Sbjct  381  KE  382


 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/48 (71%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = -2

Query  1102  IREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             +R GPR+DWT+PEI+++YDSP++DLLFHGAQVHRH   F+EVQ CTLL
Sbjct  52    VRNGPRNDWTKPEIQAVYDSPIMDLLFHGAQVHRHAHKFREVQQCTLL  99



>ref|NP_001237227.1| biotin synthase [Glycine max]
 gb|ABB72224.1| biotin synthase [Glycine max]
Length=374

 Score =   404 bits (1037),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 206/250 (82%), Positives = 225/250 (90%), Gaps = 2/250 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT+GRKTNFNQIL+YVK IR MGMEVCCTLGMLEKQQA+ELKKA
Sbjct  125  AKEAGSTRFCMGAAWRDTLGRKTNFNQILEYVKDIRDMGMEVCCTLGMLEKQQAVELKKA  184

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTRTYD+RL TLE VR+  I+VCSGGIIGLGEA++DR+G 
Sbjct  185  GLTAYNHNLDTSREYYPNIITTRTYDERLXTLEXVRDGRINVCSGGIIGLGEAEEDRVGX  244

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLPTH ESVPINAL AVKGTPLEDQKPVEIW+MIRMIATARI+MP+AMVRLSAGR
Sbjct  245  LHTLSTLPTHXESVPINALCAVKGTPLEDQKPVEIWEMIRMIATARIIMPKAMVRLSAGR  304

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEG--  246
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQLMFK+LGL+P  P   E      
Sbjct  305  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQLMFKVLGLLPXAPSLNEGETNVT  364

Query  245  ENTEEALSSS  216
            E+ +EA  SS
Sbjct  365  EDYKEAAFSS  374


 Score = 87.0 bits (214),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R I+EGPR+DW+R ++KSIYDSP+LDLLFHGAQVHRH  NF+EV  CTLL 
Sbjct  34    RAIKEGPRNDWSRDQVKSIYDSPILDLLFHGAQVHRHAHNFREVHQCTLLS  84



>ref|XP_008222617.1| PREDICTED: LOW QUALITY PROTEIN: biotin synthase [Prunus mume]
Length=383

 Score =   401 bits (1031),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 201/238 (84%), Positives = 224/238 (94%), Gaps = 3/238 (1%)
 Frame = -1

Query  959  AKEAGST*F---CIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALEL  789
            AKEAGST F   C+GAAWRDT+GRKTNFNQIL+YVK  RG+GMEVCCTLGMLEKQQAL+L
Sbjct  128  AKEAGSTRFALFCMGAAWRDTVGRKTNFNQILEYVKHSRGIGMEVCCTLGMLEKQQALKL  187

Query  788  KKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDR  609
            K+AGLTAYNHNLDTSREYYPN+ITTRTYD+RLET++ VR+AGISVCSGGIIGLGEA++DR
Sbjct  188  KEAGLTAYNHNLDTSREYYPNVITTRTYDERLETIKFVRDAGISVCSGGIIGLGEAEEDR  247

Query  608  IGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLS  429
            +GLLHTLATLP+HPESVPINALV+VKGTPL+DQKPVEIW+MIRM ATARIVMP+AMVRLS
Sbjct  248  VGLLHTLATLPSHPESVPINALVSVKGTPLQDQKPVEIWEMIRMTATARIVMPKAMVRLS  307

Query  428  AGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED  255
            AGRV+FSMPEQ LCFLAGANSIF  EKLLTTPNND+DADQLMFK+LGLIPK P F E+
Sbjct  308  AGRVKFSMPEQALCFLAGANSIFNXEKLLTTPNNDFDADQLMFKVLGLIPKAPSFSEE  365


 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IR+GPR+DW R EIK++Y SP+LDLLFHGAQVHRH  +F+EVQ CTLL 
Sbjct  37    RTIRQGPRNDWNRDEIKAVYGSPVLDLLFHGAQVHRHTHSFREVQQCTLLS  87



>ref|XP_001765903.1| predicted protein [Physcomitrella patens]
 gb|EDQ69224.1| predicted protein [Physcomitrella patens]
Length=429

 Score =   402 bits (1033),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 204/252 (81%), Positives = 228/252 (90%), Gaps = 4/252 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGS+ FC+GAAWRDT+GRKTNFNQIL+YVK+IR MGMEVCCTLGMLEK+QA +LK A
Sbjct  178  AKEAGSSRFCMGAAWRDTVGRKTNFNQILEYVKEIRAMGMEVCCTLGMLEKKQAEQLKTA  237

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YD+RL+TLE VR+AGISVCSGGIIGLGEA++DR+GL
Sbjct  238  GLTAYNHNLDTSREYYPNIITTRSYDERLKTLELVRDAGISVCSGGIIGLGEAEEDRVGL  297

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVPINAL+AVKGTPLE+QKPVE+W+M+RMIATARIVMP+AMVRLSAGR
Sbjct  298  LHTLATLPEHPESVPINALLAVKGTPLENQKPVEVWEMVRMIATARIVMPKAMVRLSAGR  357

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFL----EDS  252
            VRFS PEQ LCF+AGANSIFTGEKLLTTPNND DADQ MF+ LGLIPKPP F       S
Sbjct  358  VRFSQPEQALCFMAGANSIFTGEKLLTTPNNDKDADQQMFQTLGLIPKPPNFQLGHSYSS  417

Query  251  EGENTEEALSSS  216
              E+ EEA  S+
Sbjct  418  GDESVEEAAVSA  429


 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = -2

Query  1102  IREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             IR  PR+DWTR EI++IY+SPL+DLL +GAQVH+H   ++EVQ CTLL
Sbjct  89    IRNEPRNDWTREEIQAIYESPLMDLLLYGAQVHKHTHTWREVQQCTLL  136



>ref|XP_001763744.1| predicted protein [Physcomitrella patens]
 gb|EDQ71386.1| predicted protein [Physcomitrella patens]
Length=422

 Score =   399 bits (1026),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 201/245 (82%), Positives = 226/245 (92%), Gaps = 1/245 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGS+ FC+GAAWRDT+GRKTNFNQIL+YVK+IRGMGMEVCCTLGMLE++QA +LK A
Sbjct  175  AKEAGSSRFCMGAAWRDTVGRKTNFNQILEYVKEIRGMGMEVCCTLGMLEQKQAEQLKAA  234

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YD+RL+TLE VR+AGISVCSGGIIGLGEA++DR+GL
Sbjct  235  GLTAYNHNLDTSREYYPNIITTRSYDERLKTLELVRDAGISVCSGGIIGLGEAEEDRVGL  294

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVPINAL+AVKGTPLE+QKPVE+W+M+RMIATARIVMP+AMVRLSAGR
Sbjct  295  LHTLATLPEHPESVPINALLAVKGTPLENQKPVEVWEMVRMIATARIVMPKAMVRLSAGR  354

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE-GE  243
            VRFS PEQ LCF+AGANSIFTGEKLLTTPNND DADQ MF+ LGLI KPP F +  +  E
Sbjct  355  VRFSQPEQALCFMAGANSIFTGEKLLTTPNNDKDADQQMFQTLGLISKPPNFNQGHDVHE  414

Query  242  NTEEA  228
              EEA
Sbjct  415  RIEEA  419


 Score = 74.3 bits (181),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  1105  CIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
              IR  PRHDWTR EI++IY+SPL+DLL +GAQVH+H   ++EVQ CTLL
Sbjct  85    AIRNEPRHDWTRDEIQAIYESPLMDLLLYGAQVHKHTHKWREVQQCTLL  133



>ref|XP_002963208.1| hypothetical protein SELMODRAFT_165887 [Selaginella moellendorffii]
 gb|EFJ35079.1| hypothetical protein SELMODRAFT_165887 [Selaginella moellendorffii]
Length=406

 Score =   390 bits (1003),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 192/232 (83%), Positives = 215/232 (93%), Gaps = 0/232 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+GAAWRDT+GR +NFNQILDYVKQIRGMGMEVCCTLGMLE++ A  LK+A
Sbjct  150  AKDAGSTRFCMGAAWRDTVGRNSNFNQILDYVKQIRGMGMEVCCTLGMLEEKHAQALKEA  209

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPN+ITTR+YD+RL+TLE VR+AGISVCSGGIIGLGE  +DRIGL
Sbjct  210  GLTAYNHNLDTSREYYPNVITTRSYDERLKTLEIVRDAGISVCSGGIIGLGEQVEDRIGL  269

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLP HPESVPINALVAVKGTPLE+QKPVEIW+M+RMIATARI MP+AMVRLSAGR
Sbjct  270  LHTLSTLPQHPESVPINALVAVKGTPLENQKPVEIWEMVRMIATARICMPKAMVRLSAGR  329

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKF  264
            V+FS PEQ LCF+AGANSIFTGEKLLTTPNN +  DQ MF++LGLIPKPP F
Sbjct  330  VKFSQPEQALCFMAGANSIFTGEKLLTTPNNSFSEDQQMFQLLGLIPKPPSF  381


 Score = 86.3 bits (212),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R IREG R DW+R EI+ IYDSPLLDLLFHGAQVHRH  NF+EVQ CTLL
Sbjct  59    RAIREGSRTDWSRQEIQEIYDSPLLDLLFHGAQVHRHAHNFREVQQCTLL  108



>ref|XP_009382923.1| PREDICTED: biotin synthase-like [Musa acuminata subsp. malaccensis]
Length=380

 Score =   385 bits (988),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 210/252 (83%), Positives = 228/252 (90%), Gaps = 3/252 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRDT GRKTNFNQIL+YV +IR MGMEVCCTLGMLEKQQA ELKKA
Sbjct  129  AKEAGSTRFCMGAAWRDTFGRKTNFNQILEYVSEIRAMGMEVCCTLGMLEKQQAEELKKA  188

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YD+RL TL++VREAGISVCSGGIIGLGE ++DR+GL
Sbjct  189  GLTAYNHNLDTSREYYPNIITTRSYDERLATLQHVREAGISVCSGGIIGLGEGEEDRVGL  248

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVPINALV VKGTPL+DQKPVEIW+MIRMIATARIVMP AMVRLSAGR
Sbjct  249  LHTLATLPMHPESVPINALVPVKGTPLQDQKPVEIWEMIRMIATARIVMPRAMVRLSAGR  308

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKF--LEDSEG  246
            VRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQ+MFK+LGL  K P F   E + G
Sbjct  309  VRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQMMFKILGLTCKAPSFPEAESTLG  368

Query  245  ENT-EEALSSSG  213
              T EEA+S+ G
Sbjct  369  PQTCEEAISNVG  380


 Score = 87.4 bits (215),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IR+GPR+DW+R EIKSIYDSP+LDLLFHGAQVHRH   F+EVQ CTLL 
Sbjct  38    RTIRDGPRNDWSRDEIKSIYDSPILDLLFHGAQVHRHTHKFREVQQCTLLS  88



>ref|XP_006443094.1| hypothetical protein CICLE_v10024495mg [Citrus clementina]
 gb|ESR56334.1| hypothetical protein CICLE_v10024495mg [Citrus clementina]
Length=372

 Score =   379 bits (973),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 194/239 (81%), Positives = 218/239 (91%), Gaps = 4/239 (2%)
 Frame = -1

Query  917  WRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKAGLTAYNHNLDTSRE  738
            + DTIGRKTNFNQ L+YVK IR MGMEVCCTLGMLEKQQA+ELKKAGLTA+NHNLDTSRE
Sbjct  134  FEDTIGRKTNFNQTLEYVKDIRDMGMEVCCTLGMLEKQQAIELKKAGLTAHNHNLDTSRE  193

Query  737  YYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGllhtlatlpthPESV  558
            YYP IITT +YD+ LETL++VREAGI+VCSGGIIGLGEA++DR+GLLHTLATLPTHPESV
Sbjct  194  YYPKIITTSSYDEHLETLKHVREAGINVCSGGIIGLGEAEEDRVGLLHTLATLPTHPESV  253

Query  557  PINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGRVRFSMPEQTLCFLA  378
            PINAL+AVKGTPL+DQKPVEIW+MIRMIATARIVMP+AMV LSAGR+R SMPEQ LCFLA
Sbjct  254  PINALLAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMVILSAGRIRSSMPEQALCFLA  313

Query  377  GANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED----SEGENTEEALSSSG  213
            GANSIFTGEKLLTTPNN++ ADQLMFK+LGL PK P F ED    S+ E+ +EA+SSSG
Sbjct  314  GANSIFTGEKLLTTPNNNFVADQLMFKVLGLTPKAPSFHEDEANVSKAESCQEAVSSSG  372


 Score = 89.7 bits (221),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R IREGPRHDW++ +IKSIYDSP+LDLLFHGAQVHRH  NF+E Q CTLL
Sbjct  43    RTIREGPRHDWSKYDIKSIYDSPVLDLLFHGAQVHRHAHNFREAQQCTLL  92



>ref|XP_002981584.1| hypothetical protein SELMODRAFT_114715 [Selaginella moellendorffii]
 gb|EFJ17399.1| hypothetical protein SELMODRAFT_114715 [Selaginella moellendorffii]
Length=415

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 193/241 (80%), Positives = 215/241 (89%), Gaps = 9/241 (4%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQI-RGMGMEVCCTLGMLEKQQALELKK  783
            AK+AGST FC+GAAWRDT+GR TNFNQILDYVKQI RGMGMEVCCTLGMLE++ A  LK+
Sbjct  150  AKDAGSTRFCMGAAWRDTVGRNTNFNQILDYVKQISRGMGMEVCCTLGMLEEKHAQALKE  209

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSG--------GIIGLG  627
            AGLTAYNHNLDTSREYYPN+ITTR+YD+RL+TLE VR+AGISVCSG        GIIGLG
Sbjct  210  AGLTAYNHNLDTSREYYPNVITTRSYDERLKTLEIVRDAGISVCSGKLSLFLPRGIIGLG  269

Query  626  EADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPE  447
            E  +DRIGLLHTL+TLP HPESVPINALVAVKGTPLE+QKPVEIW+M+RMIATARI MP+
Sbjct  270  EQVEDRIGLLHTLSTLPQHPESVPINALVAVKGTPLENQKPVEIWEMVRMIATARICMPK  329

Query  446  AMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPK  267
            AMVRLSAGRV+FS PEQ LCF+AGANSIFTGEKLLTTPNN +  DQ MF++LGLIPKPP 
Sbjct  330  AMVRLSAGRVKFSQPEQALCFMAGANSIFTGEKLLTTPNNSFSEDQQMFQLLGLIPKPPS  389

Query  266  F  264
            F
Sbjct  390  F  390


 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R IREG R DW R EI+ IYDSPLLDLLFHGAQVHRH  NF+EVQ CTLL
Sbjct  59    RAIREGSRTDWRRQEIQEIYDSPLLDLLFHGAQVHRHAHNFREVQQCTLL  108



>gb|EPS62502.1| hypothetical protein M569_12287, partial [Genlisea aurea]
Length=368

 Score =   376 bits (965),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 197/228 (86%), Positives = 216/228 (95%), Gaps = 0/228 (0%)
 Frame = -1

Query  947  GST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKAGLTA  768
            GST FC+GAAWRDTIGRKTNFNQILDYVK+IRGMGMEVCCTLGMLEKQQALELK+AGLTA
Sbjct  126  GSTRFCMGAAWRDTIGRKTNFNQILDYVKEIRGMGMEVCCTLGMLEKQQALELKEAGLTA  185

Query  767  YNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGllhtl  588
            YNHNLDTSRE+YPN+ITTRTY++RL TLE+VREAGI+VCSGGIIGLGE ++DR+GLLH L
Sbjct  186  YNHNLDTSREFYPNVITTRTYEERLRTLEHVREAGINVCSGGIIGLGEGEEDRVGLLHVL  245

Query  587  atlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGRVRFS  408
            ATLP HPESVPINALV VKGTPL+DQK VEIW+MIRMI TARIVMP+AMVRLSAGRVRFS
Sbjct  246  ATLPEHPESVPINALVPVKGTPLQDQKAVEIWEMIRMIGTARIVMPKAMVRLSAGRVRFS  305

Query  407  MPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKF  264
            +PEQ LCFLAGANSIFTGEKLLTTPNNDYD DQ MF++LGLIPK P+F
Sbjct  306  IPEQALCFLAGANSIFTGEKLLTTPNNDYDDDQKMFRLLGLIPKAPQF  353


 Score = 83.2 bits (204),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = -2

Query  1102  IREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             I+ GPR+DW R EIKSIYDSP+LDLLFH AQVHRH  NF+EVQ CTLL
Sbjct  33    IKNGPRNDWRREEIKSIYDSPILDLLFHAAQVHRHSHNFREVQQCTLL  80



>gb|EXX73954.1| biotin synthase [Rhizophagus irregularis DAOM 197198w]
Length=387

 Score =   372 bits (956),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 184/240 (77%), Positives = 211/240 (88%), Gaps = 0/240 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRD  GRK+NFN+I+ YVK+IR MGMEVCCTLGML + QA  LK+A
Sbjct  134  AKEAGSTRFCMGAAWRDLHGRKSNFNKIIGYVKEIRSMGMEVCCTLGMLNESQAKALKEA  193

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYP IITTR+YD+RLET+ NVREAGISVCSGGIIGLGE  +DR+G+
Sbjct  194  GLTAYNHNLDTSREYYPKIITTRSYDERLETISNVREAGISVCSGGIIGLGETPEDRVGM  253

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLAT+P HPESVPINALV V+GTPLE Q+PV IW+M+RMI+TARIVMP++MVRLSAGR
Sbjct  254  LHTLATMPQHPESVPINALVQVEGTPLEKQEPVSIWEMVRMISTARIVMPKSMVRLSAGR  313

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFS PEQ LCF AGANSIFTG+KLLTT NND+++DQ MFK LGLIPKPP F + +   N
Sbjct  314  VRFSQPEQALCFFAGANSIFTGDKLLTTDNNDFNSDQEMFKTLGLIPKPPNFDQGTSPSN  373


 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R+DWTR EIKSIYDSP++DLL+ GA+VHR   +   VQ CTLL
Sbjct  50    RNDWTRKEIKSIYDSPMMDLLYFGAKVHRENFDPLAVQQCTLL  92



>gb|ESA20822.1| hypothetical protein GLOINDRAFT_92179 [Rhizophagus irregularis 
DAOM 181602]
Length=389

 Score =   371 bits (952),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 187/242 (77%), Positives = 212/242 (88%), Gaps = 2/242 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRD  GRK+NFN+I+ YVK+IR MGMEVCCTLGML + QA  LK+A
Sbjct  134  AKEAGSTRFCMGAAWRDLHGRKSNFNKIIGYVKEIRSMGMEVCCTLGMLNESQAKALKEA  193

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYP IITTR+YD+RLET+ NVREAGISVCSGGIIGLGE  +DR+G+
Sbjct  194  GLTAYNHNLDTSREYYPKIITTRSYDERLETISNVREAGISVCSGGIIGLGETPEDRVGM  253

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLAT+P HPESVPINALV V+GTPLE Q+PV IW+M+RMI+TARIVMP++MVRLSAGR
Sbjct  254  LHTLATMPQHPESVPINALVQVEGTPLEKQEPVSIWEMVRMISTARIVMPKSMVRLSAGR  313

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VRFS PEQ LCF AGANSIFTG+KLLTT NND+++DQ MFK LGLIPKPP F  D E   
Sbjct  314  VRFSQPEQALCFFAGANSIFTGDKLLTTDNNDFNSDQEMFKTLGLIPKPPNF--DQEQYL  371

Query  239  TE  234
            TE
Sbjct  372  TE  373


 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R+DWTR EIKSIYDSP++DLL+ GA+VHR   +   VQ CTLL 
Sbjct  50    RNDWTRKEIKSIYDSPMMDLLYFGAKVHRENFDPLAVQQCTLLS  93



>gb|AAX28926.1| biotin synthase, partial [Raphanus sativus]
Length=214

 Score =   360 bits (924),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 183/213 (86%), Positives = 201/213 (94%), Gaps = 1/213 (0%)
 Frame = -1

Query  851  GMGMEVCCTLGMLEKQQALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVR  672
            GMGMEVCCTLGM+EKQQALELKKAGLTAYNHNLDTSREYYPN+ITTR+YD+RLETL++VR
Sbjct  1    GMGMEVCCTLGMIEKQQALELKKAGLTAYNHNLDTSREYYPNVITTRSYDERLETLDHVR  60

Query  671  EAGISVCSGGIIGLGEADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIW  492
            EAGI+VCSGGIIGLGEA++DR+GLLHTLATLP+HPESVP NAL+AVKGTPLEDQKPVEIW
Sbjct  61   EAGINVCSGGIIGLGEAEEDRVGLLHTLATLPSHPESVPTNALLAVKGTPLEDQKPVEIW  120

Query  491  DMIRMIATARIVMPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDAD  312
            +MIRMI TARIVMP+AMVRLSAGRVRF+MPEQ LCFLAGANSIFTGEKLLTTPNND+DAD
Sbjct  121  EMIRMIGTARIVMPKAMVRLSAGRVRFTMPEQALCFLAGANSIFTGEKLLTTPNNDFDAD  180

Query  311  QLMFKMLGLIPKPPKFLE-DSEGENTEEALSSS  216
            QLMFK LGL PKPP F E DSE EN E+  S+S
Sbjct  181  QLMFKTLGLTPKPPSFSEDDSESENCEKVASAS  213



>gb|EPB90860.1| biotin synthetase [Mucor circinelloides f. circinelloides 1006PhL]
Length=398

 Score =   362 bits (930),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 212/237 (89%), Gaps = 0/237 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+GAAWRD  GRK+NFN+ILD+VK IR MGMEVCCTLGML+++QA  LK A
Sbjct  134  AKDAGSTRFCMGAAWRDLAGRKSNFNKILDHVKVIRSMGMEVCCTLGMLDEEQAKALKNA  193

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP IITTRTYD+RL+T++N + AGISVCSGGIIGLGE  +DR+GL
Sbjct  194  GLTAYNHNLDTSREFYPKIITTRTYDERLKTIDNAQNAGISVCSGGIIGLGEKGEDRVGL  253

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TL  HPESVP+NAL+AV+GTPLE Q+PV +++MIRMIATARI+MP++MVRLSAGR
Sbjct  254  LHTLSTLKQHPESVPVNALLAVEGTPLEKQEPVSVFEMIRMIATARIIMPKSMVRLSAGR  313

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE  249
            VRFS+PEQ +CF+AGANSIFTG+KLLTTPNN++  D+ MF +LGL+PKPP F + S+
Sbjct  314  VRFSVPEQAMCFMAGANSIFTGDKLLTTPNNEFSDDKKMFDLLGLVPKPPNFAQGSD  370


 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 39/46 (85%), Gaps = 1/46 (2%)
 Frame = -2

Query  1093  GP-RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             GP R+DWTR EI+SIYDSPL+DLL+HGA+VHR   N +EVQ CTLL
Sbjct  47    GPMRNDWTRDEIQSIYDSPLMDLLYHGAKVHRENFNPREVQQCTLL  92



>emb|CAN60576.1| hypothetical protein VITISV_034772 [Vitis vinifera]
Length=216

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 183/216 (85%), Positives = 201/216 (93%), Gaps = 4/216 (2%)
 Frame = -1

Query  848  MGMEVCCTLGMLEKQQALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVRE  669
            MGMEVCCTLGMLEKQQA+ LKKAGLTAYNHNLDTSREYYPNII TR+YD+RLETL+ VRE
Sbjct  1    MGMEVCCTLGMLEKQQAIXLKKAGLTAYNHNLDTSREYYPNIIXTRSYDERLETLQLVRE  60

Query  668  AGISVCSGGIIGLGEADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWD  489
            AGI+VCSGGIIGLGEA++DR+GLLHTLATLPTHPESVPINAL+AVKGTPLEDQKPVEIW+
Sbjct  61   AGINVCSGGIIGLGEAEEDRVGLLHTLATLPTHPESVPINALLAVKGTPLEDQKPVEIWE  120

Query  488  MIRMIATARIVMPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQ  309
            M+RMIATARIVMP+AMVRLSAGRVRFS+PEQ LCFLAGANSIFTG+KLLTTPNND+DADQ
Sbjct  121  MVRMIATARIVMPKAMVRLSAGRVRFSVPEQALCFLAGANSIFTGDKLLTTPNNDFDADQ  180

Query  308  LMFKMLGLIPKPPKFLED----SEGENTEEALSSSG  213
             MFK+LGLIPK P F ED    SE EN E+A+S SG
Sbjct  181  QMFKLLGLIPKAPSFDEDVAKTSEAENCEQAVSGSG  216



>gb|EMT17431.1| Biotin synthase [Aegilops tauschii]
Length=365

 Score =   360 bits (923),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 195/232 (84%), Gaps = 15/232 (6%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+TIGRKTNFNQIL+YVK IRGMGMEVCCTLGMLEKQQA ELKKA
Sbjct  129  AKEAGSTRFCMGAAWRETIGRKTNFNQILEYVKDIRGMGMEVCCTLGMLEKQQAEELKKA  188

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNII+TR+YDDRL+TL++VREAGISVCSGGIIGLGEA++DR+  
Sbjct  189  GLTAYNHNLDTSREYYPNIISTRSYDDRLQTLQHVREAGISVCSGGIIGLGEAEEDRV--  246

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
                       +   I ++V           PVEIW+MIRMIA+ARIVMP+AMVRLSAGR
Sbjct  247  ----KMSKVIVKQAWITSVV---------NWPVEIWEMIRMIASARIVMPKAMVRLSAGR  293

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKF  264
            VRFSMPEQ LCFLAGANSIF GEKLLTT NND+DADQ MFK+LGLIPK P F
Sbjct  294  VRFSMPEQALCFLAGANSIFAGEKLLTTANNDFDADQAMFKILGLIPKAPNF  345


 Score = 83.2 bits (204),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -2

Query  1096  EGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             +GPR+DWTRPEI++IYDSPLLDLLFHGAQVHR+   F+EVQ CTLL
Sbjct  42    DGPRNDWTRPEIQAIYDSPLLDLLFHGAQVHRNVHKFREVQQCTLL  87



>ref|XP_006494187.1| PREDICTED: biotin synthase-like [Citrus sinensis]
Length=219

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/219 (83%), Positives = 202/219 (92%), Gaps = 4/219 (2%)
 Frame = -1

Query  857  IRGMGMEVCCTLGMLEKQQALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLEN  678
            +R MGMEVCCTLGMLEKQQA+ELKKAGLTA+NHNLDTSREYYP IITT +YD+ LETL++
Sbjct  1    MRDMGMEVCCTLGMLEKQQAIELKKAGLTAHNHNLDTSREYYPKIITTSSYDEHLETLKH  60

Query  677  VREAGISVCSGGIIGLGEADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVE  498
            VREAGI+VCSGGIIGLGEA++DR+GLLHTLATLPTHPESVPINAL+AVKGTPL+DQKPVE
Sbjct  61   VREAGINVCSGGIIGLGEAEEDRVGLLHTLATLPTHPESVPINALLAVKGTPLQDQKPVE  120

Query  497  IWDMIRMIATARIVMPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYD  318
            IW+MIRMIATARIVMP+AMVRLSAGRVRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+D
Sbjct  121  IWEMIRMIATARIVMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFD  180

Query  317  ADQLMFKMLGLIPKPPKFLED----SEGENTEEALSSSG  213
            ADQLMFK+LGL PK P F E     SE E+ +EA+S SG
Sbjct  181  ADQLMFKVLGLTPKAPSFHEGEANVSEAESCQEAVSHSG  219



>emb|CDH52375.1| biotin synthase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=392

 Score =   360 bits (924),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 212/237 (89%), Gaps = 0/237 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRD  GRK+NFN+IL YVK IRGMGMEVCCTLGML + QA +LK+A
Sbjct  138  AKEAGSTRFCMGAAWRDLAGRKSNFNKILSYVKAIRGMGMEVCCTLGMLNETQAKQLKEA  197

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP II+TR+YD+RL T+ + ++AGISVCSGGIIGLGE ++DR+GL
Sbjct  198  GLTAYNHNLDTSREFYPKIISTRSYDERLSTIGHAQDAGISVCSGGIIGLGEQEEDRVGL  257

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLP HPESVP+NAL+AV GTPLE+Q+PV +++M+RMIATARIVMP++MVRLSAGR
Sbjct  258  LHTLSTLPKHPESVPVNALLAVPGTPLENQEPVSVFEMVRMIATARIVMPKSMVRLSAGR  317

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE  249
            VRFS  EQ +CF+AGANSIFTGEKLLTTPNN++  DQ MF++LGL+PKPP F + S+
Sbjct  318  VRFSTSEQAMCFMAGANSIFTGEKLLTTPNNEFTDDQKMFELLGLVPKPPNFEQGSD  374


 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = -2

Query  1093  GP-RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             GP R+DW+R EI++IYDSP +DL+F+GA+VHR   N +EVQ CTLL
Sbjct  51    GPLRNDWSRQEIQAIYDSPFMDLMFYGAKVHRENFNAREVQQCTLL  96



>emb|CDS08184.1| Putative Biotin synthase [Absidia idahoensis var. thermophila]
Length=392

 Score =   360 bits (924),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 212/237 (89%), Gaps = 0/237 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRD  GRK+NFN+IL YVK IRGMGMEVCCTLGML + QA +LK+A
Sbjct  138  AKEAGSTRFCMGAAWRDLAGRKSNFNKILSYVKAIRGMGMEVCCTLGMLNETQAKQLKEA  197

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP II+TR+YD+RL T+ + ++AGISVCSGGIIGLGE ++DR+GL
Sbjct  198  GLTAYNHNLDTSREFYPKIISTRSYDERLSTIGHAQDAGISVCSGGIIGLGEQEEDRVGL  257

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLP HPESVP+NAL+AV GTPLE+Q+PV +++M+RMIATARIVMP++MVRLSAGR
Sbjct  258  LHTLSTLPKHPESVPVNALLAVPGTPLENQEPVSVFEMVRMIATARIVMPKSMVRLSAGR  317

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE  249
            VRFS  EQ +CF+AGANSIFTGEKLLTTPNN++  DQ MF++LGL+PKPP F + S+
Sbjct  318  VRFSTSEQAMCFMAGANSIFTGEKLLTTPNNEFTDDQKMFELLGLVPKPPNFEQGSD  374


 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = -2

Query  1093  GP-RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             GP R+DWTR EI++IYDSP +DL+F+GA+VHR   N +EVQ CTLL
Sbjct  51    GPLRNDWTRQEIQAIYDSPFMDLMFYGAKVHRENFNAREVQQCTLL  96



>emb|CEG65136.1| Putative Biotin synthetase [Rhizopus microsporus]
Length=391

 Score =   360 bits (923),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/237 (74%), Positives = 213/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+GAAWRD  GRK+NFN+ILD+VK IR MGMEVCCTLGML ++QA +LK A
Sbjct  132  AKDAGSTRFCMGAAWRDLAGRKSNFNKILDHVKVIRSMGMEVCCTLGMLNEEQAKQLKDA  191

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP IITTRTYD+RLET+ N ++AGISVCSGGIIGLGE ++DR+GL
Sbjct  192  GLTAYNHNLDTSREFYPKIITTRTYDERLETINNAQKAGISVCSGGIIGLGEREEDRVGL  251

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLP HPESVP+NAL+AV GTPLE Q+PV +++M+RMIATARIVMP++MVRLSAGR
Sbjct  252  LHTLSTLPQHPESVPVNALLAVPGTPLEKQEPVSVFEMVRMIATARIVMPKSMVRLSAGR  311

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE  249
            VRFS+PEQ LCF+AGANSIFTG+KLLTTPNN+ + D+ MF++LGL+ KPP F + S+
Sbjct  312  VRFSIPEQALCFMAGANSIFTGDKLLTTPNNEMNDDKKMFEILGLVSKPPNFEQGSD  368


 Score = 70.9 bits (172),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R+DWTR EI++IYDSPL+DLL++GA+VHR   N +EVQ CTLL
Sbjct  48    RNDWTREEIQAIYDSPLMDLLYYGAKVHRENFNGREVQQCTLL  90



>emb|CEI92026.1| Putative Biotin synthetase [Rhizopus microsporus]
Length=391

 Score =   359 bits (922),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/237 (74%), Positives = 213/237 (90%), Gaps = 0/237 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+GAAWRD  GRK+NFN+ILD+VK IR MGMEVCCTLGML ++QA +LK+A
Sbjct  132  AKDAGSTRFCMGAAWRDLAGRKSNFNKILDHVKVIRSMGMEVCCTLGMLNEEQAKQLKEA  191

