BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25447_g6_i1 len=1303 path=[30782:0-1156 437:1157-1302]

Length=1303
                                                                      Score     E

ref|XP_011084946.1|  PREDICTED: laccase-4-like                          649   0.0      
ref|XP_009590412.1|  PREDICTED: laccase-4-like                          647   0.0      
emb|CDP14064.1|  unnamed protein product                                625   0.0      
gb|EYU41257.1|  hypothetical protein MIMGU_mgv1a003880mg                623   0.0      
gb|EPS61127.1|  laccase 3                                               613   0.0      
ref|XP_002265173.1|  PREDICTED: laccase-4-like                          607   0.0      Vitis vinifera
emb|CBI31539.3|  unnamed protein product                                596   0.0      
ref|XP_010104683.1|  hypothetical protein L484_022066                   595   0.0      
gb|KDP46534.1|  hypothetical protein JCGZ_08506                         593   0.0      
ref|XP_011035200.1|  PREDICTED: laccase-4                               593   0.0      
gb|KDO69098.1|  hypothetical protein CISIN_1g008799mg                   592   0.0      
ref|XP_006435668.1|  hypothetical protein CICLE_v10031134mg             592   0.0      
ref|XP_002520425.1|  laccase, putative                                  588   0.0      Ricinus communis
ref|XP_002316233.1|  hypothetical protein POPTR_0010s20050g             588   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007009094.1|  Laccase/Diphenol oxidase family protein            587   0.0      
ref|XP_002314124.1|  hypothetical protein POPTR_0009s04720g             586   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010262771.1|  PREDICTED: laccase-4-like                          585   0.0      
ref|XP_011036009.1|  PREDICTED: laccase-4-like                          585   0.0      
ref|XP_011039810.1|  PREDICTED: laccase-4-like                          585   0.0      
ref|XP_002311202.1|  laccase family protein                             585   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002299828.2|  hypothetical protein POPTR_0001s25580g             584   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011077581.1|  PREDICTED: laccase-4-like                          582   0.0      
ref|XP_008785423.1|  PREDICTED: laccase-22                              579   0.0      
ref|XP_011032154.1|  PREDICTED: laccase-4-like isoform X2               579   0.0      
ref|XP_009799024.1|  PREDICTED: laccase-4-like                          578   0.0      
gb|KHG28836.1|  Laccase-22                                              578   0.0      
gb|KDO53232.1|  hypothetical protein CISIN_1g0093922mg                  575   0.0      
ref|XP_006429309.1|  hypothetical protein CICLE_v10011400mg             577   0.0      
ref|XP_010923124.1|  PREDICTED: laccase-22                              577   0.0      
ref|XP_009624727.1|  PREDICTED: laccase-4-like                          577   0.0      
ref|XP_010104682.1|  hypothetical protein L484_022065                   577   0.0      
ref|XP_010256659.1|  PREDICTED: laccase-4                               575   0.0      
gb|KHN06247.1|  Laccase-4                                               575   0.0      
ref|XP_002322961.2|  hypothetical protein POPTR_0016s11950g             575   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009350996.1|  PREDICTED: laccase-4-like                          575   0.0      
ref|XP_003551299.1|  PREDICTED: laccase-4-like                          574   0.0      
gb|AAC49536.1|  diphenol oxidase                                        574   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009593041.1|  PREDICTED: laccase-4-like                          573   0.0      
ref|XP_009786393.1|  PREDICTED: laccase-4-like                          573   0.0      
ref|XP_010098906.1|  hypothetical protein L484_006544                   572   0.0      
ref|XP_003518300.1|  PREDICTED: laccase-4-like                          572   0.0      
emb|CAA74103.1|  laccase                                                571   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008233715.1|  PREDICTED: laccase-4-like                          571   0.0      
ref|XP_004500229.1|  PREDICTED: laccase-4-like                          570   0.0      
emb|CAC14719.1|  laccase                                                570   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003544873.2|  PREDICTED: laccase-4-like                          569   0.0      
ref|XP_010044087.1|  PREDICTED: laccase-4-like                          569   0.0      
ref|XP_007220829.1|  hypothetical protein PRUPE_ppa027203mg             569   0.0      
ref|XP_008449180.1|  PREDICTED: laccase-4-like                          568   0.0      
ref|XP_008392913.1|  PREDICTED: laccase-4-like                          568   0.0      
ref|XP_010041000.1|  PREDICTED: laccase-4-like                          568   0.0      
ref|XP_007016183.1|  Laccase/Diphenol oxidase family protein            568   0.0      
ref|XP_009358852.1|  PREDICTED: laccase-4-like                          568   0.0      
ref|XP_010553253.1|  PREDICTED: laccase-4                               568   0.0      
ref|XP_010067496.1|  PREDICTED: laccase-4-like                          568   0.0      
ref|XP_004147923.1|  PREDICTED: laccase-4-like                          567   0.0      
ref|XP_004490949.1|  PREDICTED: laccase-4-like                          566   0.0      
ref|XP_003544123.1|  PREDICTED: laccase-4-like                          566   0.0      
ref|XP_010044089.1|  PREDICTED: laccase-4-like                          566   0.0      
ref|XP_010101806.1|  hypothetical protein L484_023595                   566   0.0      
ref|XP_007140382.1|  hypothetical protein PHAVU_008G107100g             566   0.0      
ref|XP_010044090.1|  PREDICTED: laccase-4-like                          566   0.0      
ref|XP_011003662.1|  PREDICTED: laccase-4-like                          566   0.0      
ref|XP_007026781.1|  Laccase/Diphenol oxidase family protein isof...    565   0.0      
ref|XP_007142229.1|  hypothetical protein PHAVU_008G263100g             565   0.0      
ref|XP_010044088.1|  PREDICTED: laccase-4-like                          565   0.0      
emb|CDP06511.1|  unnamed protein product                                565   0.0      
ref|XP_008442464.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     565   0.0      
ref|XP_006387495.1|  hypothetical protein POPTR_0958s00200g             564   0.0      
ref|XP_003616564.1|  Laccase                                            568   0.0      
gb|EYU41858.1|  hypothetical protein MIMGU_mgv1a003895mg                563   0.0      
sp|Q0IQU1.2|LAC22_ORYSJ  RecName: Full=Laccase-22; AltName: Full=...    563   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002308209.2|  laccase family protein                             563   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002308208.2|  laccase family protein                             563   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008239590.1|  PREDICTED: laccase-4-like                          562   0.0      
gb|KHG18161.1|  Laccase-4 -like protein                                 562   0.0      
ref|XP_006293932.1|  hypothetical protein CARUB_v10022927mg             562   0.0      
ref|XP_002278638.1|  PREDICTED: laccase-4                               562   0.0      Vitis vinifera
gb|KEH34185.1|  laccase/diphenol oxidase family protein                 561   0.0      
ref|XP_010505418.1|  PREDICTED: laccase-4                               561   0.0      
ref|XP_011094977.1|  PREDICTED: laccase-4-like                          561   0.0      
ref|XP_010517091.1|  PREDICTED: laccase-4-like                          561   0.0      
ref|XP_002530417.1|  laccase, putative                                  561   0.0      Ricinus communis
ref|XP_004249583.1|  PREDICTED: laccase-4-like                          560   0.0      
ref|XP_004137913.1|  PREDICTED: laccase-4-like                          560   0.0      
gb|KGN65788.1|  hypothetical protein Csa_1G528530                       560   0.0      
ref|XP_004246339.1|  PREDICTED: laccase-4                               560   0.0      
ref|XP_008457399.1|  PREDICTED: laccase-4                               560   0.0      
ref|XP_006425016.1|  hypothetical protein CICLE_v10028117mg             559   0.0      
ref|XP_004308920.1|  PREDICTED: laccase-22-like                         559   0.0      
ref|XP_010529771.1|  PREDICTED: laccase-4-like                          559   0.0      
ref|XP_003558760.1|  PREDICTED: laccase-22                              559   0.0      
ref|XP_007205010.1|  hypothetical protein PRUPE_ppa003646mg             559   0.0      
ref|XP_008388134.1|  PREDICTED: laccase-4-like                          559   0.0      
gb|KHN20872.1|  Laccase-4                                               559   0.0      
ref|XP_007141799.1|  hypothetical protein PHAVU_008G226700g             559   0.0      
ref|XP_006602642.1|  PREDICTED: laccase-4-like isoform X2               558   0.0      
ref|XP_006411009.1|  hypothetical protein EUTSA_v10016460mg             559   0.0      
ref|XP_004163861.1|  PREDICTED: laccase-4-like                          558   0.0      
ref|XP_011019151.1|  PREDICTED: laccase-4 isoform X2                    558   0.0      
ref|XP_011019150.1|  PREDICTED: laccase-4 isoform X1                    558   0.0      
ref|XP_002879726.1|  IRX12/LAC4                                         558   0.0      
ref|XP_002322962.2|  laccase family protein                             558   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004490574.1|  PREDICTED: laccase-4-like                          558   0.0      
ref|XP_003522150.1|  PREDICTED: laccase-4-like                          558   0.0      
ref|XP_002533894.1|  laccase, putative                                  557   0.0      Ricinus communis
ref|XP_008377498.1|  PREDICTED: laccase-4-like                          557   0.0      
ref|XP_010037723.1|  PREDICTED: laccase-4-like                          557   0.0      
ref|XP_004294236.1|  PREDICTED: laccase-4-like                          557   0.0      
ref|XP_006663136.1|  PREDICTED: laccase-22-like                         557   0.0      
ref|XP_008220423.1|  PREDICTED: laccase-4                               556   0.0      
ref|XP_006602641.1|  PREDICTED: laccase-4-like isoform X1               556   0.0      
ref|XP_003516941.1|  PREDICTED: laccase-4-like                          556   0.0      
ref|XP_009384856.1|  PREDICTED: laccase-22-like                         556   0.0      
ref|NP_565881.1|  laccase-4                                             556   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509229.1|  PREDICTED: laccase-4-like                          556   0.0      
ref|XP_010907627.1|  PREDICTED: laccase-22-like                         555   0.0      
emb|CDX74915.1|  BnaA05g06610D                                          555   0.0      
ref|XP_003604619.1|  Laccase 1a                                         555   0.0      
ref|XP_004980096.1|  PREDICTED: laccase-22-like                         556   0.0      
ref|XP_007207096.1|  hypothetical protein PRUPE_ppa022440mg             554   0.0      
ref|XP_010543748.1|  PREDICTED: laccase-22-like                         554   0.0      
ref|XP_007146741.1|  hypothetical protein PHAVU_006G065800g             554   0.0      
ref|XP_009370205.1|  PREDICTED: laccase-4                               554   0.0      
ref|XP_006363052.1|  PREDICTED: laccase-4-like                          553   0.0      
emb|CDX91428.1|  BnaC04g07220D                                          553   0.0      
emb|CDY18406.1|  BnaA04g21810D                                          553   0.0      
ref|XP_009141718.1|  PREDICTED: laccase-4-like                          553   0.0      
ref|XP_008355354.1|  PREDICTED: laccase-4                               553   0.0      
gb|AES98533.2|  laccase/diphenol oxidase family protein                 553   0.0      
gb|KFK36706.1|  hypothetical protein AALP_AA4G158700                    552   0.0      
ref|XP_011080855.1|  PREDICTED: laccase-4                               551   0.0      
ref|XP_009787551.1|  PREDICTED: laccase-4-like                          551   0.0      
ref|XP_002280416.1|  PREDICTED: laccase-4                               551   0.0      Vitis vinifera
emb|CDX93330.1|  BnaC04g45660D                                          551   0.0      
ref|XP_010486777.1|  PREDICTED: laccase-22-like isoform X1              550   0.0      
gb|EMS48198.1|  Laccase-22                                              550   0.0      
ref|XP_010486778.1|  PREDICTED: laccase-22-like isoform X2              551   0.0      
ref|XP_003539958.2|  PREDICTED: laccase-4-like                          550   0.0      
ref|XP_009407561.1|  PREDICTED: laccase-22-like                         549   0.0      
ref|XP_009143427.1|  PREDICTED: laccase-4                               548   0.0      
ref|XP_011032153.1|  PREDICTED: laccase-4-like isoform X1               547   0.0      
ref|XP_009346884.1|  PREDICTED: laccase-4-like                          548   0.0      
ref|XP_006349470.1|  PREDICTED: laccase-4-like                          548   0.0      
gb|EYU26646.1|  hypothetical protein MIMGU_mgv1a003805mg                548   0.0      
gb|EMT26873.1|  Laccase-22                                              548   0.0      
ref|XP_006338994.1|  PREDICTED: laccase-4-like                          547   0.0      
ref|XP_008358974.1|  PREDICTED: laccase-4-like                          547   0.0      
ref|XP_004249084.1|  PREDICTED: laccase-4-like                          546   0.0      
dbj|BAJ98144.1|  predicted protein                                      547   0.0      
ref|XP_008775059.1|  PREDICTED: laccase-22-like                         546   0.0      
ref|XP_009374280.1|  PREDICTED: laccase-4-like                          546   0.0      
ref|XP_009337309.1|  PREDICTED: laccase-4-like                          546   0.0      
ref|XP_010535416.1|  PREDICTED: laccase-16                              547   0.0      
ref|XP_004302643.1|  PREDICTED: laccase-4-like                          546   0.0      
gb|AES99522.2|  laccase/diphenol oxidase family protein                 544   0.0      
ref|XP_004506788.1|  PREDICTED: laccase-4-like                          545   0.0      
ref|XP_010464832.1|  PREDICTED: laccase-22-like                         545   0.0      
ref|XP_009593274.1|  PREDICTED: laccase-4-like                          543   0.0      
ref|XP_007134763.1|  hypothetical protein PHAVU_010G0738000g            540   0.0      
ref|XP_010494695.1|  PREDICTED: laccase-22-like                         540   0.0      
ref|XP_009146739.1|  PREDICTED: laccase-22-like                         539   0.0      