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP IITTRTYD+RLET+ N ++AGISVCSGGIIGLGE ++DR+GL
Sbjct  192  GLTAYNHNLDTSREFYPKIITTRTYDERLETINNAQKAGISVCSGGIIGLGEKEEDRVGL  251

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLP HPESVP+NAL+AV GTPLE Q+PV +++M+RMIATARI+MP++MVRLSAGR
Sbjct  252  LHTLSTLPQHPESVPVNALLAVPGTPLEKQEPVSVFEMVRMIATARIIMPKSMVRLSAGR  311

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE  249
            VRFS+PEQ LCF+AGANSIFTG+KLLTTPNN+   D+ MF++LGL+ KPP F + S+
Sbjct  312  VRFSIPEQALCFMAGANSIFTGDKLLTTPNNEMSDDKKMFEILGLVSKPPNFEQGSD  368


 Score = 71.2 bits (173),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R+DWTR EI++IYDSPL+DLL++GA+VHR   N +EVQ CTLL
Sbjct  48    RNDWTREEIQAIYDSPLMDLLYYGAKVHRENFNGREVQQCTLL  90



>ref|XP_006682484.1| hypothetical protein BATDEDRAFT_92155 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF76871.1| hypothetical protein BATDEDRAFT_92155 [Batrachochytrium dendrobatidis 
JAM81]
Length=412

 Score =   357 bits (915),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 176/241 (73%), Positives = 210/241 (87%), Gaps = 2/241 (1%)
 Frame = -1

Query  989  LPRGTTLHSS--AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGM  816
            LP    L ++  AK+AGST FC+GAAWRD  GRKTNF+QI +YV+QIRGMGMEVCC+LGM
Sbjct  140  LPHDEVLEAARKAKDAGSTRFCMGAAWRDVQGRKTNFSQITEYVRQIRGMGMEVCCSLGM  199

Query  815  LEKQQALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGII  636
            L K+QA+ LK+AGLTAYNHNLDTSRE+YPNIITTR+YD+RL T+ NVR+AGISVCSGGII
Sbjct  200  LNKEQAIALKEAGLTAYNHNLDTSREFYPNIITTRSYDERLNTISNVRDAGISVCSGGII  259

Query  635  GLGEADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIV  456
            GLGE  +DR+G+LHTL+TLP HPESVPINAL+AV GTPLE+QKPV +W+M+RMI+TARI+
Sbjct  260  GLGEVVNDRVGMLHTLSTLPKHPESVPINALLAVPGTPLENQKPVSVWEMVRMISTARII  319

Query  455  MPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            MP+AMVRLSAGRV FS  EQ LCF+AGANSIFTG+KLLTTPNN    D+ M + LG++PK
Sbjct  320  MPKAMVRLSAGRVNFSQSEQALCFIAGANSIFTGDKLLTTPNNKASQDKEMIEALGILPK  379

Query  275  P  273
            P
Sbjct  380  P  380


 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R+DWT+ EI++IYD+PL++LL+  A VHR   N +EVQ CTLL
Sbjct  68    RNDWTKQEIQAIYDTPLIELLYQAATVHRQHFNPREVQQCTLL  110



>gb|EIE79238.1| biotin synthase [Rhizopus delemar RA 99-880]
Length=389

 Score =   354 bits (909),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 171/232 (74%), Positives = 208/232 (90%), Gaps = 0/232 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+GAAWRD  GRK+NFN+ILD+VK IR MGMEVCCTLGML ++QA +LK A
Sbjct  132  AKDAGSTRFCMGAAWRDLAGRKSNFNKILDHVKVIRSMGMEVCCTLGMLNEEQAKQLKNA  191

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP II+TR+YD+RL+T++N + AGISVCSGGIIGLGE ++DR+GL
Sbjct  192  GLTAYNHNLDTSREFYPKIISTRSYDERLKTIDNAQRAGISVCSGGIIGLGEKEEDRVGL  251

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLP HPESVP+NAL+AV GTPLE Q+PV +++M+RMIATARI+MP++MVRLSAGR
Sbjct  252  LHTLSTLPQHPESVPVNALLAVPGTPLEKQEPVSVFEMVRMIATARIIMPKSMVRLSAGR  311

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKF  264
            VRFS+PEQ LCF+AGANSIFTG+KLLTTPNN+   D+ MF +LGL+ KPP F
Sbjct  312  VRFSIPEQALCFMAGANSIFTGDKLLTTPNNEVSDDKKMFDLLGLVAKPPNF  363


 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R+DWTR EI+SIYDSPL++LL+HGA+VHR   N +EVQ CTLL
Sbjct  48    RNDWTREEIQSIYDSPLMELLYHGAKVHRENFNGREVQQCTLL  90



>gb|KFH73793.1| biotin synthase [Mortierella verticillata NRRL 6337]
Length=408

 Score =   353 bits (906),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 203/231 (88%), Gaps = 0/231 (0%)
 Frame = -1

Query  947  GST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKAGLTA  768
            GST FC+GAAWRD  GRK+NF +I+ +VK+IR M MEVCCTLGML  +QA +LK+AGLTA
Sbjct  158  GSTRFCMGAAWRDLAGRKSNFKKIVGFVKEIRAMDMEVCCTLGMLNDEQAGQLKEAGLTA  217

Query  767  YNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGllhtl  588
            YNHNLDTSREYYP IITTR+YD+RLET+  VR+AGISVCSGGIIGLGE D DR+G+LHTL
Sbjct  218  YNHNLDTSREYYPKIITTRSYDERLETISKVRDAGISVCSGGIIGLGETDTDRVGMLHTL  277

Query  587  atlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGRVRFS  408
            +T+P+HPESVP+NAL+AV+GTPLE Q+PV++WDM+RMIATARIVMP+ M+RLSAGRVRF+
Sbjct  278  STMPSHPESVPVNALLAVEGTPLEKQEPVKVWDMVRMIATARIVMPKTMIRLSAGRVRFT  337

Query  407  MPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED  255
             PEQ LCF+AGANSIFTG+KLLTTPNN ++ADQ MF  LGL+PK   F  D
Sbjct  338  EPEQALCFMAGANSIFTGDKLLTTPNNKFNADQQMFDTLGLVPKAASFKVD  388


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R+DW + EI +IY SP+++LL+HGA VHR   +   VQ CTLL 
Sbjct  70    RYDWQKEEIDAIYHSPIMELLYHGANVHRLHFDPLAVQQCTLLS  113



>gb|EMS58861.1| Biotin synthase [Triticum urartu]
Length=540

 Score =   357 bits (915),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 195/232 (84%), Gaps = 15/232 (6%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+TIGRKTNFNQIL+YVK IRGMGMEVCCTLGMLEKQQA ELKKA
Sbjct  304  AKEAGSTRFCMGAAWRETIGRKTNFNQILEYVKDIRGMGMEVCCTLGMLEKQQAEELKKA  363

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNII+TR+YDDRL+TL++VREAGISVCSGGIIGLGEA++DR+  
Sbjct  364  GLTAYNHNLDTSREYYPNIISTRSYDDRLQTLQHVREAGISVCSGGIIGLGEAEEDRV--  421

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
                       +   I ++V           PVEIW+MIRMIA+ARIVMP+AMVRLSAGR
Sbjct  422  ----KMSKVIVKQAWITSVV---------NWPVEIWEMIRMIASARIVMPKAMVRLSAGR  468

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKF  264
            VRFSMPEQ LCFLAGANSIF GEKLLTT NND+DADQ MFK+LGLIPK P F
Sbjct  469  VRFSMPEQALCFLAGANSIFAGEKLLTTANNDFDADQAMFKILGLIPKAPNF  520



>ref|XP_006494195.1| PREDICTED: biotin synthase-like isoform X1 [Citrus sinensis]
 ref|XP_006494196.1| PREDICTED: biotin synthase-like isoform X2 [Citrus sinensis]
Length=219

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 201/219 (92%), Gaps = 4/219 (2%)
 Frame = -1

Query  857  IRGMGMEVCCTLGMLEKQQALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLEN  678
            +R MGMEVCCTLGMLEKQQA+ELKKAGLTA+NHNLDTSREYYP IITT +YD+ LETL++
Sbjct  1    MRDMGMEVCCTLGMLEKQQAIELKKAGLTAHNHNLDTSREYYPKIITTSSYDEHLETLKH  60

Query  677  VREAGISVCSGGIIGLGEADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVE  498
            VREAGI+VCSGGIIGLGEA++DR+GLLHTLATLPTHPESVPINAL+AVKGTPL+DQKPVE
Sbjct  61   VREAGINVCSGGIIGLGEAEEDRVGLLHTLATLPTHPESVPINALLAVKGTPLQDQKPVE  120

Query  497  IWDMIRMIATARIVMPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYD  318
            IW+MIRMIATARIVMP+AMV LSAGR+R SMPEQ LCFLAGANSIFTGEKLLTTPNN++ 
Sbjct  121  IWEMIRMIATARIVMPKAMVILSAGRIRSSMPEQALCFLAGANSIFTGEKLLTTPNNNFV  180

Query  317  ADQLMFKMLGLIPKPPKFLED----SEGENTEEALSSSG  213
            ADQLMFK+LGL PK P F ED    S+ E+ +EA+SSSG
Sbjct  181  ADQLMFKVLGLTPKAPSFHEDEANVSKAESCQEAVSSSG  219



>ref|XP_006494201.1| PREDICTED: biotin synthase-like [Citrus sinensis]
Length=217

 Score =   342 bits (878),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 179/210 (85%), Positives = 195/210 (93%), Gaps = 4/210 (2%)
 Frame = -1

Query  848  MGMEVCCTLGMLEKQQALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVRE  669
            MGMEVCCTLGMLEK QA+ELKKAGLTAYNHNLDTSRE+Y  IITTR+YD+RLETL++VRE
Sbjct  1    MGMEVCCTLGMLEKHQAIELKKAGLTAYNHNLDTSREFYSKIITTRSYDERLETLKHVRE  60

Query  668  AGISVCSGGIIGLGEADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWD  489
            AGI+VCSGGIIGLGEA++DR+GLLHTLATLPTHPESVPINAL+AVKGTPL+DQKPVEIW+
Sbjct  61   AGINVCSGGIIGLGEAEEDRVGLLHTLATLPTHPESVPINALLAVKGTPLQDQKPVEIWE  120

Query  488  MIRMIATARIVMPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQ  309
            MIRMIATARIVMP+AMVRLSAGRVRFSMPEQ LCFLAGANSIFTGEKLLTTPNND+DADQ
Sbjct  121  MIRMIATARIVMPKAMVRLSAGRVRFSMPEQALCFLAGANSIFTGEKLLTTPNNDFDADQ  180

Query  308  LMFKMLGLIPKPPKFLEDSEGE-NTEEALS  222
            LMFK+LGL PK P F    EGE N  EA S
Sbjct  181  LMFKVLGLTPKAPSF---HEGEANVSEAES  207



>tpg|DAA48311.1| TPA: hypothetical protein ZEAMMB73_910136 [Zea mays]
Length=336

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 175/197 (89%), Positives = 191/197 (97%), Gaps = 0/197 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE+GST FC+GAAWR+TIGRK+NFNQIL+YVK+IRGMGMEVCCTLGM+EKQQA ELKKA
Sbjct  124  AKESGSTRFCMGAAWRETIGRKSNFNQILEYVKEIRGMGMEVCCTLGMIEKQQAEELKKA  183

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYPNIITTR+YDDRL+TLE+VREAGIS+CSGGIIGLGEA++DR+GL
Sbjct  184  GLTAYNHNLDTSREYYPNIITTRSYDDRLQTLEHVREAGISICSGGIIGLGEAEEDRVGL  243

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLPTHPESVPINALVAVKGTPLEDQKPVEIW+MIRMIATARI MP+AMVRLSAGR
Sbjct  244  LHTLATLPTHPESVPINALVAVKGTPLEDQKPVEIWEMIRMIATARITMPKAMVRLSAGR  303

Query  419  VRFSMPEQTLCFLAGAN  369
            VRFSMPEQ LCFLAG  
Sbjct  304  VRFSMPEQALCFLAGGQ  320


 Score = 80.5 bits (197),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = -2

Query  1096  EGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             +GPR+DW+RPEI+++YDSPLLDLLFHGAQVHR+   F+EVQ CTLL
Sbjct  37    DGPRNDWSRPEIQAVYDSPLLDLLFHGAQVHRNVHKFREVQQCTLL  82



>emb|CEI89543.1| Putative Biotin synthase [Rhizopus microsporus]
Length=250

 Score =   343 bits (879),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 204/227 (90%), Gaps = 0/227 (0%)
 Frame = -1

Query  929  IGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKAGLTAYNHNLD  750
            +GAAWRD  GRK+NFN+ILD+VK IR MGMEVCCTLGML ++QA +LK AGLTAYNHNLD
Sbjct  1    MGAAWRDLAGRKSNFNKILDHVKVIRSMGMEVCCTLGMLNEEQAKQLKDAGLTAYNHNLD  60

Query  749  TSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGllhtlatlpth  570
            TSRE+YP IITTRTYD+RLET+ N ++AGISVCSGGIIGLGE ++DR+GLLHTL+TLP H
Sbjct  61   TSREFYPKIITTRTYDERLETINNAQKAGISVCSGGIIGLGEREEDRVGLLHTLSTLPQH  120

Query  569  PESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGRVRFSMPEQTL  390
            PESVP+NAL+AV GTPLE Q+PV +++M+RMIATARIVMP++MVRLSAGRVRFS+PEQ L
Sbjct  121  PESVPVNALLAVPGTPLEKQEPVSVFEMVRMIATARIVMPKSMVRLSAGRVRFSIPEQAL  180

Query  389  CFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE  249
            CF+AGANSIFTG+KLLTTPNN+ + D+ MF++LGL+ KPP F + S+
Sbjct  181  CFMAGANSIFTGDKLLTTPNNEMNDDKKMFEILGLVSKPPNFEQGSD  227



>ref|XP_006443095.1| hypothetical protein CICLE_v10024062mg, partial [Citrus clementina]
 gb|ESR56335.1| hypothetical protein CICLE_v10024062mg, partial [Citrus clementina]
Length=303

 Score =   340 bits (871),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 181/240 (75%), Positives = 203/240 (85%), Gaps = 19/240 (8%)
 Frame = -1

Query  920  AWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKAGLTAYNHNLDTSR  741
            A  DTIGRKTNFNQ L+YVK IR M MEVCCTLGMLEKQQA+ELKKAGLTA+NHNLDTSR
Sbjct  79   ALEDTIGRKTNFNQTLEYVKDIRDMRMEVCCTLGMLEKQQAIELKKAGLTAHNHNLDTSR  138

Query  740  EYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGllhtlatlpthPES  561
            EYYP IITT +YD+ LETL++VREAGI+VCSGGIIGLGE ++DR+GLLHTLATLPTHPES
Sbjct  139  EYYPKIITTSSYDEHLETLKHVREAGINVCSGGIIGLGEPEEDRVGLLHTLATLPTHPES  198

Query  560  VPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGRVRFSMPEQTLCFL  381
            VPINAL+AVKGTPL+DQKPVEIW+MIRMIATARIVMP+AM                LCFL
Sbjct  199  VPINALLAVKGTPLQDQKPVEIWEMIRMIATARIVMPKAMA---------------LCFL  243

Query  380  AGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED----SEGENTEEALSSSG  213
            AGANSIFTGEKLLTTPNN++ ADQLMFK+LGL PK P F ED    S+ E+ +EA+SSSG
Sbjct  244  AGANSIFTGEKLLTTPNNNFVADQLMFKVLGLTPKAPSFHEDEANVSKAESYQEAISSSG  303


 Score = 89.4 bits (220),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = -2

Query  1108  RCIREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R IREGPRHDW++ +IKSIYDSP+LDLLFHGAQVHRH  NF+E Q CTLL 
Sbjct  9     RTIREGPRHDWSKYDIKSIYDSPVLDLLFHGAQVHRHAHNFREAQQCTLLS  59



>emb|CDH52376.1| biotin synthase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=381

 Score =   343 bits (881),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 202/224 (90%), Gaps = 0/224 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRD  GRK+NFN+IL YVK IRGMGMEVCCTLGML + QA +LK+A
Sbjct  138  AKEAGSTRFCMGAAWRDLAGRKSNFNKILSYVKAIRGMGMEVCCTLGMLNETQAKQLKEA  197

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP II+TR+YD+RL T+ + ++AGISVCSGGIIGLGE ++DR+GL
Sbjct  198  GLTAYNHNLDTSREFYPKIISTRSYDERLSTIGHAQDAGISVCSGGIIGLGEQEEDRVGL  257

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLP HPESVP+NAL+AV GTPLE+Q+PV +++M+RMIATARIVMP++MVRLSAGR
Sbjct  258  LHTLSTLPKHPESVPVNALLAVPGTPLENQEPVSVFEMVRMIATARIVMPKSMVRLSAGR  317

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLG  288
            VRFS  EQ +CF+AGANSIFTGEKLLTTPNN++  DQ MF++LG
Sbjct  318  VRFSTSEQAMCFMAGANSIFTGEKLLTTPNNEFTDDQKMFELLG  361


 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 38/46 (83%), Gaps = 1/46 (2%)
 Frame = -2

Query  1093  GP-RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             GP R+DW+R EI++IYDSP +DL+F+GA+VHR   N +EVQ CTLL
Sbjct  51    GPLRNDWSRQEIQAIYDSPFMDLMFYGAKVHRENFNAREVQQCTLL  96



>ref|XP_005708404.1| biotin synthetase [Galdieria sulphuraria]
 gb|EME31884.1| biotin synthetase [Galdieria sulphuraria]
Length=377

 Score =   325 bits (832),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 163/245 (67%), Positives = 202/245 (82%), Gaps = 3/245 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWR--DTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELK  786
            AKE+GST FC+GAAWR    +G +  F +ILD + +IR MG+EVC TLG+L K QAL+LK
Sbjct  118  AKESGSTRFCLGAAWRGVSQVGNR-QFERILDVIGEIRSMGLEVCATLGLLTKDQALKLK  176

Query  785  KAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRI  606
            +AGLTAYNHNLDTSRE+YP +I+TRT++DRL TL++VR+AGISVC GGI+GLGE D+DRI
Sbjct  177  EAGLTAYNHNLDTSREFYPKVISTRTFEDRLNTLQSVRDAGISVCCGGILGLGETDEDRI  236

Query  605  GllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
             LLHTLAT+P HPESVP+NALVA KGTPLED KPV +W+M RMIA+ARI+MP +MVRLSA
Sbjct  237  SLLHTLATMPKHPESVPVNALVATKGTPLEDMKPVSVWEMCRMIASARILMPSSMVRLSA  296

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEG  246
            GR+  S  EQ LCFL+GANSIFTGE+LLTTPNN++  DQ++F+ LGL  KPP F  D E 
Sbjct  297  GRISLSPAEQALCFLSGANSIFTGERLLTTPNNEFAQDQILFQTLGLRGKPPFFPMDKEA  356

Query  245  ENTEE  231
              +++
Sbjct  357  TESKK  361



>gb|EFW43202.2| biotin synthase [Capsaspora owczarzaki ATCC 30864]
Length=457

 Score =   325 bits (833),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 163/232 (70%), Positives = 196/232 (84%), Gaps = 0/232 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRD I RK+NF  +L+ V ++R MG+EVC TLGML  +QA++LK A
Sbjct  201  AKEAGSTRFCMGAAWRDVIHRKSNFAHVLEMVSEVRSMGLEVCATLGMLSPEQAVQLKNA  260

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP IITTRTYD+RL T+ N R+AG+SVCSGGIIGLGE  +DR+GL
Sbjct  261  GLTAYNHNLDTSREFYPKIITTRTYDERLNTIANARDAGLSVCSGGIIGLGEDLNDRVGL  320

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLPTHPESVP+NALV V GTPL D++ V+IW+M+RMIATARI+MP +MVRLSAGR
Sbjct  321  LHTLSTLPTHPESVPVNALVPVPGTPLGDREKVKIWEMVRMIATARILMPGSMVRLSAGR  380

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKF  264
            V F+  EQ LCF AGANSIFTG+KLLTT NN ++ DQ +F +LGL+ K P F
Sbjct  381  VNFTPIEQALCFFAGANSIFTGDKLLTTANNAFNDDQTLFNLLGLVGKEPNF  432


 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RHDWTR EI+ I+D+PLLDL++  A VHR   + ++VQ CTLL 
Sbjct  117   RHDWTRAEIQEIFDTPLLDLMYRAATVHRTHHDPRQVQQCTLLS  160



>ref|WP_007657919.1| biotin synthase [Pontibacter sp. BAB1700]
 gb|EJF09254.1| biotin synthase [Pontibacter sp. BAB1700]
Length=332

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 163/242 (67%), Positives = 200/242 (83%), Gaps = 2/242 (1%)
 Frame = -1

Query  974  TLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQAL  795
            T    AK+ GST FC+GAAWR+ +    +F+++LD VK +  MG+EVCCTLGM+ + QA 
Sbjct  90   TAAQRAKDGGSTRFCMGAAWRE-VRDNRDFDKVLDMVKGVNEMGLEVCCTLGMVNEYQAE  148

Query  794  ELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADD  615
            +LK+AGL AYNHNLDTS E Y NIITTRTYDDRL+T+ENVR+AGISVCSGGIIGLGE D+
Sbjct  149  KLKEAGLYAYNHNLDTSEENYSNIITTRTYDDRLDTIENVRKAGISVCSGGIIGLGETDE  208

Query  614  DRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVR  435
            DRIG+LH+L+TL  HPESVP+NALV VKGTPLE+Q  V +W+M+RMIATARI+MP+ MVR
Sbjct  209  DRIGMLHSLSTLVQHPESVPVNALVPVKGTPLENQPLVTVWEMVRMIATARILMPKTMVR  268

Query  434  LSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED  255
            LSAGR R S+ +Q LCFLAGANSIFTGEKLLTTPN D+DAD+ MF +LGL P+   F E+
Sbjct  269  LSAGRERMSVTDQALCFLAGANSIFTGEKLLTTPNPDFDADKAMFDLLGLTPR-KSFKEE  327

Query  254  SE  249
            ++
Sbjct  328  AQ  329



>ref|WP_018479104.1| biotin synthase [Pontibacter roseus]
Length=333

 Score =   317 bits (813),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/233 (69%), Positives = 195/233 (84%), Gaps = 1/233 (0%)
 Frame = -1

Query  974  TLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQAL  795
            T    AK+ GST FC+GAAWR+    + +F+++LD VK +  MG+EVCCTLGM+ + QA 
Sbjct  91   TAAQRAKDGGSTRFCMGAAWREVRDNR-DFDKVLDMVKGVNEMGLEVCCTLGMVNEYQAE  149

Query  794  ELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADD  615
            +LK+AGL AYNHNLDTS E Y NIITTRTYDDRL+T+ENVR+AGISVCSGGIIGLGE D+
Sbjct  150  KLKEAGLYAYNHNLDTSEENYSNIITTRTYDDRLDTIENVRKAGISVCSGGIIGLGETDE  209

Query  614  DRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVR  435
            DRIG+LHTL+TL  HPESVP+NALV VKGTPLE+Q  V +W+M+RMIATARI+MP+ MVR
Sbjct  210  DRIGMLHTLSTLVQHPESVPVNALVPVKGTPLENQPRVSVWEMVRMIATARILMPKTMVR  269

Query  434  LSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            LSAGR + ++ EQ LCFLAGANSIFTGEKLLTTPN D+DAD+ MF +LGL P+
Sbjct  270  LSAGREQMNVTEQALCFLAGANSIFTGEKLLTTPNPDFDADKAMFDLLGLTPR  322



>ref|WP_025604264.1| biotin synthase [Pontibacter actiniarum]
Length=333

 Score =   315 bits (806),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/242 (67%), Positives = 199/242 (82%), Gaps = 2/242 (1%)
 Frame = -1

Query  974  TLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQAL  795
            T    AKE GST FC+GAAWR+ +    +F+++LD VK +  +G+EVCCTLGM+ + QA 
Sbjct  90   TAAQRAKEGGSTRFCMGAAWRE-VRDNRDFDKVLDMVKGVNDLGLEVCCTLGMVNEYQAE  148

Query  794  ELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADD  615
            +LK+AGL AYNHNLDTS + Y +IITTRTYDDRL T++NVR+AGISVCSGGIIGLGE D 
Sbjct  149  KLKEAGLYAYNHNLDTSEDNYASIITTRTYDDRLNTIDNVRKAGISVCSGGIIGLGETDQ  208

Query  614  DRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVR  435
            DRIG+LHTL+T+  HPESVP+NALV VKGTPLE+Q  V +W+M+RMIATARI+MP++MVR
Sbjct  209  DRIGMLHTLSTMEQHPESVPVNALVPVKGTPLENQPLVSVWEMVRMIATARILMPKSMVR  268

Query  434  LSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED  255
            LSAGR R S+ EQ LCFLAGANSIFTGEKLLTTPN D+DAD+ MF +LGL P+   F E+
Sbjct  269  LSAGRERMSVTEQALCFLAGANSIFTGEKLLTTPNPDFDADKAMFDLLGLNPR-KSFKEE  327

Query  254  SE  249
            ++
Sbjct  328  AQ  329



>ref|XP_004349766.1| biotin synthase [Capsaspora owczarzaki ATCC 30864]
Length=393

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWRD I RK+NF  +L+ V ++R MG+EVC TLGML  +QA++LK A
Sbjct  161  AKEAGSTRFCMGAAWRDVIHRKSNFAHVLEMVSEVRSMGLEVCATLGMLSPEQAVQLKNA  220

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP IITTRTYD+RL T+ N R+AG+SVCSGGIIGLGE  +DR+GL
Sbjct  221  GLTAYNHNLDTSREFYPKIITTRTYDERLNTIANARDAGLSVCSGGIIGLGEDLNDRVGL  280

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLPTHPESVP+NALV V GTPL D++ V+IW+M+RMIATARI+MP +MVRLSAGR
Sbjct  281  LHTLSTLPTHPESVPVNALVPVPGTPLGDREKVKIWEMVRMIATARILMPGSMVRLSAGR  340

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP  279
            V F+  EQ LCF AGANSIFTG+KLLTT NN ++ DQ +F +LG  P
Sbjct  341  VNFTPIEQALCFFAGANSIFTGDKLLTTANNAFNDDQTLFNLLGKRP  387


 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RHDWTR EI+ I+D+PLLDL++  A VHR   + ++VQ CTLL 
Sbjct  77    RHDWTRAEIQEIFDTPLLDLMYRAATVHRTHHDPRQVQQCTLLS  120



>dbj|GAL84226.1| biotin synthase [Sporocytophaga myxococcoides]
Length=335

 Score =   313 bits (802),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 158/229 (69%), Positives = 196/229 (86%), Gaps = 1/229 (0%)
 Frame = -1

Query  962  SAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKK  783
            +AKE+GST FC+GAAWR+    K +F+++LD VK +  MG+EVCCTLGML ++QA++LK 
Sbjct  88   NAKESGSTRFCMGAAWREVRDNK-DFDRVLDMVKGVSQMGLEVCCTLGMLTEEQAMKLKD  146

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGL AYNHNLDTS E+Y  II+TRTYDDRL+TLENVR++ ISVCSGGIIG+GE+ +DRIG
Sbjct  147  AGLYAYNHNLDTSEEHYDKIISTRTYDDRLDTLENVRKSKISVCSGGIIGMGESHNDRIG  206

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            +L TL+TLP HPESVP+NALV V+GTPLEDQ  V +W+M+RMIATARI+MP+AMVRLSAG
Sbjct  207  MLLTLSTLPEHPESVPVNALVPVEGTPLEDQPRVSVWEMVRMIATARIIMPKAMVRLSAG  266

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            RVR S+ EQ LCFLAGANSIF G+KLLTTPN + DAD+ MF++L L P+
Sbjct  267  RVRMSLEEQGLCFLAGANSIFAGDKLLTTPNPEVDADKEMFQILNLKPR  315


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             R++WTR EI  IY+SP+LDL++  A VHR   + QEVQ CTLL  +
Sbjct  5     RNNWTREEITEIYNSPILDLIYRAATVHRANHDPQEVQVCTLLSVK  50



>emb|CBN74306.1| biotin synthase [Ectocarpus siliculosus]
Length=415

 Score =   315 bits (806),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 161/232 (69%), Positives = 193/232 (83%), Gaps = 3/232 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+   +K  FN ILD V+++ GMGMEVCCTLGML  +QA +LK+A
Sbjct  141  AKEAGSTRFCMGAAWRELGNKKKAFNNILDMVREVNGMGMEVCCTLGMLNGEQAKQLKEA  200

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP++ITTR+Y+DRLET+ NVREAGISVC GGI+GLGE ++DR+GL
Sbjct  201  GLTAYNHNLDTSREFYPSVITTRSYEDRLETISNVREAGISVCCGGILGLGEEENDRVGL  260

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPV---EIWDMIRMIATARIVMPEAMVRLS  429
            LHTLATL  HPESVPINALVAV+GTPL D+      +IWDM RMIATAR+VMP  MVRLS
Sbjct  261  LHTLATLEEHPESVPINALVAVEGTPLADEGKADTPDIWDMGRMIATARVVMPRTMVRLS  320

Query  428  AGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            AGR+ FS  EQ + F+AGANSIFTG++LLTT N ++DAD+ +F  LGL  KP
Sbjct  321  AGRLSFSEAEQAMMFMAGANSIFTGDRLLTTSNPEFDADKALFAKLGLNGKP  372


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R+DWT+ EI+ +Y+ P+L+LL+  + VHR   +  EVQ CTLL 
Sbjct  57    RNDWTKEEIREVYEMPMLELLYRASSVHRMFFDPTEVQQCTLLS  100



>ref|WP_019948907.1| biotin synthase [Hymenobacter aerophilus]
Length=336

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/247 (67%), Positives = 199/247 (81%), Gaps = 5/247 (2%)
 Frame = -1

Query  989  LPRGTTLHSS--AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGM  816
            LP    L S+  A++AGST FC+GAAWR+ I    +F+++L  V+Q+ G+G+EVCCTLGM
Sbjct  74   LPDAEVLASAQRARDAGSTRFCMGAAWRE-IRDNRDFDRVLGMVEQVNGLGLEVCCTLGM  132

Query  815  LEKQQALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGII  636
            L + QA  LK AGL AYNHNLDTSRE+Y +IITTRTYDDRL TLE+VR+AGISVCSGGII
Sbjct  133  LNEYQAERLKAAGLYAYNHNLDTSREHYDDIITTRTYDDRLNTLEHVRKAGISVCSGGII  192

Query  635  GLGEADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIV  456
            GLGE D+DR+ +LHTLATLP HPESVP+NALV V+GTPL +Q  V +W+M+RMIATARI+
Sbjct  193  GLGETDEDRVAMLHTLATLPAHPESVPVNALVPVEGTPLAEQPRVSVWEMLRMIATARIL  252

Query  455  MPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            MP  MVRLSAGR    + EQ LCFLAGANSIF+GEKLLTTPN D+DADQ MF +LGL  K
Sbjct  253  MPHTMVRLSAGRQEMPVTEQALCFLAGANSIFSGEKLLTTPNPDFDADQQMFALLGL--K  310

Query  275  PPKFLED  255
            P K  +D
Sbjct  311  PRKSFKD  317



>ref|WP_022823353.1| biotin synthase [Hymenobacter norwichensis]
Length=335

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 166/247 (67%), Positives = 199/247 (81%), Gaps = 5/247 (2%)
 Frame = -1

Query  989  LPRGTTLHSS--AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGM  816
            LP    L S+  AK++GST FC+GAAWR+ I    +F+++L  V+Q+ G+G+EVCCTLGM
Sbjct  76   LPDAEVLASAQRAKDSGSTRFCMGAAWRE-IRDNRDFDRVLGMVEQVNGLGLEVCCTLGM  134

Query  815  LEKQQALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGII  636
            L + QA  LK+AGL AYNHNLDTSRE+Y +IITTRTYDDRL TLE+VR+AGISVCSGGII
Sbjct  135  LNEYQAERLKQAGLYAYNHNLDTSREHYDDIITTRTYDDRLNTLEHVRKAGISVCSGGII  194

Query  635  GLGEADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIV  456
            GLGE D+DR+ +LHTLATLP HPESVP+NALV V GTPL DQ  V +W+M+RMIATARI+
Sbjct  195  GLGETDEDRVAMLHTLATLPAHPESVPVNALVPVAGTPLADQPRVSVWEMLRMIATARIL  254

Query  455  MPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            MP  MVRLSAGR    + EQ LCFLAGANSIF+GEKLLTTPN D+DAD+ MF +LGL  K
Sbjct  255  MPHTMVRLSAGRQEMPVTEQALCFLAGANSIFSGEKLLTTPNPDFDADKQMFALLGL--K  312

Query  275  PPKFLED  255
            P K  +D
Sbjct  313  PRKSFKD  319



>gb|AII50630.1| biotin synthase [Hymenobacter sp. APR13]
Length=335

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 167/247 (68%), Positives = 199/247 (81%), Gaps = 5/247 (2%)
 Frame = -1

Query  989  LPRGTTLHSS--AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGM  816
            LP    L S+  AK++GST FC+GAAWR+ I    +F+++L  V+Q+ G+G+EVCCTLGM
Sbjct  76   LPDAEVLASAQRAKDSGSTRFCMGAAWRE-IRDNKDFDRVLGMVEQVNGLGLEVCCTLGM  134

Query  815  LEKQQALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGII  636
            L + QA  LK+AGL AYNHNLDTSRE Y +IITTRTYDDRL TLE+VR+AGISVCSGGII
Sbjct  135  LNEYQAERLKQAGLYAYNHNLDTSREKYDDIITTRTYDDRLNTLEHVRKAGISVCSGGII  194

Query  635  GLGEADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIV  456
            GLGE D+DRI +LHTLATLP HPESVP+NALV V+GTPL DQ  V +W+M+RMIATARI+
Sbjct  195  GLGETDEDRIAMLHTLATLPAHPESVPVNALVPVEGTPLADQPRVSVWEMLRMIATARIL  254

Query  455  MPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            MP  MVRLSAGR    + EQ LCFLAGANSIF+GEKLLTTPN D+DAD+ MF +LGL  K
Sbjct  255  MPHTMVRLSAGRQEMPVTEQALCFLAGANSIFSGEKLLTTPNPDFDADKQMFALLGL--K  312

Query  275  PPKFLED  255
            P K  +D
Sbjct  313  PRKSFKD  319



>gb|AHJ97171.1| biotin synthase [Hymenobacter swuensis DY53]
Length=335

 Score =   310 bits (795),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 167/247 (68%), Positives = 198/247 (80%), Gaps = 5/247 (2%)
 Frame = -1

Query  989  LPRGTTLHSS--AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGM  816
            LP    L S+  AK++GST FC+GAAWR+ I    +F+++L  V+Q+ G+G+EVCCTLGM
Sbjct  76   LPDAEVLASAQRAKDSGSTRFCMGAAWRE-IRDNRDFDRVLGMVEQVNGLGLEVCCTLGM  134

Query  815  LEKQQALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGII  636
            L + QA  LK+AGL AYNHNLDTSRE Y +IITTRTYDDRL TLE+VR+AGISVCSGGII
Sbjct  135  LNEYQAERLKQAGLYAYNHNLDTSREKYDDIITTRTYDDRLNTLEHVRKAGISVCSGGII  194

Query  635  GLGEADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIV  456
            GLGE D+DRI +LHTLATLP HPESVP+NALV V GTPL DQ  V +W+M+RMIATARI+
Sbjct  195  GLGETDEDRIAMLHTLATLPAHPESVPVNALVPVAGTPLADQPRVSVWEMLRMIATARIL  254

Query  455  MPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            MP  MVRLSAGR    + EQ LCFLAGANSIF+GEKLLTTPN D+DAD+ MF +LGL  K
Sbjct  255  MPHTMVRLSAGRQEMPVTEQALCFLAGANSIFSGEKLLTTPNPDFDADKQMFALLGL--K  312

Query  275  PPKFLED  255
            P K  +D
Sbjct  313  PRKSFKD  319



>ref|WP_027001110.1| biotin synthase [Flexibacter roseolus]
Length=316

 Score =   310 bits (793),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 196/230 (85%), Gaps = 1/230 (0%)
 Frame = -1

Query  965  SSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELK  786
            + A +AGST FC+GAAWR+ +    +F+++L+ VK+I  MGMEVCCTLGML + QA +LK
Sbjct  84   AEAWQAGSTRFCMGAAWRE-VREGRDFDRLLEAVKKINHMGMEVCCTLGMLTESQAQKLK  142

Query  785  KAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRI  606
            +AGL AYNHNLDTS EYY +II+TR Y DRL+TLENVR++GISVCSGGIIG+GEA+ DRI
Sbjct  143  EAGLYAYNHNLDTSPEYYNDIISTRDYQDRLQTLENVRKSGISVCSGGIIGMGEAETDRI  202

Query  605  GllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            GLLHTLATLP HPESVP+NALV V+GTPLE+Q+ V +W+M+RMIATARI+MP+AMVRLSA
Sbjct  203  GLLHTLATLPEHPESVPVNALVPVEGTPLEEQEKVSVWEMVRMIATARIIMPKAMVRLSA  262

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            GRVR S+ EQ LCFLAGANSIF G+KLLTTPN  Y +DQ MF++L L P+
Sbjct  263  GRVRMSLEEQALCFLAGANSIFAGDKLLTTPNPSYISDQEMFQILQLTPR  312



>ref|WP_028981645.1| biotin synthase [Sporocytophaga myxococcoides]
Length=335

 Score =   310 bits (794),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 156/229 (68%), Positives = 195/229 (85%), Gaps = 1/229 (0%)
 Frame = -1

Query  962  SAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKK  783
            +AKE+GST FC+GAAWR+    K +F+++LD VK +  MG+EVCCTLGML ++QA++LK 
Sbjct  88   NAKESGSTRFCMGAAWREVRDNK-DFDRVLDMVKGVSQMGLEVCCTLGMLTEEQAMKLKD  146

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGL AYNHNLDTS E+Y  II+TRTYDDRL+TLENVR++ ISVCSGGIIG+GE+ +DRIG
Sbjct  147  AGLYAYNHNLDTSEEHYDKIISTRTYDDRLDTLENVRKSKISVCSGGIIGMGESHNDRIG  206

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            +L TL+TLP HPESVP+NALV V+GTPLEDQ  V +W+MIRMIATARI+MP+AMVRLSAG
Sbjct  207  MLLTLSTLPEHPESVPVNALVPVEGTPLEDQPRVSVWEMIRMIATARIIMPKAMVRLSAG  266

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            RVR +  EQ LCF+AGANSIF G+KLLTTPN + DAD+ +F++L L P+
Sbjct  267  RVRMNQEEQALCFMAGANSIFAGDKLLTTPNPEVDADKELFQVLNLKPR  315


 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R++WTR EI  IY+SP+LDL++  A VHR   + QEVQ CTLL
Sbjct  5     RNNWTREEITEIYNSPILDLIYRAATVHRANHDAQEVQVCTLL  47



>ref|WP_014219895.1| biotin synthase [Niastella koreensis]
 ref|YP_005009385.1| biotin synthase [Niastella koreensis GR20-10]
 gb|AEV99981.1| biotin synthase [Niastella koreensis GR20-10]
Length=324

 Score =   310 bits (793),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 158/239 (66%), Positives = 194/239 (81%), Gaps = 2/239 (1%)
 Frame = -1

Query  965  SSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELK  786
            + AK AGST FC+GAAWR+ +    +F++++D VK +  MGMEVCCTLGML + QA +L 
Sbjct  85   AKAKAAGSTRFCMGAAWRE-VRDNRDFDRVIDMVKGVNEMGMEVCCTLGMLTESQAQKLA  143

Query  785  KAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRI  606
             AGL AYNHNLDTS+EYY  IITTRTYDDRLETL+NVR+AGISVC GGI+GLGE   DRI
Sbjct  144  DAGLYAYNHNLDTSKEYYTEIITTRTYDDRLETLDNVRKAGISVCCGGIVGLGETHADRI  203

Query  605  GllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
             +LHTL+T+P HPESVPINALVAV GTPLE+ + V++WDM++MIATARI+MP+AMVRLSA
Sbjct  204  KMLHTLSTMPEHPESVPINALVAVAGTPLENNQKVDVWDMVKMIATARILMPKAMVRLSA  263

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE  249
            GR   S+ +Q +CF+AGANSIFTGEKLLTTPN  +D DQ MF +LG+ P+   F E+ E
Sbjct  264  GRATMSVSDQAMCFMAGANSIFTGEKLLTTPNPSFDEDQAMFNLLGITPREA-FKEEKE  321



>ref|WP_009193496.1| Biotin synthase [Cesiribacter andamanensis]
 gb|EMR04811.1| Biotin synthase [Cesiribacter andamanensis AMV16]
Length=335

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 194/228 (85%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+GAAWR+ +    +F+++L+ VK + GMGMEVCCTLGML ++QAL+L++A
Sbjct  89   AKQAGSTRFCMGAAWRE-VRNNRDFDKVLEMVKGVNGMGMEVCCTLGMLTEEQALKLQEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS E+Y  II+TRTY DRL+TL NVR++GISVCSGGIIG+GE+  DRIG+
Sbjct  148  GLYAYNHNLDTSEEHYGEIISTRTYQDRLDTLNNVRKSGISVCSGGIIGMGESQHDRIGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVP+NALV V+GTPLE Q  V +WDM+RMIATARI+MP+AMVRLSAGR
Sbjct  208  LHTLATLPEHPESVPVNALVPVEGTPLEQQPKVPVWDMVRMIATARIIMPKAMVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            VR ++ EQ LCF+AGANSIF G+KLLTTPN D  +DQ MF++L L P+
Sbjct  268  VRMTLEEQALCFMAGANSIFAGDKLLTTPNPDVVSDQEMFQILNLKPR  315


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R +WTR EI +IY+ P L+L++ GA VHR   + QEVQ CTLL
Sbjct  5     RTNWTRSEIDTIYNLPFLELVYRGASVHRQYHDAQEVQVCTLL  47



>ref|WP_025538819.1| biotin synthase [Cytophagaceae bacterium JGI 0001001-B3]
Length=325

 Score =   309 bits (791),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 191/230 (83%), Gaps = 1/230 (0%)
 Frame = -1

Query  965  SSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELK  786
            + AKE+GST FC+GAAWR+ +    +F++++  VK +  MGMEVCCTLGML  QQA +LK
Sbjct  87   ADAKESGSTRFCMGAAWRE-VRDNRDFDKVISMVKGVSAMGMEVCCTLGMLTAQQAQKLK  145

Query  785  KAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRI  606
             AGL AYNHNLDTS E+Y +IITTRTYDDRL+TLE+VR+A ISVCSGGIIG+GE ++DRI
Sbjct  146  DAGLYAYNHNLDTSAEFYNDIITTRTYDDRLDTLEHVRDAKISVCSGGIIGMGEHENDRI  205

Query  605  GllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            G+LH LATLP HPESVP+NALV V+GTPLEDQ  V +WDM+RMIATAR++MP AMVRLSA
Sbjct  206  GMLHVLATLPEHPESVPVNALVPVEGTPLEDQPKVSVWDMVRMIATARLIMPRAMVRLSA  265

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            GRVR ++ EQ LCFLAGANSIF G+KLLTTPN  Y  DQ MF++L L P+
Sbjct  266  GRVRMTLEEQALCFLAGANSIFAGDKLLTTPNPGYIRDQEMFQVLQLKPR  315


 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             R+DWTR EI SI++ P+L+L++  A VHR      EVQ CTLL  +
Sbjct  5     RNDWTREEIASIFNRPVLELIYEAATVHRQYHEAGEVQVCTLLSVK  50



>ref|WP_038114156.1| biotin synthase [Tolypothrix bouteillei]
Length=323

 Score =   308 bits (789),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/228 (70%), Positives = 194/228 (85%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+    K +F+++L+ VK +  MG+EVCCTLGML ++QA +LK A
Sbjct  87   AKEAGSTRFCMGAAWREVRDNK-DFDKVLEMVKGVSTMGLEVCCTLGMLSEEQAQKLKDA  145

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS E+Y +IITTRTY DRL+TLENV +A ISVCSGGIIG+GE  +DRIG+
Sbjct  146  GLYAYNHNLDTSEEFYDDIITTRTYKDRLDTLENVSKAKISVCSGGIIGMGEKIEDRIGM  205

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVP+NALV V+GTPLEDQ+ V +W+M+RMIATARI+MP+AMVRLSAGR
Sbjct  206  LHTLATLPEHPESVPVNALVPVEGTPLEDQEKVSVWEMVRMIATARILMPKAMVRLSAGR  265

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            VR ++ EQ LCF+AGANSIF G+KLLTTPN  Y AD+ MF++L LIP+
Sbjct  266  VRMNVEEQALCFMAGANSIFAGDKLLTTPNPAYVADKEMFQILNLIPR  313



>ref|WP_018343604.1| biotin synthase [Cytophaga aurantiaca]
Length=337

 Score =   308 bits (789),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 188/228 (82%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE+GST FC+GAAWR+    K +F++++D VK +  MGMEVCCTLGML  +QA +LK A
Sbjct  89   AKESGSTRFCMGAAWREVRDNK-DFDKVIDMVKGVSTMGMEVCCTLGMLTPEQATKLKDA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS E+Y  +ITTRTYDDRLETL+NVR A ISVCSGGIIG+GE+  DR+G+
Sbjct  148  GLYAYNHNLDTSEEHYDKVITTRTYDDRLETLDNVRNAKISVCSGGIIGMGESHGDRVGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL  +  HPESVP+NALV V+GTPLEDQ  V +W+M+RMIATARI+MP+AMVRLSAGR
Sbjct  208  LHTLVNMAEHPESVPVNALVPVEGTPLEDQPRVSVWEMVRMIATARIIMPKAMVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            VR +  EQ LCFLAGANSIF G+KLLTTPN + +AD+ MF++L L P+
Sbjct  268  VRMNTEEQALCFLAGANSIFAGDKLLTTPNPEVNADKEMFQVLNLKPR  315


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R++WT+ EI +IY+SP+LDL++ GA VHR   + QEVQ CTLL 
Sbjct  5     RNNWTKEEISAIYNSPILDLMYRGATVHREFHDPQEVQVCTLLS  48



>ref|WP_009583686.1| Biotin synthase [Fulvivirga imtechensis]
 gb|ELR68098.1| Biotin synthase [Fulvivirga imtechensis AK7]
Length=331

 Score =   307 bits (787),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 157/228 (69%), Positives = 192/228 (84%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+GAAWR+ +    +F+++LD VK +  +G+EVCCTLGML ++QA +LK A
Sbjct  89   AKDAGSTRFCMGAAWRE-VRDNRDFDRVLDMVKGVNNLGLEVCCTLGMLTEEQAQKLKDA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS E+Y  II+TRTYDDRL+TLENVR+A ISVCSGGIIG+GE+D DRIG+
Sbjct  148  GLYAYNHNLDTSEEHYKEIISTRTYDDRLDTLENVRKAKISVCSGGIIGMGESDSDRIGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVP+NALV V+GTP+ +Q  V IW+M+RMIATARI+MP+AMVRLSAGR
Sbjct  208  LHTLATLPEHPESVPVNALVPVEGTPMAEQPRVSIWEMVRMIATARIIMPKAMVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            VR +M EQ LCF+AGANSIF G+KLLTTPN D   D+ MF+ L LIP+
Sbjct  268  VRMNMEEQALCFMAGANSIFAGDKLLTTPNPDVVQDEEMFQTLNLIPR  315


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             R++WTR EI  IY+SP+LDL++  A  HR   N  EVQ CTLL  +
Sbjct  5     RNNWTREEISEIYNSPVLDLIYRAATAHREHHNASEVQVCTLLSVK  50



>ref|WP_035726594.1| biotin synthase [Flexibacter elegans]
Length=323

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 193/229 (84%), Gaps = 1/229 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE+GST FC+GAAWR+    + +F+++L+ VK +  +GMEVCCTLGML  +QA +LK+A
Sbjct  87   AKESGSTRFCMGAAWREVRDNR-DFDRVLEMVKGVNALGMEVCCTLGMLTAEQAQKLKEA  145

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS  +Y ++ITTRT+DDRL+T+ENVR++GISVC GGIIGLGE D+DRI +
Sbjct  146  GLFAYNHNLDTSESHYGDVITTRTFDDRLKTIENVRKSGISVCCGGIIGLGETDEDRISM  205

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVP+NALV+++GTPLE+Q+ V +W+M+RMIATARI MP+AMVRLSAGR
Sbjct  206  LHTLATLPEHPESVPVNALVSIEGTPLENQERVSVWEMVRMIATARITMPQAMVRLSAGR  265

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            +  S  EQ LCFLAGANSIF G+KLLTTPN + +ADQ +F ML L P+P
Sbjct  266  LEMSTEEQALCFLAGANSIFAGDKLLTTPNPEQNADQQLFSMLNLTPRP  314


 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R+DWT+ EI+++Y SP+LDL++  A VHR   N QEVQ CTLL
Sbjct  3     RNDWTQAEIENLYHSPVLDLIYQAATVHRQYHNPQEVQVCTLL  45



>ref|WP_026261968.1| biotin synthase [Spirosoma panaciterrae]
Length=340

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 191/233 (82%), Gaps = 1/233 (0%)
 Frame = -1

Query  974  TLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQAL  795
            T    AK+ GST FC+GAAWR+ +    +F+++L+ V+ +  MG+EVCCTLGML + QA 
Sbjct  91   TAAQRAKDTGSTRFCMGAAWRE-VRDNRDFDKVLEMVQGVNEMGLEVCCTLGMLTESQAQ  149

Query  794  ELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADD  615
             LK AGL AYNHNLDTS EYY +IITTRTYDDRL+TL + R+AGISVCSGGIIG+GE+D 
Sbjct  150  RLKDAGLYAYNHNLDTSEEYYGDIITTRTYDDRLDTLSHARKAGISVCSGGIIGMGESDQ  209

Query  614  DRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVR  435
            DRIG+LHTLATLP HPESVP+NALV V+GTPLEDQ  V IW+M+RMIATARI+MP+AMVR
Sbjct  210  DRIGMLHTLATLPQHPESVPVNALVPVEGTPLEDQPRVSIWEMVRMIATARIIMPKAMVR  269

Query  434  LSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            LSAGRVR +  EQ LCFLAGANSIF G+KLLTTPN D DADQ +F+ L + P+
Sbjct  270  LSAGRVRMNTEEQALCFLAGANSIFAGDKLLTTPNPDEDADQQLFQTLNIRPR  322


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             R DWTR EI  IY+SP+LDL++  A VHR   + QEVQ CTLL  +
Sbjct  12    RTDWTRAEIADIYNSPVLDLMYRAATVHRQHHDPQEVQVCTLLSVK  57



>ref|WP_027302930.1| biotin synthase [Rudanella lutea]
Length=341

 Score =   307 bits (786),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/241 (67%), Positives = 196/241 (81%), Gaps = 2/241 (1%)
 Frame = -1

Query  965  SSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELK  786
            S AK +GS+ FC+GAAWR+    K +F+++LD V+ +  MGMEVCCTLGML   QA +LK
Sbjct  93   SRAKASGSSRFCMGAAWREVRDNK-DFDKVLDMVRGVNAMGMEVCCTLGMLTDSQAQKLK  151

Query  785  KAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRI  606
             AGL AYNHNLDTS EYY +II+TRTYDDRLETL +VR+AGISVCSGGIIG+GE+ +DRI
Sbjct  152  DAGLYAYNHNLDTSEEYYGDIISTRTYDDRLETLGHVRQAGISVCSGGIIGMGESHNDRI  211

Query  605  GllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            G+LHTL+TLP HPESVP+NALV V+GTPLEDQ+ V +W+M+RMIATARI+MP+AMVRLSA
Sbjct  212  GMLHTLSTLPEHPESVPVNALVPVEGTPLEDQERVSVWEMVRMIATARIIMPKAMVRLSA  271

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEG  246
            GRVR S  EQ LCFLAGANSIF G+KLLTTPN   DAD  +F+ L + P+   F  +S G
Sbjct  272  GRVRMSTEEQALCFLAGANSIFAGDKLLTTPNPGDDADGQLFQTLNIRPR-EAFKNESTG  330

Query  245  E  243
            +
Sbjct  331  Q  331


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             R+DWTR EI +IY+SP+LDL++  A VHR   + QEVQ CTLL  +
Sbjct  11    RNDWTRDEIGAIYNSPVLDLIYRAATVHRQHHDPQEVQVCTLLSVK  56



>ref|WP_011585834.1| biotin synthase [Cytophaga hutchinsonii]
 ref|YP_679062.1| biotin synthase [Cytophaga hutchinsonii ATCC 33406]
 sp|Q11S94.1|BIOB_CYTH3 RecName: Full=Biotin synthase [Cytophaga hutchinsonii ATCC 33406]
 gb|ABG59720.1| biotin synthase [Cytophaga hutchinsonii ATCC 33406]
Length=337

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 189/228 (83%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE+GST FC+GAAWR+    K +F++++D VK +  MGMEVCCTLGML  +QA +LK A
Sbjct  89   AKESGSTRFCMGAAWREVRDNK-DFDKVIDMVKGVSTMGMEVCCTLGMLTPEQADKLKDA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS E+Y  +ITTRTYDDRLETL+NVR A ISVCSGGIIG+GE+  DR+G+
Sbjct  148  GLYAYNHNLDTSAEHYDKVITTRTYDDRLETLDNVRNAKISVCSGGIIGMGESHGDRVGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLA +  HPESVP+NALV V+GTPLEDQ  V +W+M+RMIATARI+MP+AMVRLSAGR
Sbjct  208  LHTLANMVEHPESVPVNALVPVEGTPLEDQPRVSVWEMVRMIATARIIMPKAMVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            VR +  EQ LCFLAGANSIF G+KLLTTPN + +AD+ MF++L L P+
Sbjct  268  VRMNTEEQALCFLAGANSIFAGDKLLTTPNPEVNADKEMFQVLNLKPR  315


 Score = 58.2 bits (139),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R++WT+ EI +IY+SP+LDL++ GA VHR   + QEVQ CTLL 
Sbjct  5     RNNWTKEEISAIYNSPILDLMYRGATVHREFHDPQEVQVCTLLS  48



>ref|WP_028663710.1| biotin synthase [Runella zeae]
Length=324

 Score =   306 bits (783),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/229 (67%), Positives = 193/229 (84%), Gaps = 1/229 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+ GST FC+GAAWR+ +    +F+++L+ VK +  +G+EVCCTLGML + QA +LK A
Sbjct  87   AKDTGSTRFCMGAAWRE-VRDNRDFDRVLEMVKGVNKIGLEVCCTLGMLSESQAQKLKDA  145

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS E+Y ++I+TRTYDDRL+TL +V++AGIS CSGGIIG+GE+D+DRIG+
Sbjct  146  GLYAYNHNLDTSEEFYGDVISTRTYDDRLDTLHHVQKAGISACSGGIIGMGESDEDRIGM  205

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L+TLA+LPT PESVP+NALVAV+GTPLE+QK V +W+MIRMIATARI++P+AMVRLSAGR
Sbjct  206  LYTLASLPTPPESVPVNALVAVEGTPLENQKRVSVWEMIRMIATARILIPQAMVRLSAGR  265

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            V  S  EQ LCFLAGANSIF GEKLLTTPN D DAD  +F+ L + P+P
Sbjct  266  VSMSAEEQALCFLAGANSIFAGEKLLTTPNPDIDADAELFQTLNIKPRP  314



>ref|WP_012926960.1| biotin synthase [Spirosoma linguale]
 ref|YP_003387224.1| biotin synthase [Spirosoma linguale DSM 74]
 gb|ADB38425.1| biotin synthase [Spirosoma linguale DSM 74]
Length=330

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 192/233 (82%), Gaps = 1/233 (0%)
 Frame = -1

Query  974  TLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQAL  795
            T    AK+ GST FC+GAAWR+ +   ++F+++LD V  +  MG+EVCCTLGML + QA 
Sbjct  81   TAAQRAKDTGSTRFCMGAAWRE-VRDNSDFDKVLDMVHGVNEMGLEVCCTLGMLTETQAQ  139

Query  794  ELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADD  615
            +LK AGL AYNHNLDTS E+Y +II+TRTYDDRL+TL + R+AGISVCSGGIIG+GE+D 
Sbjct  140  KLKDAGLYAYNHNLDTSEEFYGDIISTRTYDDRLDTLGHARKAGISVCSGGIIGMGESDQ  199

Query  614  DRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVR  435
            DRIG+LHTLATLP HPESVP+NALV V+GTPLEDQ  V +W+MIRMIATARI+MP+AMVR
Sbjct  200  DRIGMLHTLATLPQHPESVPVNALVPVEGTPLEDQPRVSVWEMIRMIATARIIMPKAMVR  259

Query  434  LSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            LSAGRVR +  EQ LCFLAGANSIF G+KLLTTPN D DADQ +F+ L + P+
Sbjct  260  LSAGRVRMNTEEQALCFLAGANSIFAGDKLLTTPNPDEDADQQLFQTLNIRPR  312


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             R DWTR EI  IY+SP+LDL++  A VHR   + QEVQ CTLL  +
Sbjct  2     RTDWTRAEIAEIYNSPVLDLMYRAATVHRQYHDPQEVQVCTLLSVK  47



>ref|WP_018473322.1| biotin synthase [Echinicola pacifica]
Length=325

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 158/230 (69%), Positives = 191/230 (83%), Gaps = 1/230 (0%)
 Frame = -1

Query  965  SSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELK  786
            + AK AGST FC+GAAWR+    K +F+++LD VK +  MGMEVCCTLGML ++QA +LK
Sbjct  87   AEAKSAGSTRFCMGAAWREVRDNK-DFDKVLDMVKGVNNMGMEVCCTLGMLSEEQAQKLK  145

Query  785  KAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRI  606
             AGL AYNHNLDTS E+Y  IITTR YDDRL TL+NVR+A ISVCSGGIIGLGE  DDR+
Sbjct  146  DAGLYAYNHNLDTSEEHYNEIITTRNYDDRLGTLDNVRKADISVCSGGIIGLGENLDDRV  205

Query  605  GllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            G+LHTLATLP+HPESVP+NALV V+GTPLEDQ+ V +W+M+RMIATARI+MP+AMVRLSA
Sbjct  206  GMLHTLATLPSHPESVPVNALVPVEGTPLEDQERVSVWEMVRMIATARIIMPKAMVRLSA  265

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            GRVR +  EQ LCF+AGANSIF G+KLLTTPN + D D+ +F+ L L P+
Sbjct  266  GRVRMNTEEQALCFMAGANSIFAGDKLLTTPNPEVDMDKQLFQTLNLKPR  315


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             R++WTR EIK+I+D P+++L++  A VHR   +  EVQ CTLL  +
Sbjct  5     RNNWTREEIKAIFDMPIMELMYKAATVHREYNDPTEVQVCTLLSVK  50



>ref|WP_009280732.1| biotin synthase [Fibrisoma limi]
 emb|CCH52148.1| biotin synthase [Fibrisoma limi BUZ 3]
Length=346

 Score =   306 bits (783),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 158/233 (68%), Positives = 192/233 (82%), Gaps = 1/233 (0%)
 Frame = -1

Query  974  TLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQAL  795
            T    AKEAGST FC+GAAWR+    + +F+++LD V+ +  MGMEVCCTLGML + QA 
Sbjct  97   TAAQRAKEAGSTRFCMGAAWREVRDNR-DFDKVLDMVQGVNAMGMEVCCTLGMLTESQAQ  155

Query  794  ELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADD  615
            +LK AGL AYNHNLDTS E+Y +II+TRTYDDRLET+ + R+AGISVCSGGIIG+GE+D 
Sbjct  156  KLKDAGLYAYNHNLDTSEEFYGDIISTRTYDDRLETIGHARKAGISVCSGGIIGMGESDS  215

Query  614  DRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVR  435
            DRIG+LHTLATLP HPESVP+NALV V+GTPLEDQ  V +W+M+RMIATAR++MP+AMVR
Sbjct  216  DRIGMLHTLATLPEHPESVPVNALVPVEGTPLEDQPRVSVWEMVRMIATARLIMPKAMVR  275

Query  434  LSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            LSAGRVR S+ EQ LCFLAGANSIF G+KLLTTPN   D DQ +F+ L + P+
Sbjct  276  LSAGRVRMSIEEQALCFLAGANSIFAGDKLLTTPNPGDDLDQQLFQTLNIRPR  328


 Score = 57.8 bits (138),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             R+DWTR EI  IY+SP+LDL++  A VHR   + QEVQ CTLL  +
Sbjct  18    RNDWTRAEISEIYNSPVLDLVYRAATVHRQFHDPQEVQVCTLLSVK  63



>ref|WP_015331117.1| biotin synthase [Fibrella aestuarina]
 ref|YP_007320611.1| biotin synthase [Fibrella aestuarina BUZ 2]
 emb|CCH00018.1| biotin synthase [Fibrella aestuarina BUZ 2]
Length=359

 Score =   306 bits (783),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 191/230 (83%), Gaps = 1/230 (0%)
 Frame = -1

Query  965  SSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELK  786
            S A+ +GS+ FC+GAAWR+ +    +F+++LD V+ +  MGMEVCCTLGML   QA +LK
Sbjct  112  SRAQASGSSRFCMGAAWRE-VRDNRDFDKVLDMVRGVNAMGMEVCCTLGMLTDSQAQKLK  170

Query  785  KAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRI  606
            +AGL AYNHNLDTS E+Y +IITTRTYDDRL+TL +VR+AGISVCSGGIIG+GE+ +DRI
Sbjct  171  EAGLYAYNHNLDTSEEFYGDIITTRTYDDRLDTLGHVRDAGISVCSGGIIGMGESHNDRI  230

Query  605  GllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            G+L TLATLP HPESVP+NALV V+GTPLE+Q+ V +W+M+RMIATARI MP AMVRLSA
Sbjct  231  GMLLTLATLPEHPESVPVNALVPVEGTPLEEQERVSVWEMVRMIATARITMPNAMVRLSA  290

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            GRVR +  EQ LCFLAGANSIF G+KLLTTPN D DADQ +F+ L + P+
Sbjct  291  GRVRMTTEEQALCFLAGANSIFAGDKLLTTPNPDVDADQQLFQTLNIKPR  340


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 1/51 (2%)
 Frame = -2

Query  1099  REGP-RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             R  P R DWTR EI  IY+SP+LDL++  A VHR   + QEVQ CTLL  +
Sbjct  25    RSNPMRTDWTRDEIADIYNSPVLDLIYRAATVHRQHHDPQEVQVCTLLSVK  75



>ref|WP_017731753.1| biotin synthase [Nafulsella turpanensis]
Length=337

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 155/228 (68%), Positives = 194/228 (85%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE+GST FC+GAAWR+ +    +F+++LD VK +  +GMEVCCTLGML ++QA +LK+A
Sbjct  89   AKESGSTRFCMGAAWRE-VRNNRDFDKVLDMVKGVNKLGMEVCCTLGMLTEEQANKLKEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS E+Y +II+TRTY DRL+TLENVR+A ISVCSGGIIGLGE+ +DRIG+
Sbjct  148  GLYAYNHNLDTSEEHYGDIISTRTYKDRLDTLENVRQAKISVCSGGIIGLGESMEDRIGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLP HPESVP+NALV V+GTPLE+Q  V +W+M+RMIATARI+MP+AMVRLSAGR
Sbjct  208  LHTLSTLPEHPESVPVNALVPVEGTPLEEQPRVSVWEMVRMIATARIIMPKAMVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            VR +  EQ LCF+AGANSIF G+KLLTTPN +  +DQ MF++L L P+
Sbjct  268  VRMNTEEQALCFMAGANSIFAGDKLLTTPNPNVVSDQEMFQVLNLKPR  315


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R++WTR EI +IY+SP+L+L++  A VHR   + QEVQ CTLL
Sbjct  5     RNNWTREEIAAIYNSPVLELIYRAATVHREFNDPQEVQVCTLL  47



>ref|WP_014797147.1| biotin synthase [Flexibacter litoralis]
 ref|YP_006433483.1| biotin synthase [Flexibacter litoralis DSM 6794]
 gb|AFM03690.1| biotin synthase [Flexibacter litoralis DSM 6794]
Length=333

 Score =   303 bits (775),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 191/228 (84%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE+GST FC+GAAWR+ +     F+ ++D VK+I  MG+EVCCTLGML ++QA +LK A
Sbjct  95   AKESGSTRFCMGAAWRE-VRNGREFDSVVDAVKEINEMGLEVCCTLGMLTEEQAQKLKDA  153