emb|CDY01010.1|  BnaC05g41900D                                          538   0.0      
gb|KDO37344.1|  hypothetical protein CISIN_1g009854mg                   535   0.0      
ref|XP_010676357.1|  PREDICTED: laccase-4-like                          535   0.0      
ref|XP_003615575.1|  Laccase 1a                                         536   0.0      
gb|KFK27419.1|  hypothetical protein AALP_AA8G380300                    533   0.0      
ref|XP_010685615.1|  PREDICTED: laccase-4                               534   0.0      
ref|XP_009120399.1|  PREDICTED: laccase-16                              535   0.0      
ref|XP_010033027.1|  PREDICTED: laccase-4-like                          534   0.0      
ref|XP_008441433.1|  PREDICTED: laccase-4-like                          532   0.0      
emb|CDX80325.1|  BnaC09g34170D                                          533   0.0      
gb|KHN04832.1|  Laccase-4                                               531   0.0      
ref|XP_010454388.1|  PREDICTED: laccase-16                              529   0.0      
ref|XP_010483503.1|  PREDICTED: laccase-16-like isoform X3              529   0.0      
ref|XP_010483501.1|  PREDICTED: laccase-16-like isoform X1              529   0.0      
ref|XP_010443638.1|  PREDICTED: laccase-16-like                         527   4e-180   
ref|XP_009789473.1|  PREDICTED: laccase-4-like isoform X1               527   4e-180   
gb|EPS60103.1|  laccase 1a                                              525   2e-179   
ref|XP_006300062.1|  hypothetical protein CARUB_v10016290mg             524   3e-179   
gb|KGN45770.1|  hypothetical protein Csa_6G009490                       523   9e-179   
sp|Q1PDH6.2|LAC16_ARATH  RecName: Full=Laccase-16; AltName: Full=...    523   1e-178   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009589148.1|  PREDICTED: laccase-4-like                          521   9e-178   
ref|XP_006840270.1|  hypothetical protein AMTR_s00045p00045490          520   2e-177   
ref|XP_010543228.1|  PREDICTED: laccase-10                              519   4e-177   
ref|XP_004138572.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     518   8e-177   
ref|XP_010690098.1|  PREDICTED: laccase-4-like                          518   9e-177   
ref|XP_009416212.1|  PREDICTED: laccase-22-like                         518   1e-176   
ref|XP_004150626.1|  PREDICTED: laccase-4-like                          515   3e-176   
ref|XP_006282033.1|  hypothetical protein CARUB_v10028274mg             514   8e-176   
ref|XP_004241179.1|  PREDICTED: laccase-4-like                          514   6e-175   
gb|KCW52562.1|  hypothetical protein EUGRSUZ_J01941                     512   6e-175   
ref|XP_009789474.1|  PREDICTED: laccase-4-like isoform X2               510   4e-174   
ref|XP_006401026.1|  hypothetical protein EUTSA_v10013285mg             509   4e-174   
ref|NP_195739.2|  laccase 10                                            511   6e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398646.1|  hypothetical protein EUTSA_v10015593mg             509   3e-173   
ref|XP_006350822.1|  PREDICTED: laccase-4-like                          509   3e-173   
gb|EPS65618.1|  hypothetical protein M569_09159                         508   5e-173   
emb|CDY48114.1|  BnaC02g03710D                                          508   8e-173   
gb|ABE66261.1|  laccase/diphenol oxidase                                506   3e-172   
ref|XP_009125430.1|  PREDICTED: laccase-10                              507   3e-172   
gb|ABK28766.1|  unknown                                                 506   3e-172   
ref|XP_010490598.1|  PREDICTED: laccase-10-like isoform X1              506   3e-172   
ref|XP_002873023.1|  predicted protein                                  506   4e-172   
ref|XP_010452014.1|  PREDICTED: laccase-10 isoform X1                   506   7e-172   
emb|CDY55905.1|  BnaAnng13970D                                          505   1e-171   
emb|CAB69847.1|  laccase-like protein                                   504   2e-171   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287399.1|  hypothetical protein CARUB_v10000605mg             504   3e-171   
ref|XP_010423919.1|  PREDICTED: laccase-10-like                         504   3e-171   
ref|XP_009590676.1|  PREDICTED: laccase-11-like                         500   1e-169   
ref|XP_009764219.1|  PREDICTED: laccase-11-like                         499   2e-169   
gb|KFK44563.1|  hypothetical protein AALP_AA1G273400                    499   3e-169   
ref|XP_004233973.1|  PREDICTED: laccase-11                              499   5e-169   
ref|XP_010924287.1|  PREDICTED: laccase-11-like                         498   7e-169   
gb|AES94995.2|  laccase/diphenol oxidase family protein                 497   2e-168   
ref|XP_006347000.1|  PREDICTED: laccase-11-like                         496   5e-168   
gb|ACN39933.1|  unknown                                                 496   7e-168   Picea sitchensis
ref|XP_009593898.1|  PREDICTED: laccase-11-like                         494   4e-167   
ref|XP_004512055.1|  PREDICTED: laccase-11-like                         494   4e-167   
ref|XP_009793780.1|  PREDICTED: laccase-11-like                         494   4e-167   
ref|XP_009772835.1|  PREDICTED: laccase-11-like                         493   1e-166   
gb|KHN36103.1|  Laccase-11                                              491   2e-166   
gb|KHG01609.1|  Laccase-11 -like protein                                491   4e-166   
ref|XP_009593896.1|  PREDICTED: laccase-11-like                         491   5e-166   
ref|XP_003612035.1|  Laccase-11                                         491   6e-166   
ref|XP_002866298.1|  hypothetical protein ARALYDRAFT_496014             489   7e-166   
ref|XP_004232420.1|  PREDICTED: laccase-11                              490   8e-166   
gb|KHN24301.1|  Laccase-4                                               489   9e-166   
ref|XP_004160985.1|  PREDICTED: laccase-11-like                         490   2e-165   
ref|XP_008452071.1|  PREDICTED: laccase-11-like                         489   3e-165   
gb|EYU42613.1|  hypothetical protein MIMGU_mgv1a003791mg                489   3e-165   
ref|XP_003632636.1|  PREDICTED: laccase-11                              489   3e-165   
gb|KDP41783.1|  hypothetical protein JCGZ_26801                         498   4e-165   
ref|XP_006466813.1|  PREDICTED: laccase-11-like                         489   4e-165   
ref|XP_006340638.1|  PREDICTED: laccase-11-like                         488   4e-165   
ref|NP_200699.1|  laccase 16                                            487   6e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004146556.1|  PREDICTED: laccase-11-like                         488   8e-165   
ref|XP_006425656.1|  hypothetical protein CICLE_v10025287mg             488   8e-165   
ref|XP_003612037.1|  Laccase-11                                         488   1e-164   
ref|XP_009378520.1|  PREDICTED: laccase-11-like                         488   1e-164   
ref|XP_011099634.1|  PREDICTED: laccase-11-like                         488   1e-164   
ref|XP_008449246.1|  PREDICTED: laccase-11                              487   2e-164   
ref|XP_004143251.1|  PREDICTED: laccase-11-like                         487   2e-164   
ref|XP_010024157.1|  PREDICTED: laccase-11                              486   3e-164   
ref|XP_010679744.1|  PREDICTED: laccase-11                              486   3e-164   
ref|XP_008357173.1|  PREDICTED: laccase-11-like                         486   6e-164   
emb|CDP09155.1|  unnamed protein product                                492   7e-164   
ref|XP_007156958.1|  hypothetical protein PHAVU_002G031600g             485   1e-163   
ref|XP_007046899.1|  Laccase 11                                         485   1e-163   
ref|XP_007205004.1|  hypothetical protein PRUPE_ppa003572mg             485   1e-163   
ref|XP_010452196.1|  PREDICTED: laccase-11                              484   2e-163   
ref|XP_010423743.1|  PREDICTED: laccase-11-like                         484   2e-163   
ref|XP_011088411.1|  PREDICTED: laccase-11-like                         484   2e-163   
emb|CDO97037.1|  unnamed protein product                                484   2e-163   
ref|XP_002310245.1|  hypothetical protein POPTR_0007s13050g             484   2e-163   Populus trichocarpa [western balsam poplar]
ref|XP_004232419.1|  PREDICTED: laccase-11-like                         484   2e-163   
ref|XP_009392410.1|  PREDICTED: laccase-11                              483   4e-163   
ref|XP_006287320.1|  hypothetical protein CARUB_v10000520mg             485   4e-163   
ref|XP_010490794.1|  PREDICTED: laccase-11-like                         483   4e-163   
ref|XP_006340637.1|  PREDICTED: laccase-11-like                         483   4e-163   
ref|XP_002313847.2|  hypothetical protein POPTR_0009s10550g             483   7e-163   Populus trichocarpa [western balsam poplar]
emb|CDP02005.1|  unnamed protein product                                483   7e-163   
gb|KHN41966.1|  Laccase-11                                              483   1e-162   
gb|KHN36104.1|  Laccase-11                                              482   1e-162   
ref|XP_002873085.1|  hypothetical protein ARALYDRAFT_487097             482   1e-162   
ref|XP_002512915.1|  laccase, putative                                  482   1e-162   Ricinus communis
emb|CDY10394.1|  BnaCnng02950D                                          483   1e-162   
gb|AAK37829.1|AF132125_1  laccase                                       482   1e-162   Pinus taeda
emb|CDY62896.1|  BnaAnng18410D                                          482   2e-162   
ref|XP_003516567.1|  PREDICTED: laccase-11-like                         482   2e-162   
ref|XP_003538856.1|  PREDICTED: laccase-11-like                         482   2e-162   
emb|CDX70319.1|  BnaA10g26680D                                          481   2e-162   
ref|XP_007198990.1|  hypothetical protein PRUPE_ppa003590mg             481   3e-162   
ref|XP_008338318.1|  PREDICTED: laccase-11-like                         481   5e-162   
ref|XP_009125488.1|  PREDICTED: laccase-11                              480   6e-162   
ref|XP_002519529.1|  laccase, putative                                  480   7e-162   Ricinus communis
ref|XP_009340732.1|  PREDICTED: laccase-11-like                         480   8e-162   
ref|XP_008236999.1|  PREDICTED: laccase-11-like                         480   9e-162   
ref|XP_004300985.1|  PREDICTED: laccase-11-like                         480   9e-162   
emb|CAB86093.1|  laccase precursor-like                                 479   1e-161   
ref|XP_006398771.1|  hypothetical protein EUTSA_v10013135mg             480   1e-161   
ref|NP_195946.2|  laccase 11                                            479   1e-161   
ref|XP_011000403.1|  PREDICTED: laccase-11-like                         479   1e-161   
gb|KDO50695.1|  hypothetical protein CISIN_1g036540mg                   479   1e-161   
dbj|BAN10308.1|  laccase                                                479   1e-161   
ref|XP_009342664.1|  PREDICTED: laccase-11-like                         479   2e-161   
ref|XP_007200216.1|  hypothetical protein PRUPE_ppa015544mg             479   3e-161   
ref|XP_004289138.1|  PREDICTED: laccase-11-like                         479   4e-161   
ref|XP_011025818.1|  PREDICTED: laccase-11-like                         478   4e-161   
gb|KHG22893.1|  Laccase-4 -like protein                                 475   8e-161   
gb|AAK37830.1|AF132126_1  laccase                                       478   1e-160   
emb|CDY44351.1|  BnaC02g03260D                                          477   1e-160   
ref|XP_010926015.1|  PREDICTED: laccase-11-like                         487   1e-160   
ref|XP_008241697.1|  PREDICTED: laccase-11-like                         477   1e-160   
ref|XP_009122722.1|  PREDICTED: laccase-11-like                         477   1e-160   
ref|XP_004292029.1|  PREDICTED: laccase-11-like                         476   2e-160   
gb|EYU40190.1|  hypothetical protein MIMGU_mgv1a003793mg                476   3e-160   
ref|XP_004292037.1|  PREDICTED: laccase-11-like                         476   3e-160   
ref|XP_006428774.1|  hypothetical protein CICLE_v10013446mg             476   3e-160   
ref|XP_006878556.1|  hypothetical protein AMTR_s00011p00235480          475   5e-160   
ref|XP_007204198.1|  hypothetical protein PRUPE_ppa003577mg             476   6e-160   
ref|XP_008352457.1|  PREDICTED: laccase-11-like                         475   7e-160   
ref|XP_008385897.1|  PREDICTED: laccase-11-like                         476   7e-160   
emb|CAN71891.1|  hypothetical protein VITISV_040864                     474   2e-159   
ref|XP_002275392.1|  PREDICTED: laccase-11                              474   2e-159   
ref|XP_002305436.1|  hypothetical protein POPTR_0004s16370g             473   3e-159   
ref|XP_010254791.1|  PREDICTED: laccase-11-like                         483   5e-159   
ref|XP_007156959.1|  hypothetical protein PHAVU_002G031700g             473   5e-159   
ref|XP_007042164.1|  Laccase 11                                         482   6e-159   
gb|KFK24777.1|  hypothetical protein AALP_AA8G023500                    473   7e-159   
gb|KHG17519.1|  Laccase-4 -like protein                                 471   7e-159   
ref|XP_009371609.1|  PREDICTED: laccase-11-like                         472   1e-158   
ref|XP_008338086.1|  PREDICTED: laccase-11-like                         472   1e-158   
gb|KDP24484.1|  hypothetical protein JCGZ_25048                         467   8e-158   
emb|CBI17500.3|  unnamed protein product                                469   1e-157   
ref|XP_002266464.1|  PREDICTED: laccase-11                              469   1e-157   
ref|XP_010263632.1|  PREDICTED: laccase-11-like                         479   3e-157   
sp|Q8RYM9.1|LAC2_ORYSJ  RecName: Full=Laccase-2; AltName: Full=Be...    468   4e-157   
ref|XP_004969263.1|  PREDICTED: laccase-2-like                          468   6e-157   
ref|XP_010558158.1|  PREDICTED: laccase-11                              468   9e-157   
gb|EAZ12812.1|  hypothetical protein OsJ_02731                          467   1e-156   
ref|XP_010543401.1|  PREDICTED: laccase-11-like                         466   3e-156   
ref|XP_008800741.1|  PREDICTED: laccase-11-like                         478   1e-155   
ref|XP_010107530.1|  hypothetical protein L484_024383                   464   2e-155   
ref|XP_007026782.1|  Laccase/Diphenol oxidase family protein isof...    460   6e-155   
gb|KHG11130.1|  Laccase-4 -like protein                                 455   1e-152   
ref|XP_004972357.1|  PREDICTED: laccase-2-like                          448   3e-149   
gb|AAK37828.1|AF132124_1  laccase                                       448   5e-149   
emb|CAN71338.1|  hypothetical protein VITISV_008643                     444   8e-148   