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  II+TR Y +RL+TLENVR++GISVCSGGIIG+GE ++DRIG+
Sbjct  154  GLYAYNHNLDTSEEYYDKIISTRDYSNRLDTLENVRKSGISVCSGGIIGMGEEEEDRIGM  213

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVP+NALV V+GTPLE+Q+ V +W+MIRMIATARI+MP AMVRLSAGR
Sbjct  214  LHTLATLPEHPESVPVNALVPVEGTPLEEQEKVSVWEMIRMIATARIIMPRAMVRLSAGR  273

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            VR ++ EQ LCFLAGANSIF G+KLLTTPN D   D+ +F++L + P+
Sbjct  274  VRMNVEEQALCFLAGANSIFAGDKLLTTPNPDTKTDKELFQILQIKPR  321


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             + +WTR EI  IY++P+L+L++ GA VHR      EVQ CTLL
Sbjct  11    KTNWTRAEIAEIYNTPILELIYKGASVHRKFHETSEVQVCTLL  53



>ref|WP_018620609.1| biotin synthase [Spirosoma luteum]
Length=331

 Score =   302 bits (773),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/233 (67%), Positives = 190/233 (82%), Gaps = 1/233 (0%)
 Frame = -1

Query  974  TLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQAL  795
            T    AK+ GST FC+GAAWR+ +    +F+++LD V+ +  MG+EVCCTLGML +QQA 
Sbjct  82   TAAQRAKDTGSTRFCMGAAWRE-VRDNRDFDKVLDMVQGVNEMGLEVCCTLGMLTEQQAQ  140

Query  794  ELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADD  615
            +LK AGL AYNHNLDTS E+Y +II+TRTYDDRL+TL + R+AGISVCSGGIIG+GE+D 
Sbjct  141  KLKDAGLYAYNHNLDTSEEFYGDIISTRTYDDRLDTLGHARKAGISVCSGGIIGMGESDT  200

Query  614  DRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVR  435
            DRIG+LHTLATLP HPESVP+NALV V+GTPLEDQ  V +W+MIRMIATARI MP+AMVR
Sbjct  201  DRIGMLHTLATLPQHPESVPVNALVPVEGTPLEDQPRVSVWEMIRMIATARISMPKAMVR  260

Query  434  LSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            LSAGRVR +  EQ LCFLAGANSIF G+KLLTTPN   D D  +F+ML + P+
Sbjct  261  LSAGRVRMTTEEQALCFLAGANSIFAGDKLLTTPNPSEDTDAQLFQMLNIRPR  313


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             R DWTR EI  IY+SP+LDL++  A VHR   + QEVQ CTLL  +
Sbjct  3     RTDWTRAEIADIYNSPVLDLMYRAATVHRQHHDPQEVQVCTLLSVK  48



>ref|WP_038028898.1| biotin synthase [Thermonema rossianum]
Length=326

 Score =   301 bits (772),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 155/240 (65%), Positives = 197/240 (82%), Gaps = 1/240 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+ +    +F+++L+ VK +  +G+EVCCTLGML ++QA +LK+A
Sbjct  87   AKEAGSTRFCMGAAWRE-VRNNRDFDKVLEMVKGVANLGLEVCCTLGMLTEEQAQKLKEA  145

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS +YY +II+TRTY+DRL+T+E V ++GISVCSGGIIGLGE ++DRI +
Sbjct  146  GLYAYNHNLDTSEDYYDDIISTRTYEDRLKTIEAVNKSGISVCSGGIIGLGEKEEDRIAM  205

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLAT+ THPESVPINALV V GTPL +Q  V +W+M+RMIATARI+MP+AMVRLSAGR
Sbjct  206  LHTLATMSTHPESVPINALVPVPGTPLAEQPRVSVWEMVRMIATARILMPKAMVRLSAGR  265

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            VR ++ EQ LCFLAGANSIF G+KLLTTPN DY  DQ +F++L L P+P    E +  E+
Sbjct  266  VRMNVEEQALCFLAGANSIFAGDKLLTTPNPDYVEDQKLFQILQLKPRPAYKQEANRCEH  325



>ref|WP_015266361.1| biotin synthetase [Echinicola vietnamensis]
 ref|YP_007224818.1| biotin synthetase [Echinicola vietnamensis DSM 17526]
 gb|AGA78808.1| biotin synthetase [Echinicola vietnamensis DSM 17526]
Length=325

 Score =   301 bits (771),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 158/239 (66%), Positives = 195/239 (82%), Gaps = 3/239 (1%)
 Frame = -1

Query  965  SSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELK  786
            + AK AGST FC+GAAWR+ +    +F+++LD VK +  MGMEVCCTLGML ++QA +LK
Sbjct  87   TDAKAAGSTRFCMGAAWRE-VRDNRDFDKVLDMVKGVNNMGMEVCCTLGMLSEEQAKKLK  145

Query  785  KAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRI  606
             AGL AYNHNLDTS ++Y  IITTR YDDRL+TL+NVR+A ISVCSGGIIGLGE  DDR+
Sbjct  146  DAGLYAYNHNLDTSEDHYNEIITTRNYDDRLDTLDNVRKADISVCSGGIIGLGENLDDRV  205

Query  605  GllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            G+LHTLATLP+HPESVP+NALV V+GTPLE Q+ V +W+M+RMIATARI+MP++MVRLSA
Sbjct  206  GMLHTLATLPSHPESVPVNALVPVEGTPLEKQERVSVWEMVRMIATARIIMPKSMVRLSA  265

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE  249
            GRVR +  EQ LCF+AGANSIF G+KLLTTPN + D D+ +F+ L L  KP K  +D E
Sbjct  266  GRVRMNTEEQALCFMAGANSIFAGDKLLTTPNPEEDMDKKLFQTLDL--KPRKAFKDQE  322


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R++WTR EIK I+DSP+++L++  A VHR   + QEVQ CTLL 
Sbjct  5     RNNWTREEIKEIFDSPIMELMYKAATVHREFHDPQEVQVCTLLS  48



>ref|WP_026465026.1| biotin synthase [Adhaeribacter aquaticus]
Length=332

 Score =   301 bits (772),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 187/228 (82%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK++GST FC+GAAWR+ +    +F+++L  V ++  +G+EVCCTLGML + QA  LK+A
Sbjct  95   AKDSGSTRFCMGAAWRE-VRDNRDFDRVLGMVTKVNDIGLEVCCTLGMLNEYQAQRLKEA  153

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS ++Y +IITTR Y+DRL+TLE+VR+AGISVCSGGIIGLGE D DRI +
Sbjct  154  GLYAYNHNLDTSSDHYESIITTRKYEDRLDTLEHVRKAGISVCSGGIIGLGETDQDRIEM  213

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LH L+ LP HPESVP+NALV VKGTPLEDQ  + +W+MIRMIATARI MP  MVRLSAGR
Sbjct  214  LHVLSNLPEHPESVPVNALVPVKGTPLEDQPRLSVWEMIRMIATARITMPRTMVRLSAGR  273

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
               S+PEQ LCF+AGANSIF+GEKLLTTPN   + DQLMF++LGL P+
Sbjct  274  TEMSLPEQALCFMAGANSIFSGEKLLTTPNPGLNDDQLMFQLLGLSPR  321



>ref|WP_039128407.1| biotin synthase [Flavihumibacter sp. ZG627]
 gb|KIC91452.1| biotin synthase [Flavihumibacter sp. ZG627]
Length=322

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 187/228 (82%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            A EAGST FC+GAAWR+    + +F+++++ VK +  +GMEVCCT+GML ++QA +L  A
Sbjct  87   ASEAGSTRFCMGAAWREVRDNR-DFDRVIEMVKGVNQLGMEVCCTMGMLTEEQAKKLHDA  145

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS E+Y +IITTRTYDDRL TL NVR+AGISVCSGGIIGLGE  +DRIG+
Sbjct  146  GLYAYNHNLDTSEEHYSDIITTRTYDDRLRTLSNVRKAGISVCSGGIIGLGETHEDRIGM  205

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTL+TLP+HPESVPINALV V GTPL+  K V+IWDM+RMIATARI+MP  MVRLSAGR
Sbjct  206  LHTLSTLPSHPESVPINALVPVAGTPLQHNKKVDIWDMVRMIATARILMPATMVRLSAGR  265

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
               S+ EQ LCF+AGANSIF G+KLLTTPN  +D D LMF++LGL  +
Sbjct  266  NEMSIAEQALCFMAGANSIFAGDKLLTTPNPSFDDDNLMFQLLGLTAR  313


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R DWT+ EI SIY++PLL+L++  A +HR   +  EVQ CTLL 
Sbjct  3     RTDWTKEEITSIYNTPLLELIYKAATLHREYQDTAEVQVCTLLS  46



>ref|WP_020532011.1| biotin synthase [Flexithrix dorotheae]
Length=326

 Score =   300 bits (769),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 162/251 (65%), Positives = 197/251 (78%), Gaps = 5/251 (2%)
 Frame = -1

Query  989  LPRGTTLHSS--AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGM  816
            LP    + ++  AK  GST FC+GAAWR+    + +F ++LD VK I  MG+EVCCTLGM
Sbjct  78   LPTNVVIKNAEEAKANGSTRFCMGAAWREVRDNR-DFERVLDMVKGINKMGLEVCCTLGM  136

Query  815  LEKQQALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGII  636
            L ++QA +LK AGL AYNHNLDTS E+Y ++ITTR Y DRL+TLENVR A ISVCSGGII
Sbjct  137  LTEEQAQKLKDAGLYAYNHNLDTSEEHYGDVITTRNYADRLDTLENVRNAKISVCSGGII  196

Query  635  GLGEADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIV  456
            GLGE + DRIG+LHTL+TLP HPESVP+NALVAVKGTP+E+Q+ V +WDM+RMIATARI+
Sbjct  197  GLGEQETDRIGMLHTLSTLPEHPESVPVNALVAVKGTPMENQERVPVWDMLRMIATARII  256

Query  455  MPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            MP+AMVRLSAGR+  +  EQ LCFLAGANSIF GEKLLTTPN + D D+ MF+ L L  K
Sbjct  257  MPKAMVRLSAGRLEMNTEEQALCFLAGANSIFAGEKLLTTPNPEVDKDKEMFQTLNL--K  314

Query  275  PPKFLEDSEGE  243
            P K  ++ E E
Sbjct  315  PRKSFKNQEVE  325


 Score = 51.6 bits (122),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R+DWTR EI  I+++P+L+L++    VHR   + QEVQ CTLL
Sbjct  6     RNDWTRDEIAEIFNTPILELIYKAGSVHRAYHDPQEVQVCTLL  48



>ref|WP_039141956.1| biotin synthase [Flavihumibacter solisilvae]
 gb|KIC93466.1| biotin synthase [Flavihumibacter solisilvae]
Length=321

 Score =   300 bits (767),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 154/233 (66%), Positives = 189/233 (81%), Gaps = 1/233 (0%)
 Frame = -1

Query  974  TLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQAL  795
            T    AK+AGST FC+GAAWR+    + +F+++++ VK +  +GMEVCCT+GML + QA 
Sbjct  82   TYAQKAKDAGSTRFCMGAAWREVRDNR-DFDRVIEMVKGVNELGMEVCCTMGMLTEGQAQ  140

Query  794  ELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADD  615
             L++AGL AYNHNLDTS E+Y +IITTRTY+DRL TL NVR+AGISVCSGGIIGLGE   
Sbjct  141  RLQEAGLYAYNHNLDTSEEHYSDIITTRTYNDRLSTLNNVRKAGISVCSGGIIGLGETHQ  200

Query  614  DRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVR  435
            DRIG+LHTL+TLP HPESVPINALV V GTPLE  K ++IWDM+RMIATARI+MP +MVR
Sbjct  201  DRIGMLHTLSTLPQHPESVPINALVPVAGTPLEHNKKIDIWDMVRMIATARILMPGSMVR  260

Query  434  LSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            LSAGR   ++ EQ LCF+AGANSIF GEKLLTTPN  +D D +MF++LGL P+
Sbjct  261  LSAGRNDMTVAEQALCFMAGANSIFAGEKLLTTPNPSFDDDNMMFQLLGLKPR  313


 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R+DWTR EI  IY++PLL+L++  A VHR   +  EVQ CTLL 
Sbjct  3     RNDWTREEITEIYNTPLLELIYRAATVHREHQDTAEVQVCTLLS  46



>ref|WP_020601818.1| biotin synthase [Spirosoma spitsbergense]
Length=335

 Score =   300 bits (768),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 189/233 (81%), Gaps = 1/233 (0%)
 Frame = -1

Query  974  TLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQAL  795
            T    AK+ GST FC+GAAWR+ +    +F+++LD V+ +  MG+EVCCTLGML +QQA 
Sbjct  84   TAAQRAKDTGSTRFCMGAAWRE-VRDNRDFDKVLDMVQGVNEMGLEVCCTLGMLTEQQAQ  142

Query  794  ELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADD  615
            +LK AGL AYNHNLDTS E+Y +II+TRTYDDRL+TL + R+AGISVCSGGIIG+GE D 
Sbjct  143  KLKDAGLYAYNHNLDTSEEFYGDIISTRTYDDRLDTLGHARKAGISVCSGGIIGMGETDT  202

Query  614  DRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVR  435
            DRIG+LHTLATLP HPESVP+NALV V+GTPLEDQ  V +W+MIRMIATARI+MP+AMVR
Sbjct  203  DRIGMLHTLATLPQHPESVPVNALVPVEGTPLEDQPRVSVWEMIRMIATARIIMPKAMVR  262

Query  434  LSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            LSAGRVR +  EQ LCFLAGANSIF G+KLLTTPN   D D  +F+ L + P+
Sbjct  263  LSAGRVRMNTEEQALCFLAGANSIFAGDKLLTTPNPSEDTDTQLFQTLNIRPR  315


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQKR  950
             R DWTR EI  IY+SP+LDL++  A VHR   + QEVQ CTLL  +
Sbjct  5     RTDWTRAEIADIYNSPVLDLVYRAATVHRQHHDPQEVQVCTLLSVK  50



>ref|XP_005713576.1| biotin synthetase [Chondrus crispus]
 emb|CDF33757.1| biotin synthetase [Chondrus crispus]
Length=401

 Score =   301 bits (772),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 157/242 (65%), Positives = 194/242 (80%), Gaps = 3/242 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWR--DTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELK  786
            AKE GST FC+GAAWR    +G +  F+++L  V ++RGMGMEVC TLG+L  +QA +LK
Sbjct  158  AKEGGSTRFCMGAAWRGVSQVGPR-QFDRVLQMVSEVRGMGMEVCATLGLLNTEQAKKLK  216

Query  785  KAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRI  606
            +AGLTAYNHNLDTS+EYYP +IT+R Y+DRL+TLE+VREAGISVC GGIIGLGE+ +DR+
Sbjct  217  EAGLTAYNHNLDTSKEYYPKVITSRVYEDRLKTLESVREAGISVCCGGIIGLGESHEDRV  276

Query  605  GllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
             LLHTLATL  HPESVP+NALVA +GTPLE+   V +WD+ RMIATARIVMP +MVRLSA
Sbjct  277  SLLHTLATLKEHPESVPVNALVANEGTPLEEADTVPVWDLCRMIATARIVMPRSMVRLSA  336

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEG  246
            GR+  S  EQ LCF+AGANSIFTG+KLLTTPN ++  D+ MF+ LGL  K P + E  E 
Sbjct  337  GRLGLSEAEQALCFMAGANSIFTGDKLLTTPNPEFSEDRAMFETLGLKGKQPFYYEKLEE  396

Query  245  EN  240
            ++
Sbjct  397  KH  398


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R+DWTR EI+ +Y+ PLLDL++HGA  HR   N +EVQ CTLL
Sbjct  74    RYDWTRDEIRRLYNHPLLDLVYHGATAHRIYFNPREVQQCTLL  116



>ref|WP_006341945.1| biotin synthase [Parachlamydia acanthamoebae]
 gb|EFB40786.1| hypothetical protein pah_c188o039 [Parachlamydia acanthamoebae 
str. Hall's coccus]
Length=333

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 197/246 (80%), Gaps = 2/246 (1%)
 Frame = -1

Query  962  SAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKK  783
            +AK AGST FC+GAAWR  +    +F ++L  V+++  +G+EVCC LGML ++QA +LK+
Sbjct  89   NAKNAGSTRFCMGAAWRQ-VRNSPDFERVLVMVREVSQLGLEVCCCLGMLTEEQAKKLKE  147

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGL +YNHN+D+  E+YP+IIT+RTY DRL TLENVR+A +SVC GGIIGLGE  +DRI 
Sbjct  148  AGLHSYNHNVDSGEEFYPSIITSRTYQDRLNTLENVRKADLSVCCGGIIGLGEKSEDRIS  207

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            +LHTLATLPTHP+SVPIN LV+VKGTPL++Q P+ +W+M+RM+ATAR++MP++MVRLSAG
Sbjct  208  MLHTLATLPTHPDSVPINMLVSVKGTPLQNQAPIPVWEMLRMVATARLIMPQSMVRLSAG  267

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPP-KFLEDSEG  246
            R+  S  EQ LCF+AGANSIFTG+KLLTTPN D+D DQ+M K LGL+ KP  K  E+   
Sbjct  268  RLSLSDAEQALCFMAGANSIFTGDKLLTTPNPDFDRDQIMLKTLGLVSKPAEKSAEEETC  327

Query  245  ENTEEA  228
            E T  A
Sbjct  328  ECTTHA  333


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W+R EI SIY SPLLDL+F  A VHR   + +E+Q CTLL 
Sbjct  6     RHNWSREEISSIYHSPLLDLIFEAASVHRKFHSSREIQLCTLLS  49



>ref|WP_013925054.1| biotin synthase [Parachlamydia acanthamoebae]
 ref|YP_004652387.1| biotin synthase [Parachlamydia acanthamoebae UV-7]
 emb|CCB86533.1| biotin synthase [Parachlamydia acanthamoebae UV-7]
Length=333

 Score =   298 bits (763),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 191/230 (83%), Gaps = 1/230 (0%)
 Frame = -1

Query  962  SAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKK  783
            +AK AGST FC+GAAWR  +    +F ++L  V+++  +G+EVCC LGML ++QA +LK+
Sbjct  89   NAKNAGSTRFCMGAAWRQ-VRNSPDFERVLVMVREVSQLGLEVCCCLGMLTEEQAKKLKE  147

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGL +YNHN+D+  E+YP+IIT+RTY DRL TLENVR+A +SVC GGIIGLGE  +DRI 
Sbjct  148  AGLHSYNHNVDSGEEFYPSIITSRTYQDRLNTLENVRKADLSVCCGGIIGLGEKSEDRIS  207

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            +LHTLATLPTHP+SVPIN LV+VKGTPL++Q P+ +W+M+RM+ATAR++MP++MVRLSAG
Sbjct  208  MLHTLATLPTHPDSVPINMLVSVKGTPLQNQAPIPVWEMLRMVATARLIMPQSMVRLSAG  267

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            R+  S  EQ LCF+AGANSIFTG+KLLTTPN D+D DQ+M K LGL+ KP
Sbjct  268  RLSLSDAEQALCFMAGANSIFTGDKLLTTPNPDFDRDQIMLKTLGLVSKP  317


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W+R EI SIY SPLLDL+F  A VHR     +E+Q CTLL 
Sbjct  6     RHNWSREEISSIYHSPLLDLIFEAASVHRKFHASREIQLCTLLS  49



>ref|WP_038104366.1| biotin synthase [Tolypothrix bouteillei]
Length=328

 Score =   298 bits (762),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 186/228 (82%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            A+ AGST FC+GAAWR+    + +F+++LD VK +  +GMEVCCTLGML + QA +L +A
Sbjct  90   ARAAGSTRFCMGAAWREVRDNR-DFDRVLDMVKGVNELGMEVCCTLGMLTEDQAKKLAEA  148

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS++YY  II+TRTYDDRL+TL+NVR+AG+SVC GGIIGLGE   DRI +
Sbjct  149  GLYAYNHNLDTSKDYYGEIISTRTYDDRLQTLDNVRKAGVSVCCGGIIGLGETHKDRINM  208

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVP+NALV +KGTPL++   V++WDM+RMIATARI+MP  MVRLSAGR
Sbjct  209  LHTLATLPEHPESVPVNALVRIKGTPLQNNSKVDVWDMVRMIATARILMPATMVRLSAGR  268

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
               S+ EQTLCF+AGANSIF G+KLLTTPN  +D D  MF +LGL P+
Sbjct  269  TEMSVAEQTLCFMAGANSIFAGDKLLTTPNPSFDEDMAMFDLLGLQPR  316


 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  1102  IREGPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             ++   R++WT  E++SIY++PLL+L++  A VHR   N  EVQ CTLL 
Sbjct  1     MKNAYRNNWTLEEVESIYNTPLLELMYRAATVHRQFNNTGEVQVCTLLS  49



>gb|KIA77733.1| Biotin synthase [Parachlamydia acanthamoebae]
Length=348

 Score =   298 bits (763),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/230 (64%), Positives = 191/230 (83%), Gaps = 1/230 (0%)
 Frame = -1

Query  962  SAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKK  783
            +AK AGST FC+GAAWR  +    +F ++L  V+++  +G+EVCC LGML ++QA +LK+
Sbjct  104  NAKNAGSTRFCMGAAWRQ-VRNSPDFERVLVMVREVSQLGLEVCCCLGMLTEEQAKKLKE  162

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGL +YNHN+D+  E+YP+IIT+RTY DRL TLENVR+A +SVC GGIIGLGE  +DRI 
Sbjct  163  AGLHSYNHNVDSGEEFYPSIITSRTYQDRLNTLENVRKADLSVCCGGIIGLGEKSEDRIS  222

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            +LHTLATLPTHP+SVPIN LV+VKGTPL++Q P+ +W+M+RM+ATAR++MP++MVRLSAG
Sbjct  223  MLHTLATLPTHPDSVPINMLVSVKGTPLQNQAPIPVWEMLRMVATARLIMPQSMVRLSAG  282

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            R+  S  EQ LCF+AGANSIFTG+KLLTTPN D+D DQ+M K LGL+ KP
Sbjct  283  RLSLSDAEQALCFMAGANSIFTGDKLLTTPNPDFDRDQIMLKTLGLVSKP  332


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W+R EI SIY SPLLDL+F  A VHR     +E+Q CTLL 
Sbjct  21    RHNWSREEISSIYHSPLLDLIFEAASVHRKFHASREIQLCTLLS  64



>ref|WP_039751343.1| biotin synthase [Hassallia byssoidea]
 gb|KIF30596.1| biotin synthase [Hassallia byssoidea VB512170]
Length=321

 Score =   296 bits (759),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 151/230 (66%), Positives = 189/230 (82%), Gaps = 1/230 (0%)
 Frame = -1

Query  965  SSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELK  786
              AKE+GST FC+GAAWR+ +    +F+++++ VK +  + MEVCCTLGML  +QA +LK
Sbjct  85   HEAKESGSTRFCMGAAWRE-VRDNRDFDKVIEMVKGVNALDMEVCCTLGMLTPEQAEKLK  143

Query  785  KAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRI  606
             AGL AYNHNLDTS E+Y +IITTR Y DRL+T+ENVR+A ISVC+GGIIG+GE + DRI
Sbjct  144  AAGLYAYNHNLDTSEEFYNDIITTRNYQDRLDTIENVRKAKISVCAGGIIGMGENEQDRI  203

Query  605  GllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            G+LHTLATLP HPESVP+NALV V+GTPLEDQ+ V +W+M+RMIATARI+MP+AMVRLSA
Sbjct  204  GMLHTLATLPEHPESVPVNALVPVEGTPLEDQEKVSVWEMVRMIATARIIMPKAMVRLSA  263

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            GRVR ++ EQ LCF+AGANSIF G+KLLTTPN     DQ MF++L L P+
Sbjct  264  GRVRMTLEEQALCFMAGANSIFAGDKLLTTPNPGVVQDQEMFQLLQLKPR  313



>dbj|GAA97873.1| hypothetical protein E5Q_04553 [Mixia osmundae IAM 14324]
Length=412

 Score =   300 bits (767),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 183/225 (81%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWRD  GRK+ FN+ILD V +IRGMGMEVC TLGML+K QA  LK+A
Sbjct  158  AKANGSTRFCMGAAWRDLHGRKSGFNRILDMVSEIRGMGMEVCTTLGMLDKDQARRLKEA  217

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYP +ITTR+YD+RL T+ENVREAGISVCSGGIIGLGE  +DR+GL
Sbjct  218  GLTAYNHNLDTSREYYPEVITTRSYDERLATIENVREAGISVCSGGIIGLGEKKEDRVGL  277

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++ LP  PES P+NALV ++GTPL   + V+I DM+R IATAR+V+P +++RL+AGR
Sbjct  278  IWEMSRLPEPPESFPVNALVPIEGTPLGGNEQVKIHDMLRTIATARLVLPTSIIRLAAGR  337

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
            + ++  EQ +CF+AGAN+IFTGE++LTTP + +D D  M +  G+
Sbjct  338  ITYTEAEQAMCFMAGANAIFTGERMLTTPTSGWDEDGAMLERWGM  382



>ref|XP_003889641.1| biotin synthase [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gb|EHS63496.1| biotin synthase [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
Length=402

 Score =   299 bits (765),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 190/251 (76%), Gaps = 5/251 (2%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWRD  GRK  F +IL+ VK++R MGMEVC TLGML  +QA++LK+A
Sbjct  136  AKANGSTRFCMGAAWRDMNGRKNGFKKILEMVKEVRAMGMEVCTTLGMLSPEQAVQLKEA  195

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYP +I+TR+YD+RL+T+ENVREAG+SVCSGGIIGLGE+D+DRI L
Sbjct  196  GLTAYNHNLDTSREYYPKVISTRSYDERLQTIENVREAGLSVCSGGIIGLGESDEDRIAL  255

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++ LP  PES P+NALV + GTPL D + V   +++R I+TARIV+P ++VR +AGR
Sbjct  256  ICQMSQLPAPPESFPVNALVPIPGTPLGDNERVSFHEILRTISTARIVLPTSIVRFAAGR  315

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
              FS  EQ +CF+AGAN+IFTGEK+LTTP + +D D  MF   G+ P     L     EN
Sbjct  316  NTFSEAEQAMCFMAGANAIFTGEKMLTTPTSGWDEDISMFSRWGITP-----LGSFASEN  370

Query  239  TEEALSSSG*D  207
             ++A S S  D
Sbjct  371  QDQAQSDSTAD  381



>gb|KEI37736.1| hypothetical protein L969DRAFT_89705 [Mixia osmundae IAM 14324]
Length=441

 Score =   300 bits (768),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 183/225 (81%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWRD  GRK+ FN+ILD V +IRGMGMEVC TLGML+K QA  LK+A
Sbjct  187  AKANGSTRFCMGAAWRDLHGRKSGFNRILDMVSEIRGMGMEVCTTLGMLDKDQARRLKEA  246

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYP +ITTR+YD+RL T+ENVREAGISVCSGGIIGLGE  +DR+GL
Sbjct  247  GLTAYNHNLDTSREYYPEVITTRSYDERLATIENVREAGISVCSGGIIGLGEKKEDRVGL  306

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++ LP  PES P+NALV ++GTPL   + V+I DM+R IATAR+V+P +++RL+AGR
Sbjct  307  IWEMSRLPEPPESFPVNALVPIEGTPLGGNEQVKIHDMLRTIATARLVLPTSIIRLAAGR  366

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
            + ++  EQ +CF+AGAN+IFTGE++LTTP + +D D  M +  G+
Sbjct  367  ITYTEAEQAMCFMAGANAIFTGERMLTTPTSGWDEDGAMLERWGM  411



>ref|WP_015249572.1| biotin synthase [Singulisphaera acidiphila]
 ref|YP_007206184.1| biotin synthetase [Singulisphaera acidiphila DSM 18658]
 gb|AGA30489.1| biotin synthetase [Singulisphaera acidiphila DSM 18658]
Length=327

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 152/235 (65%), Positives = 190/235 (81%), Gaps = 1/235 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+ G+T FCIGAAWR+ +     F+Q+L+ V+ I+ + ME CCTLGML + QA  LK+A
Sbjct  89   AKDEGATRFCIGAAWRE-VRDNAQFDQVLEMVRGIKTLEMEACCTLGMLSEDQARRLKEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLD+S+E+Y  II+TRTY+DRL+TL +VREAGISVC GGI+G+GE +DDRIGL
Sbjct  148  GLDAYNHNLDSSQEFYDRIISTRTYEDRLQTLGHVREAGISVCCGGIVGMGETEDDRIGL  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP  PESVP+NALVAV+GTPL D+  V+IW+M+R IATARI+MPE+MVRLSAGR
Sbjct  208  LHTLATLPEPPESVPVNALVAVEGTPLADRPRVDIWEMVRTIATARILMPESMVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLED  255
            V  S  +Q LCFLAGANSIF G+KLLTTPN   D D+++F+ LGL P+P +   D
Sbjct  268  VDMSETDQALCFLAGANSIFAGDKLLTTPNPKVDRDRILFERLGLTPRPLEVTAD  322



>ref|XP_002479458.1| biotin synthase, putative [Talaromyces stipitatus ATCC 10500]
 gb|EED19024.1| biotin synthase, putative [Talaromyces stipitatus ATCC 10500]
Length=395

 Score =   298 bits (762),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 154/245 (63%), Positives = 191/245 (78%), Gaps = 2/245 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRKT+   I + V  +R MGMEVC TLGM++ +QA ELK A
Sbjct  140  AKENGSTRFCMGAAWRDMRGRKTSLKNIKEMVTGVRSMGMEVCVTLGMIDSEQAKELKDA  199

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYP+IIT+R+YD+RL+TL NVR+AGI+VCSGGI+GLGEAD DRIGL
Sbjct  200  GLTAYNHNLDTSREYYPSIITSRSYDERLQTLSNVRDAGINVCSGGILGLGEADSDRIGL  259

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHT+ATLP+HPES P+NALV +KGTPL D+K +    ++R IATARIV+P  +VRL+AGR
Sbjct  260  LHTVATLPSHPESFPVNALVPIKGTPLGDRKMISFDKLLRTIATARIVLPATIVRLAAGR  319

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            +  S  +Q  CF+AGAN++FTGEK+LTT  N +D D  MF+  G  P   K  ED  G+N
Sbjct  320  INLSEEQQVSCFMAGANAVFTGEKMLTTDCNGWDQDHEMFQRWGFYPM--KSFEDKGGKN  377

Query  239  TEEAL  225
             + A+
Sbjct  378  EKSAM  382



>ref|WP_018126511.1| hypothetical protein [Balneola vulgaris]
Length=330

 Score =   295 bits (756),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 189/230 (82%), Gaps = 3/230 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKT-NFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKK  783
            AK+AGST FC+GAAWR    RKT +F+++LD V  +  +G+EVC TLGML  +QA +LK+
Sbjct  89   AKDAGSTRFCMGAAWRS--ARKTKDFDEVLDVVSSVADLGLEVCATLGMLNDEQAAKLKE  146

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGL AYNHNLD+S ++Y  IITTRTY+DRL+T++ V++  ISVCSGGIIG+GE+ +DRIG
Sbjct  147  AGLYAYNHNLDSSEDFYKKIITTRTYEDRLDTIKKVQDNNISVCSGGIIGMGESHEDRIG  206

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            LL+TL+ L THPESVP+NAL+AV+GTP+E+Q  V  WDM RMIATARI+MP++MVRLSAG
Sbjct  207  LLYTLSNLETHPESVPVNALIAVEGTPMENQPKVPSWDMARMIATARILMPKSMVRLSAG  266

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            RVR +  EQ LCF+AGANSIFTGEKLLTT NN+ D D  MF++ GL P+P
Sbjct  267  RVRMNFEEQALCFMAGANSIFTGEKLLTTNNNELDEDMHMFELFGLTPRP  316


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R+DWT+ EI  IY++PL++L++  A +HR      EVQ CTLL 
Sbjct  5     RNDWTKEEISEIYNTPLMELIYRAATIHREYHKTGEVQVCTLLS  48



>ref|XP_002291078.1| biotin synthase, BioB [Thalassiosira pseudonana CCMP1335]
 gb|EED91185.1| biotin synthase, BioB, partial [Thalassiosira pseudonana CCMP1335]
Length=330

 Score =   295 bits (754),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 185/237 (78%), Gaps = 11/237 (5%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+GAAWR+   +K  FN ILD VK + GMG+EVCCTLGML  +QA +LK+A
Sbjct  93   AKDAGSTRFCMGAAWRELGNKKNAFNHILDMVKGVNGMGLEVCCTLGMLNAEQARQLKEA  152

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTS E+YPN+ITTRTY+DRLET+ NVREAGISVC GGI+GLGE + DR+GL
Sbjct  153  GLTAYNHNLDTSPEHYPNVITTRTYEDRLETIANVREAGISVCCGGILGLGEKEADRVGL  212

Query  599  lhtlatlpthPESVPINALVAVKGTPL------EDQKP-----VEIWDMIRMIATARIVM  453
            LH LATLP HPESVPINALVAV+GTPL      ED K      V+ +DM RMIATARIVM
Sbjct  213  LHVLATLPEHPESVPINALVAVEGTPLGNAAADEDSKADGIADVDAFDMARMIATARIVM  272

Query  452  PEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLI  282
            P  MVRLSAGR+ FS  EQ L F AGANSIF G+KLLTT N ++D D  +F  LG +
Sbjct  273  PRTMVRLSAGRLSFSDAEQFLMFQAGANSIFNGDKLLTTDNPEFDQDMALFDKLGFV  329



>ref|WP_018611323.1| hypothetical protein [Segetibacter koreensis]
Length=336

 Score =   295 bits (754),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 146/228 (64%), Positives = 185/228 (81%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AG++  C+GAAWR+ +    +F+++L+ VK +  M MEVCCTLGML  +QA +LK A
Sbjct  86   AKDAGASRLCMGAAWRE-VRNNRDFDRVLEMVKVVNAMDMEVCCTLGMLTYEQAQKLKDA  144

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS E Y NIITTRTY DRL+TL+NVR+A ++VCSGGIIGLGE ++ RIG+
Sbjct  145  GLFAYNHNLDTSEENYKNIITTRTYADRLQTLDNVRKAKLTVCSGGIIGLGETEEHRIGM  204

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L+ LA LP  PESVPINALVAV+GTPLEDQ+ V +W+M+RMIAT RI+MP+ +VRLSAGR
Sbjct  205  LYVLANLPQQPESVPINALVAVEGTPLEDQQRVSVWEMVRMIATTRIIMPKTVVRLSAGR  264

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            +  S+PEQ LCF+AGANSIF G+KLLTTPN   + D  MF++LGL P+
Sbjct  265  LEMSLPEQALCFMAGANSIFAGDKLLTTPNPSLNEDMKMFEILGLKPR  312



>ref|WP_037327009.1| biotin synthase [Sediminibacterium sp. OR43]
Length=334

 Score =   295 bits (754),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 150/228 (66%), Positives = 185/228 (81%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+GAAWR+ +    +F+++L+ VK +  MGMEVCCTLGML ++QA +L  A
Sbjct  92   AKDAGSTRFCMGAAWRE-VRDNRDFDRVLEMVKGVNEMGMEVCCTLGMLTEEQAKKLADA  150

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS+E+Y  IITTRTY+DRLETL++VR+AG++VC GGIIGLGE  +DRI +
Sbjct  151  GLYAYNHNLDTSKEHYGEIITTRTYEDRLETLDHVRKAGVTVCCGGIIGLGETHEDRINM  210

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVPINALV + GTPLE    V++WDM+RMIATARI+MP  MVRLSAGR
Sbjct  211  LHTLATLPEHPESVPINALVPIAGTPLEHNHKVDVWDMVRMIATARILMPATMVRLSAGR  270

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
               S  EQ LCF+AGANSIF G+KLLTTPN  ++ D +MF +LGL P+
Sbjct  271  TDMSTAEQALCFMAGANSIFAGDKLLTTPNPSFEEDNVMFSLLGLKPR  318


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R +WT  E+KSIYD+PLL+L+F+ A +HR   +  EVQ CTLL 
Sbjct  8     RTNWTLEEVKSIYDTPLLELVFNAATLHRKYNDTAEVQVCTLLS  51



>dbj|GAM40110.1| Bio2 homolog [Talaromyces cellulolyticus]
Length=379

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/247 (62%), Positives = 190/247 (77%), Gaps = 0/247 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRKT+   I + V  +R MGMEVC TLGM++ +QA ELK A
Sbjct  124  AKENGSTRFCMGAAWRDMRGRKTSLKNIKEMVTGVRSMGMEVCVTLGMIDTEQAKELKDA  183

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYP+IIT+R+YD+RL+TL NVR+AGI+VCSGGI+GLGEAD DRIGL
Sbjct  184  GLTAYNHNLDTSREYYPSIITSRSYDERLQTLSNVRDAGINVCSGGILGLGEADSDRIGL  243

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHT+ATLP+HPES P+NALV +KGTPL D+K +    ++R IATARIV+P  +VRL+AGR
Sbjct  244  LHTVATLPSHPESFPVNALVPIKGTPLGDRKMISFDKLLRTIATARIVLPATIVRLAAGR  303

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            V  S  +Q  CF+AGAN++FTGEK+LTT  N +D D  MF+  G  P      E+ +GE 
Sbjct  304  VNLSEEQQVTCFMAGANAVFTGEKMLTTDCNGWDQDHEMFRKWGFYPMKSFENEEVKGEK  363

Query  239  TEEALSS  219
            +   + S
Sbjct  364  SAVVIES  370



>ref|WP_037361450.1| biotin synthase [Sediminibacterium sp. OR53]
Length=334

 Score =   293 bits (751),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 185/228 (81%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+GAAWR+    + +F+++L+ VK +  MGMEVCCTLGML ++QA +L  A
Sbjct  92   AKDAGSTRFCMGAAWREVRDNR-DFDRVLEMVKGVNEMGMEVCCTLGMLTEEQAKKLADA  150

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS+E+Y  IITTRTY+DRLETL++VR+AG++VC GGIIGLGE  +DRI +
Sbjct  151  GLYAYNHNLDTSKEHYGEIITTRTYEDRLETLDHVRKAGVTVCCGGIIGLGETHEDRINM  210

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHTLATLP HPESVPINALV + GTPLE    V++WDM+RMI+TARI+MP  MVRLSAGR
Sbjct  211  LHTLATLPEHPESVPINALVPIAGTPLEHNHKVDVWDMVRMISTARILMPATMVRLSAGR  270

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
               S  EQ LCF+AGANSIF G+KLLTTPN  ++ D +MF +LGL P+
Sbjct  271  TDMSTAEQALCFMAGANSIFAGDKLLTTPNPSFEEDNVMFSLLGLKPR  318


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R +WT  E+KSIYD+PLL+L+F+ A +HR   +  EVQ CTLL 
Sbjct  8     RTNWTLEEVKSIYDTPLLELVFNAATLHRKYNDTAEVQVCTLLS  51



>ref|WP_013453234.1| biotin synthase [Marivirga tractuosa]
 ref|YP_004053191.1| biotin synthase [Marivirga tractuosa DSM 4126]
 gb|ADR21083.1| biotin synthase [Marivirga tractuosa DSM 4126]
Length=334

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 154/240 (64%), Positives = 189/240 (79%), Gaps = 3/240 (1%)
 Frame = -1

Query  989  LPRGTTLHSS--AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGM  816
            LP    L S+  AKE GST FC+GAAWR+ +    +F+++LD VK I  + MEVCCTLGM
Sbjct  77   LPTEQVLESARIAKENGSTRFCMGAAWRE-VRDNRDFDRVLDMVKGINELDMEVCCTLGM  135

Query  815  LEKQQALELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGII  636
            L + QA +LK+AGL AYNHNLDTS E+Y +II+TRTYDDRL+T+ NVR+A ISVCSGGII
Sbjct  136  LTESQAQKLKEAGLYAYNHNLDTSEEHYDDIISTRTYDDRLDTIGNVRKAKISVCSGGII  195

Query  635  GLGEADDDRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIV  456
            GLGE  +DR+G+LHTLAT+  HPESVP+NALV V GTPLE Q  V +W+M+RMIATARI 
Sbjct  196  GLGEQHEDRVGMLHTLATMEEHPESVPVNALVPVPGTPLEKQPKVSVWEMVRMIATARIT  255

Query  455  MPEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            MP+AMVRLSAGRVR +  EQ LCF+AGANSIF G+KLLTTPN + + D  +F+ L L P+
Sbjct  256  MPKAMVRLSAGRVRMNQEEQALCFMAGANSIFAGDKLLTTPNPEVNEDAELFQTLNLKPR  315


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R+DWT+ EI+ IY+ P+L+L++  A VHR   +  EVQ CTLL
Sbjct  5     RNDWTKEEIEKIYNQPILELIYQAATVHREFNDPSEVQVCTLL  47



>gb|EJU00998.1| biotin synthase [Dacryopinax sp. DJM-731 SS1]
Length=369

 Score =   294 bits (753),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWRD  GRK+ F +IL  V ++RGMGMEVC TLGML+  QA +LK+A
Sbjct  109  AKANGSTRFCMGAAWRDLAGRKSGFKKILAMVSEVRGMGMEVCTTLGMLDADQARQLKEA  168

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP++ITTR+YD+RLETL+NVREAGI+VCSGGI+GLGE ++DR+GL
Sbjct  169  GLTAYNHNLDTSREFYPSVITTRSYDERLETLKNVREAGINVCSGGILGLGEKEEDRVGL  228

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  +A LP HPES P+NALV + GTPLE+  P    +++R IATARIV+P  ++RL+AGR
Sbjct  229  ITEVANLPEHPESFPVNALVPIPGTPLENNTPTTAPEILRTIATARIVLPRTIIRLAAGR  288

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
              FS  EQ +CF+AGAN++FTGEK+LTTP + +D D+ MF   GL
Sbjct  289  QTFSETEQAMCFMAGANAVFTGEKMLTTPCSGWDEDKAMFDRWGL  333


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RHDWTR E++ +YD+PLL+L++  A VHR   +  +VQ CTL+ 
Sbjct  25    RHDWTRQEVQKVYDTPLLELVYKAATVHRMWHDPSKVQLCTLMN  68



>gb|EUC67119.1| biotin synthase [Rhizoctonia solani AG-3 Rhs1AP]
Length=381

 Score =   294 bits (752),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRK+ FN+IL+ V +IRGMGMEVC TLGML  +QA +LK+A
Sbjct  125  AKENGSTRFCMGAAWRDLQGRKSGFNRILEMVAEIRGMGMEVCTTLGMLTPEQARQLKEA  184

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP +ITTR+YDDRL T+E V++AGI+VCSGGI+GLGE D+DR+GL
Sbjct  185  GLTAYNHNLDTSREFYPKVITTRSYDDRLATIEAVQDAGINVCSGGILGLGETDEDRVGL  244

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  +AT+ +HPES P+NALV + GTPLE    +    ++R IATAR+ MP  ++RLSAGR
Sbjct  245  IWEVATMRSHPESFPVNALVPIAGTPLESNPLIPHQTILRTIATARVAMPSTIIRLSAGR  304

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
             +FS  EQ +CF+AGAN++FTGEK+LTTP + +D D+ MF   GL
Sbjct  305  HKFSEAEQAMCFMAGANAVFTGEKMLTTPCSSWDEDKDMFSRWGL  349


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH WT+ EI  IY  PLLDL+F  A VHR   +  ++Q CTL+ 
Sbjct  41    RHSWTKGEISEIYHGPLLDLVFQAAAVHRKHFDPSKIQMCTLMN  84



>ref|XP_007265898.1| biotin synthase [Fomitiporia mediterranea MF3/22]
 gb|EJD04297.1| biotin synthase [Fomitiporia mediterranea MF3/22]
Length=388

 Score =   294 bits (752),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/225 (61%), Positives = 183/225 (81%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWRD  GRK+ F +IL+ V+++RGMGMEVC TLGML   QA++LK+A
Sbjct  125  AKANGSTRFCMGAAWRDLAGRKSGFKRILEMVREVRGMGMEVCTTLGMLSADQAMQLKEA  184

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP++ITTRTYD+RLET+ NVR+AGISVCSGGI+GLGE+ +DR+GL
Sbjct  185  GLTAYNHNLDTSREFYPSVITTRTYDERLETIANVRDAGISVCSGGILGLGESKEDRVGL  244

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  +A +P HPES P+NALV + GTP+E  +P+ + ++IR IATARIV+P  ++RL+AGR
Sbjct  245  IWEVANMPEHPESFPVNALVPIPGTPMEKNEPISVHNLIRTIATARIVLPSTIIRLAAGR  304

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
               S  EQ +CF++GAN++FTGE++LTTP + +D D+ M    GL
Sbjct  305  QTLSESEQAMCFMSGANAVFTGERMLTTPCSPWDEDKAMMSRWGL  349


 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RHDWTR EI+ IY +PLLDL+F  A VHR   + ++VQ CTL+ 
Sbjct  41    RHDWTRQEIQEIYGTPLLDLVFRSASVHRQYHDPKKVQLCTLMN  84



>gb|KEP55586.1| biotin synthase [Rhizoctonia solani 123E]
Length=381

 Score =   293 bits (751),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRK+ FN+IL+ V +IRGMGMEVC TLGML  +QA +LK+A
Sbjct  125  AKENGSTRFCMGAAWRDLQGRKSGFNRILEMVAEIRGMGMEVCTTLGMLTPEQARQLKEA  184

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP +ITTR+YDDRL T+E V++AGI+VCSGGI+GLGE D+DR+GL
Sbjct  185  GLTAYNHNLDTSREFYPKVITTRSYDDRLATIEAVQDAGINVCSGGILGLGETDEDRVGL  244

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  +AT+ +HPES P+NALV + GTPLE    +    ++R IATAR+ MP  ++RLSAGR
Sbjct  245  IWEVATMRSHPESFPVNALVPIAGTPLESNPLIPHQTILRTIATARVAMPSTIIRLSAGR  304

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
             +FS  EQ +CF+AGAN++FTGEK+LTTP + +D D+ MF   GL
Sbjct  305  HKFSEAEQAMCFMAGANAVFTGEKMLTTPCSSWDEDKDMFSRWGL  349


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH WT+ EI  IY  PLLDL+F  A VHR   +  ++Q CTL+ 
Sbjct  41    RHSWTKGEISEIYHGPLLDLVFQAAAVHRKHFDPSKIQMCTLMN  84



>gb|EJK70128.1| hypothetical protein THAOC_08542 [Thalassiosira oceanica]
Length=446

 Score =   295 bits (756),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/240 (66%), Positives = 185/240 (77%), Gaps = 11/240 (5%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+GAAWR+   +K  FN IL+ V+ + GMG+EVCCTLGML  +QA +LK A
Sbjct  178  AKDAGSTRFCMGAAWRELGNKKNAFNHILNMVRGVNGMGLEVCCTLGMLNAEQARQLKDA  237

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTS E+YPN+ITTRTY+DRLET+ NVREAGISVC GGI+GLGE + DR+GL
Sbjct  238  GLTAYNHNLDTSPEHYPNVITTRTYEDRLETIANVREAGISVCCGGILGLGEKETDRVGL  297

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKP-----------VEIWDMIRMIATARIVM  453
            LH LATLP HPESVPINALVAV+GTPL D              V+ +DM RMIATARIVM
Sbjct  298  LHVLATLPEHPESVPINALVAVEGTPLGDADADEGVDSDGIANVDSFDMARMIATARIVM  357

Query  452  PEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            P  MVRLSAGR+ FS  EQ L F AGANSIF G+KLLTT N  +D+D  +F+ LG + KP
Sbjct  358  PRTMVRLSAGRLSFSDAEQYLMFQAGANSIFNGDKLLTTDNPAFDSDTALFQKLGFVGKP  417



>ref|WP_016194428.1| Biotin synthase [Arcticibacter svalbardensis]
 gb|EOR95671.1| Biotin synthase [Arcticibacter svalbardensis MN12-7]
Length=336

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/243 (60%), Positives = 191/243 (79%), Gaps = 3/243 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE G++  C+GAAWR+ +    +F+++++ VK +  + MEVC TLGML + QA +L  A
Sbjct  89   AKEGGASRLCMGAAWRE-VRDNRDFDRVIEMVKAVNELDMEVCATLGMLTESQAQKLADA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHN+DTS + Y  IITTRT+DDRL+T++NVR+A I+VCSGGIIGLGE D+DRI +
Sbjct  148  GLYAYNHNIDTSEDDYKRIITTRTFDDRLKTIDNVRKAKITVCSGGIIGLGETDNDRISM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L TL+ +  HPESVPINALVA+KGTPLEDQKPV IWDM+RMIATARI+MP+++VRLSAGR
Sbjct  208  LQTLSNMAKHPESVPINALVAIKGTPLEDQKPVPIWDMVRMIATARIIMPKSVVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
               SM +Q LCF+AGANSIF G+KLLTTPN +++ D  MF++LGL  KP +  +     N
Sbjct  268  NEMSMTDQALCFMAGANSIFAGDKLLTTPNPEFNEDMKMFEILGL--KPREAFKKGRPAN  325

Query  239  TEE  231
            TE+
Sbjct  326  TEQ  328



>gb|KDO30987.1| hypothetical protein SPRG_04175 [Saprolegnia parasitica CBS 223.65]
Length=368

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 185/230 (80%), Gaps = 3/230 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK AGST FC+G+AWR+ +G+K  F  +L  V+++ GMGMEVCCTLGM+ ++QA++LK+A
Sbjct  113  AKAAGSTRFCMGSAWRE-VGKKNAFKDVLTMVREVNGMGMEVCCTLGMITEEQAVQLKEA  171

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTSRE+YPN+ITTRTYDDRL T+ NVR+AGISVC GGI+G+GE DDDR+GL
Sbjct  172  GLAAYNHNLDTSREHYPNVITTRTYDDRLNTIANVRKAGISVCCGGILGIGEKDDDRVGL  231

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQ--KPVEIWDMIRMIATARIVMPEAMVRLSA  426
            LHTLAT+  HPESVP+NALV+V+GTPL D   K V  +DM R IATARI+MP+ MVRLSA
Sbjct  232  LHTLATMEEHPESVPVNALVSVQGTPLADANLKAVTAFDMARAIATARILMPKTMVRLSA  291

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            GR+ FS  EQ   F+AGANSIF G+ LLTT N  ++ D  +F  LGL+ K
Sbjct  292  GRMSFSDAEQGFLFMAGANSIFNGDTLLTTSNPAFEKDNQLFTDLGLVGK  341


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R DW+  E+K IY+ PLL+L++  A VHR   + +EVQ CTLL 
Sbjct  29    RTDWSYDEVKEIYNKPLLELIYQAATVHRIHFDPREVQQCTLLS  72



>ref|WP_015694036.1| biotin synthase [Saprospira grandis]
 ref|YP_005324031.1| biotin synthase [Saprospira grandis str. Lewin]
 gb|AFC26447.1| biotin synthase [Saprospira grandis str. Lewin]
Length=330

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/233 (65%), Positives = 181/233 (78%), Gaps = 1/233 (0%)
 Frame = -1

Query  974  TLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQAL  795
            T  S AK  G+T FC+GAAWR     K  F+++L  V+ +  +GMEVCCTLGML ++QA 
Sbjct  83   TKASIAKSNGATRFCMGAAWRHVKNNK-QFDRVLQMVQGVNSLGMEVCCTLGMLTEEQAQ  141

Query  794  ELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADD  615
             LK+AGL AYNHNLDTS E Y NIITTR Y DRL+T++NVR  GISVCSGGIIGLGE D 
Sbjct  142  RLKEAGLYAYNHNLDTSEENYENIITTREYQDRLDTIDNVRNTGISVCSGGIIGLGETDQ  201

Query  614  DRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVR  435
            DRI +LHTLA +P HPESVP+NALV V GTPLEDQK + +W+M+RMIATARI+MP + VR
Sbjct  202  DRIAMLHTLANMPKHPESVPVNALVRVPGTPLEDQKRITLWEMLRMIATARIIMPLSQVR  261

Query  434  LSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            LSAGR   S+ EQ  CF+AGA+SIF GEKLLTTPN D D D+ MF++LGL P+
Sbjct  262  LSAGREEMSIEEQAFCFMAGASSIFAGEKLLTTPNPDVDQDRQMFQLLGLQPR  314


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R+DWT  EI+ IY+ P+LDL++  A VHR     +EVQ CTLL
Sbjct  4     RNDWTTAEIEEIYNRPILDLVYEAATVHRKYHEAREVQVCTLL  46



>ref|XP_001731769.1| hypothetical protein MGL_1037 [Malassezia globosa CBS 7966]
 gb|EDP44555.1| hypothetical protein MGL_1037 [Malassezia globosa CBS 7966]
Length=401

 Score =   293 bits (751),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/227 (62%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWR+  GRK  FN+ILD V++IRGMGMEVC TLGML  +QA +LK+A
Sbjct  114  AKANGSTRFCMGAAWREIGGRKRGFNRILDMVREIRGMGMEVCTTLGMLTAEQAQQLKEA  173

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL+AYNHNLDTSREYY  +IT+RTYDDRL+T+ +VR+AGISVCSGGI+GLGE + DR+GL
Sbjct  174  GLSAYNHNLDTSREYYGKVITSRTYDDRLQTIAHVRDAGISVCSGGILGLGEDESDRVGL  233

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++ LP  PES P+NALVA+ GTP+E Q PV+  +M+R +ATARIV+P ++VR++AGR
Sbjct  234  IWEMSRLPEAPESFPVNALVAIPGTPMEGQPPVQFQEMLRTVATARIVLPTSIVRIAAGR  293

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP  279
              F+  EQ + FLAGAN+IFTG ++LTTP + +D D+ M +  GL P
Sbjct  294  QMFTESEQAMLFLAGANAIFTGHRMLTTPTSSWDQDRAMLERWGLSP  340



>ref|XP_008605759.1| biotin synthetase [Saprolegnia diclina VS20]
 gb|EQC40915.1| biotin synthetase [Saprolegnia diclina VS20]
Length=369

 Score =   292 bits (748),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/230 (65%), Positives = 185/230 (80%), Gaps = 3/230 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK AGST FC+G+AWR+ +G+K  F  +L  V+++ GMGMEVCCTLGM+ ++QA++LK+A
Sbjct  113  AKAAGSTRFCMGSAWRE-VGKKNAFKDVLTMVREVNGMGMEVCCTLGMITEEQAVQLKEA  171

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTSRE+YPN+ITTRTYDDRL T+ NVR+AGISVC GGI+G+GE DDDR+GL
Sbjct  172  GLAAYNHNLDTSREHYPNVITTRTYDDRLNTIANVRKAGISVCCGGILGIGEKDDDRVGL  231

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQ--KPVEIWDMIRMIATARIVMPEAMVRLSA  426
            LHTLAT+  HPESVP+NALV+V+GTPL D   K V  +DM R IATARI+MP+ MVRLSA
Sbjct  232  LHTLATMEEHPESVPVNALVSVQGTPLADANLKAVTAFDMARAIATARILMPKTMVRLSA  291

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            GR+ FS  EQ   F+AGANSIF G+ LLTT N  ++ D  +F  LGL+ K
Sbjct  292  GRMSFSDAEQGFLFMAGANSIFNGDTLLTTANPAFEKDNQLFTDLGLVGK  341


 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R DW+  E+K IY+ PLL+L++  A VHR   + +EVQ CTLL 
Sbjct  29    RTDWSYDEVKEIYNKPLLELIYQAATVHRIHFDPREVQQCTLLS  72



>ref|XP_009829629.1| biotin synthase [Aphanomyces astaci]
 gb|ETV80682.1| biotin synthase [Aphanomyces astaci]
Length=378

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 186/231 (81%), Gaps = 3/231 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+G+AWR+ +G+K  FN +L  V+++  MGMEVCCTLGML ++QA++LK+A
Sbjct  118  AKKAGSTRFCMGSAWRE-VGKKNAFNDVLTMVREVNSMGMEVCCTLGMLTEEQAVQLKEA  176

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTSRE+YPN+I+TRTYDDRL T+ NVR+AGISVC GGI+G+GE + DR+ L
Sbjct  177  GLAAYNHNLDTSREHYPNVISTRTYDDRLNTIANVRKAGISVCCGGILGIGEKEHDRVAL  236

Query  599  lhtlatlpthPESVPINALVAVKGTPL--EDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            LHTLAT+  HPESVP+NALV+V GTPL  ED  PV  +DM R IATARI+MP+ MVRLSA
Sbjct  237  LHTLATMEEHPESVPVNALVSVVGTPLASEDLPPVTAFDMARTIATARILMPKTMVRLSA  296

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            GR+ FS  EQ L F+AGANSIF G+ LLTT N  ++ D  +F  LGL+ KP
Sbjct  297  GRMSFSDAEQGLLFMAGANSIFNGDTLLTTANPAFEKDNALFTDLGLVGKP  347


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R DW+R E+K IY+ PLL+L++  A VHR   + +EVQ CTLL 
Sbjct  34    RTDWSREEVKRIYEQPLLELVYQAATVHRIHFDPREVQQCTLLS  77



>ref|XP_008873321.1| biotin synthase [Aphanomyces invadans]
 gb|ETV97760.1| biotin synthase [Aphanomyces invadans]
Length=378

 Score =   293 bits (749),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 186/231 (81%), Gaps = 3/231 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+AGST FC+G+AWR+ +G+K  FN +L  V+++  MGMEVCCTLGML ++QA++LK+A
Sbjct  119  AKKAGSTRFCMGSAWRE-VGKKNAFNDVLTMVREVNNMGMEVCCTLGMLTEEQAVQLKEA  177

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTSRE+YPN+I+TRTYDDRL T+ NVR+AGISVC GGI+G+GE + DRI L
Sbjct  178  GLAAYNHNLDTSREHYPNVISTRTYDDRLNTIANVRKAGISVCCGGILGIGEKEHDRIAL  237

Query  599  lhtlatlpthPESVPINALVAVKGTPL--EDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            LHTLAT+  HPESVP+NALV+V GTPL  E+  PV  +DM R IATARI+MP+ MVRLSA
Sbjct  238  LHTLATMEEHPESVPVNALVSVAGTPLASEELPPVTAFDMARAIATARILMPKTMVRLSA  297

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            GR+ FS  EQ L F+AGANSIF G+ LLTT N  ++ D  +F  LGL+ KP
Sbjct  298  GRMSFSDAEQGLLFMAGANSIFNGDTLLTTANPAFEKDNALFADLGLVGKP  348


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             R DWTR E+K IY+ PLL+L++  A VHR   + +EVQ CTLL 
Sbjct  35    RTDWTRDEVKRIYEQPLLELVYQAATVHRIHFDPREVQQCTLLS  78



>ref|WP_002660339.1| biotin synthase [Saprospira grandis]
 gb|EJF54598.1| biotin synthetase [Saprospira grandis DSM 2844]
Length=330

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 149/233 (64%), Positives = 180/233 (77%), Gaps = 1/233 (0%)
 Frame = -1

Query  974  TLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQAL  795
            T  S AK  G+T FC+GAAWR     K  F+++L  V+ +  +GMEVCCTLGML ++QA 
Sbjct  83   TKASIAKSNGATRFCMGAAWRHVKNNK-QFDRVLQMVQGVNSLGMEVCCTLGMLTEEQAQ  141

Query  794  ELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADD  615
             LK+AGL AYNHNLDTS E Y NIITTR Y DR++T++NVR  GISVCSGGIIGLGE D 
Sbjct  142  RLKEAGLYAYNHNLDTSEENYENIITTRDYQDRIDTIDNVRNTGISVCSGGIIGLGETDQ  201

Query  614  DRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVR  435
            DRI +LHTLA +  HPESVP+NALV V GTPLEDQK + +W+M+RMIATARI+MP + VR
Sbjct  202  DRIAMLHTLANMAKHPESVPVNALVRVPGTPLEDQKRITLWEMLRMIATARIIMPLSQVR  261

Query  434  LSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            LSAGR   S+ EQ  CF+AGA+SIF GEKLLTTPN D D D+ MF++LGL P+
Sbjct  262  LSAGREEMSIEEQAFCFMAGASSIFAGEKLLTTPNPDVDQDRQMFQLLGLHPR  314


 Score = 52.4 bits (124),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             R+DWT  EI+ IY+ P+LDL++  A VHR     +EVQ CTLL
Sbjct  4     RNDWTTAEIEEIYNRPILDLVYEAATVHRKYHEAREVQVCTLL  46



>ref|XP_001558101.1| hypothetical protein BC1G_03133 [Botrytis cinerea B05.10]
Length=276

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+ GST FC+GAAWRD  GRKTN   +   V +IRGMGMEVC TLGM++ +QA ELK+A
Sbjct  14   AKDNGSTRFCMGAAWRDMRGRKTNLKNVKTMVSEIRGMGMEVCVTLGMIDAEQAQELKEA  73

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHN+DTSR++YP +ITTR+YD+RL T++NVR+AGI+VC+GGI+GLGE   D IGL
Sbjct  74   GLTAYNHNVDTSRDFYPKVITTRSYDERLNTIKNVRDAGINVCTGGILGLGENKSDHIGL  133

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L T+ATLP+HPES P+N LVA+KGTPLE  K VE  +M+RM+ATARIVMP+ +VRL+AGR
Sbjct  134  LETVATLPSHPESFPVNMLVAIKGTPLEGNKKVEFENMLRMVATARIVMPKTIVRLAAGR  193

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP  279
               S  +Q LCF+AGAN++FTGEK+LTTP   +  D ++F   GL P
Sbjct  194  GELSEEQQVLCFMAGANAVFTGEKMLTTPAVGWGVDSVVFNRWGLRP  240



>gb|ELU44645.1| biotin synthase [Rhizoctonia solani AG-1 IA]
Length=382

 Score =   292 bits (748),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 182/225 (81%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRK+ FN+IL+ V++IRGMGMEVC TLGML  +QA +LK+A
Sbjct  125  AKENGSTRFCMGAAWRDLQGRKSGFNRILEMVREIRGMGMEVCTTLGMLSPEQARQLKEA  184

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP +ITTR+YD+RL T+E V++AGI+VCSGGI+GLGE D+DR+GL
Sbjct  185  GLTAYNHNLDTSREFYPKVITTRSYDERLATIEAVQDAGINVCSGGILGLGETDEDRVGL  244

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  +A +  HPES P+NALV ++GTPLE+   +    ++R IATARI +P  ++RLSAGR
Sbjct  245  IWEVANMRAHPESFPVNALVPIQGTPLENNPIIPHQTILRTIATARIALPSTIIRLSAGR  304

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
             +FS  EQ +CF+AGAN++FTGEK+LTTP + +D D+ MF   GL
Sbjct  305  HKFSEAEQMMCFMAGANAVFTGEKMLTTPCSSWDEDKEMFSRWGL  349



>ref|XP_002143161.1| biotin synthase, putative [Talaromyces marneffei ATCC 18224]
 gb|EEA26646.1| biotin synthase, putative [Talaromyces marneffei ATCC 18224]
 gb|KFX52563.1| Biotin synthase, mitochondrial [Talaromyces marneffei PM1]
 gb|KFX52564.1| Biotin synthase, mitochondrial [Talaromyces marneffei PM1]
Length=397

 Score =   293 bits (749),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 191/246 (78%), Gaps = 2/246 (1%)
 Frame = -1

Query  962  SAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKK  783
            +AKE GST FC+GAAWRD  GRKT+   I + V  +R MGMEVC TLGM++ +QA ELK 
Sbjct  141  TAKENGSTRFCMGAAWRDMRGRKTSLKNIKEMVTGVRSMGMEVCVTLGMIDSEQAKELKD  200

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGLTAYNHNLDTSREYYP+IIT+R+YD+RL+TL NVR+AGI+VCSGGI+GLGEAD DR+G
Sbjct  201  AGLTAYNHNLDTSREYYPSIITSRSYDERLQTLSNVRDAGINVCSGGILGLGEADSDRVG  260

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            LLHT+ATLP+HPES P+NALV +KGTPL D+K +    ++R IATARIV+P  +VRL+AG
Sbjct  261  LLHTVATLPSHPESFPVNALVPIKGTPLGDRKMISFDKLLRTIATARIVLPATIVRLAAG  320

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGE  243
            R+  S  +Q  CF+AGAN++FTGEK+LTT  N +D D  MF+  G  P   K  E+ E E
Sbjct  321  RINLSEEQQVSCFMAGANAVFTGEKMLTTDCNGWDQDHEMFRRWGFYPM--KSFENKELE  378

Query  242  NTEEAL  225
              + A+
Sbjct  379  GEKPAV  384



>emb|CCF46810.1| biotin synthase, partial [Colletotrichum higginsianum]
Length=305

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 184/228 (81%), Gaps = 0/228 (0%)
 Frame = -1