gb|AGJ83750.1|  Laccase 1a                                              434   1e-147   
ref|XP_004514392.1|  PREDICTED: laccase-17-like                         443   3e-147   
ref|XP_008359106.1|  PREDICTED: laccase-17-like                         441   4e-146   
ref|XP_008385215.1|  PREDICTED: laccase-17-like                         440   6e-146   
ref|XP_008223967.1|  PREDICTED: laccase-17                              436   1e-144   
ref|XP_007207312.1|  hypothetical protein PRUPE_ppa003714mg             436   1e-144   
ref|XP_009354529.1|  PREDICTED: laccase-17-like                         436   5e-144   
ref|XP_008222577.1|  PREDICTED: laccase-17-like                         434   1e-143   
ref|XP_004970542.1|  PREDICTED: laccase-4-like                          434   2e-143   
ref|XP_006644994.1|  PREDICTED: laccase-12/13-like                      434   2e-143   
ref|XP_009358279.1|  PREDICTED: laccase-17-like                         434   2e-143   
gb|KDP44151.1|  hypothetical protein JCGZ_05618                         433   3e-143   
ref|NP_001105875.1|  putative laccase precursor                         434   3e-143   
ref|XP_008358049.1|  PREDICTED: laccase-17-like                         433   3e-143   
ref|XP_004246355.1|  PREDICTED: laccase-4-like                          432   5e-143   
ref|XP_008665185.1|  PREDICTED: laccase-4-like                          433   6e-143   
ref|XP_007207546.1|  hypothetical protein PRUPE_ppa017421mg             432   6e-143   
ref|XP_006424707.1|  hypothetical protein CICLE_v10028090mg             432   8e-143   
gb|KDO73032.1|  hypothetical protein CISIN_1g008109mg                   432   1e-142   
ref|XP_004294638.1|  PREDICTED: laccase-17-like                         432   1e-142   
ref|XP_006363100.1|  PREDICTED: laccase-4-like                          431   2e-142   
ref|XP_007016607.1|  Laccase 17                                         431   2e-142   
ref|NP_001044772.1|  Os01g0842400                                       431   2e-142   
gb|AAK37827.1|AF132123_1  laccase                                       431   2e-142   
gb|EAZ14115.1|  hypothetical protein OsJ_04039                          431   3e-142   
gb|KHN41965.1|  Laccase-11                                              427   4e-142   
ref|XP_010107320.1|  hypothetical protein L484_009454                   431   5e-142   
ref|XP_010920540.1|  PREDICTED: laccase-10-like                         430   5e-142   
gb|EEC71777.1|  hypothetical protein OsI_04389                          430   6e-142   
gb|KHN14004.1|  Laccase-17                                              429   1e-141   
gb|KCW85519.1|  hypothetical protein EUGRSUZ_B02316                     428   1e-141   
gb|EEC71780.1|  hypothetical protein OsI_04394                          429   1e-141   
ref|XP_009354528.1|  PREDICTED: laccase-17-like                         429   1e-141   
emb|CDY08537.1|  BnaA05g27730D                                          427   2e-141   
ref|XP_003552179.1|  PREDICTED: laccase-17-like                         429   2e-141   
ref|XP_008778578.1|  PREDICTED: laccase-10-like                         429   2e-141   
ref|NP_001044773.1|  Os01g0842500                                       427   5e-141   
ref|XP_008811561.1|  PREDICTED: laccase-11-like                         426   5e-141   
ref|XP_009788568.1|  PREDICTED: laccase-4-like                          427   6e-141   
ref|XP_004294637.1|  PREDICTED: laccase-17-like                         427   6e-141   
ref|XP_010043504.1|  PREDICTED: laccase-17                              427   7e-141   
gb|AAK37825.1|AF132121_1  laccase                                       426   1e-140   
emb|CAN66454.1|  hypothetical protein VITISV_020528                     426   1e-140   
ref|XP_009597234.1|  PREDICTED: laccase-4-like                          426   1e-140   
gb|EYU26609.1|  hypothetical protein MIMGU_mgv1a003496mg                426   1e-140   
ref|XP_010092993.1|  hypothetical protein L484_007174                   426   2e-140   
ref|XP_002531824.1|  laccase, putative                                  426   2e-140   
ref|XP_006370270.1|  hypothetical protein POPTR_0001s41160g             426   2e-140   
gb|KDO52343.1|  hypothetical protein CISIN_1g008085mg                   425   2e-140   
ref|XP_011094888.1|  PREDICTED: laccase-17-like                         426   3e-140   
ref|XP_008803092.1|  PREDICTED: laccase-17-like                         426   3e-140   
ref|XP_009782930.1|  PREDICTED: laccase-4-like                          426   3e-140   
ref|XP_010690924.1|  PREDICTED: laccase-17-like                         426   3e-140   
ref|XP_006429125.1|  hypothetical protein CICLE_v10011362mg             426   3e-140   
ref|XP_006583598.1|  PREDICTED: laccase-17-like                         426   3e-140   
ref|XP_002278215.1|  PREDICTED: laccase-17                              425   4e-140   
emb|CDP06593.1|  unnamed protein product                                424   5e-140   
ref|XP_006846062.1|  hypothetical protein AMTR_s00012p00061910          424   5e-140   
ref|XP_007140513.1|  hypothetical protein PHAVU_008G119000g             425   7e-140   
ref|XP_008385213.1|  PREDICTED: laccase-17-like                         425   7e-140   
ref|XP_009602033.1|  PREDICTED: laccase-4-like                          424   7e-140   
ref|XP_002269038.2|  PREDICTED: laccase-17 isoform X2                   424   9e-140   
ref|NP_001146658.1|  uncharacterized protein LOC100280258 precursor     424   1e-139   
gb|AFW84624.1|  putative laccase family protein                         424   1e-139   
ref|XP_010654257.1|  PREDICTED: laccase-17 isoform X1                   424   1e-139   
ref|XP_002458746.1|  hypothetical protein SORBIDRAFT_03g039520          424   1e-139   
dbj|BAJ99773.1|  predicted protein                                      424   1e-139   
ref|XP_010256874.1|  PREDICTED: laccase-17-like                         424   2e-139   
ref|XP_006856866.1|  hypothetical protein AMTR_s00055p00190270          424   2e-139   
gb|EMT20803.1|  Laccase-4                                               424   2e-139   
ref|XP_007016584.1|  Laccase 17                                         423   2e-139   
ref|XP_004492322.1|  PREDICTED: laccase-17-like                         423   2e-139   
ref|XP_009338594.1|  PREDICTED: laccase-17-like                         424   2e-139   
ref|XP_008463808.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    423   2e-139   
gb|KDP35659.1|  hypothetical protein JCGZ_09097                         423   3e-139   
ref|XP_003564593.1|  PREDICTED: laccase-12/13-like                      423   3e-139   
ref|XP_007140298.1|  hypothetical protein PHAVU_008G100400g             424   3e-139   
gb|KDO52342.1|  hypothetical protein CISIN_1g008085mg                   423   4e-139   
gb|EYU26602.1|  hypothetical protein MIMGU_mgv1a003840mg                422   4e-139   
gb|KDO73109.1|  hypothetical protein CISIN_1g047497mg                   422   5e-139   
ref|XP_006424671.1|  hypothetical protein CICLE_v10030166mg             422   5e-139   
gb|AES79165.2|  laccase/diphenol oxidase family protein                 422   5e-139   
ref|XP_003552160.2|  PREDICTED: laccase-17-like isoform X1              422   5e-139   
ref|XP_011042451.1|  PREDICTED: laccase-17-like                         422   7e-139   
ref|XP_011094887.1|  PREDICTED: laccase-17-like                         422   8e-139   
ref|XP_011002147.1|  PREDICTED: laccase-17-like                         422   8e-139   
gb|KHN24986.1|  Laccase-17                                              422   9e-139   
gb|AAK37823.1|  laccase                                                 422   9e-139   
gb|KHF97742.1|  Laccase-17 -like protein                                422   9e-139   
ref|XP_010535559.1|  PREDICTED: laccase-17                              422   1e-138   
ref|XP_008222248.1|  PREDICTED: laccase-2                               422   1e-138   
ref|XP_002458747.1|  hypothetical protein SORBIDRAFT_03g039530          422   1e-138   
ref|XP_003532315.1|  PREDICTED: laccase-17-like                         421   1e-138   
ref|XP_011077639.1|  PREDICTED: laccase-17-like                         421   1e-138   
ref|XP_009403441.1|  PREDICTED: laccase-4-like                          421   1e-138   
ref|XP_002531561.1|  laccase, putative                                  420   1e-138   
ref|XP_010037821.1|  PREDICTED: laccase-17-like                         421   2e-138   
ref|XP_006602579.1|  PREDICTED: laccase-17-like isoform X2              421   2e-138   
ref|XP_007208016.1|  hypothetical protein PRUPE_ppa003296mg             421   2e-138   
gb|KHN16224.1|  Laccase-17                                              422   4e-138   
ref|XP_007022468.1|  Laccase 17                                         420   4e-138   
ref|XP_006370271.1|  hypothetical protein POPTR_0001s41170g             420   4e-138   
ref|XP_002531562.1|  laccase, putative                                  420   4e-138   
ref|XP_007208294.1|  hypothetical protein PRUPE_ppa003308mg             420   4e-138   
ref|XP_004148786.1|  PREDICTED: laccase-17-like                         420   5e-138   
ref|XP_011094885.1|  PREDICTED: laccase-17-like                         419   6e-138   
emb|CDM84967.1|  unnamed protein product                                419   7e-138   
emb|CBI16199.3|  unnamed protein product                                419   8e-138   
ref|XP_009354571.1|  PREDICTED: laccase-17-like                         418   8e-138   
ref|XP_010920538.1|  PREDICTED: laccase-4-like                          419   8e-138   
ref|XP_003562893.1|  PREDICTED: laccase-4-like                          419   9e-138   
ref|XP_004137934.1|  PREDICTED: laccase-17-like                         419   9e-138   
dbj|BAJ84890.1|  predicted protein                                      419   1e-137   
ref|XP_006429124.1|  hypothetical protein CICLE_v10011358mg             419   1e-137   
ref|XP_002299296.1|  laccase family protein                             419   1e-137   
ref|XP_010690891.1|  PREDICTED: laccase-17-like                         419   1e-137   
gb|KDP35658.1|  hypothetical protein JCGZ_09096                         419   1e-137   
ref|XP_002300066.1|  hypothetical protein POPTR_0001s35740g             419   1e-137   
emb|CAN80346.1|  hypothetical protein VITISV_003134                     420   1e-137   
ref|XP_002284473.1|  PREDICTED: laccase-17                              419   1e-137   
ref|XP_006646133.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-2-like     417   2e-137   
ref|XP_008358843.1|  PREDICTED: laccase-17-like                         419   2e-137   
ref|XP_006480874.1|  PREDICTED: laccase-17-like isoform X1              418   2e-137   
gb|AAC04576.1|  putative high-pI laccase                                417   2e-137   
gb|KHN16229.1|  Laccase-17                                              418   2e-137   
emb|CDY67936.1|  BnaCnng57030D                                          414   3e-137   
ref|XP_004241217.1|  PREDICTED: laccase-2-like                          417   3e-137   
emb|CDM80721.1|  unnamed protein product                                417   3e-137   
gb|KEH22917.1|  laccase/diphenol oxidase family protein                 418   4e-137   
gb|KEH22816.1|  laccase/diphenol oxidase family protein                 417   5e-137   
ref|XP_010654256.1|  PREDICTED: laccase-17-like isoform X2              417   6e-137   
emb|CDX71061.1|  BnaC03g11450D                                          417   6e-137   
gb|KCW85651.1|  hypothetical protein EUGRSUZ_B02438                     412   7e-137   
ref|XP_002520231.1|  laccase, putative                                  417   8e-137   
emb|CDP09087.1|  unnamed protein product                                417   9e-137   
ref|XP_010275879.1|  PREDICTED: laccase-17-like                         417   1e-136   
ref|XP_006846275.1|  hypothetical protein AMTR_s00012p00248430          416   1e-136   
ref|XP_009597231.1|  PREDICTED: laccase-17-like                         416   1e-136   
ref|XP_010683867.1|  PREDICTED: laccase-17-like                         416   1e-136   
ref|XP_008797558.1|  PREDICTED: laccase-11-like                         425   1e-136   
ref|XP_008387787.1|  PREDICTED: laccase-17-like                         416   1e-136   
dbj|BAJ96691.1|  predicted protein                                      416   1e-136   
ref|XP_010541373.1|  PREDICTED: laccase-17                              418   2e-136   
emb|CDX88735.1|  BnaA03g09140D                                          415   3e-136   
ref|XP_008240716.1|  PREDICTED: laccase-17-like                         415   4e-136   
emb|CDY31581.1|  BnaA10g12900D                                          415   4e-136   
ref|XP_008442529.1|  PREDICTED: laccase-17-like                         414   5e-136   
ref|XP_006846265.1|  hypothetical protein AMTR_s00012p00245710          414   6e-136   
ref|XP_003564592.1|  PREDICTED: laccase-4-like                          414   6e-136   
ref|XP_003622947.1|  Laccase                                            414   8e-136   
ref|XP_002268628.2|  PREDICTED: laccase-17-like isoform X1              414   1e-135   
gb|EMS51326.1|  Laccase-4                                               414   1e-135   
ref|XP_007026975.1|  Laccase 17                                         414   1e-135   
emb|CAA74105.1|  laccase                                                414   1e-135   
ref|XP_009796024.1|  PREDICTED: laccase-2-like                          414   1e-135   
ref|XP_008785569.1|  PREDICTED: laccase-17-like                         413   2e-135   
ref|XP_006341009.1|  PREDICTED: laccase-17-like                         413   2e-135   
ref|XP_006445791.1|  hypothetical protein CICLE_v10018047mg             413   2e-135   
ref|XP_004302730.1|  PREDICTED: laccase-17-like                         414   2e-135   
gb|EMT21652.1|  Laccase-4                                               413   2e-135   
ref|XP_004492318.1|  PREDICTED: laccase-17-like                         413   3e-135   
ref|NP_001147942.1|  L-ascorbate oxidase precursor                      413   3e-135   
ref|XP_002308164.1|  hypothetical protein POPTR_0006s08740g             413   3e-135   
ref|XP_009120521.1|  PREDICTED: laccase-17-like                         412   3e-135   
ref|XP_007026974.1|  Laccase 17                                         413   3e-135   
gb|ACN34362.1|  unknown                                                 413   3e-135   
emb|CDP01507.1|  unnamed protein product                                413   4e-135   
ref|XP_011019838.1|  PREDICTED: laccase-17-like                         412   4e-135   
ref|XP_007026985.1|  Laccase 17 isoform 3                               410   4e-135   
ref|XP_010922297.1|  PREDICTED: laccase-17-like                         412   5e-135   
ref|XP_004970548.1|  PREDICTED: putative laccase-5-like                 412   5e-135   