Query  962  SAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKK  783
            +AKE GST FC+GAAWRD  GRK +   I   V  +RGMGMEVC TLGM++ QQA ELK+
Sbjct  62   TAKENGSTRFCMGAAWRDMRGRKNSLKNIKAMVSGVRGMGMEVCVTLGMIDDQQARELKE  121

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGLTAYNHN+DTSRE+YP+II+TR+YD+RL+TL +VR+AGI+VCSGGI+GLGE+ DDRIG
Sbjct  122  AGLTAYNHNVDTSREFYPSIISTRSYDERLKTLSHVRDAGINVCSGGILGLGESSDDRIG  181

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            LLHT++TLP+HPES P+NALV +KGTPL D+ P++   M+R IATAR++MP  ++R++AG
Sbjct  182  LLHTVSTLPSHPESFPVNALVPIKGTPLGDRTPIQFSSMLRTIATARVIMPATIIRIAAG  241

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP  279
            R   S  +Q LCF+AGAN+IFTGEK+LTT  N +D D  MF   GL P
Sbjct  242  RKTMSEEKQALCFMAGANAIFTGEKMLTTDCNSWDEDNAMFGRWGLEP  289



>gb|ETS63560.1| hypothetical protein PaG_01857 [Pseudozyma aphidis DSM 70725]
Length=425

 Score =   293 bits (751),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWR+  GRK  FN+ILD V++IRGMGMEVC TLGML  +QA +LK+A
Sbjct  162  AKANGSTRFCMGAAWREVGGRKRGFNRILDMVREIRGMGMEVCTTLGMLSPEQAKQLKEA  221

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYY  ++TTR+YDDR+ T+ NVREAGISVCSGGI+GLGE  +DR+GL
Sbjct  222  GLTAYNHNLDTSREYYGKVVTTRSYDDRIGTIANVREAGISVCSGGILGLGEEHEDRVGL  281

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  + TLP HPES P+NALVA+ GTP+E+ KP+   DM+R +ATARIV+P +++RL+AGR
Sbjct  282  IWEMGTLPEHPESFPVNALVAIPGTPMENNKPISFQDMLRTVATARIVLPGSIIRLAAGR  341

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
              F+  EQ + FLAGAN+IFTGE++LTTP + +D D+ M    GL
Sbjct  342  HLFTESEQAMAFLAGANAIFTGERMLTTPTSSWDDDKSMLARWGL  386


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W+R E++ IYDSPLL+L+F  A VHR       VQ CTL+ 
Sbjct  78    RHNWSRSEVQKIYDSPLLELVFRSANVHRMHHPVNRVQLCTLMN  121



>ref|WP_008989946.1| biotin synthase [Galbibacter marinus]
 gb|EKF56617.1| biotin synthase [Galbibacter marinus]
Length=366

 Score =   291 bits (745),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 187/246 (76%), Gaps = 2/246 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK AGS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKAAGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMVTENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR Y+DRLET+ NVR+  ++VCSGGIIG+GE  +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKEVISTRGYEDRLETIGNVRKTNVTVCSGGIIGMGEKVEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+E+Q+PVEIWDMIRM+ATARIVMP+  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPMEEQEPVEIWDMIRMVATARIVMPQTQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
             + S   Q +CF AGANSIF G+KLLTTPN D + D  MF+ LGLIP+ P F++ ++ E+
Sbjct  268  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMAMFEKLGLIPQKP-FVKKAQPES  326

Query  239  TEEALS  222
             E   S
Sbjct  327  VEAEFS  332



>ref|XP_007737163.1| biotin synthetase [Capronia epimyces CBS 606.96]
 gb|EXJ79375.1| biotin synthetase [Capronia epimyces CBS 606.96]
Length=409

 Score =   293 bits (749),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 156/257 (61%), Positives = 191/257 (74%), Gaps = 10/257 (4%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GS  FC+GAAWRD  GR      I++ VK +RG+GME C TLGML+KQQA ELK+A
Sbjct  148  AKANGSNRFCMGAAWRDMRGRTRGLKNIVEMVKGVRGLGMEACVTLGMLDKQQAKELKEA  207

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEA-DDDRIG  603
            GLTAYNHNLDTSRE+YPNIITTRTYD+RL+TLENVREAGI VCSGGI+GLGE    D +G
Sbjct  208  GLTAYNHNLDTSREHYPNIITTRTYDERLQTLENVREAGIHVCSGGILGLGETPQTDHVG  267

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            L++TLATLP HPES P+N LV +KGTP+  Q+PV+I D++R IATAR+VMP+ ++R++AG
Sbjct  268  LIYTLATLPEHPESFPVNKLVPIKGTPMFGQEPVKIEDVVRCIATARLVMPKTIIRIAAG  327

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP---------KPP  270
            RV     EQ LCF+AGAN+IFTGEK+LTT  N +D D+ MF+  GL P           P
Sbjct  328  RVTMPESEQMLCFMAGANAIFTGEKMLTTECNGWDEDKAMFERWGLTPMQTEASQIVAEP  387

Query  269  KFLEDSEGENTEEALSS  219
            KF   S     EE+ S+
Sbjct  388  KFEAQSFAHLREESKSA  404



>ref|WP_029270996.1| biotin synthase [Flavobacterium sp. KJJ]
Length=362

 Score =   291 bits (744),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 189/249 (76%), Gaps = 2/249 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKSSGSSRVCMGAAWRN-VKDGEEFDQVLEMVRTINKLDMEVCCTLGMITENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY ++I+TR ++DRLET+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKDVISTRAFEDRLETIENVRKTNVTVCSGGIIGMGESIEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+E++KPVEIW+MIRM+AT RIVMP+  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPMEEEKPVEIWEMIRMVATTRIVMPDTQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
               S   Q +CF AGANSIF G+KLLTTPN D   D  MF++LGLIP+ P F++ S+ + 
Sbjct  268  TNMSREGQAMCFFAGANSIFAGDKLLTTPNPDVQEDMKMFELLGLIPQKP-FVKVSQPQT  326

Query  239  TEEALSSSG  213
             E A S  G
Sbjct  327  VEAADSQFG  335



>ref|XP_002899794.1| biotin synthase [Phytophthora infestans T30-4]
 gb|EEY60848.1| biotin synthase [Phytophthora infestans T30-4]
Length=377

 Score =   291 bits (745),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 187/231 (81%), Gaps = 3/231 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK AGST FC+G+AWR+ +G+K  F  ILD V+Q++ M +EVCCTLGML K+QA++LK+A
Sbjct  122  AKAAGSTRFCMGSAWRE-VGKKNAFRHILDMVRQVKEMDLEVCCTLGMLTKEQAVQLKEA  180

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL+AYNHNLDTSRE+Y  +ITTRTYDDRL+T+ENVR+AGISVC GGI+GLGE   DR+GL
Sbjct  181  GLSAYNHNLDTSREHYAKVITTRTYDDRLKTIENVRKAGISVCCGGILGLGEEKIDRVGL  240

Query  599  lhtlatlpthPESVPINALVAVKGTPL--EDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            LHTLAT+  HPESVP+NALV+V+GTPL  ED  PV   DM RMIATARI+MP+ MVRLSA
Sbjct  241  LHTLATMDEHPESVPVNALVSVEGTPLFDEDIAPVTASDMARMIATARILMPKTMVRLSA  300

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            GR+ F+  EQ + F+AGANSIF G+ LLTT N  ++ D+ +F+  GL  KP
Sbjct  301  GRMSFTDAEQGMMFMAGANSIFNGDTLLTTANPAFEKDKRLFESFGLKGKP  351


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RHDWT+ E+++I+D PLL+L++  A VHR   +  EVQ CTLL 
Sbjct  38    RHDWTKEEVQAIFDQPLLELVYKAATVHRMHFDPTEVQQCTLLS  81



>dbj|GAK62357.1| biotin synthase [Pseudozyma antarctica]
Length=425

 Score =   293 bits (749),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWR+  GRK  FN+ILD V++IRGMGMEVC TLGML  +QA +LK+A
Sbjct  162  AKANGSTRFCMGAAWREVGGRKRGFNRILDMVREIRGMGMEVCTTLGMLSPEQAKQLKEA  221

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYY  ++TTR+YDDR+ T+ NVREAGISVCSGGI+GLGE  +DR+GL
Sbjct  222  GLTAYNHNLDTSREYYGKVVTTRSYDDRIGTIANVREAGISVCSGGILGLGEEHEDRVGL  281

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  + TLP HPES P+NALVA+ GTP+E+ KP+   DM+R +ATARIV+P +++RL+AGR
Sbjct  282  IWEMGTLPEHPESFPVNALVAIPGTPMENNKPISFQDMLRTVATARIVLPGSIIRLAAGR  341

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
              F+  EQ + FLAGAN+IFTGE++LTTP + +D D+ M    GL
Sbjct  342  HLFTESEQAMAFLAGANAIFTGERMLTTPTSSWDDDKSMLARWGL  386


 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W+R E++ IYDSPLL+L+F  A VHR       VQ CTL+ 
Sbjct  78    RHNWSRSEVQKIYDSPLLELVFRSANVHRMHHPVNRVQLCTLMN  121



>ref|XP_007861248.1| biotin synthase [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ60964.1| biotin synthase [Gloeophyllum trabeum ATCC 11539]
Length=385

 Score =   291 bits (746),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 180/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRK  F +IL  V+++RGMGMEVC TLGML   QA +LK+A
Sbjct  122  AKENGSTRFCMGAAWRDLAGRKRGFERILQMVREVRGMGMEVCTTLGMLSPAQAKQLKEA  181

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP +ITTR+YD+RL+T+  VREAGISVCSGGI+GLGE+D DR+GL
Sbjct  182  GLTAYNHNLDTSREFYPQVITTRSYDERLDTIAAVREAGISVCSGGILGLGESDRDRVGL  241

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++ +P HPES P+NALV +KGTPLED +PV    ++R I+TARIV+P+ ++RL+AGR
Sbjct  242  IWEVSNMPEHPESFPVNALVPIKGTPLEDNEPVPYHTLLRTISTARIVLPKTIIRLAAGR  301

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
               S  EQ +CF+AGAN++FTGE++LTTP + +D D+ M    GL
Sbjct  302  QTLSESEQAMCFMAGANAVFTGEQMLTTPCSPWDEDKAMMGRWGL  346


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             RHDWTR E++ IYD+PLLDL+F  A VHR   +  ++Q CTL+
Sbjct  38    RHDWTREEVQQIYDTPLLDLVFRAASVHRQHHDPSKIQLCTLM  80



>ref|XP_571682.1| biotin synthase [Cryptococcus neoformans var. neoformans JEC21]
 ref|XP_774922.1| hypothetical protein CNBF0870 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL20275.1| hypothetical protein CNBF0870 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW44375.1| biotin synthase, putative [Cryptococcus neoformans var. neoformans 
JEC21]
Length=388

 Score =   291 bits (745),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 186/237 (78%), Gaps = 2/237 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWRD  GRK+ F +IL+ VK++RGMGMEVC TLGML  +QA+ LK+A
Sbjct  135  AKANGSTRFCMGAAWRDLAGRKSGFEKILEMVKEVRGMGMEVCTTLGMLSPEQAIRLKEA  194

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL+AYNHNLDTSRE+YP ++T+R+YDDRL T+  VREAGISVCSGGI+GLGE D+DR+GL
Sbjct  195  GLSAYNHNLDTSREFYPEVVTSRSYDDRLSTIAAVREAGISVCSGGILGLGERDEDRVGL  254

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +H ++ +P HPES P+N LV + GTPLE  +PV++  ++R IATARIV+P+ ++RL+AGR
Sbjct  255  IHEVSRMPEHPESFPVNTLVPIPGTPLEGNEPVKVHTVLRTIATARIVLPKTIIRLAAGR  314

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE  249
              FS  EQ + F+AGAN+IFTGEK+LTTP + +D D+ M    GL  +  +  ED E
Sbjct  315  HEFSETEQAMAFMAGANAIFTGEKMLTTPCSGWDEDKAMLDRWGL--RGQRSFEDKE  369



>ref|WP_026714352.1| biotin synthase [Flavobacterium daejeonense]
Length=361

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 180/230 (78%), Gaps = 1/230 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE+GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGML + QA  L +A
Sbjct  89   AKESGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMLTENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR ++DRLET+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKEVISTRGFEDRLETIENVRKTNVTVCSGGIIGMGESIEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTPLE++KPVEIW+MIRM+AT RIVMPE  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPLEEEKPVEIWEMIRMVATTRIVMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPP  270
            +  S   Q +CF AGANSIF G+KLLTTPN D + D  MF+MLGL P+ P
Sbjct  268  MNMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFEMLGLNPQKP  317



>ref|WP_035135358.1| biotin synthase [Flavobacterium beibuense]
 gb|KGO79384.1| biotin synthase [Flavobacterium beibuense F44-8]
Length=360

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 184/242 (76%), Gaps = 2/242 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKSSGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMITENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR Y+DRL+T++NVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKEVISTRGYEDRLQTIDNVRKTNVTVCSGGIIGMGESVEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  LA+L   PESVPINALVAV GTPLED+KPVEIWDMIRM+AT RIVMP   VRLSAGR
Sbjct  208  LVALASLSPQPESVPINALVAVDGTPLEDEKPVEIWDMIRMVATTRIVMPLTQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
             + S   Q +CF AGANSIF G+KLLTTPN D + D  MF+MLGLIP+ P F + S+ + 
Sbjct  268  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFEMLGLIPQKP-FAKKSQPKT  326

Query  239  TE  234
             E
Sbjct  327  VE  328



>ref|WP_026898538.1| biotin synthase [Pedobacter oryzae]
Length=317

 Score =   288 bits (737),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/232 (62%), Positives = 183/232 (79%), Gaps = 1/232 (0%)
 Frame = -1

Query  971  LHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALE  792
            L   AK AGS+  C+GAAWR+ +    +F+++++ V  +  + MEVCCTLGML  +QA +
Sbjct  78   LAQKAKNAGSSRLCMGAAWRE-VRNNRDFDRVIEMVTAVNALDMEVCCTLGMLTFEQATK  136

Query  791  LKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDD  612
            LKKAGL AYNHNLDTS E Y  +ITTRT+DDRL+TL NVR A ++VCSGGIIGLGE ++D
Sbjct  137  LKKAGLYAYNHNLDTSEENYSKVITTRTFDDRLQTLHNVRRANLTVCSGGIIGLGETEED  196

Query  611  RIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRL  432
            RI +LHTL  LP HPESVPINALVA+KGTPLE+Q+ V +W+M+RMIAT RI+MP+ +VRL
Sbjct  197  RIEMLHTLCNLPHHPESVPINALVAIKGTPLENQQRVSVWEMVRMIATTRIIMPKTVVRL  256

Query  431  SAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            SAGR+  SM EQ LCF+AGANSIF G+KLLTTPN  ++ D  MF++LGL  +
Sbjct  257  SAGRLEMSMAEQALCFMAGANSIFAGDKLLTTPNPSFNDDMQMFEILGLTAR  308



>ref|WP_027421042.1| biotin synthase [Crocinitomix catalasitica]
Length=364

 Score =   290 bits (741),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 183/234 (78%), Gaps = 1/234 (0%)
 Frame = -1

Query  971  LHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALE  792
            L  +AK +GS+  C+GAAWR+    + +F+++++ V++I GMGMEVC TLGML+  QA  
Sbjct  85   LAKNAKASGSSRVCMGAAWRNVRDNR-DFDKVVEMVQEINGMGMEVCATLGMLDAAQAER  143

Query  791  LKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDD  612
            LK AGL AYNHNLD+S+E+Y +II+TR Y +R++T++N REAGISVCSGGIIG+GE  +D
Sbjct  144  LKNAGLYAYNHNLDSSQEFYKDIISTRQYQERIDTIKNAREAGISVCSGGIIGMGETAED  203

Query  611  RIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRL  432
            RIG+L T   +   PES+PINALVAV+GTPL+DQ PV +WDM+RMIAT+RI+ PE+++RL
Sbjct  204  RIGMLMTYVHMEQPPESIPINALVAVEGTPLQDQNPVLVWDMVRMIATSRIMFPESIIRL  263

Query  431  SAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPP  270
            SAGR   S   Q LCF AGA+SIF G+KLLTTPN +Y+AD  +FK LGL  K P
Sbjct  264  SAGRTEMSDEAQALCFFAGASSIFAGDKLLTTPNPEYNADVALFKTLGLTAKSP  317



>dbj|GAC95584.1| hypothetical protein PHSY_003160 [Pseudozyma hubeiensis SY62]
Length=438

 Score =   292 bits (747),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWR+  GRK  FN+ILD V++IRGMGMEVC TLGML  +QA +LK+A
Sbjct  170  AKANGSTRFCMGAAWREVGGRKRGFNRILDMVREIRGMGMEVCTTLGMLTTEQAKQLKEA  229

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYY  ++TTR+YDDR+ T+ NVREAGISVCSGGI+GLGE  +DR+GL
Sbjct  230  GLTAYNHNLDTSREYYGKVVTTRSYDDRIGTIANVREAGISVCSGGILGLGEEHEDRVGL  289

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++TLP HPES P+NALVA+ GTP+E  KP+   +M+R +ATARIV+P +++RL+AGR
Sbjct  290  IWEMSTLPEHPESFPVNALVAIPGTPMEQNKPITFQEMLRTVATARIVLPGSIIRLAAGR  349

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
              F+  EQ + FLAGAN+IFTGE++LTTP + +D D+ M    GL
Sbjct  350  HLFTESEQAMAFLAGANAIFTGERMLTTPTSSWDEDKAMLGRWGL  394


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W+R E++ IYDSPLL+L+F  A VHR       VQ CTL+ 
Sbjct  86    RHNWSRKEVQQIYDSPLLELVFRSANVHRQHHPVNRVQLCTLMN  129



>gb|EST09931.1| biotin synthase [Pseudozyma brasiliensis GHG001]
Length=430

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWR+  GRK  FN+ILD V++IRGMGMEVC TLGML  +QA +LK+A
Sbjct  164  AKANGSTRFCMGAAWREVGGRKRGFNRILDMVREIRGMGMEVCTTLGMLTTEQAKQLKEA  223

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYY  ++TTR+YDDR+ T+ NVREAGISVCSGGI+GLGE  +DR+GL
Sbjct  224  GLTAYNHNLDTSREYYGKVVTTRSYDDRIGTIANVREAGISVCSGGILGLGEEHEDRVGL  283

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++TLP HPES P+NALVA+ GTP+E  +P+   DM+R +ATARIV+P +++RL+AGR
Sbjct  284  IWEMSTLPEHPESFPVNALVAIPGTPMEQNEPISFQDMLRTVATARIVLPGSIIRLAAGR  343

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
              F+  EQ + FLAGAN+IFTGE++LTTP + +D D+ M    GL
Sbjct  344  HLFTESEQAMAFLAGANAIFTGERMLTTPTSSWDDDKAMLGRWGL  388


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W+R E++ IYDSPLL+L+F  A VHR       VQ CTL+ 
Sbjct  80    RHNWSRKEVQQIYDSPLLELVFRSANVHRSHHPVNRVQLCTLMN  123



>ref|WP_028870751.1| biotin synthase [Psychroserpens burtonensis]
Length=364

 Score =   289 bits (740),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 147/242 (61%), Positives = 183/242 (76%), Gaps = 2/242 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKSSGSSRVCMGAAWRN-VKDGEEFDQVLEMVRTINKLEMEVCCTLGMITENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLD+S EYY  +I+TR Y+DRLET++NVR+  ++VCSGGIIG+GE  +DR G+
Sbjct  148  GLYAYNHNLDSSEEYYKKVISTRGYEDRLETIDNVRKTNVTVCSGGIIGMGENIEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  LATL   PESVPINALVAV+GTPLEDQKPV IWDM+RM+ATARIVMPE  VRLSAGR
Sbjct  208  LVALATLNPQPESVPINALVAVEGTPLEDQKPVSIWDMVRMVATARIVMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
               S   Q +CF AGANSIF G+KLLTTPN D   D  MFK+LGL P+ P F++ ++ E 
Sbjct  268  TEMSREGQAMCFFAGANSIFAGDKLLTTPNPDVGEDMEMFKLLGLNPQKP-FVKKTQPET  326

Query  239  TE  234
             E
Sbjct  327  IE  328



>dbj|GAC73543.1| biotin synthase [Pseudozyma antarctica T-34]
Length=541

 Score =   295 bits (755),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 144/225 (64%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWR+  GRK  FN+ILD V++IRGMGMEVC TLGML  +QA +LK+A
Sbjct  278  AKANGSTRFCMGAAWREVGGRKRGFNRILDMVREIRGMGMEVCTTLGMLSPEQAKQLKEA  337

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYY  ++TTR+YDDR+ T+ NVREAGISVCSGGI+GLGE  +DRIGL
Sbjct  338  GLTAYNHNLDTSREYYGKVVTTRSYDDRIGTIANVREAGISVCSGGILGLGEEHEDRIGL  397

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  + TLP HPES P+NALVA+ GTP+E+ KP+   DM+R +ATARIV+P +++RL+AGR
Sbjct  398  IWEMGTLPEHPESFPVNALVAIPGTPMENNKPISFQDMLRTVATARIVLPGSIIRLAAGR  457

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
              F+  EQ + FLAGAN+IFTGE++LTTP + +D D+ M    GL
Sbjct  458  HLFTESEQAMAFLAGANAIFTGERMLTTPTSSWDDDKSMLARWGL  502


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             RH+W+R E++ IYDSPLL+L+F  A VHR       VQ CTL+
Sbjct  194   RHNWSRSEVQKIYDSPLLELVFRSANVHRMHHPVNRVQLCTLM  236



>ref|WP_013992744.1| biotin synthase [Zobellia galactanivorans]
 ref|YP_004735823.1| biotin synthase [Zobellia galactanivorans]
 emb|CAZ95435.1| Biotin synthase [Zobellia galactanivorans]
Length=364

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 147/246 (60%), Positives = 186/246 (76%), Gaps = 2/246 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGML + QA  L +A
Sbjct  89   AKASGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMLTENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS +YY ++I+TR ++DRLET++NVR++ ++VCSGGIIG+GEA +DR G+
Sbjct  148  GLYAYNHNLDTSEDYYKDVISTRAFEDRLETIDNVRKSNVTVCSGGIIGMGEAIEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  LA+L   PESVPINALVAV+GTP+ED +PV IWDMIRM+AT RIVMPE  VRLSAGR
Sbjct  208  LVALASLNPQPESVPINALVAVEGTPMEDMEPVSIWDMIRMVATTRIVMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
               S   Q +CF AGANSIF G+KLLTTPN D + D  MFKMLGL P+ P F + S+ + 
Sbjct  268  TEMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMEMFKMLGLNPQKP-FTKVSQPKT  326

Query  239  TEEALS  222
             E A S
Sbjct  327  VEAAES  332



>ref|XP_009536581.1| hypothetical protein PHYSODRAFT_526228 [Phytophthora sojae]
 gb|EGZ08409.1| hypothetical protein PHYSODRAFT_526228 [Phytophthora sojae]
Length=379

 Score =   290 bits (741),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 149/231 (65%), Positives = 187/231 (81%), Gaps = 3/231 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK AGST FC+G+AWR+ +G+K  F  ILD V+Q++ M +EVCCTLGML ++QA++LK+A
Sbjct  124  AKAAGSTRFCMGSAWRE-VGKKNAFRHILDMVRQVKAMDLEVCCTLGMLTEEQAVQLKEA  182

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL+AYNHNLDTSRE+Y  +ITTRTYDDRL+T+ENVR+AGISVC GGI+GLGE   DR+GL
Sbjct  183  GLSAYNHNLDTSREHYAKVITTRTYDDRLKTIENVRKAGISVCCGGILGLGEDKIDRVGL  242

Query  599  lhtlatlpthPESVPINALVAVKGTPL--EDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            LHTLAT+  HPESVP+NALV+V+GTPL  ED  PV   DM RMIATARI+MP+ MVRLSA
Sbjct  243  LHTLATMDEHPESVPVNALVSVEGTPLFDEDIAPVTASDMARMIATARILMPKTMVRLSA  302

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            GR+ F+  EQ + F+AGANSIF G+ LLTT N  ++ D+ +F+  GL  KP
Sbjct  303  GRMSFTDAEQGMMFMAGANSIFNGDTLLTTANPAFEKDKRLFESFGLKGKP  353


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RHDWT+ E+++I+D PLL+L++  A VHR   +  EVQ CTLL 
Sbjct  40    RHDWTKEEVQAIFDQPLLELVYKAATVHRMHFDPTEVQQCTLLS  83



>ref|WP_027138232.1| biotin synthase [Gaetbulibacter saemankumensis]
Length=364

 Score =   289 bits (740),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 177/230 (77%), Gaps = 1/230 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGML + QA  L +A
Sbjct  89   AKSGGSSRVCMGAAWRN-VKDGEEFDQVLEMVRTINKLDMEVCCTLGMLTENQAKRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLD+S EYY  +I+TR ++DRLET++NVR+  ++VCSGGIIG+GE ++DR G+
Sbjct  148  GLYAYNHNLDSSEEYYKEVISTRGFEDRLETIDNVRKTNVTVCSGGIIGMGEKEEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTPLEDQKPV IWDM+RM+AT RIVMPE  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPLEDQKPVSIWDMVRMVATTRIVMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPP  270
             + S   Q +CF AGANSIF G+KLLTTPN D + D  MFK+LGL P+ P
Sbjct  268  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMEMFKLLGLNPQKP  317



>emb|CCF54041.1| probable biotin synthase [Ustilago hordei]
Length=444

 Score =   291 bits (746),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWR+  GRK  FN+ILD V++IRGMGMEVC TLGML  +QA +LK+A
Sbjct  176  AKANGSTRFCMGAAWREVGGRKRGFNRILDMVREIRGMGMEVCTTLGMLTTEQAKQLKQA  235

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYY  ++TTR+YDDR+ T+ NVREAGISVCSGGI+GLGE  +DR+GL
Sbjct  236  GLTAYNHNLDTSREYYGKVVTTRSYDDRIGTIANVREAGISVCSGGILGLGEEHEDRVGL  295

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++TLP HPES P+NALVA+ GTP+E  +P+   DM+R +ATARIV+P +++RL+AGR
Sbjct  296  IWEMSTLPEHPESFPVNALVAIPGTPMEANEPITFQDMLRTVATARIVLPGSIIRLAAGR  355

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
              F+  EQ + FLAGAN+IFTGE++LTTP + +D D+ M    GL
Sbjct  356  HLFTESEQAMAFLAGANAIFTGERMLTTPTSSWDEDKAMLSRWGL  400


 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W+R E++ IYDSPLL L+F  A VHR       VQ CTL+ 
Sbjct  92    RHNWSRKEVQEIYDSPLLQLVFRSANVHRMHHPVNRVQLCTLMN  135



>ref|XP_007879379.1| hypothetical protein PFL1_03669 [Pseudozyma flocculosa PF-1]
 gb|EPQ28866.1| hypothetical protein PFL1_03669 [Pseudozyma flocculosa PF-1]
Length=453

 Score =   292 bits (747),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWR+  GRK  FN+ILD V++IRGMGMEVC TLGML  +QA +LK+A
Sbjct  187  AKENGSTRFCMGAAWREVGGRKRGFNRILDMVREIRGMGMEVCTTLGMLTVEQAKQLKEA  246

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYY  ++TTR+Y+DR+ T+ NVREAGISVCSGGI+GLGE  +DR+GL
Sbjct  247  GLTAYNHNLDTSREYYGKVVTTRSYNDRIGTIANVREAGISVCSGGILGLGEEQEDRVGL  306

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++ LP HPES P+NALVA+ GTP+E+ KP+   +M+R +ATARIV+P +++RL+AGR
Sbjct  307  IWEMSCLPEHPESFPVNALVAIPGTPMENNKPITFQEMLRTVATARIVLPGSIIRLAAGR  366

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
              F+  EQ +CFLAGAN+IFTG K+LTTP   +D D+ M    GL
Sbjct  367  HLFTESEQAMCFLAGANAIFTGHKMLTTPTTGWDEDKEMLGRWGL  411


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RHDW R +++ IYDSPLL+L+F  A VHR   +   VQ CTL+ 
Sbjct  103   RHDWNREDVQRIYDSPLLELVFRSANVHRQHHSADRVQLCTLMN  146



>ref|WP_026983703.1| biotin synthase [Flavobacterium sp. URHB0058]
Length=362

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 188/246 (76%), Gaps = 2/246 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKSSGSSRVCMGAAWRN-VKDGEEFDQVLEMVRTINKLDMEVCCTLGMITENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY ++I+TR ++DRL+T+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKDVISTRGFEDRLQTIENVRKTNVTVCSGGIIGMGESIEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+E++KPVEIW+MIRM+AT RIVMP+  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPMEEEKPVEIWEMIRMVATTRIVMPDTQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
               S   Q +CF AGANSIF G+KLLTTPN D   D  MF+MLGLIP+ P F++ S+ + 
Sbjct  268  TNMSREGQAMCFFAGANSIFAGDKLLTTPNPDVHEDMKMFEMLGLIPQKP-FVKVSQPQT  326

Query  239  TEEALS  222
             E A S
Sbjct  327  VEAADS  332



>ref|WP_007807625.1| biotin synthase [Flavobacterium sp. CF136]
 gb|EJL63823.1| biotin synthase [Flavobacterium sp. CF136]
Length=362

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/246 (59%), Positives = 188/246 (76%), Gaps = 2/246 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKSSGSSRVCMGAAWRN-VKDGEEFDQVLEMVRTINKLDMEVCCTLGMITENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY ++I+TR ++DRL+T+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKDVISTRGFEDRLQTIENVRKTNVTVCSGGIIGMGESIEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+E++KPVEIW+MIRM+AT RIVMP+  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPMEEEKPVEIWEMIRMVATTRIVMPDTQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
               S   Q +CF AGANSIF G+KLLTTPN D   D  MF+MLGLIP+ P F++ S+ + 
Sbjct  268  TNMSREGQAMCFFAGANSIFAGDKLLTTPNPDVHEDMKMFEMLGLIPQKP-FVKVSQPQT  326

Query  239  TEEALS  222
             E A S
Sbjct  327  VEAADS  332



>ref|XP_756462.1| hypothetical protein UM00315.1 [Ustilago maydis 521]
 gb|EAK81300.1| hypothetical protein UM00315.1 [Ustilago maydis 521]
Length=436

 Score =   291 bits (745),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWR+  GRK  FN+ILD V++IRGMGMEVC TLGML  +QA +LK+A
Sbjct  167  AKANGSTRFCMGAAWREVGGRKRGFNRILDMVREIRGMGMEVCTTLGMLTPEQAKQLKEA  226

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYY  ++TTR+YDDR+ T+ NVREAGISVCSGGI+GLGE  +DR+GL
Sbjct  227  GLTAYNHNLDTSREYYGKVVTTRSYDDRIGTIANVREAGISVCSGGILGLGEEHEDRVGL  286

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++TLP HPES P+NALVA+ GTP+E  KP+   +M+R +ATARIV+P +++RL+AGR
Sbjct  287  IWEMSTLPEHPESFPVNALVAIPGTPMEQNKPITFQEMLRTVATARIVLPGSIIRLAAGR  346

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
              F+  EQ + FLAGAN+IFTGE++LTTP + +D D+ M    GL
Sbjct  347  HLFTESEQAMAFLAGANAIFTGERMLTTPTSSWDEDKAMLGRWGL  391


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W+R E++ IYDSPLL+L+F  A VHR       VQ CTL+ 
Sbjct  83    RHNWSRKEVQRIYDSPLLELVFRSANVHRMHHPVNRVQLCTLMN  126



>emb|CBQ67716.1| probable biotin synthase [Sporisorium reilianum SRZ2]
Length=445

 Score =   291 bits (746),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/225 (63%), Positives = 181/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWR+  GRK  FN+ILD V++IRGMGMEVC TLGML  +QA +LK+A
Sbjct  175  AKANGSTRFCMGAAWREVGGRKRGFNRILDMVREIRGMGMEVCTTLGMLTTEQAKQLKEA  234

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYY  ++TTR+YDDR+ T+ NVREAGISVCSGGI+GLGE  +DR+GL
Sbjct  235  GLTAYNHNLDTSREYYGKVVTTRSYDDRIGTIANVREAGISVCSGGILGLGEEHEDRVGL  294

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++TLP HPES P+NALVA+ GTP+E  KP+   +M+R +ATARIV+P +++RL+AGR
Sbjct  295  IWEMSTLPEHPESFPVNALVAIPGTPMEQNKPITFQEMLRTVATARIVLPGSIIRLAAGR  354