>ref|XP_011084946.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=555

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/386 (79%), Positives = 340/386 (88%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             +P  VES +R+YKF+V  KNT+ LCASKPI+VVNGKFPGP LYARE D V+VRV NHV++
Sbjct  17    YPTCVESRVRNYKFSVVRKNTTALCASKPIIVVNGKFPGPTLYAREDDIVIVRVVNHVKD  76

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGWSDGPAYITQCPIQ GQSY+YNFTLTGQRGTLLWH+HINWQRATV
Sbjct  77    NVTIHWHGVRQLRTGWSDGPAYITQCPIQTGQSYIYNFTLTGQRGTLLWHAHINWQRATV  136

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFPKPDKEEII+ GEWW S+VE VIN AM+LG PPNVSDAHTINGL
Sbjct  137   HGAIVILPKRGVPYPFPKPDKEEIIIFGEWWKSDVEAVINQAMKLGQPPNVSDAHTINGL  196

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGP P CSS+GY L+VE+GKTYLLR+VNAA+NEELFFKIAGH+L +VEVDA+Y KPF+TD
Sbjct  197   PGPAPNCSSQGYTLQVETGKTYLLRIVNAAVNEELFFKIAGHQLTIVEVDASYTKPFKTD  256

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+GPGQTTNALLTADQK G Y IAISPFMDTIVA DNQTA  TL Y G   ++ST LT
Sbjct  257   TIFIGPGQTTNALLTADQKIGNYLIAISPFMDTIVAIDNQTAMGTLRYNGMLAVSSTTLT  316

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              MP QNATP+TT F DSLRSLNS+ YPANVP +VDHSL+FAIGV VNPC  C +GSRV+A
Sbjct  317   AMPPQNATPITTKFMDSLRSLNSKEYPANVPQTVDHSLMFAIGVAVNPCATCVNGSRVMA  376

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
             DINNVSFVMPTT +LQAHYYNISGV+
Sbjct  377   DINNVSFVMPTTAILQAHYYNISGVY  402



>ref|XP_009590412.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/386 (78%), Positives = 340/386 (88%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  VES++RHYKFTV  KN +RLCA+KPI+ VNGKFPGP LYARE DTV+VRV NHVQ+
Sbjct  18    FPAFVESIVRHYKFTVVRKNATRLCATKPIITVNGKFPGPTLYAREDDTVLVRVVNHVQD  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGWSDGPAYITQCPIQ GQSYLYNFTLTGQRGTLLWH+HINWQRATV
Sbjct  78    NVTIHWHGVRQLRTGWSDGPAYITQCPIQTGQSYLYNFTLTGQRGTLLWHAHINWQRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK  VPYPFPKP+KEEII+LGEWW+S+VE VIN AM++G+ PNVSDAHTING 
Sbjct  138   HGAIVILPKRRVPYPFPKPEKEEIIILGEWWSSDVEAVINQAMKMGVAPNVSDAHTINGH  197

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGP P CSSKGY L VESGKTYLLR++NAALNEELFFKIAGH L VVEVDA+YVKPF+TD
Sbjct  198   PGPAPNCSSKGYTLHVESGKTYLLRIINAALNEELFFKIAGHNLTVVEVDASYVKPFKTD  257

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+ PGQTTNA+LTADQ AGKY IA+SPFMDTIVATDN TAT T+ Y GT  L+ TALT
Sbjct  258   TIFIAPGQTTNAILTADQSAGKYLIAVSPFMDTIVATDNLTATGTVHYLGTDALSPTALT  317

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              +P +NATPVT  F DSLRSLNS+ YPANVPL++DHSL+  +G+GVNPC  C +GSRVVA
Sbjct  318   TIPSRNATPVTNIFVDSLRSLNSKKYPANVPLTIDHSLLLTMGIGVNPCATCQNGSRVVA  377

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
              INNV+FVMPTT +LQAHYYNISGV+
Sbjct  378   AINNVTFVMPTTAILQAHYYNISGVY  403



>emb|CDP14064.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/386 (76%), Positives = 329/386 (85%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FPVSVE + RHYKF V  +  +RLCA+K IV VNGKFPGP +YARE D +VV+V NHVQE
Sbjct  17    FPVSVEPVTRHYKFNVVQRKKTRLCATKSIVTVNGKFPGPTVYAREDDRLVVKVVNHVQE  76

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGWSDGPAYITQCPIQ GQSY YNFTLTGQRGTLLWH H+NW RATV
Sbjct  77    NVTIHWHGVRQLRTGWSDGPAYITQCPIQSGQSYTYNFTLTGQRGTLLWHGHVNWLRATV  136

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFPKPDKEEIIVLGEWW S+VE VIN ++Q+G  PNVSDAHTINGL
Sbjct  137   HGAIVILPKRGVPYPFPKPDKEEIIVLGEWWKSDVEAVINQSLQVGRAPNVSDAHTINGL  196

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGP P CSS GY L VESGKTYLLR+VNA LNEELFFKIAGH+L +VEVDA+YVKPF+TD
Sbjct  197   PGPAPNCSSNGYTLHVESGKTYLLRIVNAGLNEELFFKIAGHQLTIVEVDASYVKPFKTD  256

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+GPGQTTNA+LTADQ AGKY IAISPFMDT VATDNQTAT  + YK T   + TALT
Sbjct  257   TIFIGPGQTTNAILTADQDAGKYLIAISPFMDTTVATDNQTATGVIRYKSTTAFSPTALT  316

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              +P +NATPVT +F +SLRSLNS+ YP  VPL +DHSL+F IG+G+NPC  C +GSRVVA
Sbjct  317   TIPPRNATPVTNSFMESLRSLNSKEYPTKVPLEIDHSLLFTIGIGINPCATCQNGSRVVA  376

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
              INNV+FV+PTT LLQAHYY ISGV+
Sbjct  377   AINNVTFVLPTTALLQAHYYGISGVY  402



>gb|EYU41257.1| hypothetical protein MIMGU_mgv1a003880mg [Erythranthe guttata]
Length=558

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/388 (79%), Positives = 337/388 (87%), Gaps = 3/388 (1%)
 Frame = +3

Query  147   PVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQEN  326
             P  VES IRHYKFTV  KNTS+LCASKPI+ VNGKFPGP LYARE DTVVVRV NHV++N
Sbjct  18    PSLVESRIRHYKFTVVKKNTSKLCASKPIITVNGKFPGPTLYAREDDTVVVRVVNHVKDN  77

Query  327   VSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVH  506
             V+ HWHG++Q RTGW+DGPAYITQCPIQ GQSY+YNFTLTGQRGTLLWH+HINWQRATVH
Sbjct  78    VTFHWHGIRQLRTGWADGPAYITQCPIQTGQSYIYNFTLTGQRGTLLWHAHINWQRATVH  137

Query  507   GAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLP  686
             GAIVILPK GVPYPFPKPDKEEIIV GEWW S+VE VIN AM+LG PPNVSDAHTING  
Sbjct  138   GAIVILPKRGVPYPFPKPDKEEIIVFGEWWKSDVEMVINQAMKLGQPPNVSDAHTINGQT  197

Query  687   GPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDT  866
             GP P CSSKGY + VESGKTYLLR+VNAA+NEELFFKIAGH++ +VEVDATY KPF TDT
Sbjct  198   GPAPNCSSKGYTMYVESGKTYLLRIVNAAVNEELFFKIAGHQMTIVEVDATYTKPFRTDT  257

Query  867   IFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAS---TA  1037
             IF+GPGQTTNALL AD+K G YQIAISPFMDTIVATD+QTATATL Y GT   A+   T 
Sbjct  258   IFIGPGQTTNALLKADRKIGNYQIAISPFMDTIVATDSQTATATLRYNGTLSAAASSPTT  317

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             LT MP +NAT VTT F DSLRSLNSR YPANVP ++DHSL+ AIGVGVNPC  C +GSRV
Sbjct  318   LTTMPSKNATKVTTNFMDSLRSLNSRKYPANVPKTIDHSLLLAIGVGVNPCGTCVNGSRV  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VADINNV+FVMPTT +LQAHYYN+SGV+
Sbjct  378   VADINNVTFVMPTTAILQAHYYNVSGVY  405



>gb|EPS61127.1| laccase 3, partial [Genlisea aurea]
Length=551

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/388 (74%), Positives = 327/388 (84%), Gaps = 0/388 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C +P+ VES++RHYKF+V  KNT +LC SKPI+ VNGKFPGP LYARE DTV+V+V N V
Sbjct  11    CWYPLHVESIVRHYKFSVVKKNTRKLCESKPIITVNGKFPGPTLYAREDDTVLVKVVNRV  70

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
              ENV+IHWHGV+Q RTGWSDGPAYITQCPIQ G+SY YNFTLTGQRGTLL+HSHINWQRA
Sbjct  71    TENVTIHWHGVRQLRTGWSDGPAYITQCPIQAGKSYTYNFTLTGQRGTLLYHSHINWQRA  130

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGAIVILP+L   YPFPKPD E+II+L EWW S+VE VIN AM  G+PPNVSDAHTIN
Sbjct  131   TLHGAIVILPRLRDSYPFPKPDDEKIIILAEWWKSDVEAVINSAMSQGLPPNVSDAHTIN  190

Query  678   GLPGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE  857
             GLPGP P C+S GY L VESGKTYLLR++NAALNEELFFKIA H+  VVEVDA Y KPF 
Sbjct  191   GLPGPLPNCTSPGYTLHVESGKTYLLRIINAALNEELFFKIADHKFTVVEVDARYTKPFT  250

Query  858   TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA  1037
             TDT+F+GPGQTTN LL ADQK GKY IAISPFMDTIVATDNQ ATA L Y  T   + T 
Sbjct  251   TDTLFIGPGQTTNVLLRADQKIGKYLIAISPFMDTIVATDNQRATAFLRYNNTVAFSPTN  310

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             LT +P +NAT VTTTF DSLRS+NS  +PANVP  +DHSL+ AIGVGVNPCP+C +G+R+
Sbjct  311   LTPLPPRNATSVTTTFVDSLRSINSNTFPANVPKKIDHSLLLAIGVGVNPCPSCFNGTRL  370

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VADINNVSFVMPTT LLQAHYYN+SG+F
Sbjct  371   VADINNVSFVMPTTALLQAHYYNMSGIF  398



>ref|XP_002265173.1| PREDICTED: laccase-4-like [Vitis vinifera]
Length=553

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/386 (72%), Positives = 331/386 (86%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V +M+RHYKF+V MKNT+RLCA+KPIV VNG+FPGP LYARE DTV+VRV NHV  
Sbjct  15    FPTLVGAMVRHYKFSVVMKNTTRLCATKPIVTVNGRFPGPKLYAREDDTVIVRVINHVTY  74

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV++HWHGVKQ RTGWSDGPAY+TQCPIQPGQSY+YNFTL+GQRGTLLWH+HI+W RAT+
Sbjct  75    NVTLHWHGVKQLRTGWSDGPAYVTQCPIQPGQSYIYNFTLSGQRGTLLWHAHISWLRATM  134

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             +GAIVILPK GVPYPFPKPD+E +++LGEWW ++VE VIN A+Q G+PPN+SDAHTING 
Sbjct  135   YGAIVILPKRGVPYPFPKPDREVVVILGEWWKADVEAVINQAIQSGLPPNISDAHTINGH  194

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGPT TCSS+GY L VESGKTY+LR+VNAA+N+ELFFKI+GH+L VVEVDA Y KPF+TD
Sbjct  195   PGPTSTCSSQGYTLNVESGKTYMLRIVNAAVNDELFFKISGHQLTVVEVDAIYAKPFKTD  254

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             T+F+ PGQTTNALLTADQ AGKY + +SPFMD  +  DN T TA LSY GT   + T LT
Sbjct  255   TLFIAPGQTTNALLTADQGAGKYLVVVSPFMDAPIPVDNITGTAILSYTGTLAASPTVLT  314

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
               P QNAT +T++F DSL+SLNS+ YPANVPL++DHSL+F IGVGVNPC  C +GSR+V+
Sbjct  315   TSPSQNATQLTSSFMDSLKSLNSKQYPANVPLAIDHSLLFTIGVGVNPCSTCVNGSRLVS  374

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
              INNV+FVMPTT LL+AHYYNI GVF
Sbjct  375   YINNVTFVMPTTGLLEAHYYNIGGVF  400



>emb|CBI31539.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/380 (73%), Positives = 327/380 (86%), Gaps = 1/380 (0%)
 Frame = +3

Query  165   MIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWH  344
             M+RHYKF+V MKNT+RLCA+KPIV VNG+FPGP LYARE DTV+VRV NHV  NV++HWH
Sbjct  1     MVRHYKFSVVMKNTTRLCATKPIVTVNGRFPGPKLYAREDDTVIVRVINHVTYNVTLHWH  60

Query  345   GVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVIL  524
             GVKQ RTGWSDGPAY+TQCPIQPGQSY+YNFTL+GQRGTLLWH+HI+W RAT++GAIVIL
Sbjct  61    GVKQLRTGWSDGPAYVTQCPIQPGQSYIYNFTLSGQRGTLLWHAHISWLRATMYGAIVIL  120

Query  525   PKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTC  704
             PK GVPYPFPKPD+E +++LGEWW ++VE VIN A+Q G+PPN+SDAHTING PGPT TC
Sbjct  121   PKRGVPYPFPKPDREVVVILGEWWKADVEAVINQAIQSGLPPNISDAHTINGHPGPTSTC  180

Query  705   SSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGP  881
             SS+ GY L VESGKTY+LR+VNAA+N+ELFFKI+GH+L VVEVDA Y KPF+TDT+F+ P
Sbjct  181   SSQAGYTLNVESGKTYMLRIVNAAVNDELFFKISGHQLTVVEVDAIYAKPFKTDTLFIAP  240

Query  882   GQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQN  1061
             GQTTNALLTADQ AGKY + +SPFMD  +  DN T TA LSY GT   + T LT  P QN
Sbjct  241   GQTTNALLTADQGAGKYLVVVSPFMDAPIPVDNITGTAILSYTGTLAASPTVLTTSPSQN  300

Query  1062  ATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVS  1241
             AT +T++F DSL+SLNS+ YPANVPL++DHSL+F IGVGVNPC  C +GSR+V+ INNV+
Sbjct  301   ATQLTSSFMDSLKSLNSKQYPANVPLAIDHSLLFTIGVGVNPCSTCVNGSRLVSYINNVT  360

Query  1242  FVMPTTPLLQAHYYNISGVF  1301
             FVMPTT LL+AHYYNI GVF
Sbjct  361   FVMPTTGLLEAHYYNIGGVF  380



>ref|XP_010104683.1| hypothetical protein L484_022066 [Morus notabilis]
 gb|EXC01489.1| hypothetical protein L484_022066 [Morus notabilis]
Length=556

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/389 (71%), Positives = 325/389 (84%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP SV+ M+RHYKF V +KNT++LC+SKPIV VNGKFPGP +YARE DT++++V NHV
Sbjct  15    CLFPASVDCMVRHYKFNVVLKNTTKLCSSKPIVTVNGKFPGPTIYAREDDTLLIKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTL WH+HI W RA
Sbjct  75    KYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLWWHAHILWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFP P+KEE+IVLGEWW S+VE VIN A++ G+ PNVSDAHTIN
Sbjct  135   TVHGAIVILPKRGVPYPFPTPNKEEVIVLGEWWKSDVESVINQALKSGLAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C S+ G+ L VESG+TY+LR+VNAALNEELFFKIAGH+L VVEVDA Y KPF
Sbjct  195   GQPGPVSNCPSQGGFTLPVESGQTYMLRIVNAALNEELFFKIAGHKLAVVEVDAVYTKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTNALLTADQ AGKY +  SP+MD  +A DN+TATATL Y GT   + T
Sbjct  255   KTDTIVIAPGQTTNALLTADQNAGKYSVLASPYMDAPIAVDNKTATATLHYSGTLSSSRT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT  P QNAT + T FT+SLRSLNS+ YPA VPL +DHSL+F IG+GVNPC  C +GSR
Sbjct  315   ILTAPPPQNATSIATKFTNSLRSLNSKKYPARVPLKIDHSLLFTIGLGVNPCKTCVNGSR  374

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVADINNV+FVMP   LLQAH++NISGVF
Sbjct  375   VVADINNVTFVMPNIALLQAHFFNISGVF  403



>gb|KDP46534.1| hypothetical protein JCGZ_08506 [Jatropha curcas]
Length=563

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/387 (72%), Positives = 324/387 (84%), Gaps = 1/387 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP SV+ ++RHYKF V MK  +RLC+SKPIV VNGKFPGP + ARE DTV+V+V NHV+ 
Sbjct  24    FPASVDCLVRHYKFNVVMKKATRLCSSKPIVTVNGKFPGPTIVAREDDTVLVKVVNHVKY  83

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ+YLYNFT+TGQRGTLLWH+HI W RATV
Sbjct  84    NVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYLYNFTVTGQRGTLLWHAHILWLRATV  143

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFP P KEE+IVLGEWW S+VE V+N AM+ G  PNVSDAHTING 
Sbjct  144   HGAIVILPKRGVPYPFPTPHKEEVIVLGEWWKSDVEAVVNEAMKSGGAPNVSDAHTINGH  203

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP P C S+ G+NL VESGKTY+LR++NAALNEELFFKIA H+L VVEVDATYVKPF+T
Sbjct  204   PGPVPACPSQGGFNLPVESGKTYMLRIINAALNEELFFKIACHKLTVVEVDATYVKPFKT  263

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DTI + PGQTTN LLTAD+ +GKY +A SPFMD  +A DN TA+ATL Y G    A+T L
Sbjct  264   DTIVIAPGQTTNVLLTADRTSGKYLVAASPFMDAPIAVDNVTASATLHYSGALSSAATIL  323

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T+ P QNATP+  TF +SLRSLNS+ YPANVPL +DH L F IG+GVNPC  C++G+RVV
Sbjct  324   TVPPPQNATPIAATFANSLRSLNSKKYPANVPLKIDHFLFFTIGLGVNPCATCATGNRVV  383

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             ADINNV+FVMPT  LLQAH++NISGVF
Sbjct  384   ADINNVTFVMPTISLLQAHFFNISGVF  410



>ref|XP_011035200.1| PREDICTED: laccase-4 [Populus euphratica]
Length=556

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/389 (72%), Positives = 322/389 (83%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP SVESM+RHYKF V MKNT+RLC+ KPIV VNG+FPGP L ARE DTV+V+V NHV
Sbjct  15    CLFPASVESMVRHYKFNVVMKNTTRLCSEKPIVTVNGRFPGPTLVAREDDTVLVKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPIQP QS++YNFT+TGQRGTL WH+HI W RA
Sbjct  75    KYNVSIHWHGVRQLRTGWADGPAYITQCPIQPRQSFVYNFTITGQRGTLFWHAHILWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFP P +EE+IVLGEWW S+VE VIN AM  G+ PNVSDAHTIN
Sbjct  135   TVHGAIVILPKRGVPYPFPTPHREEVIVLGEWWKSDVEAVINEAMSSGMAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CSS+ GYNL V+ GKTYLLR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  195   GHPGPVSACSSQGGYNLPVQPGKTYLLRIINAALNEELFFKIAGHQLTVVEVDATYVKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             + DTI + PGQTTN L+TA++ +G+Y +A SPFMD  +A DN TATATL Y GT   ++T
Sbjct  255   KIDTIVIAPGQTTNVLVTANRGSGRYLVAASPFMDAPIAVDNVTATATLHYSGTLASSAT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT+ P QNATPV T FTD+LRSLNS  YPA VPL +DHSL F +G+GVNPC  C +GSR
Sbjct  315   TLTVPPAQNATPVATNFTDALRSLNSIKYPARVPLKIDHSLFFTVGLGVNPCATCVNGSR  374

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVAD NNV+FVMPT  LLQAH++NI GVF
Sbjct  375   VVADFNNVTFVMPTIALLQAHFFNIKGVF  403



>gb|KDO69098.1| hypothetical protein CISIN_1g008799mg [Citrus sinensis]
Length=553

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/386 (72%), Positives = 320/386 (83%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  VES +RHY FTV M N ++LCASK IV VNGKFPGP L+ARE D V+VRV NHV+ 
Sbjct  15    FPALVESAVRHYNFTVVMTNMTKLCASKSIVTVNGKFPGPTLHAREDDNVIVRVTNHVKY  74

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGW DGPAYITQCPIQPGQSY+YNFTLTGQRGTLLWH+HI+W RATV
Sbjct  75    NVTIHWHGVRQLRTGWYDGPAYITQCPIQPGQSYVYNFTLTGQRGTLLWHAHISWLRATV  134

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK  VPYPFPK DKE+IIV GEWW ++VE VIN A Q+G+ PNVSDAHTING 
Sbjct  135   HGAIVILPKRSVPYPFPKADKEKIIVFGEWWKADVEAVINQATQMGVAPNVSDAHTINGH  194

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGP   C+S+G+ L VESGKTYLLR+VNAA+N+ELFFKIAGH L VVEVD++Y KPF+TD
Sbjct  195   PGPVTNCTSQGFTLHVESGKTYLLRIVNAAVNDELFFKIAGHNLTVVEVDSSYTKPFKTD  254

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+GPGQTTNALLTAD+K GKY I ISPFMDTIVA +N T  A L YKGT   +ST LT
Sbjct  255   TIFIGPGQTTNALLTADKKIGKYLITISPFMDTIVAVNNVTGIAFLRYKGTVAFSSTTLT  314

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              +P  NAT VT TF+D+LRSLNS+ YPA VPL+VDHSL+  + V VNPC  C +G++V A
Sbjct  315   NVPAINATEVTNTFSDNLRSLNSKRYPAKVPLTVDHSLLLTMAVAVNPCATCPNGTKVGA  374

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
              +NN+SFVMPTT LLQAHYY ISGVF
Sbjct  375   AMNNISFVMPTTALLQAHYYKISGVF  400



>ref|XP_006435668.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
 ref|XP_006486373.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR48908.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
Length=553

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/386 (72%), Positives = 320/386 (83%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  VES +RHY FTV M N ++LCASK IV VNGKFPGP L+ARE D V+VRV NHV+ 
Sbjct  15    FPALVESAVRHYNFTVVMTNMTKLCASKSIVTVNGKFPGPTLHAREDDNVIVRVTNHVKY  74

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGW DGPAYITQCPIQPGQSY+YNFTLTGQRGTLLWH+HI+W RATV
Sbjct  75    NVTIHWHGVRQLRTGWYDGPAYITQCPIQPGQSYVYNFTLTGQRGTLLWHAHISWLRATV  134

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK  VPYPFPK DKE+IIV GEWW ++VE VIN A Q+G+ PNVSDAHTING 
Sbjct  135   HGAIVILPKRSVPYPFPKADKEKIIVFGEWWKADVEAVINQATQMGVAPNVSDAHTINGH  194

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGP   C+S+G+ L VESGKTYLLR+VNAA+N+ELFFKIAGH L VVEVD++Y KPF+TD
Sbjct  195   PGPVTNCTSQGFTLHVESGKTYLLRIVNAAVNDELFFKIAGHNLTVVEVDSSYTKPFKTD  254

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+GPGQTTNALLTAD+K GKY I +SPFMDTIVA +N T  A L YKGT   +ST LT
Sbjct  255   TIFIGPGQTTNALLTADKKIGKYLITVSPFMDTIVAVNNVTGIAFLRYKGTVAFSSTTLT  314

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              +P  NAT VT TF+D+LRSLNS+ YPA VPL+VDHSL+  + V VNPC  C +G++V A
Sbjct  315   NVPAINATEVTNTFSDNLRSLNSKRYPAKVPLTVDHSLLITMAVAVNPCATCPNGTKVGA  374

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
              +NN+SFVMPTT LLQAHYY ISGVF
Sbjct  375   AMNNISFVMPTTALLQAHYYKISGVF  400



>ref|XP_002520425.1| laccase, putative [Ricinus communis]
 gb|EEF41838.1| laccase, putative [Ricinus communis]
Length=556

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/389 (71%), Positives = 322/389 (83%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP SVE M+RHYKF V MK  +++C++KPIV VNGKFPGP L ARE DTV+V+V NHV
Sbjct  15    CLFPASVECMVRHYKFNVVMKTATKMCSTKPIVTVNGKFPGPTLVAREDDTVLVKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFTLTGQRGTL WH+HI W RA
Sbjct  75    KYNLSIHWHGIRQVRTGWADGPAYITQCPIQPGQSYVYNFTLTGQRGTLWWHAHILWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFP PDKEE+IVL EWW S+VE VIN A++ G+ PNVSDAHTIN
Sbjct  135   TVHGAIVILPKRGVPYPFPTPDKEEVIVLSEWWKSDVEAVINEALKSGLAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP P C S+ G+ L V SGKTY+LR+VNAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  195   GHPGPVPACPSQGGFTLPVHSGKTYMLRIVNAALNEELFFKIAGHQLTVVEVDATYVKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN LLTA + +GKY +A SPFMD  +A DN TA ATL Y GT   ++T
Sbjct  255   KTDTIVIAPGQTTNVLLTAGRSSGKYLVAASPFMDAPIAVDNVTAVATLHYSGTLSSSAT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT  P +NAT + + FT++LRSLNS+ YPANVPL +DHSL F IG+GVNPC  C +GSR
Sbjct  315   TLTATPPKNATSIASNFTNALRSLNSKKYPANVPLKIDHSLFFTIGLGVNPCATCVNGSR  374

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVADINNV+FVMPT  LLQAH++NISGVF
Sbjct  375   VVADINNVTFVMPTIGLLQAHFFNISGVF  403



>ref|XP_002316233.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
 gb|EEF02404.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
Length=555

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/386 (70%), Positives = 316/386 (82%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  VE  +R Y F V + NT++LC++K I  +NGKFPGP +YAREGD V +R+ N VQ 
Sbjct  16    FPALVECKVRLYNFRVVLTNTTKLCSTKSIPTINGKFPGPTIYAREGDNVNIRLTNQVQY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV++HWHGV+Q RTGW+DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWH+HI+W RAT+
Sbjct  76    NVTVHWHGVRQLRTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHISWLRATI  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVI PK GVPYPFPKPDKE+II+L EWW ++VE V+N A   G+PPN+SDAHT+NG 
Sbjct  136   HGAIVIFPKKGVPYPFPKPDKEKIIILSEWWKADVEAVVNQATMTGLPPNISDAHTVNGH  195

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
              G  P C+S G+ L VESGKTYLLR++NAALN+ELFFKIAGH + VVEVDAT+ KPF TD
Sbjct  196   TGAVPGCTSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDATFTKPFSTD  255

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+GPGQTTNALLTAD+  GKY IA+SPFMDT+VA DN TA A L YKGT   +   LT
Sbjct  256   TIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAFLRYKGTLAFSPPVLT  315

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
               P  NATP T+TF D LRSLNS+ YPANVPL+VDH L F IGVG++PC  C++GS+ VA
Sbjct  316   TTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVGIDPCATCTNGSKAVA  375

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
             DINNVSF+MPTT LLQAHYYNISGVF
Sbjct  376   DINNVSFIMPTTALLQAHYYNISGVF  401



>ref|XP_007009094.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY17904.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=554

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/387 (72%), Positives = 318/387 (82%), Gaps = 1/387 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FPV VE  IRHY FTV +KNT+RLCA+KPIV VNG+FPGP LYAREGD V+ RV NHVQ 
Sbjct  15    FPVLVECKIRHYNFTVVLKNTTRLCATKPIVTVNGQFPGPTLYAREGDNVLARVTNHVQH  74

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGWSDGPAYITQCPIQPGQ++LYNFT+TGQRGTLLWH+HI+W R+T+
Sbjct  75    NVTIHWHGVRQLRTGWSDGPAYITQCPIQPGQNFLYNFTVTGQRGTLLWHAHISWLRSTM  134

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFPKP KE++I+LGEWW ++ E V+N AMQ G+ PNVSDAHTING 
Sbjct  135   HGAIVILPKKGVPYPFPKPYKEKVIILGEWWKADTEAVVNQAMQTGLAPNVSDAHTINGH  194

Query  684   PGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
              GP   CSS+G Y L VE+GKTYLLRVVNAA+NEELFFKIAGH L VVEVDA Y KP++T
Sbjct  195   AGPLANCSSEGAYTLHVETGKTYLLRVVNAAVNEELFFKIAGHNLTVVEVDAVYTKPYKT  254

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DT+F+GPGQTT +LLTADQ  GKY IA+SPFMDTIVA DN TA   L Y  T     T L
Sbjct  255   DTLFLGPGQTTTSLLTADQGIGKYLIAVSPFMDTIVAVDNLTAVGFLRYNHTLAFTPTTL  314