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
              F+  EQ + FLAGAN+IFTGE++LTTP + +D D+ M    GL
Sbjct  355  HLFTESEQAMAFLAGANAIFTGERMLTTPTSSWDDDKAMLGRWGL  399


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W+R E++ IYDSPLL+L+F  A VHR       VQ CTL+ 
Sbjct  91    RHNWSRKEVQHIYDSPLLELVFRSANVHRMHHPVNRVQLCTLMN  134



>gb|KGB76106.1| biotin synthase [Cryptococcus gattii R265]
Length=388

 Score =   289 bits (740),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 186/237 (78%), Gaps = 2/237 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWRD  G+K+ F +IL+ VK++RGMGMEVC TLGML  +QA+ LK+A
Sbjct  135  AKANGSTRFCMGAAWRDLAGKKSGFEKILEMVKEVRGMGMEVCTTLGMLTPEQAIRLKEA  194

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL+AYNHNLDTSRE+YP +IT+R+YDDRL T+  VREAGISVCSGGI+GLGE D+DR+GL
Sbjct  195  GLSAYNHNLDTSREFYPEVITSRSYDDRLSTIAAVREAGISVCSGGILGLGEQDEDRVGL  254

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +H ++ +P HPES P+N LV + GTPLE  +PV++  ++R IATARIV+P+ ++RL+AGR
Sbjct  255  IHEVSRMPQHPESFPVNTLVPIPGTPLEGNEPVKVHTVLRTIATARIVLPKTIIRLAAGR  314

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE  249
              FS  EQ + F+AGAN+IFTGEK+LTTP + +D D+ M    GL  +  +  ED E
Sbjct  315  HEFSETEQAMAFMAGANAIFTGEKMLTTPCSGWDDDKAMLDRWGL--RGQRSFEDKE  369



>ref|XP_007586851.1| putative biotin synthase protein [Neofusicoccum parvum UCRNP2]
 gb|EOD45680.1| putative biotin synthase protein [Neofusicoccum parvum UCRNP2]
Length=421

 Score =   290 bits (743),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/227 (64%), Positives = 183/227 (81%), Gaps = 0/227 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRK +   I   V+ +RGMGMEVC TLGM+++ QA ELK+A
Sbjct  179  AKENGSTRFCMGAAWRDMRGRKNSLKNIKTMVEGVRGMGMEVCVTLGMIDEHQAKELKEA  238

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHN+DTSRE+YP++I+TRTYD+RL+TL +VR+AGI+VCSGGI+GLGE   D IGL
Sbjct  239  GLTAYNHNVDTSREFYPSVISTRTYDERLKTLSHVRDAGINVCSGGILGLGEKSKDHIGL  298

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            LHT++TLP+HPES P+NALV +KGTPL D+KP+E   M+R IATARIVMP  ++R++AGR
Sbjct  299  LHTVSTLPSHPESFPVNALVPIKGTPLGDRKPLEFTSMLRTIATARIVMPSTIIRIAAGR  358

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP  279
               S  +Q +CF+AGAN+IFTGEK+LTT  N +D D  MF   GL+P
Sbjct  359  KTMSEEKQAMCFMAGANAIFTGEKMLTTECNGWDEDNTMFGRWGLVP  405


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -2

Query  1093  GPRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
              PR++WT+ EI +IY +PL+DL F    VHR   N  EVQ CTL+ 
Sbjct  93    APRNNWTKEEISAIYYTPLMDLAFQAGTVHRRFHNPAEVQLCTLMN  138



>ref|WP_014389463.1| biotin synthase [Flavobacterium indicum]
 ref|YP_005358402.1| biotin synthase [Flavobacterium indicum GPTSA100-9 = DSM 17447]
 emb|CCG54345.1| Biotin synthase [Flavobacterium indicum GPTSA100-9 = DSM 17447]
Length=361

 Score =   288 bits (738),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 143/230 (62%), Positives = 178/230 (77%), Gaps = 1/230 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGML + QA  L +A
Sbjct  89   AKSSGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMLTENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLD+S EYY  +I+TR ++DRL+T+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  148  GLYAYNHNLDSSEEYYKEVISTRGFEDRLQTIENVRKTNVTVCSGGIIGMGESIEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTPLEDQKPVEIW+MIRM+AT RIVMPE  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPLEDQKPVEIWEMIRMVATTRIVMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPP  270
               S   Q +CF AGANSIF G+KLLTTPN D + D  MF+MLGL P+ P
Sbjct  268  TEMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFEMLGLQPQKP  317



>gb|KEF63152.1| biotin synthetase [Exophiala aquamarina CBS 119918]
Length=408

 Score =   290 bits (742),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 183/228 (80%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GS  FC+GAAWRD  GRK     I++ VK +R +GME C TLGM++K QALELK+A
Sbjct  141  AKANGSNRFCMGAAWRDMRGRKRGLKNIVEMVKGVRSLGMEACVTLGMVDKAQALELKEA  200

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEA-DDDRIG  603
            GLTAYNHNLDTSRE+YPNIITTR+YD+RL+TLENVREAGI VCSGGI+GLGE    D +G
Sbjct  201  GLTAYNHNLDTSREHYPNIITTRSYDERLQTLENVREAGIHVCSGGILGLGETPQTDHVG  260

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            L++TLATLP HPES P+N LV +KGTP+  Q+PV++ DM+R+IATAR+VMP+ ++R++AG
Sbjct  261  LIYTLATLPGHPESFPVNKLVPIKGTPMFGQEPVKLEDMVRVIATARLVMPKTIIRIAAG  320

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP  279
            RV     EQ LCF+AGAN+IFTGEK+LTT  N +D D+ MF+  GL P
Sbjct  321  RVSMPESEQMLCFMAGANAIFTGEKMLTTECNGWDEDKAMFERWGLTP  368



>ref|XP_001590701.1| hypothetical protein SS1G_08441 [Sclerotinia sclerotiorum 1980]
 gb|EDN92578.1| hypothetical protein SS1G_08441 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=417

 Score =   290 bits (742),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/227 (64%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+ GST FC+GAAWRD  GRKTN   +   V +IRGMGMEVC TLGM++ +QA ELK+A
Sbjct  156  AKDNGSTRFCMGAAWRDMRGRKTNLKNVKTMVSEIRGMGMEVCVTLGMIDAEQAQELKEA  215

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHN+DTSR++YP +ITTRTYD+RL+T++NVREAGI+VC+GGI+GLGE   D IGL
Sbjct  216  GLTAYNHNVDTSRDFYPKVITTRTYDERLDTIKNVREAGINVCTGGILGLGENKSDHIGL  275

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L T+ATLP+HPES P+N LVA+KGTPLE  K VE  +M+RM+ATARIVMP+ +VRL+AGR
Sbjct  276  LETVATLPSHPESFPVNMLVAIKGTPLEGNKKVEFENMLRMVATARIVMPKTIVRLAAGR  335

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP  279
               S  +Q LCF+AGAN++FTGE +LTTP   +  D ++F   GL P
Sbjct  336  GELSEEQQVLCFMAGANAVFTGETMLTTPAVGWGVDSVVFNRWGLRP  382



>ref|WP_023578699.1| biotin synthase [Flavobacterium limnosediminis]
 gb|ESU29011.1| biotin synthase [Flavobacterium limnosediminis JC2902]
Length=364

 Score =   288 bits (738),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 146/246 (59%), Positives = 186/246 (76%), Gaps = 2/246 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGML + QA  L +A
Sbjct  90   AKSGGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMLTENQAHRLAEA  148

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR ++DRL+T+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  149  GLYAYNHNLDTSEEYYKEVISTRGFEDRLQTIENVRKTNVTVCSGGIIGMGESIEDRAGM  208

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+ED+KPVEIW+MIRM+AT RIVMPE  VRLSAGR
Sbjct  209  LVALSTLNPQPESVPINALVAVEGTPMEDEKPVEIWEMIRMVATTRIVMPETQVRLSAGR  268

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
             + S   Q +CF AGANSIF G+KLLTTPN D + D  MF+MLG+ P+ P F++  + E 
Sbjct  269  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFEMLGMQPQKP-FIKLMQPET  327

Query  239  TEEALS  222
             E A S
Sbjct  328  VEAADS  333



>emb|CCA68823.1| probable biotin synthase [Piriformospora indica DSM 11827]
Length=392

 Score =   289 bits (740),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 174/225 (77%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWR   GR  +FN IL  V++IRGMGMEVC TLGML   +A +LK+A
Sbjct  136  AKENGSTRFCMGAAWRTATGRPRSFNNILTMVREIRGMGMEVCTTLGMLTPDEAKQLKEA  195

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYP +ITTR+YDDRL T+E VR AGISVCSGGI+GLGE DDDR+GL
Sbjct  196  GLTAYNHNLDTSREYYPEVITTRSYDDRLNTIEAVRSAGISVCSGGILGLGETDDDRVGL  255

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++    HPES P+NALV + GTP+E+  PV +  ++R IATAR+V+PE ++RLSAGR
Sbjct  256  IWEVSNFEEHPESFPVNALVPIPGTPMENNPPVAVHTLLRTIATARLVLPETIIRLSAGR  315

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
               +  EQ +CF+AGAN+IFTG+ +LTTP + +D D+ M    GL
Sbjct  316  QTLNETEQAMCFMAGANAIFTGDAMLTTPCSPWDEDKAMMDRWGL  360


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -2

Query  1090  PRHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             PR  WT+ EIK IYDSPLLDL+F  A  HR   +  +VQ CTL+ 
Sbjct  51    PRKHWTKAEIKEIYDSPLLDLVFRAAASHRVHFDPSKVQLCTLMN  95



>ref|WP_018279337.1| biotin synthase [Capnocytophaga cynodegmi]
Length=363

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 186/242 (77%), Gaps = 2/242 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +G++  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGML + QA  L +A
Sbjct  89   AKSSGASRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMLTENQAKRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR Y+DRL+T+ENVR+  I+VCSGGIIG+GE+ +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKEVISTRGYEDRLQTIENVRKTNITVCSGGIIGMGESLEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+EDQKPVEIW+MIRMIATARIVMPE  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPMEDQKPVEIWEMIRMIATARIVMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
             + S   Q +CF AGANSIF G+KLLTTPN + + D +MF+MLG+  + P F + ++   
Sbjct  268  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPNINEDMMMFEMLGMRTQKP-FEKHTQPTT  326

Query  239  TE  234
            TE
Sbjct  327  TE  328



>ref|WP_026980516.1| biotin synthase [Flavobacterium suncheonense]
 gb|KGO89250.1| biotin synthase [Flavobacterium suncheonense GH29-5 = DSM 17707]
Length=365

 Score =   288 bits (737),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 185/242 (76%), Gaps = 2/242 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGML + QA  L +A
Sbjct  90   AKSSGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMLTENQAQRLAEA  148

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR Y+DRL+T+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  149  GLYAYNHNLDTSEEYYKEVISTRGYEDRLQTIENVRKTNVTVCSGGIIGMGESIEDRAGM  208

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+ED+KPVEIW+MIRM+AT RIVMPE  VRLSAGR
Sbjct  209  LVALSTLNPQPESVPINALVAVEGTPMEDEKPVEIWEMIRMVATTRIVMPETQVRLSAGR  268

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
             + S   Q +CF AGANSIF G+KLLTTPN D + D  MF++LGL P+ P F++  + E 
Sbjct  269  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFELLGLQPQKP-FIKLMQPET  327

Query  239  TE  234
             E
Sbjct  328  VE  329



>ref|XP_003194662.1| biotin synthase [Cryptococcus gattii WM276]
 gb|ADV22875.1| biotin synthase, putative [Cryptococcus gattii WM276]
Length=388

 Score =   289 bits (739),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 142/237 (60%), Positives = 186/237 (78%), Gaps = 2/237 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWRD  G+K+ F +IL+ VK++RGMGMEVC TLGML  +QA+ LK+A
Sbjct  135  AKANGSTRFCMGAAWRDLAGKKSGFEKILEMVKEVRGMGMEVCTTLGMLTPEQAIRLKEA  194

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL+AYNHNLDTSRE+YP +IT+R+YDDRL T+  VREAGISVCSGGI+GLGE D+DR+GL
Sbjct  195  GLSAYNHNLDTSREFYPEVITSRSYDDRLSTIAAVREAGISVCSGGILGLGEQDEDRVGL  254

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +H ++ +P HPES P+N LV + GTPLE  +PV++  ++R IATARIV+P+ ++RL+AGR
Sbjct  255  IHEVSRMPEHPESFPVNTLVPIPGTPLEGNEPVKVHTVLRTIATARIVLPKTIIRLAAGR  314

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE  249
              FS  EQ + F+AGAN+IFTGEK+LTTP + +D D+ M    GL  +  +  ED E
Sbjct  315  HEFSETEQAMAFMAGANAIFTGEKMLTTPCSGWDDDKAMLDRWGL--RGQRSFEDKE  369



>ref|XP_007720430.1| biotin synthetase [Capronia coronata CBS 617.96]
 gb|EXJ96201.1| biotin synthetase [Capronia coronata CBS 617.96]
Length=407

 Score =   290 bits (741),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 183/228 (80%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GS  FC+GAAWRD  GR      I++ VK +RG+GME C TLGML+KQQA ELK+A
Sbjct  146  AKANGSNRFCMGAAWRDMRGRTRGLKNIVEMVKGVRGLGMEACVTLGMLDKQQAKELKEA  205

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEA-DDDRIG  603
            GLTAYNHNLDTSRE+YPN+ITTRTYD+RL+TLENVREAGI VCSGGI+GLGE  + D +G
Sbjct  206  GLTAYNHNLDTSREHYPNVITTRTYDERLQTLENVREAGIHVCSGGILGLGETPETDHVG  265

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            L+HTLATLP HPES P+N LV +KGTP+  Q+PV++ D++R IATAR+VMP+ ++R++AG
Sbjct  266  LIHTLATLPEHPESFPVNKLVPIKGTPMFGQEPVKLEDIVRCIATARLVMPQTIIRIAAG  325

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP  279
            RV     EQ LCF+AGAN+IFTGEK+LTT  N +D D+ MF+  GL P
Sbjct  326  RVTMPESEQMLCFMAGANAIFTGEKMLTTECNGWDEDKAMFQRWGLEP  373



>gb|ESZ95534.1| hypothetical protein SBOR_4087 [Sclerotinia borealis F-4157]
Length=423

 Score =   290 bits (742),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 149/247 (60%), Positives = 189/247 (77%), Gaps = 2/247 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRKTN   +   V +IRGMGMEVC TLGM++ +QA ELK+A
Sbjct  161  AKENGSTRFCMGAAWRDLRGRKTNLKNVKTMVSEIRGMGMEVCVTLGMIDAEQAQELKEA  220

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHN+DTSR++YP +ITTR+YD+RL T++NVREAGI+VC+GGI+GLGE   D IGL
Sbjct  221  GLTAYNHNVDTSRDFYPKVITTRSYDERLNTIKNVREAGINVCTGGILGLGENKSDHIGL  280

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L T+ATLP HPES P+N LVA+KGTPLE  K VE   M+RM+ATARIVMP+ +VRL+AGR
Sbjct  281  LETVATLPAHPESFPVNMLVAIKGTPLEGNKKVEFESMLRMVATARIVMPKTIVRLAAGR  340

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
               S  +Q LCF+AGAN++FTGE +LTTP   +  D ++F   GL  +P +  E    +N
Sbjct  341  GELSEEQQVLCFMAGANAVFTGETMLTTPAVGWGVDSVVFNRWGL--RPMQSFEVEALKN  398

Query  239  TEEALSS  219
             + A+S+
Sbjct  399  DKPAVSA  405



>gb|ETK88376.1| biotin synthase [Phytophthora parasitica]
 gb|ETL41774.1| biotin synthase [Phytophthora parasitica]
 gb|ETL94931.1| biotin synthase [Phytophthora parasitica]
 gb|ETM48168.1| biotin synthase [Phytophthora parasitica]
 gb|ETO77232.1| biotin synthase [Phytophthora parasitica P1976]
 gb|ETP18228.1| biotin synthase [Phytophthora parasitica CJ01A1]
Length=377

 Score =   288 bits (738),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 187/231 (81%), Gaps = 3/231 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK AGST FC+G+AWR+ +G+K  F  ILD V+Q++ + +EVCCTLGML ++QA++LK+A
Sbjct  122  AKAAGSTRFCMGSAWRE-VGKKNAFRHILDMVRQVKDLDLEVCCTLGMLTEEQAVQLKEA  180

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL+AYNHNLDTSRE+Y  +ITTRTYDDRL+T+ENVR+AGISVC GGI+GLGE   DR+GL
Sbjct  181  GLSAYNHNLDTSREHYAKVITTRTYDDRLKTIENVRKAGISVCCGGILGLGEEKIDRVGL  240

Query  599  lhtlatlpthPESVPINALVAVKGTPL--EDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            LHTLAT+  HPESVP+NALV+V+GTPL  ED  PV   DM RMIATARI+MP+ MVRLSA
Sbjct  241  LHTLATMDEHPESVPVNALVSVEGTPLFDEDIPPVTASDMARMIATARILMPKTMVRLSA  300

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            GR+ F+  EQ + F+AGANSIF G+ LLTT N  ++ D+ +F+  GL  KP
Sbjct  301  GRMSFTDAEQGMMFMAGANSIFNGDTLLTTANPAFEKDKRLFESFGLKGKP  351


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RHDWT+ E+++IYD PLL+L++  A VHR   +  EVQ CTLL 
Sbjct  38    RHDWTKEEVQAIYDQPLLELVYKAATVHRMHFDPTEVQQCTLLS  81



>ref|XP_007378536.1| biotin synthase [Punctularia strigosozonata HHB-11173 SS5]
 gb|EIN13619.1| biotin synthase [Punctularia strigosozonata HHB-11173 SS5]
Length=373

 Score =   288 bits (737),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 180/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRK  F +IL  V+++RGMGMEVC TLGML  +QA  LK+A
Sbjct  118  AKENGSTRFCMGAAWRDLAGRKRGFERILTMVREVRGMGMEVCTTLGMLSPEQAKMLKEA  177

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP +ITTR+YD+RL+T+  VREAGISVCSGGI+GLGE+++DR+GL
Sbjct  178  GLTAYNHNLDTSREHYPKVITTRSYDERLDTISAVREAGISVCSGGILGLGESNEDRVGL  237

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++ +P HPES P+NALV +KGTPLE+ +PV    ++R IATARIV+P  ++RL+AGR
Sbjct  238  IWEVSNMPEHPESFPVNALVPIKGTPLENNEPVAYQTLLRTIATARIVLPTTIIRLAAGR  297

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
               S  EQ +CF+AGAN++FTGE++LTTP + +D D+ M    GL
Sbjct  298  QTLSENEQAMCFMAGANAVFTGEQMLTTPCSPWDEDKAMMARWGL  342


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RHDW++ EI+ IYDSPLLDL+F  A VHR   +  +VQ CTL+ 
Sbjct  34    RHDWSKQEIQKIYDSPLLDLVFRAATVHRQHFDPGQVQLCTLMN  77



>gb|ESU23746.1| biotin synthase [Flavobacterium enshiense DK69]
Length=344

 Score =   287 bits (734),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 185/242 (76%), Gaps = 2/242 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGML + QA  L +A
Sbjct  68   AKSSGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMLTENQAQRLAEA  126

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR ++DRL+T+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  127  GLYAYNHNLDTSEEYYKEVISTRGFEDRLQTIENVRKTNVTVCSGGIIGMGESIEDRAGM  186

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+ED+KPVEIW+MIRM+AT RIVMPE  VRLSAGR
Sbjct  187  LVALSTLNPQPESVPINALVAVEGTPMEDEKPVEIWEMIRMVATTRIVMPETQVRLSAGR  246

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
             + S   Q +CF AGANSIF G+KLLTTPN D + D  MF++LGL P+ P F++  + E 
Sbjct  247  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFELLGLQPQKP-FIKLMQPET  305

Query  239  TE  234
             E
Sbjct  306  VE  307



>ref|XP_008904154.1| biotin synthase [Phytophthora parasitica INRA-310]
 gb|ETI48436.1| biotin synthase [Phytophthora parasitica P1569]
 gb|ETN10393.1| biotin synthase [Phytophthora parasitica INRA-310]
 gb|ETP46172.1| biotin synthase [Phytophthora parasitica P10297]
Length=377

 Score =   288 bits (737),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 187/231 (81%), Gaps = 3/231 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK AGST FC+G+AWR+ +G+K  F  ILD V+Q++ + +EVCCTLGML ++QA++LK+A
Sbjct  122  AKAAGSTRFCMGSAWRE-VGKKNAFRHILDMVRQVKDLDLEVCCTLGMLTEEQAVQLKEA  180

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL+AYNHNLDTSRE+Y  +ITTRTYDDRL+T+ENVR+AGISVC GGI+GLGE   DR+GL
Sbjct  181  GLSAYNHNLDTSREHYAKVITTRTYDDRLKTIENVRKAGISVCCGGILGLGEEKIDRVGL  240

Query  599  lhtlatlpthPESVPINALVAVKGTPL--EDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            LHTLAT+  HPESVP+NALV+V+GTPL  ED  PV   DM RMIATARI+MP+ MVRLSA
Sbjct  241  LHTLATMDEHPESVPVNALVSVEGTPLFDEDIPPVTASDMARMIATARILMPKTMVRLSA  300

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            GR+ F+  EQ + F+AGANSIF G+ LLTT N  ++ D+ +F+  GL  KP
Sbjct  301  GRMSFTDAEQGMMFMAGANSIFNGDTLLTTANPAFEKDKRLFESFGLKGKP  351


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RHDWT+ E+++IYD PLL+L++  A VHR   +  EVQ CTLL 
Sbjct  38    RHDWTKEEVQAIYDQPLLELVYKAATVHRMHFDPTEVQQCTLLS  81



>gb|KDN40514.1| biotin synthase [Tilletiaria anomala UBC 951]
Length=465

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 143/225 (64%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWR+  GRK  F +IL  V +IRGMGMEVC TLGML  +QA +LK A
Sbjct  188  AKENGSTRFCMGAAWREVGGRKRGFGRILQMVSEIRGMGMEVCTTLGMLTPEQAKQLKAA  247

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYY  ++TTR+YDDR+ TL NVR+AGISVCSGGI+GLGE ++DR+GL
Sbjct  248  GLTAYNHNLDTSREYYGKVVTTRSYDDRIGTLANVRDAGISVCSGGILGLGEQEEDRVGL  307

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++ LP HPES P+NALVA+ GTP+ED KPV+   M+R IATAR+V+P +++RL+AGR
Sbjct  308  IWEMSRLPEHPESFPVNALVAIPGTPMEDNKPVDFRTMLRTIATARLVLPTSIIRLAAGR  367

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
              FS  EQ   FLAGAN+IFTG K+LTTP + +D D++M    GL
Sbjct  368  HLFSESEQAFAFLAGANAIFTGHKMLTTPTSGWDEDKMMLARWGL  412



>gb|AFR95906.1| biotin synthase [Cryptococcus neoformans var. grubii H99]
Length=388

 Score =   288 bits (738),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/237 (59%), Positives = 185/237 (78%), Gaps = 2/237 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GST FC+GAAWRD  G+K+ F +IL  VK++RGMGMEVC TLGML  +QA+ LK+A
Sbjct  135  AKANGSTRFCMGAAWRDLAGKKSGFEKILTMVKEVRGMGMEVCTTLGMLTPEQAIRLKEA  194

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL+AYNHNLDTSRE+YP ++T+R+YDDRL T+  VREAGISVCSGGI+GLGE D+DR+GL
Sbjct  195  GLSAYNHNLDTSREFYPEVVTSRSYDDRLSTIAAVREAGISVCSGGILGLGEQDEDRVGL  254

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +H ++ +P HPES P+N LV + GTPLE  +PV++  ++R IATARIV+P+ ++RL+AGR
Sbjct  255  IHEVSRMPQHPESFPVNTLVPIPGTPLEGNEPVKVHTVLRTIATARIVLPKTIIRLAAGR  314

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSE  249
              FS  EQ + F+AGAN+IFTGEK+LTTP + +D D+ M    GL  +  +  ED E
Sbjct  315  HEFSETEQAMAFMAGANAIFTGEKMLTTPCSGWDEDKAMLDRWGL--RGQRSFEDKE  369



>gb|EPS99112.1| hypothetical protein FOMPIDRAFT_1164351 [Fomitopsis pinicola 
FP-58527 SS1]
Length=371

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 178/225 (79%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRK  F +IL  V+++RGM MEVC TLGML  +QA +LK+A
Sbjct  117  AKENGSTRFCMGAAWRDLAGRKRGFEKILHMVREVRGMDMEVCTTLGMLSPEQAKQLKEA  176

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP +ITTR+YD+RL+T+  VREAGISVCSGGI+GLGE D DR+GL
Sbjct  177  GLTAYNHNLDTSREFYPEVITTRSYDERLDTISAVREAGISVCSGGILGLGETDKDRVGL  236

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++ +P HPES P+NALV +KGTPLED +PV    ++R IATARIV+P+ ++RL+AGR
Sbjct  237  IWEVSNMPEHPESFPVNALVPIKGTPLEDNEPVPYPTLLRTIATARIVLPQTIIRLAAGR  296

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
                  +Q +CF+AGAN+IFTGE++LTTP + +D D+ M    GL
Sbjct  297  QTLDESKQAMCFMAGANAIFTGEQMLTTPCSPWDEDKAMMARWGL  341


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             RHDWT+PEI+  YD PLLDL+F  A VHR   +  ++Q CTL+
Sbjct  33    RHDWTKPEIQKTYDGPLLDLVFRAAAVHREHHDPSKIQLCTLM  75



>gb|KDB14206.1| putative biotin synthase [Ustilaginoidea virens]
Length=413

 Score =   289 bits (740),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 148/248 (60%), Positives = 188/248 (76%), Gaps = 0/248 (0%)
 Frame = -1

Query  962  SAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKK  783
            +AKE GST FC+GAAWRD  GRK +   I + VK +R MGMEVC TLGM++ +QA +LK+
Sbjct  166  TAKENGSTRFCMGAAWRDMRGRKNSLRNITEMVKGVRAMGMEVCVTLGMIDNEQAKQLKE  225

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGLTAYNHN+DTSRE+YPN+ITTR+YD+RL TL NVR+AGI+VCSGGI+GLGE+ +DR+G
Sbjct  226  AGLTAYNHNVDTSREFYPNVITTRSYDERLRTLSNVRDAGINVCSGGILGLGESSEDRVG  285

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            LLHT++TLP HPES P+NALV +KGTPL D  PV    M+R IATARI+MP  ++R++AG
Sbjct  286  LLHTVSTLPCHPESFPVNALVPIKGTPLGDTTPVAFTSMLRTIATARIIMPATIIRIAAG  345

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGE  243
            R   S  +Q LCF+AGAN+IFTG+K+LTT  N +D D  MF   GL P        +EG 
Sbjct  346  RKTMSEEKQALCFMAGANAIFTGDKMLTTDCNGWDEDSAMFGRWGLSPMKSFNKTAAEGA  405

Query  242  NTEEALSS  219
               +A S+
Sbjct  406  GQVDAASA  413



>ref|WP_028890014.1| biotin synthase [Tenacibaculum ovolyticum]
Length=366

 Score =   288 bits (736),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 189/266 (71%), Gaps = 10/266 (4%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+LD V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKSSGSSRVCMGAAWRN-VKDGPEFDQVLDMVRTINKLDMEVCCTLGMVTENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLD+S EYY  +I+TR Y DRL+T++NVR+  ++VCSGGIIG+GE  +DR G+
Sbjct  148  GLYAYNHNLDSSEEYYKEVISTRGYQDRLDTIDNVRKTNVTVCSGGIIGMGENSEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PES PINALVAV+GTPLED+KPVEIWDM+RM+AT RIV+PE  VRLSAGR
Sbjct  208  LVALSTLNPQPESTPINALVAVEGTPLEDEKPVEIWDMVRMVATTRIVLPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
             + S   Q +CF AGANSIF G+KLLTTPN D + D  MFK+LGL P+ P F +  + + 
Sbjct  268  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFKLLGLNPQKP-FTKKVQPQT  326

Query  239  TEEALSSSG*D*CLFFENNNVKPSLT  162
             E   S+        FEN   KP  T
Sbjct  327  VEAKDSA--------FENLGEKPKWT  344



>gb|KDR84807.1| hypothetical protein GALMADRAFT_233182 [Galerina marginata CBS 
339.88]
Length=379

 Score =   288 bits (737),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 189/255 (74%), Gaps = 11/255 (4%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRK  F +IL+ V+++RGMGMEVC TLGML  +QA +LK+A
Sbjct  117  AKENGSTRFCMGAAWRDLAGRKRGFERILEMVREVRGMGMEVCTTLGMLSPEQARQLKEA  176

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP +ITTR+YDDRLET+  VR+AGISVCSGGI+GLGE+D DR+GL
Sbjct  177  GLTAYNHNLDTSREFYPQVITTRSYDDRLETISAVRDAGISVCSGGILGLGESDSDRVGL  236

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            ++ +A +P HPES P+NALV + GTPLE   PV +  +IR IATAR+ MP  ++RL+AGR
Sbjct  237  IYEVANMPEHPESFPVNALVPIPGTPLEGNDPVSVHILIRTIATARVAMPATIIRLAAGR  296

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLM-----------FKMLGLIPKP  273
                  +Q +CF+AGAN++FTGE++LTTP + +D D+ M           F+ +G+  K 
Sbjct  297  NTLDETDQAMCFMAGANAVFTGEQMLTTPCSPWDEDKAMMGRWGLDGMRSFEQVGVAKKE  356

Query  272  PKFLEDSEGENTEEA  228
               LE +E   T ++
Sbjct  357  AARLEQAEIRQTTKS  371


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W + EI+ IYD+PLLDL+F  A VHR   +  ++Q CTL+ 
Sbjct  33    RHNWKKDEIQQIYDTPLLDLVFRAASVHRQHHDPTKIQLCTLMN  76



>ref|WP_026775474.1| biotin synthase [Polaribacter sp. Hel_I_88]
Length=365

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/230 (61%), Positives = 177/230 (77%), Gaps = 1/230 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            A+E+GS+  C+GAAWR+ +     F+Q+LD V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   ARESGSSRVCMGAAWRN-VKDGPEFDQVLDMVRTINKLDMEVCCTLGMVTENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLD+S EYY  +I+TR Y DRL+T++NVR+  ++VCSGGIIG+GE  +DR G+
Sbjct  148  GLYAYNHNLDSSEEYYKEVISTRGYQDRLDTIDNVRKTNVTVCSGGIIGMGEKAEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PES PINALVAV+GTPLED+KPVEIWDMIRM+AT RIV+PE  VRLSAGR
Sbjct  208  LVALSTLNPQPESTPINALVAVEGTPLEDEKPVEIWDMIRMVATTRIVLPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPP  270
             + S   Q +CF AGANSIF G+KLLTTPN D + D  MFK+LGL P+ P
Sbjct  268  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFKLLGLNPQKP  317



>ref|WP_013998458.1| biotin synthase [Capnocytophaga canimorsus]
 ref|YP_004741589.1| biotin synthase [Capnocytophaga canimorsus Cc5]
 gb|AEK24482.1| Biotin synthase [Capnocytophaga canimorsus Cc5]
Length=360

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/230 (62%), Positives = 179/230 (78%), Gaps = 1/230 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +G++  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKSSGASRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLNMEVCCTLGMITENQAKRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR Y+DRL+T+ENVR+  I+VCSGGIIG+GE+ +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKEVISTRGYEDRLQTIENVRKTNITVCSGGIIGMGESLEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+EDQKPVEIW+MIRMIAT RIVMPE  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPMEDQKPVEIWEMIRMIATTRIVMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPP  270
             + S   Q +CF AGANSIF G+KLLTTPN + + D +MF+MLGL  + P
Sbjct  268  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPNINEDMMMFEMLGLRTQKP  317



>ref|WP_026706039.1| biotin synthase [Flavobacterium soli]
Length=362

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 180/230 (78%), Gaps = 1/230 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKSSGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMITENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR ++DRL+T+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKEVISTRGFEDRLQTIENVRKTNVTVCSGGIIGMGESVEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTPLE++KPVEIW+MIRM+AT RI+MP+  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPLEEEKPVEIWEMIRMVATTRIIMPQTQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPP  270
            +  S   Q +CF AGANSIF G+KLLTTPN D + D  MF+MLGLIP+ P
Sbjct  268  MNMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFEMLGLIPQKP  317