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T +P  NAT VT  F+ SLRSLNS+ YPANVPL++DHSL F IG+G+NPC  C +GSR V
Sbjct  315   TSIPPVNATSVTEVFSKSLRSLNSKEYPANVPLTIDHSLFFTIGIGINPCATCVNGSRAV  374

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             A INNV+F MPTT LLQAHYY ISGVF
Sbjct  375   AAINNVTFDMPTTALLQAHYYGISGVF  401



>ref|XP_002314124.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
 gb|EEE88079.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
Length=556

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/389 (71%), Positives = 322/389 (83%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP SVESM+RHYKF V MKN+++LC++KPIV VNG+FPGP L ARE DTV+V+V NHV
Sbjct  15    CLFPASVESMVRHYKFNVVMKNSTKLCSTKPIVTVNGQFPGPTLVAREDDTVLVKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQS++YNFT+TGQRGTLLWH+HI W RA
Sbjct  75    KYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSFVYNFTITGQRGTLLWHAHILWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFP P KE++I+LGEWW S+VE VIN A + GI PNVSDAHTIN
Sbjct  135   TVHGAIVILPKRGVPYPFPTPRKEKVIILGEWWKSDVEAVINEATKSGIAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CSS  GYNL V  GKTY+LR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  195   GHPGPVSACSSHGGYNLSVHPGKTYMLRIINAALNEELFFKIAGHQLTVVEVDATYVKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             + DT+ + PGQTTN L+TA++ +G+Y +A SPFMD  +A DN TATATL Y GT     T
Sbjct  255   KIDTVVIAPGQTTNVLVTANRGSGQYLVAASPFMDAPIAVDNVTATATLHYSGTLASTIT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT+ P +NATPV T FT++LRSLNS  YPA VPL +DHSL F +G+GVNPC  C +GSR
Sbjct  315   TLTVPPAKNATPVATNFTNALRSLNSIKYPARVPLKIDHSLFFTVGLGVNPCATCINGSR  374

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVADINNV+FVMPT  LLQAH +NISGVF
Sbjct  375   VVADINNVTFVMPTIALLQAHVFNISGVF  403



>ref|XP_010262771.1| PREDICTED: laccase-4-like [Nelumbo nucifera]
Length=555

 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/388 (71%), Positives = 325/388 (84%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
              P  VE  +RHYKF V  +N +RLC++KPIV VNG+FPGP LYAREGDTV+V+V NHVQ 
Sbjct  15    LPSLVECRVRHYKFNVVTRNFTRLCSTKPIVTVNGRFPGPTLYAREGDTVLVKVVNHVQY  74

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTLLWH+HI W RAT+
Sbjct  75    NVTIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRATL  134

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFPKP KE +++LGEWW S+VE VIN A+  G+ PNVSDAHTING 
Sbjct  135   HGAIVILPKRGVPYPFPKPHKEVVVILGEWWKSDVEAVINEALGSGLAPNVSDAHTINGH  194

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP P CSS+ G+ L+V+ GKTY+LR++NAALNEELFFKIAGH+L VVEVDA Y KPF+T
Sbjct  195   PGPVPGCSSQDGFQLQVDPGKTYMLRLINAALNEELFFKIAGHQLTVVEVDAVYTKPFKT  254

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DT+ + PGQTTN LLTA + +GKY +A SPFMDT +VA DN TATATL Y G+   ++T 
Sbjct  255   DTVLIAPGQTTNVLLTAGRSSGKYLVAASPFMDTPVVAVDNMTATATLHYSGSLATSATT  314

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             LT  P QNATPV T F DSLRSLNS+ YPA VP +VDHSL+F++G+GVNPC  C +GSRV
Sbjct  315   LTNPPPQNATPVATNFMDSLRSLNSKQYPAKVPQTVDHSLLFSVGLGVNPCSTCPNGSRV  374

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VADINNVSFVMPTT LLQAH++NISGVF
Sbjct  375   VADINNVSFVMPTTALLQAHFFNISGVF  402



>ref|XP_011036009.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=555

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/386 (70%), Positives = 313/386 (81%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  VE  +R Y F V + NT++LC++K I  +NGKFPGP +YAREGD V +R+ N VQ 
Sbjct  16    FPALVECKVRLYNFRVVLTNTTKLCSTKSIPTINGKFPGPTIYAREGDNVNIRLTNQVQH  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV++HWHGV+Q RTGW+DGPAYITQCPI PGQSYLYNFTLTGQRGTLLWH+HI+W RAT+
Sbjct  76    NVTVHWHGVRQLRTGWADGPAYITQCPILPGQSYLYNFTLTGQRGTLLWHAHISWLRATI  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVI PK GVPYPFPKPDKE+II L EWW ++VE VIN A   G+PPN+SDAHT+NG 
Sbjct  136   HGAIVIFPKKGVPYPFPKPDKEKIITLSEWWKADVEAVINQATMTGLPPNISDAHTVNGQ  195

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
              G  P C+S G+ L VESGKTYLLR++NAALN+ELFFKIAGH + VVEVDATY KPF TD
Sbjct  196   TGAVPGCTSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDATYTKPFSTD  255

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+GPGQTTNALLTAD+  GKY IA+SPFMDT+VA DN TA A L YKGT   +   LT
Sbjct  256   TIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAFLRYKGTLAFSPPVLT  315

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
               P  NATP T+TF D LRSLNS+ YPANVPL+VDH L F IGVG++PC  C +GS+ VA
Sbjct  316   TTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVGIDPCATCINGSKAVA  375

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
             DINNVSF+MPTT LLQAHYYNISGVF
Sbjct  376   DINNVSFIMPTTALLQAHYYNISGVF  401



>ref|XP_011039810.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=556

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/386 (69%), Positives = 318/386 (82%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V+  +R Y F V + NT++LC++K IV +NGKFPGP +YAREGD V +++ NHVQ 
Sbjct  17    FPALVQCKVRRYDFRVVLTNTTKLCSTKSIVTINGKFPGPTIYAREGDNVNIKLTNHVQY  76

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGWSDGPAYITQCPI+PGQSYLYNFTLTGQRGTLLWH+HI+W RAT+
Sbjct  77    NVTIHWHGVRQLRTGWSDGPAYITQCPIRPGQSYLYNFTLTGQRGTLLWHAHISWLRATI  136

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILP+ GVPYPFPKPDKE+II+LGEWW ++VE V+N A Q G+PPN+SDAH +NG 
Sbjct  137   HGAIVILPQKGVPYPFPKPDKEKIIILGEWWKADVEAVVNQATQTGLPPNISDAHIVNGQ  196

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
              G  P C S G+ L VESGKTYLLR++NAALN+ELFFKIAGH + VVEVDA Y KP  TD
Sbjct  197   TGAVPGCPSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDAAYTKPLSTD  256

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+GPGQTTNALLTAD++ GKY +A+SPFMDT+VA DN TA A L YKGT   +   LT
Sbjct  257   TIFIGPGQTTNALLTADKRVGKYLMAVSPFMDTVVAVDNVTAIAFLRYKGTIAFSPPVLT  316

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
               P  NATPVT+TF D+LRSLNS+ YPANVPL+VDHSL F IGVG++PC  C +GS+ V 
Sbjct  317   TTPAINATPVTSTFMDNLRSLNSKKYPANVPLTVDHSLYFTIGVGIDPCATCVNGSKAVG  376

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
              INN+SF+MPTT LLQAHYY+ISGVF
Sbjct  377   AINNISFIMPTTALLQAHYYSISGVF  402



>ref|XP_002311202.1| laccase family protein [Populus trichocarpa]
 gb|EEE88569.1| laccase family protein [Populus trichocarpa]
Length=556

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/386 (70%), Positives = 318/386 (82%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  VE  +R Y F V + NT++LC++K IV +NGKFPGP +YAREGD V +++ NHVQ 
Sbjct  17    FPALVECEVRLYDFRVVLTNTTKLCSTKSIVTINGKFPGPTIYAREGDNVNIKLTNHVQY  76

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGWSDGPAYITQCPI+PGQSYLYNFTLTGQRGTLLWH+HI+W RAT+
Sbjct  77    NVTIHWHGVRQLRTGWSDGPAYITQCPIRPGQSYLYNFTLTGQRGTLLWHAHISWLRATI  136

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILP+ GVPYPFPKPDKE+II+LGEWW ++VE V+N A Q G+PPN+SDAH +NG 
Sbjct  137   HGAIVILPQKGVPYPFPKPDKEKIIILGEWWKADVEAVVNQATQTGLPPNISDAHIVNGQ  196

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
              G  P C S G+ L VESGKTYLLR++NAALN+ELFFKIAGH + VVEVDA Y KPF TD
Sbjct  197   TGAVPGCPSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDAAYTKPFSTD  256

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+GPGQTTNALLTAD+  GKY +A+SPFMDT+VA DN TA A L YKGT   +   LT
Sbjct  257   TIFIGPGQTTNALLTADKSVGKYLMAVSPFMDTVVAVDNVTAIAFLRYKGTIAFSPPVLT  316

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
               P  NATPVT+TF D+LRSLNS+ +PANVPL+VDHSL F IGVG++PC  C +GS+ V 
Sbjct  317   TTPAINATPVTSTFMDNLRSLNSKKFPANVPLTVDHSLYFTIGVGIDPCATCVNGSKAVG  376

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
              INN+SF+MPTT LLQAHYY+ISGVF
Sbjct  377   AINNISFIMPTTALLQAHYYSISGVF  402



>ref|XP_002299828.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
 gb|EEE84633.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
Length=557

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/389 (72%), Positives = 322/389 (83%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP SVESM+RHYKF V MKNT+RLC+ KPIV VNG+FPGP L ARE DTV+V+V NHV
Sbjct  16    CLFPASVESMVRHYKFNVVMKNTTRLCSEKPIVTVNGRFPGPTLVAREDDTVLVKVVNHV  75

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCP+QPGQ+++YNFT+TGQRGTLLWH+HI W RA
Sbjct  76    KYNVSIHWHGIRQLRTGWADGPAYITQCPLQPGQNFVYNFTITGQRGTLLWHAHILWLRA  135

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFP P +EE+IVLGEWW S+VE VIN AM  G  PNVSDAHTIN
Sbjct  136   TVHGAIVILPKRGVPYPFPTPHREEVIVLGEWWKSDVEAVINEAMNSGRAPNVSDAHTIN  195

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CSS+ GYNL V  GKTY+LR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  196   GHPGPVSGCSSQGGYNLPVRPGKTYMLRIINAALNEELFFKIAGHQLTVVEVDATYVKPF  255

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             + DTI + PGQTTN L+TA++ +GKY +A SPFMD  +A DN TATATL Y GT    +T
Sbjct  256   KIDTIVIAPGQTTNVLVTANRGSGKYLVAASPFMDAPIAVDNVTATATLHYSGTLASTTT  315

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT+ P QNATPV T FTD+LRSLNS  YPA VPL +DHSL F IG+GVNPC  C +G+R
Sbjct  316   TLTVPPAQNATPVATNFTDALRSLNSIKYPARVPLKIDHSLFFTIGLGVNPCATCVNGNR  375

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVADINNV+FVMPT  LLQAH++NI GVF
Sbjct  376   VVADINNVTFVMPTIALLQAHFFNIKGVF  404



>ref|XP_011077581.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=557

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/392 (70%), Positives = 323/392 (82%), Gaps = 4/392 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FPV V+  +RHYKF V MKNT+RLC++K IV VNGKFPGP +YARE DTV+++V NHV
Sbjct  13    CLFPVLVQCRVRHYKFNVVMKNTTRLCSTKSIVTVNGKFPGPTIYAREDDTVLIKVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  73    KYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGA+VILPKLGVPYPFPKP+ E +I+LGEWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TLHGALVILPKLGVPYPFPKPNHERVIILGEWWKSDTEAVINEALKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSS-KGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP P CSS  G+ L+VE GKTYLLR++NAALNEELFFKIAGHR+ +VEVDATYVKPF
Sbjct  193   GHPGPVPNCSSTDGFILDVEPGKTYLLRLINAALNEELFFKIAGHRMTIVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLAS  1031
             +TDTI + PGQTTNA+LT D+  GKY +A SPFMDT +VA DN TATATL Y GT   + 
Sbjct  253   KTDTIVIAPGQTTNAILTTDRAVGKYMVAASPFMDTPVVAVDNLTATATLHYSGTLSSSL  312

Query  1032  TALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SS  1205
             T  T  P QNATPV   FT+SLRSLNS  YPA VP  VDHSL F +G+G+NPCP C  ++
Sbjct  313   TTFTRPPAQNATPVANNFTNSLRSLNSNKYPAKVPQKVDHSLFFTVGLGINPCPTCKATN  372

Query  1206  GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             GSRVVA +NNV+FVMPT  LLQAH++NI GVF
Sbjct  373   GSRVVAAVNNVTFVMPTIALLQAHFFNIKGVF  404



>ref|XP_008785423.1| PREDICTED: laccase-22 [Phoenix dactylifera]
Length=554

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/391 (69%), Positives = 324/391 (83%), Gaps = 5/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  PV V+   RHYKF V MKN +RLC++KPIV VNG+FPGP LYAREGD V+V+V NHV
Sbjct  13    CLLPVLVDGRTRHYKFNVVMKNATRLCSTKPIVTVNGRFPGPTLYAREGDNVLVKVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NV+IHWHGV+Q RTGW+DGPAYITQCPIQPG SY+YNFT+TGQRGTL WH+HI W R 
Sbjct  73    KYNVTIHWHGVRQLRTGWADGPAYITQCPIQPGSSYVYNFTITGQRGTLFWHAHILWLRV  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPKL VPYPFP P KEE+I+LGEWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TVHGAIVILPKLHVPYPFPTPHKEEVIILGEWWKSDTEAVINQALKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C +SKG+ L+V+SG+TY+LR+VNAALNEELFF++AGH++ VVEVDATY KPF
Sbjct  193   GHPGPMSACPASKGFQLKVDSGRTYMLRIVNAALNEELFFRVAGHQMTVVEVDATYTKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN LLTADQ AG+Y +  SPFMD+ +A DNQTA A + Y  T+ +A++
Sbjct  253   KTDTILITPGQTTNVLLTADQGAGRYLVTASPFMDSPIAVDNQTAMAVVHY--TNTVAAS  310

Query  1035  ALTIM--PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG  1208
             ALT +  P QNATPV + F DSLRSLNS+ YPA VP +VDHSL+F +G+GVNPCP C +G
Sbjct  311   ALTAIKPPPQNATPVASNFIDSLRSLNSKQYPARVPSTVDHSLLFTVGLGVNPCPTCVNG  370

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVAD+NNVSF MPTT +LQAHY+N+SGVF
Sbjct  371   SRVVADMNNVSFTMPTTAILQAHYFNVSGVF  401



>ref|XP_011032154.1| PREDICTED: laccase-4-like isoform X2 [Populus euphratica]
Length=556

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/389 (70%), Positives = 317/389 (81%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP SVESM+RHYKF V MKN+++LC++KPIV VNG+FPGP L ARE DTV+V+V NHV
Sbjct  15    CLFPASVESMVRHYKFNVVMKNSTKLCSTKPIVTVNGQFPGPTLVAREDDTVLVKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTL WH+HI W RA
Sbjct  75    KYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLFWHAHILWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFP P KE++IVLGEWW S+VE VIN A + G+ PNVSDAHTIN
Sbjct  135   TVHGAIVILPKRGVPYPFPTPRKEKVIVLGEWWKSDVEAVINEATKSGMAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CSS  GYNL V  GKTY+ R++NAALNEELFFKIAGH+L VVEVDA YVKPF
Sbjct  195   GHPGPVSACSSHGGYNLTVHPGKTYMFRIINAALNEELFFKIAGHQLTVVEVDAAYVKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             + DT+ + PGQTTN LLTA++ +GKY +A SPFMD  +A DN TATA L Y GT     T
Sbjct  255   KIDTVVIAPGQTTNVLLTANRGSGKYLVAASPFMDAPIAVDNVTATAILHYSGTLASTIT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT+ P +NATPV T FT++LRSLNS  YPA VPL +D SL F +G+GVNPC  C +GSR
Sbjct  315   TLTVPPAKNATPVATNFTNALRSLNSIKYPARVPLKIDRSLFFTVGLGVNPCATCINGSR  374

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVADINNV+FVMPT  LLQAH +NISGVF
Sbjct  375   VVADINNVTFVMPTIALLQAHVFNISGVF  403



>ref|XP_009799024.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=557

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/391 (69%), Positives = 320/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP+ VE  IRHYKF V MKNT+RLC+SKPIV VNGKFPGP +YARE DTV+V+V NHV
Sbjct  14    CLFPLVVECRIRHYKFNVVMKNTTRLCSSKPIVTVNGKFPGPTIYAREEDTVLVKVVNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTL WH+HI W RA
Sbjct  74    KYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPKLGVPYPFPKP+ E +++L EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  134   TVHGAIVILPKLGVPYPFPKPNHEAVVLLAEWWKSDTEAVINEAIKSGLAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C S+ GY L V+ GKTYLLRV+NAALNEELFFKIAGH++ VVEVDATYVKPF
Sbjct  194   GHPGPVSNCPSQGGYKLNVDPGKTYLLRVINAALNEELFFKIAGHKMTVVEVDATYVKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN ++TA+Q +GKY +A SPFMD  +A DN TA ATL Y GT      
Sbjct  254   KTDTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNVTAIATLHYSGTQGNNRI  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACS--SG  1208
             +LT  P +NATPV  TF DSLRSLNS+ YPANVP  +DHSL F +G+G+NPCP+C   +G
Sbjct  314   SLTSTPPKNATPVANTFLDSLRSLNSKKYPANVPKKIDHSLFFTVGLGINPCPSCKQGNG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMPTT LLQAH++ I GVF
Sbjct  374   SRVVASVNNVTFVMPTTALLQAHFFGIKGVF  404



>gb|KHG28836.1| Laccase-22 [Gossypium arboreum]
Length=574

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/386 (71%), Positives = 312/386 (81%), Gaps = 1/386 (0%)
 Frame = +3

Query  147   PVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQEN  326
             P  VE  IRHY F V +KN ++LC++KPIV VNGKFPG  LYAREGD V+VR+ NHVQ N
Sbjct  36    PAFVECRIRHYHFNVVVKNETKLCSTKPIVTVNGKFPGQTLYAREGDNVLVRLTNHVQYN  95

Query  327   VSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVH  506
             V+IHWHGV+Q RTGWSDGPAYITQCPIQPGQ++LYNFTLTGQRGTLLWH+HI+W R+TVH
Sbjct  96    VTIHWHGVRQLRTGWSDGPAYITQCPIQPGQNFLYNFTLTGQRGTLLWHAHISWLRSTVH  155

Query  507   GAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLP  686
             GAIVILPK GVPYPFPKP KE++IVLGEWW ++ E V+N AMQ G+PPN+SDAHTING P
Sbjct  156   GAIVILPKKGVPYPFPKPYKEKVIVLGEWWKADTEAVVNQAMQTGLPPNISDAHTINGHP  215

Query  687   GPTPTCSS-KGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             GP P CSS   Y L VE+GKTYLLRV+NAALN+ELFFKIA H L VVEVDA Y KP ETD
Sbjct  216   GPVPNCSSDDAYTLHVETGKTYLLRVINAALNDELFFKIANHNLTVVEVDACYTKPLETD  275

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             T+F+GPGQTT ALL ADQ  GKY IAISPFMDT+VA DN T    L Y  T     T   
Sbjct  276   TLFLGPGQTTTALLKADQGIGKYLIAISPFMDTVVAVDNLTGMGYLRYNHTLAFTPTTFV  335

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              +P  NATP+T+ F+DSLRSLNS+ Y ANVPL++DHSL F IGVG+NPC  C +GSR VA
Sbjct  336   PIPSVNATPLTSVFSDSLRSLNSKQYLANVPLTIDHSLFFTIGVGINPCATCFNGSRAVA  395

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
              INNVSFVMPTT +LQAHYY I+GVF
Sbjct  396   AINNVSFVMPTTAILQAHYYGINGVF  421



>gb|KDO53232.1| hypothetical protein CISIN_1g0093922mg, partial [Citrus sinensis]
Length=506

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/391 (69%), Positives = 320/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  VE  +RHYKF V MKN+++LC+SKPIV VN KFPGP LYARE DTV+V+V NHV
Sbjct  13    CLFPALVECRVRHYKFNVVMKNSTKLCSSKPIVTVNRKFPGPTLYAREHDTVLVKVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NV+IHWHGV+Q RTGW+DGPAYITQCPIQ G SY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  73    KYNVTIHWHGVRQLRTGWADGPAYITQCPIQSGHSYVYNFTITGQRGTLLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFPKP KE ++VL EWW S+ E VIN A+Q G+ PNVSD+HTIN
Sbjct  133   TVHGAIVILPKRGVPYPFPKPHKEVVVVLAEWWKSDTEAVINQALQSGLAPNVSDSHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP  +CSS+ G+ L V+SGKTY+LR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  193   GQPGPISSCSSQGGFTLPVDSGKTYMLRIINAALNEELFFKIAGHKLTVVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TD I + PGQTTN LL+AD+ +GKY +A SPFMD  +A DN TATATL Y GT   ++T
Sbjct  253   KTDNIVIAPGQTTNVLLSADKTSGKYLVAASPFMDAPIAVDNVTATATLHYSGTLASSAT  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P +N T +   F DSLRSLNS+ YPA VP +VDH+L+F +G+GVNPCP+C +  G
Sbjct  313   TLTSTPPKNGTAIANKFIDSLRSLNSKKYPAKVPQTVDHNLLFTVGLGVNPCPSCKAGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPT  LLQAH++NISGVF
Sbjct  373   SRVVASINNVTFVMPTIALLQAHFFNISGVF  403



>ref|XP_006429309.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
 ref|XP_006480970.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR42549.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
Length=555

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/391 (69%), Positives = 322/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  VE  +RHYKF V MKN+++LC+SKPIV VNGKFPGP LYARE DTV+V+V NHV
Sbjct  13    CLFPALVECRVRHYKFNVVMKNSTKLCSSKPIVTVNGKFPGPTLYAREHDTVLVKVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NV+IHWHGV+Q RTGW+DGPAYITQCPIQ G SY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  73    KYNVTIHWHGVRQLRTGWADGPAYITQCPIQSGHSYVYNFTITGQRGTLLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFPKP KE ++VL EWW S+ E VIN A++ G+ PNVSD+HTIN
Sbjct  133   TVHGAIVILPKRGVPYPFPKPHKEVVVVLAEWWKSDTEAVINQALRSGLAPNVSDSHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP  +CSS+ G+ L V+SGKTY+LR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  193   GQPGPISSCSSQGGFTLPVDSGKTYMLRIINAALNEELFFKIAGHKLTVVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN LL+AD+ +GKY +A SPFMD  +A DN TATATL Y GT   ++T
Sbjct  253   KTDTIVIAPGQTTNVLLSADKTSGKYLVAASPFMDAPIAVDNATATATLHYSGTLASSAT  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P +N T +   F DSLRSLNS+ YPA VP +VDH+L+F +G+GVNPCP+C +  G
Sbjct  313   TLTSTPPKNGTAIANKFIDSLRSLNSKKYPAKVPQTVDHNLLFTVGLGVNPCPSCKAGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPT  LLQAH++NISGVF
Sbjct  373   SRVVASINNVTFVMPTIALLQAHFFNISGVF  403



>ref|XP_010923124.1| PREDICTED: laccase-22 [Elaeis guineensis]
Length=554

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/389 (69%), Positives = 318/389 (82%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  PV V+   RHYKF V MKN +RLC++KPIV VNG+FPGP LYAREGD V+V+V NHV
Sbjct  13    CLLPVVVDGRTRHYKFNVVMKNATRLCSTKPIVTVNGRFPGPTLYAREGDNVLVKVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NV+IHWHGV+Q RTGW+DGPAYITQCPIQPG +Y+YNFT+TGQRGTL WH+HI W R 
Sbjct  73    KYNVTIHWHGVRQLRTGWADGPAYITQCPIQPGNNYVYNFTITGQRGTLFWHAHILWLRV  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPKL VPYPFP P KEE+I+LGEWW S+ E VIN A++ G+ PNVSDAH IN
Sbjct  133   TVHGAIVILPKLHVPYPFPTPHKEEVIILGEWWKSDTEAVINEALKSGLAPNVSDAHVIN  192

Query  678   GLPGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP  TC +SKG+ L+V+SGKTY+LR++NAALNEELFFK+AGH+L VVEVDATY KPF
Sbjct  193   GHPGPMSTCPASKGFQLKVDSGKTYMLRIINAALNEELFFKVAGHQLTVVEVDATYTKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN LLTAD+ AG+Y +  SPFMD+ +A DNQTA AT+ Y  T      
Sbjct  253   KTDTILITPGQTTNVLLTADRGAGRYLVTASPFMDSPIAVDNQTAMATVHYTNTVSTTVL  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
               T  P QNATPV + F DSLRSLNS+ YPA VPL+VDHSL+F +G+GVNPCP C +GSR
Sbjct  313   TTTKPPPQNATPVASNFIDSLRSLNSKKYPARVPLTVDHSLLFTVGLGVNPCPTCVNGSR  372

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVAD+NNV+F MPTT +LQAHY+NISGVF
Sbjct  373   VVADVNNVTFSMPTTAILQAHYFNISGVF  401



>ref|XP_009624727.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/391 (68%), Positives = 320/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP+ VE  IRHYKF V +KNT+RLC+SKPIV VNGKFPGP +YAREGDTV+V+V NHV
Sbjct  14    CLFPLVVECRIRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTIYAREGDTVLVKVVNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTL WH+HI W RA
Sbjct  74    KYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPKLGVPYPFPKP+ E +++L EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  134   TVHGAIVILPKLGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAIKSGLAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C+S+ GY L V+ GKTY+LRV+NAALNEELFFKIAGH++ VVEVDATY+KPF
Sbjct  194   GHPGPVSNCASQGGYKLNVDPGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYIKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN ++TA+Q +GKY +A SPFMD  +A DN TA ATL Y GT   +  
Sbjct  254   KTDTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNVTAIATLHYSGTQGNSHI  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACS--SG  1208
             +LT  P +NATPV  TF DSLRSLNS+ YPA VP  +DHSL F +G+G+NPCP C   +G
Sbjct  314   SLTSTPPKNATPVANTFLDSLRSLNSKKYPAKVPKKIDHSLFFTVGLGINPCPTCKQGNG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMPT  LLQAH++ I GVF
Sbjct  374   SRVVASVNNVTFVMPTVALLQAHFFGIKGVF  404



>ref|XP_010104682.1| hypothetical protein L484_022065 [Morus notabilis]
 gb|EXC01488.1| hypothetical protein L484_022065 [Morus notabilis]
Length=556

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/389 (69%), Positives = 321/389 (83%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP SVE M+RHYKF V +KN+++LC+SK IV VNGKFPGP +YARE DT++V+V NHV
Sbjct  15    CLFPASVECMVRHYKFNVVLKNSTKLCSSKQIVTVNGKFPGPTIYAREDDTLLVKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPAYITQCPIQPGQ ++YNFT+TGQRGTL WH+HI W RA
Sbjct  75    KYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQQFVYNFTITGQRGTLWWHAHILWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFP+P KE+++VLGEWW S+VE VIN A++ G+ PNVSDAHTIN
Sbjct  135   TVHGAIVILPKRGVPYPFPRPHKEKVLVLGEWWKSDVEAVINEALKSGLAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C+S+ G+ L V + KTYLLR+VNAALNEELFFKIAGH+L VVEVDA Y KPF
Sbjct  195   GQPGPVSGCTSQGGFTLPVGASKTYLLRIVNAALNEELFFKIAGHQLTVVEVDAVYTKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +T T+ + PGQTTN LL AD+KAG+Y +A +PFMD  +A DN+TATATL Y GT   + T
Sbjct  255   KTGTVIIAPGQTTNVLLNADRKAGRYLVAATPFMDAPIAVDNKTATATLHYSGTLSSSRT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT +P QNAT + T FT SLRSLNS+ YPA VPL +DHSL+F IG+GVNPC  C +GSR
Sbjct  315   ILTALPPQNATSIATNFTSSLRSLNSKKYPARVPLKIDHSLLFTIGLGVNPCKTCVNGSR  374

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVADINNV+FVMP   LLQAH++NISGVF
Sbjct  375   VVADINNVTFVMPNIALLQAHFFNISGVF  403



>ref|XP_010256659.1| PREDICTED: laccase-4 [Nelumbo nucifera]
Length=554

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/383 (72%), Positives = 319/383 (83%), Gaps = 1/383 (0%)
 Frame = +3