>ref|XP_009854465.1| biotin synthase [Neurospora tetrasperma FGSC 2508]
 gb|EGO54514.1| biotin synthase [Neurospora tetrasperma FGSC 2508]
 gb|EGZ68034.1| biotin synthase [Neurospora tetrasperma FGSC 2509]
Length=439

 Score =   290 bits (741),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 183/248 (74%), Gaps = 11/248 (4%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRKTN   I   VK +R +GME C TLGM+++ QA EL+ A
Sbjct  166  AKENGSTRFCMGAAWRDMRGRKTNLKNIKAMVKGVRELGMEACVTLGMIDQNQAAELRDA  225

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHN+DTSREYYPN+ITTRTYD+RL T+ NVR+AGI VCSGGI+GLGE D DR+  
Sbjct  226  GLTAYNHNVDTSREYYPNVITTRTYDERLTTINNVRQAGIHVCSGGILGLGEDDADRVSF  285

Query  599  lhtlatlpthPESVPINALVAVKGTPLED-----------QKPVEIWDMIRMIATARIVM  453
            L+T+AT+ +HPES PINALV +KGTPL D           +  V   D +RM+ATAR+V+
Sbjct  286  LYTVATMESHPESFPINALVPIKGTPLGDASAAKSETGEPESTVTFHDTVRMVATARLVL  345

Query  452  PEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            P +++RL+AGR+  +  EQ LCF+AGAN+IFTGEK+LTTP + +D D+ MF   GL P  
Sbjct  346  PGSVIRLAAGRINLTESEQALCFMAGANAIFTGEKMLTTPCSGWDEDKAMFDRWGLRPML  405

Query  272  PKFLEDSE  249
            P  L  SE
Sbjct  406  PDELHGSE  413



>ref|WP_035630262.1| biotin synthase [Flavobacterium enshiense]
 gb|KGO96125.1| biotin synthase [Flavobacterium enshiense DK69]
Length=366

 Score =   287 bits (734),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 185/242 (76%), Gaps = 2/242 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGML + QA  L +A
Sbjct  90   AKSSGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMLTENQAQRLAEA  148

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR ++DRL+T+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  149  GLYAYNHNLDTSEEYYKEVISTRGFEDRLQTIENVRKTNVTVCSGGIIGMGESIEDRAGM  208

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+ED+KPVEIW+MIRM+AT RIVMPE  VRLSAGR
Sbjct  209  LVALSTLNPQPESVPINALVAVEGTPMEDEKPVEIWEMIRMVATTRIVMPETQVRLSAGR  268

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
             + S   Q +CF AGANSIF G+KLLTTPN D + D  MF++LGL P+ P F++  + E 
Sbjct  269  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFELLGLQPQKP-FIKLMQPET  327

Query  239  TE  234
             E
Sbjct  328  VE  329



>ref|WP_026904826.1| biotin synthase [Pedobacter glucosidilyticus]
Length=332

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 176/228 (77%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE G++  C+GAAWR+    + +F++++D VK +  M MEVCCTLGML   QA  L  A
Sbjct  89   AKEGGASRLCMGAAWREVRDNR-DFDKVIDMVKAVNEMDMEVCCTLGMLNADQAQRLADA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS E Y  II+TRTYDDRL+T+ENVR+A ++VCSGGIIGLGE  +DR+ +
Sbjct  148  GLYAYNHNLDTSEEDYKRIISTRTYDDRLQTIENVRKAKLTVCSGGIIGLGETVNDRVSM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  LA +P HPESVP+NALV VKGTPLE+Q  V IWDMIRMIATARI+MP+  VRLSAGR
Sbjct  208  LRVLANMPQHPESVPVNALVPVKGTPLENQPRVPIWDMIRMIATARIIMPKTCVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
               S  EQ LCF+AGANSIF G+KLLTTPN D+  D  MF++LGL P+
Sbjct  268  TEMSTIEQALCFMAGANSIFAGDKLLTTPNPDFKDDMAMFELLGLTPR  315



>ref|WP_002704409.1| biotin synthase [Microscilla marina]
 gb|EAY24670.1| biotin synthase [Microscilla marina ATCC 23134]
Length=334

 Score =   286 bits (731),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/232 (61%), Positives = 177/232 (76%), Gaps = 1/232 (0%)
 Frame = -1

Query  971  LHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALE  792
            +   AK+AGS+  C+GAAWR+    + +F+++L+ VK +  M MEVCCTLGML   QA +
Sbjct  83   MAKEAKDAGSSRVCMGAAWREVRDNR-DFDRVLEMVKAVNDMDMEVCCTLGMLNANQAQK  141

Query  791  LKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDD  612
            L  AGL AYNHN+DTS EYY  +ITTRTY DRL T+ N REAG++VCSGGI+GLGE D D
Sbjct  142  LADAGLYAYNHNVDTSEEYYSEVITTRTYKDRLNTINNAREAGLTVCSGGIVGLGETDKD  201

Query  611  RIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRL  432
            R+G+L  L+ L  HP+SVPINALV ++GTPLEDQ  V I DM+RMIATARI+MP+ +VRL
Sbjct  202  RVGMLKVLSNLHPHPDSVPINALVRIEGTPLEDQPKVPIQDMVRMIATARILMPKTVVRL  261

Query  431  SAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPK  276
            SAGR   S+ EQ +CF+AGANSIF G+KLLTTPN D+  D  MF +LGL P+
Sbjct  262  SAGRTEMSLSEQAMCFMAGANSIFAGDKLLTTPNPDFKDDMEMFDILGLAPR  313


 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             +HDWT  EI++IY+ PLLDL+F  A +HR   ++ EVQ  +L+ 
Sbjct  3     KHDWTLAEIEAIYNKPLLDLMFEAASIHRQNKDYAEVQISSLIS  46



>emb|CCD52022.1| similar to biotin synthase [Botrytis cinerea T4]
 gb|EMR87227.1| putative biotin synthase protein [Botrytis cinerea BcDW1]
Length=414

 Score =   288 bits (738),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 182/227 (80%), Gaps = 0/227 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK+ GST FC+GAAWRD  GRKTN   +   V +IRGMGMEVC TLGM++ +QA ELK+A
Sbjct  152  AKDNGSTRFCMGAAWRDMRGRKTNLKNVKTMVSEIRGMGMEVCVTLGMIDAEQAQELKEA  211

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHN+DTSR++YP +ITTR+YD+RL T++NVR+AGI+VC+GGI+GLGE   D IGL
Sbjct  212  GLTAYNHNVDTSRDFYPKVITTRSYDERLNTIKNVRDAGINVCTGGILGLGENKSDHIGL  271

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L T+ATLP+HPES P+N LVA+KGTPLE  K VE  +M+RM+ATARIVMP+ +VRL+AGR
Sbjct  272  LETVATLPSHPESFPVNMLVAIKGTPLEGNKKVEFENMLRMVATARIVMPKTIVRLAAGR  331

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP  279
               S  +Q LCF+AGAN++FTGEK+LTTP   +  D ++F   GL P
Sbjct  332  GELSEEQQVLCFMAGANAVFTGEKMLTTPAVGWGVDSVVFNRWGLRP  378



>ref|XP_001828414.2| biotin synthase [Coprinopsis cinerea okayama7#130]
 gb|EAU93406.2| biotin synthase [Coprinopsis cinerea okayama7#130]
Length=351

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 179/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRK  F +IL  V+++RGMGMEVC TLGML  +QA +LK+A
Sbjct  103  AKENGSTRFCMGAAWRDLAGRKRGFERILQMVREVRGMGMEVCTTLGMLSPEQARQLKEA  162

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP +ITTR+YD+RL+T+  VREAGISVCSGGI+GLGE+D DR+GL
Sbjct  163  GLTAYNHNLDTSREFYPQVITTRSYDERLDTIAAVREAGISVCSGGILGLGESDADRVGL  222

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++ +P HPES P+NALV ++GTPLE  + V    ++R IATARIVMP+ ++RL+AGR
Sbjct  223  IWEVSNMPEHPESFPVNALVPIEGTPLEKNERVPHHTLLRTIATARIVMPKTIIRLAAGR  282

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
               S  EQ +CF+AGAN++FTGE++LTTP + +D D+ M    GL
Sbjct  283  NTLSEAEQAMCFMAGANAVFTGEQMLTTPCSPWDEDKAMMSRWGL  327


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLL  959
             RHDW R EI++IYDSPL++L+F  A +HR   +  ++Q CTL+
Sbjct  19    RHDWRREEIQTIYDSPLMELVFRAASIHRQHQDPSKIQLCTLM  61



>ref|WP_036121363.1| biotin synthase [Mangrovimonas yunxiaonensis]
 gb|KFB01406.1| biotin synthase [Mangrovimonas yunxiaonensis]
Length=364

 Score =   286 bits (733),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 182/242 (75%), Gaps = 2/242 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGML + QA  L +A
Sbjct  89   AKASGSSRVCMGAAWRN-VKDGEEFDQVLEMVRTINKLDMEVCCTLGMLTENQAKRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLD+S EYY  +I+TR ++DRLET+ NVR+  ++VCSGGIIG+GE  +DR G+
Sbjct  148  GLYAYNHNLDSSEEYYKEVISTRGFEDRLETIGNVRKTNVTVCSGGIIGMGEKTEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTPLEDQKPV IWDM+RM+AT RIVMPE  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPLEDQKPVSIWDMVRMVATTRIVMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
             + +   Q +CF AGANSIF G+KLLTTPN D + D  MF+MLGL P+ P F++  + E 
Sbjct  268  TQMTREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMEMFEMLGLNPQKP-FIKKMQPET  326

Query  239  TE  234
             E
Sbjct  327  VE  328



>ref|XP_007821645.1| biotin synthase, putative [Metarhizium robertsii ARSEF 23]
Length=402

 Score =   288 bits (736),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 183/228 (80%), Gaps = 0/228 (0%)
 Frame = -1

Query  962  SAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKK  783
            +AKE GST FC+GAAWRD  GRK +   I + VK ++ MGMEVC TLGM++ +QA +LK+
Sbjct  155  TAKENGSTRFCMGAAWRDMRGRKNSLKNITEMVKGVKAMGMEVCVTLGMIDAEQAKQLKE  214

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGLTAYNHN+DTSRE+YP+IITTR+YD+RL+TL NVR+AGI+VCSGGI+GLGE+ +DR+G
Sbjct  215  AGLTAYNHNVDTSREFYPSIITTRSYDERLKTLSNVRDAGINVCSGGILGLGESSEDRVG  274

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            LLHT++TLP+HPES P+NALV +KGTPL D  P+    M+R IATARIVMP  ++R++AG
Sbjct  275  LLHTVSTLPSHPESFPVNALVPIKGTPLGDTTPIAFTSMLRTIATARIVMPATIIRIAAG  334

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP  279
            R   S  +Q LCF+AGAN+IFTGEK+LTT  N +D D  MF   GL P
Sbjct  335  RKTMSEEKQALCFMAGANAIFTGEKMLTTDCNGWDEDSAMFGRWGLEP  382



>ref|WP_038267410.1| biotin synthase [Zhouia amylolytica]
 gb|ETN94650.1| BioB protein [Zhouia amylolytica AD3]
Length=367

 Score =   286 bits (733),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 145/242 (60%), Positives = 186/242 (77%), Gaps = 2/242 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK++GS+  C+GAAWR+ +     F ++L+ V+ I  + MEVCCTLGML + QA  L +A
Sbjct  89   AKQSGSSRVCMGAAWRN-VKDGPEFEEVLEMVRTINKLDMEVCCTLGMLTENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR Y+DRL+T++NVR+  ++VCSGGIIG+GE  +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKEVISTRGYEDRLQTIDNVRKTNVTVCSGGIIGMGEKLEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L +L+TL  HPESVPINALVAV+GTP+E+Q+PVEIWDM+RM+AT RIVMPE  VRLSAGR
Sbjct  208  LVSLSTLNPHPESVPINALVAVEGTPMEEQQPVEIWDMLRMVATTRIVMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
             + S   Q +CF AGANSIF G+KLLTTPN D + D  MFKMLGL P+ P F +  + + 
Sbjct  268  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMEMFKMLGLNPQKP-FTKKVQPQT  326

Query  239  TE  234
            TE
Sbjct  327  TE  328



>ref|WP_023570443.1| biotin synthase [Flavobacterium cauense]
 gb|ESU19894.1| biotin synthase [Flavobacterium cauense R2A-7]
 gb|KGO83700.1| biotin synthase [Flavobacterium cauense R2A-7]
Length=362

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/242 (60%), Positives = 184/242 (76%), Gaps = 2/242 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGML + QA  L +A
Sbjct  90   AKSGGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMLTENQAHRLAEA  148

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS +YY  +I+TR ++DRL+T+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  149  GLYAYNHNLDTSEDYYKEVISTRGFEDRLQTIENVRKTNVTVCSGGIIGMGESIEDRAGM  208

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+ED+KPVEIW+MIRM+AT RIVMPE  VRLSAGR
Sbjct  209  LVALSTLNPQPESVPINALVAVEGTPMEDEKPVEIWEMIRMVATTRIVMPETQVRLSAGR  268

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
             + S   Q +CF AGANSIF G+KLLTTPN D + D  MF+MLGL P+ P F++  + E 
Sbjct  269  TQMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFEMLGLQPQKP-FIKLMQPET  327

Query  239  TE  234
             E
Sbjct  328  VE  329



>ref|WP_039110475.1| biotin synthase [Flavobacterium sp. AED]
 gb|KIA84877.1| biotin synthase [Flavobacterium sp. AED]
Length=361

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 187/246 (76%), Gaps = 2/246 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKSSGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMITENQAHRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR ++DRL+T+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKEVISTRGFEDRLQTIENVRKTNVTVCSGGIIGMGESIEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+E++KPVEIW+MIRM+AT RI+MPE  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPMEEEKPVEIWEMIRMVATTRIIMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            +  S   Q +CF AGANSIF G+KLLTTPN D + D  MF+MLGL P+ P F + S+ + 
Sbjct  268  MNMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFEMLGLNPQKP-FTKVSQPQT  326

Query  239  TEEALS  222
             E A S
Sbjct  327  VEAADS  332



>ref|WP_016991098.1| biotin synthase [Flavobacterium sp. ACAM 123]
Length=361

 Score =   286 bits (732),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 188/246 (76%), Gaps = 2/246 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE+GS+  C+GAAWR+ +    +F+Q+L+ V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKESGSSRVCMGAAWRN-VKDGPDFDQVLEMVRTINKLEMEVCCTLGMITENQAHRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR ++DRL+T+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKEVISTRGFEDRLQTIENVRKTNVTVCSGGIIGMGESIEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALV V+GTP+E++KPVEIW+MIRM+AT+RI+MPE  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVPVEGTPMEEEKPVEIWEMIRMVATSRIIMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
            +  S   Q +CF AGANSIF G+KLLTTPN D + D  MF+MLGL P+ P F + S+   
Sbjct  268  MNMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMKMFEMLGLNPQKP-FTKVSQPAT  326

Query  239  TEEALS  222
             E A S
Sbjct  327  VEAANS  332



>ref|XP_956564.1| biotin synthase [Neurospora crassa OR74A]
 gb|EAA27328.1| biotin synthase [Neurospora crassa OR74A]
 gb|KHE86280.1| hypothetical protein GE21DRAFT_9189 [Neurospora crassa]
Length=439

 Score =   289 bits (739),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/248 (59%), Positives = 183/248 (74%), Gaps = 11/248 (4%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRKTN   I   V  +R +GME C TLGM+++ QA EL+ A
Sbjct  166  AKENGSTRFCMGAAWRDMRGRKTNLKNIKAMVSGVRELGMEACVTLGMIDESQAAELRDA  225

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHN+DTSREYYPN+ITTRTYD+RL+T+ NVR+AGI VCSGGI+GLGE D DR+  
Sbjct  226  GLTAYNHNVDTSREYYPNVITTRTYDERLKTINNVRQAGIHVCSGGILGLGEDDTDRVSF  285

Query  599  lhtlatlpthPESVPINALVAVKGTPLED-----------QKPVEIWDMIRMIATARIVM  453
            L+T+AT+ +HPES PINALV +KGTPL D           +  V   D +RM+ATAR+V+
Sbjct  286  LYTVATMESHPESFPINALVPIKGTPLGDASAAKSETGEPESTVTFHDTVRMVATARLVL  345

Query  452  PEAMVRLSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            P +++RL+AGR+  +  EQ LCF+AGAN+IFTGEK+LTTP + +D D+ MF   GL P  
Sbjct  346  PGSVIRLAAGRINLTESEQALCFMAGANAIFTGEKMLTTPCSGWDEDKAMFDRWGLRPML  405

Query  272  PKFLEDSE  249
            P  L  SE
Sbjct  406  PDELHGSE  413



>gb|KFG78056.1| putative biotin synthase [Metarhizium anisopliae]
 gb|KID68871.1| Biotin synthase, partial [Metarhizium anisopliae ARSEF 549]
Length=419

 Score =   288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 150/249 (60%), Positives = 189/249 (76%), Gaps = 6/249 (2%)
 Frame = -1

Query  974  TLHSSAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQAL  795
            T   +AKE GST FC+GAAWRD  GRK +   I + VK ++ MGMEVC TLGM++ +QA 
Sbjct  168  TAARTAKENGSTRFCMGAAWRDMRGRKNSLKNITEMVKGVKAMGMEVCVTLGMIDAEQAK  227

Query  794  ELKKAGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADD  615
            +LK+AGLTAYNHN+DTSRE+YP+IITTR+YD+RL+TL NVR+AGI+VCSGGI+GLGE+ +
Sbjct  228  QLKEAGLTAYNHNVDTSREFYPSIITTRSYDERLKTLSNVRDAGINVCSGGILGLGESSE  287

Query  614  DRIGllhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVR  435
            DR+GLLHT++TLP+HPES P+NALV +KGTPL D  P+    M+R IATARIVMP  ++R
Sbjct  288  DRVGLLHTVSTLPSHPESFPVNALVPIKGTPLGDTTPIAFTSMLRTIATARIVMPATIIR  347

Query  434  LSAGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP------KP  273
            ++AGR   S  +Q LCF+AGAN+IFTGEK+LTT  N +D D  MF   GL P      KP
Sbjct  348  IAAGRKTMSEEKQALCFMAGANAIFTGEKMLTTDCNGWDEDSAMFGRWGLEPMKSFDKKP  407

Query  272  PKFLEDSEG  246
             K   D E 
Sbjct  408  VKGAGDIEA  416



>ref|XP_007325395.1| hypothetical protein AGABI1DRAFT_110110 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM83448.1| hypothetical protein AGABI1DRAFT_110110 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=375

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 179/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRK  F +IL+ V+++RGMGMEVC TLGML  +QA +LK+A
Sbjct  117  AKENGSTRFCMGAAWRDLSGRKRGFERILEMVREVRGMGMEVCTTLGMLTPEQARKLKEA  176

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP +ITTR+YDDRLET+  VR+AGISVCSGGI+GLGE D DRIGL
Sbjct  177  GLTAYNHNLDTSREFYPQVITTRSYDDRLETINAVRDAGISVCSGGILGLGETDADRIGL  236

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++ +P HPES P+NALV + GTPLE+ +PV    ++R IATARIV+P  ++RL+AGR
Sbjct  237  IWEVSCMPEHPESFPVNALVPIPGTPLENNEPVPHHTLVRTIATARIVLPTTIIRLAAGR  296

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
               S  EQ +CF+AGAN++FTG+++LTTP + +D D+ +    GL
Sbjct  297  NTLSEAEQVMCFMAGANAVFTGDQMLTTPCSPWDEDKALMGRWGL  341


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W R EIK IY+SPL+DL+F    +HR   + Q++Q CTL+ 
Sbjct  33    RHNWRRQEIKDIYNSPLMDLVFRATSIHRQHHDPQKIQLCTLMN  76



>ref|XP_009268729.1| Biotin synthase [Wallemia ichthyophaga EXF-994]
 gb|EOR00288.1| Biotin synthase [Wallemia ichthyophaga EXF-994]
Length=386

 Score =   287 bits (734),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/247 (60%), Positives = 191/247 (77%), Gaps = 2/247 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK AGST FC+GAAWRD  GRK  F++IL  V++I+GMGMEVC TLGML  +QA+ LK A
Sbjct  133  AKNAGSTRFCMGAAWRDVGGRKRGFDRILAMVREIKGMGMEVCTTLGMLSSEQAIALKDA  192

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSREYYP +IT+R+YDDRL T+ NVR+AGISVCSGGI+GLGE  DDR+GL
Sbjct  193  GLTAYNHNLDTSREYYPEVITSRSYDDRLSTISNVRDAGISVCSGGILGLGEQQDDRVGL  252

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  L+ LP HPES P+NALV +KGTPLE+  PV + +++R IATARIVMP+++VR++AGR
Sbjct  253  IWELSRLPEHPESFPVNALVPIKGTPLENNTPVAVEEVVRTIATARIVMPKSIVRIAAGR  312

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP-KPPKFLEDSEGE  243
              F+  EQ +CF++GAN+IF+G  +LTT   + D D  +F+  GL P +P + +ED+   
Sbjct  313  KMFTDAEQAMCFMSGANAIFSG-YMLTTDGVEKDQDAELFEKWGLQPMRPYENVEDTYEN  371

Query  242  NTEEALS  222
              + A S
Sbjct  372  KIQAAPS  378



>ref|XP_009536616.1| hypothetical protein PHYSODRAFT_340219 [Phytophthora sojae]
 gb|EGZ08444.1| hypothetical protein PHYSODRAFT_340219 [Phytophthora sojae]
Length=379

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/227 (65%), Positives = 185/227 (81%), Gaps = 3/227 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK AGST FC+G+AWR+ +G+K  F  ILD V+Q++ M +EVCCTLGML ++QA++LK+A
Sbjct  124  AKAAGSTRFCMGSAWRE-VGKKNAFRHILDMVRQVKAMDLEVCCTLGMLTEEQAVQLKEA  182

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL+AYNHNLDTSRE+Y  +ITTRTYDDRL+T+ENVR+AGISVC GGI+GLGE   DR+GL
Sbjct  183  GLSAYNHNLDTSREHYAKVITTRTYDDRLKTIENVRKAGISVCCGGILGLGEDKIDRVGL  242

Query  599  lhtlatlpthPESVPINALVAVKGTPL--EDQKPVEIWDMIRMIATARIVMPEAMVRLSA  426
            LHTLAT+  HPESVP+NALV+V+GTPL  ED  PV   DM RMIATARI+MP+ MVRLSA
Sbjct  243  LHTLATMDEHPESVPVNALVSVEGTPLFDEDIAPVTASDMARMIATARILMPKTMVRLSA  302

Query  425  GRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
            GR+ F+  EQ + F+AGANSIF G+ LLTT N  ++ D+ +F+  GL
Sbjct  303  GRMSFTDAEQGMMFMAGANSIFNGDTLLTTANPAFEKDKRLFESFGL  349


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RHDWT+ E+++I+D PLL+L++  A VHR   +  EVQ CTLL 
Sbjct  40    RHDWTKEEVQAIFDQPLLELVYKAATVHRMHFDPTEVQQCTLLS  83



>ref|WP_039113228.1| MULTISPECIES: biotin synthase [Flavobacterium]
 gb|KIA98286.1| biotin synthase [Flavobacterium sp. KMS]
 gb|KIC02409.1| biotin synthase [Flavobacterium sp. JRM]
Length=361

 Score =   286 bits (732),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/242 (59%), Positives = 183/242 (76%), Gaps = 2/242 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKSSGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMITENQAQRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS EYY  +I+TR ++DRL+T+ENVR+  ++VCSGGIIG+GE+ +DR G+
Sbjct  148  GLYAYNHNLDTSEEYYKEVISTRGFEDRLQTIENVRKTNVTVCSGGIIGMGESIEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L+TL   PESVPINALVAV+GTP+E++KPVEIW+MIRM+AT RI+MPE  VRLSAGR
Sbjct  208  LVALSTLNPQPESVPINALVAVEGTPMEEEKPVEIWEMIRMVATTRIIMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPPKFLEDSEGEN  240
               S   Q +CF AGANSIF G+KLLTTPN D   D  MF +LGLIP+ P F + S+ E 
Sbjct  268  TNMSREGQAMCFFAGANSIFAGDKLLTTPNPDVHEDMKMFDLLGLIPQKP-FTKVSQPET  326

Query  239  TE  234
             E
Sbjct  327  VE  328



>ref|XP_006454758.1| hypothetical protein AGABI2DRAFT_189996 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV51781.1| hypothetical protein AGABI2DRAFT_189996 [Agaricus bisporus var. 
bisporus H97]
Length=375

 Score =   286 bits (733),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 179/225 (80%), Gaps = 0/225 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKE GST FC+GAAWRD  GRK  F +IL+ V+++RGMGMEVC TLGML  +QA +LK+A
Sbjct  117  AKENGSTRFCMGAAWRDLSGRKRGFERILEMVREVRGMGMEVCTTLGMLSPEQARKLKEA  176

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GLTAYNHNLDTSRE+YP +ITTR+YDDRLET+  VR+AGISVCSGGI+GLGE D DRIGL
Sbjct  177  GLTAYNHNLDTSREFYPQVITTRSYDDRLETINAVRDAGISVCSGGILGLGETDADRIGL  236

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            +  ++ +P HPES P+NALV + GTPLE+ +PV    ++R IATARIV+P  ++RL+AGR
Sbjct  237  IWEISCMPEHPESFPVNALVPIPGTPLENNEPVPHHTLVRTIATARIVLPTTIIRLAAGR  296

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGL  285
               S  EQ +CF+AGAN++FTG+++LTTP + +D D+ +    GL
Sbjct  297  NTLSEAEQVMCFMAGANAVFTGDQMLTTPCSPWDEDKALMGRWGL  341


 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/44 (50%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -2

Query  1087  RHDWTRPEIKSIYDSPLLDLLFHGAQVHRHGLNFQEVQHCTLLQ  956
             RH+W R EIK IY+SPL+DL+F    +HR   + Q++Q CTL+ 
Sbjct  33    RHNWRRQEIKDIYNSPLMDLVFRATSIHRQHHDPQKIQLCTLMN  76



>ref|XP_007803846.1| Biotin synthase [Endocarpon pusillum Z07020]
 gb|ERF70493.1| Biotin synthase [Endocarpon pusillum Z07020]
Length=405

 Score =   287 bits (735),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 148/228 (65%), Positives = 182/228 (80%), Gaps = 1/228 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK  GS  FC+GAAWRD  GRK+    I+  VK +R MGME C TLGML K+QALELK+A
Sbjct  145  AKGNGSNRFCMGAAWRDMRGRKSGLKNIVQMVKGVREMGMEACVTLGMLNKEQALELKEA  204

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEA-DDDRIG  603
            GLTAYNHNLDTSRE+YPN+ITTR+YD+RLET+ENVR+AGI VCSGGI+GLGE    D +G
Sbjct  205  GLTAYNHNLDTSREHYPNVITTRSYDERLETIENVRQAGIHVCSGGILGLGETPQTDHVG  264

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            L+HTLATLP+HPES P+N LVA+  TP+   +PV++ D++R IATAR+VMP+ +VRL+AG
Sbjct  265  LIHTLATLPSHPESFPVNRLVAIPNTPMYGSEPVKLEDLVRCIATARLVMPKTIVRLAAG  324

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP  279
            RV     EQ LCF+AGAN+IFTGEK+LTTP N +D D+ MF+  GL P
Sbjct  325  RVGMPESEQMLCFMAGANAIFTGEKMLTTPCNGWDEDKAMFERWGLQP  372



>ref|WP_036157176.1| biotin synthase [Maribacter forsetii]
Length=364

 Score =   286 bits (732),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/230 (61%), Positives = 177/230 (77%), Gaps = 1/230 (0%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AK +GS+  C+GAAWR+ +     F+Q+L+ V+ I  + MEVCCTLGM+ + QA  L +A
Sbjct  89   AKASGSSRVCMGAAWRN-VKDGPEFDQVLEMVRTINKLDMEVCCTLGMITENQAKRLAEA  147

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL AYNHNLDTS +YY ++I+TR ++DRL+T+ENVR++ ++VCSGGIIG+GEA +DR G+
Sbjct  148  GLYAYNHNLDTSEDYYKDVISTRAFEDRLDTIENVRKSNVTVCSGGIIGMGEALEDRAGM  207

Query  599  lhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAGR  420
            L  L +L   PESVPINALVAV+GTP+ED +PV IWDMIRM+AT RIVMPE  VRLSAGR
Sbjct  208  LVALTSLNPQPESVPINALVAVEGTPMEDIEPVSIWDMIRMVATTRIVMPETQVRLSAGR  267

Query  419  VRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKPP  270
               S   Q +CF AGANSIF G+KLLTTPN D + D  MFKMLGL P+ P
Sbjct  268  TEMSREGQAMCFFAGANSIFAGDKLLTTPNPDVNEDMAMFKMLGLNPQKP  317



>gb|EXV04565.1| biotin synthase domain protein [Metarhizium robertsii]
 gb|EFY99398.2| Biotin synthase [Metarhizium robertsii ARSEF 23]
Length=419

 Score =   288 bits (737),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 144/228 (63%), Positives = 183/228 (80%), Gaps = 0/228 (0%)
 Frame = -1

Query  962  SAKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKK  783
            +AKE GST FC+GAAWRD  GRK +   I + VK ++ MGMEVC TLGM++ +QA +LK+
Sbjct  172  TAKENGSTRFCMGAAWRDMRGRKNSLKNITEMVKGVKAMGMEVCVTLGMIDAEQAKQLKE  231

Query  782  AGLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIG  603
            AGLTAYNHN+DTSRE+YP+IITTR+YD+RL+TL NVR+AGI+VCSGGI+GLGE+ +DR+G
Sbjct  232  AGLTAYNHNVDTSREFYPSIITTRSYDERLKTLSNVRDAGINVCSGGILGLGESSEDRVG  291

Query  602  llhtlatlpthPESVPINALVAVKGTPLEDQKPVEIWDMIRMIATARIVMPEAMVRLSAG  423
            LLHT++TLP+HPES P+NALV +KGTPL D  P+    M+R IATARIVMP  ++R++AG
Sbjct  292  LLHTVSTLPSHPESFPVNALVPIKGTPLGDTTPIAFTSMLRTIATARIVMPATIIRIAAG  351

Query  422  RVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIP  279
            R   S  +Q LCF+AGAN+IFTGEK+LTT  N +D D  MF   GL P
Sbjct  352  RKTMSEEKQALCFMAGANAIFTGEKMLTTDCNGWDEDSAMFGRWGLEP  399



>ref|XP_002181331.1| biotin synthase [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47254.1| biotin synthase [Phaeodactylum tricornutum CCAP 1055/1]
Length=437

 Score =   288 bits (738),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 182/232 (78%), Gaps = 3/232 (1%)
 Frame = -1

Query  959  AKEAGST*FCIGAAWRDTIGRKTNFNQILDYVKQIRGMGMEVCCTLGMLEKQQALELKKA  780
            AKEAGST FC+GAAWR+   +K  F  IL+ V+ + GMG+EVCCTLGML  +QA +LK+A
Sbjct  174  AKEAGSTRFCMGAAWRELGNKKNAFGHILEMVRGVNGMGLEVCCTLGMLNAEQAKQLKEA  233

Query  779  GLTAYNHNLDTSREYYPNIITTRTYDDRLETLENVREAGISVCSGGIIGLGEADDDRIGl  600
            GL+AYNHNLDTS E+YP +I+TR+Y+DRL T+ NVR+AGISVC GGI+GLGE + DR+GL
Sbjct  234  GLSAYNHNLDTSPEHYPKVISTRSYEDRLNTIANVRDAGISVCCGGILGLGEEEKDRVGL  293

Query  599  lhtlatlpthPESVPINALVAVKGTPL---EDQKPVEIWDMIRMIATARIVMPEAMVRLS  429
            LH LATLP HPESVPINALVAV+GTPL   ED   V+ + M RMIATARIVMP  MVRLS
Sbjct  294  LHVLATLPEHPESVPINALVAVEGTPLGDSEDISRVDAFAMARMIATARIVMPRTMVRLS  353

Query  428  AGRVRFSMPEQTLCFLAGANSIFTGEKLLTTPNNDYDADQLMFKMLGLIPKP  273
            AGR+ FS  EQ L F AGANSIF G+KLLTT N ++D DQ +F+  G   KP
Sbjct  354  AGRLSFSDAEQYLMFQAGANSIFNGDKLLTTANPEFDQDQALFRKFGFQGKP  405



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4018413329892