Query  156   VESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSI  335
             VE  IRHYKF V MKNT+RLC++KPIV VNG+FPGP LYARE DTV+V+V NHVQ NV+I
Sbjct  19    VECRIRHYKFNVVMKNTTRLCSTKPIVTVNGRFPGPTLYAREDDTVLVKVVNHVQYNVTI  78

Query  336   HWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAI  515
             HWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTLLWH+HI W RAT+HGAI
Sbjct  79    HWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRATLHGAI  138

Query  516   VILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPT  695
             VILPK GVPYPFP P KE +++LGEWW S+VE VIN A+  G+ PNVSDAHTING PGP 
Sbjct  139   VILPKHGVPYPFPTPHKEVVVILGEWWKSDVEAVINEALNSGLAPNVSDAHTINGQPGPV  198

Query  696   PTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIF  872
             PTC S+ G+NL+VE GKTY+LR++NAALNEELFFKIAGH+L VVEVDA Y KPF+TDTI 
Sbjct  199   PTCPSQSGFNLKVEPGKTYMLRIINAALNEELFFKIAGHKLTVVEVDAVYTKPFKTDTIV  258

Query  873   VGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMP  1052
             + PGQTTN LL   + +GKY +A SPFMD+ +A DN TATATL Y GT   ++T LT  P
Sbjct  259   IAPGQTTNVLLETGRGSGKYLVAASPFMDSPIAVDNMTATATLHYSGTLATSATTLTNPP  318

Query  1053  LQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADIN  1232
              QNATPV + F DSLRSLNS+ YP  VPL+VDHSL+F +G+GVNPC  C +G RV+ADIN
Sbjct  319   PQNATPVASNFIDSLRSLNSKEYPVKVPLTVDHSLLFTVGLGVNPCSTCPNGIRVIADIN  378

Query  1233  NVSFVMPTTPLLQAHYYNISGVF  1301
             NVSFVMPTT LLQAHY NISGVF
Sbjct  379   NVSFVMPTTALLQAHYLNISGVF  401



>gb|KHN06247.1| Laccase-4 [Glycine soja]
Length=556

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/389 (68%), Positives = 318/389 (82%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P+SVE+M+RHYKF V +KN +RLC++KPIV VNGKFPGP +YARE DTV+V+V NHV
Sbjct  15    CLLPLSVEAMVRHYKFNVVLKNATRLCSTKPIVTVNGKFPGPNIYAREDDTVLVKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ+++YNFTLTGQRGTL WH+HI W RA
Sbjct  75    KYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQAFIYNFTLTGQRGTLWWHAHILWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPKLGVPYPFPKP+ E++++L EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  135   TVHGALVILPKLGVPYPFPKPNMEQVMILSEWWKSDTEAVINEALKSGLAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C+S+ G+ L+V+ G TYLLR++NAALNEELFFKIAGH L VVEVDA Y KPF
Sbjct  195   GHPGPVQGCASQEGFKLDVQPGNTYLLRIINAALNEELFFKIAGHELTVVEVDAVYTKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN LLT    AGKY +A SPFMD  +A DN+TATATL Y GT     T
Sbjct  255   KTDTIVIAPGQTTNVLLTTKHAAGKYLVAASPFMDAPIAVDNKTATATLHYSGTLGSTIT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT MP +NATP+ T+FTDSLRSLNS+ YPA VPL +DH+L+F + +G+NPC  C + SR
Sbjct  315   TLTSMPPKNATPLATSFTDSLRSLNSKKYPARVPLKIDHNLLFTVSLGINPCATCVNNSR  374

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVADINNV+FVMP   LLQAH++ I GVF
Sbjct  375   VVADINNVTFVMPKISLLQAHFFKIKGVF  403



>ref|XP_002322961.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
 gb|EEF04722.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
Length=557

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/391 (69%), Positives = 320/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  VE  IRHYKF V MKNT+RLC+SKPIV VNG FPGP LYARE DTV+V+V N V
Sbjct  14    CLFPAVVECRIRHYKFNVVMKNTTRLCSSKPIVTVNGLFPGPTLYAREDDTVLVKVVNRV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  74    KYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+V+LPKLGVPYPFP P KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  134   TVHGALVVLPKLGVPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG   TCSS+ G+ L V+SGKTY+LR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  194   GHPGAVSTCSSQGGFTLPVQSGKTYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTN L+T ++  GKY +A SPFMD  +A DN TATATL Y G    + T
Sbjct  254   KTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATATLHYSGALSNSPT  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LTI P +NAT +   FT+SLRSLNS+ +PA VPL+VDHSL F +G+G+NPCP C +  G
Sbjct  314   TLTIPPPKNATAIANQFTNSLRSLNSKTFPAKVPLTVDHSLFFTVGLGINPCPTCKAGNG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH++NISGVF
Sbjct  374   SRVVASINNVTFVMPTTALLQAHFFNISGVF  404



>ref|XP_009350996.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/387 (70%), Positives = 317/387 (82%), Gaps = 1/387 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             +P  VES+IRHYKF+V  KNT+ LCASKPIV VNGKFPGP LYARE DTV+VRV NHV+ 
Sbjct  19    YPAFVESLIRHYKFSVVYKNTTNLCASKPIVTVNGKFPGPTLYAREDDTVIVRVTNHVKY  78

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGVKQ  TGWSDGPAYITQCPIQPGQ+Y+YNFTLTGQRGTLLWH+H +W RAT+
Sbjct  79    NVTIHWHGVKQRGTGWSDGPAYITQCPIQPGQNYIYNFTLTGQRGTLLWHAHDSWLRATL  138

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK   PYPFP PD+E+II++ EWW S+VEDVIN A Q G+PPNVSDAHTING 
Sbjct  139   HGAIVILPKRSTPYPFPTPDEEKIIIMAEWWKSDVEDVINQATQSGLPPNVSDAHTINGR  198

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
              GP P CSS+ GY L VE+GKTY+LR+VNAA+N+ELFFK+AGH L VVEVDA+Y KPF+T
Sbjct  199   VGPLPGCSSQGGYTLHVENGKTYMLRIVNAAINDELFFKVAGHNLTVVEVDASYTKPFQT  258

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DTI+ GPGQTTN +LTA+Q  GKY I  SPFMD  +  DN T  ATL YKGT    +  L
Sbjct  259   DTIYTGPGQTTNVILTANQGIGKYFITASPFMDAPIGFDNATVIATLRYKGTPANPTAIL  318

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T +P +NATP+T  F DSLRSLNS+ YPA+VPL++DHSL F I VG NPC AC SGS++V
Sbjct  319   TSIPPRNATPLTDAFVDSLRSLNSKQYPADVPLTIDHSLFFTISVGANPCAACVSGSKLV  378

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             + INNVSFVMP+  LLQA+YYN+ GV+
Sbjct  379   SAINNVSFVMPSISLLQAYYYNVKGVY  405



>ref|XP_003551299.1| PREDICTED: laccase-4-like [Glycine max]
Length=556

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/389 (68%), Positives = 318/389 (82%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P+SVE+M+RHYKF V +KN +RLC++KPIV VNGKFPGP +YARE DTV+V+V NHV
Sbjct  15    CLLPLSVEAMVRHYKFNVVLKNATRLCSTKPIVTVNGKFPGPTIYAREDDTVLVKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ+++YNFTLTGQRGTL WH+HI W RA
Sbjct  75    KYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQAFIYNFTLTGQRGTLWWHAHILWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPKLGVPYPFPKP+ E++++L EWW S+ E VIN A++ G+ PNVS+AHTIN
Sbjct  135   TVHGALVILPKLGVPYPFPKPNMEQVMILSEWWKSDTEAVINEALKSGLAPNVSNAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C+S+ G+ L+V+ G TYLLR++NAALNEELFFKIAGH L VVEVDA Y KPF
Sbjct  195   GHPGPVQGCASQEGFKLDVQPGNTYLLRIINAALNEELFFKIAGHELTVVEVDAVYTKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN LLT    AGKY +A SPFMD  +A DN+TATATL Y GT     T
Sbjct  255   KTDTIVIAPGQTTNVLLTTKHAAGKYLVAASPFMDAPIAVDNKTATATLHYSGTLGSTIT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT MP +NATP+ T+FTDSLRSLNS+ YPA VPL +DH+L+F + +G+NPC  C + SR
Sbjct  315   TLTSMPPKNATPLATSFTDSLRSLNSKKYPARVPLKIDHNLLFTVSLGINPCATCVNNSR  374

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVADINNV+FVMP   LLQAH++ I GVF
Sbjct  375   VVADINNVTFVMPKISLLQAHFFKIKGVF  403



>gb|AAC49536.1| diphenol oxidase [Nicotiana tabacum]
Length=557

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/391 (68%), Positives = 318/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP+ VE  IRHYKF V MKNT+RLC+SKPIV VNGKFPGP +YAREGDTV+V+V NHV
Sbjct  14    CLFPLVVECRIRHYKFNVVMKNTTRLCSSKPIVTVNGKFPGPTIYAREGDTVLVKVVNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTL WH+HI W RA
Sbjct  74    KYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILP LGVPYPFPKP+ E +++L EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  134   TVHGAIVILPNLGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAIKSGLAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C+S+ GY L V+ GKTY+LRV+NAALNEELFFKIAGH++ VVEVDATY+KPF
Sbjct  194   GHPGPVSNCASQGGYKLNVDPGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYIKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN ++TA+Q +GKY +A SPFMD  +A DN TA ATL Y GT   +  
Sbjct  254   KTDTIVIAPGQTTNVIVTANQGSGKYMVAASPFMDAPIAVDNVTAIATLHYSGTQGNSHI  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACS--SG  1208
             +LT  P +NATPV  TF DSLRSLNS+ YPA VP  +DHSL F +G+G+NPCP C   +G
Sbjct  314   SLTSTPPKNATPVANTFLDSLRSLNSKKYPAKVPKKIDHSLFFTVGLGINPCPTCKQGNG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMPT  LLQAH++   GVF
Sbjct  374   SRVVASVNNVTFVMPTVALLQAHFFGTKGVF  404



>ref|XP_009593041.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/391 (69%), Positives = 316/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  VE  IR Y F V +KNTSRLC++KPIV VNGKFPGP +YARE DTV++RV NHV
Sbjct  13    CLFPAFVECRIRRYNFNVMVKNTSRLCSTKPIVTVNGKFPGPTVYAREDDTVLIRVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQSYLYNFT+TGQRGTL WH+HI W R+
Sbjct  73    KYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQSYLYNFTITGQRGTLFWHAHILWLRS  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPKLGVPYPFPKPD E +++L EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TVHGAIVILPKLGVPYPFPKPDHEAVVILAEWWKSDTEAVINQAIKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C S+ GY L V+ GK+Y+LRV+NAALNEELFFKIAGH++ VVEVDATYVKPF
Sbjct  193   GHPGPLSNCPSQGGYKLSVDPGKSYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN ++ A+Q +GKY +  SPFMD  +A DN TATATL Y GT   + T
Sbjct  253   KTDTIVIAPGQTTNVIVAANQGSGKYMVVASPFMDAPIAVDNATATATLHYSGTLASSVT  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACS--SG  1208
              LT  P +NATPV   F DSLRSLNS+ YPA VP +VDHSL F +G+G+NPCP+C   +G
Sbjct  313   TLTNTPPKNATPVANNFVDSLRSLNSKKYPAKVPKNVDHSLFFTVGLGINPCPSCKQGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH++ I GV+
Sbjct  373   SRVVASINNVTFVMPTTALLQAHFFGIKGVY  403



>ref|XP_009786393.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=556

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/391 (69%), Positives = 317/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  VE  IR Y F V +KNT+RLC++KPIV VNGKFPGP +YARE DTV++RV NHV
Sbjct  13    CLFPAFVECRIRRYNFNVMVKNTTRLCSTKPIVTVNGKFPGPTVYAREDDTVLIRVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQSYLYNFT+TGQRGTL WH+HI W R+
Sbjct  73    KYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQSYLYNFTITGQRGTLFWHAHILWLRS  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPKLGVPYPFPKPD E ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TVHGAIVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINQAIKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C S+ GY L V+ GK+Y+LRV+NAALNEELFFKIAGH++ VVEVDATY+KPF
Sbjct  193   GHPGPLSNCPSQGGYTLSVDPGKSYMLRVINAALNEELFFKIAGHKMTVVEVDATYIKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN ++TA+Q +GKY +  SPFMD  +A DN TATATL Y GT   + T
Sbjct  253   KTDTIVIAPGQTTNVIVTANQGSGKYMVVASPFMDAPIAVDNATATATLHYSGTLASSVT  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACS--SG  1208
              LT  P +NATPV   F DSLRSLNS+ YPA VP +VDHSL F +G+G+NPCP+C   +G
Sbjct  313   TLTNTPPKNATPVANNFVDSLRSLNSKKYPAKVPKNVDHSLFFTVGLGINPCPSCKQGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH++ I GV+
Sbjct  373   SRVVASINNVTFVMPTTALLQAHFFGIKGVY  403



>ref|XP_010098906.1| hypothetical protein L484_006544 [Morus notabilis]
 gb|EXB76109.1| hypothetical protein L484_006544 [Morus notabilis]
Length=545

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/386 (69%), Positives = 312/386 (81%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP SV+ ++RHY F+V + NT++LC+SKP V VNG+FPGP LYARE D V+VRV NHV  
Sbjct  16    FPASVDCLVRHYNFSVVLTNTTKLCSSKPTVTVNGQFPGPTLYAREDDNVIVRVINHVNR  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             N++IHWHG++Q RT W+DGPAY+TQCPIQPGQ+Y+YNFTLTGQRGTLLWH+HI+W RATV
Sbjct  76    NLTIHWHGIRQLRTAWADGPAYVTQCPIQPGQNYVYNFTLTGQRGTLLWHAHISWLRATV  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFPKPDKE+II+L EWW ++VE V+N A Q G PPNVSDAHTING 
Sbjct  136   HGAIVILPKRGVPYPFPKPDKEKIIILAEWWKADVEAVVNQATQSGQPPNVSDAHTINGF  195

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PG  P+CSS+GY L V++GKTYLLR++NAALN+ELFFKIAGH L VVE DA+Y KPFETD
Sbjct  196   PGQVPSCSSQGYTLHVKTGKTYLLRIINAALNDELFFKIAGHNLTVVEADASYTKPFETD  255

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+ PGQTTNALL  DQ  GKY IAI+PFMD  +  +N T+ ATL YK T     T LT
Sbjct  256   TIFLSPGQTTNALLKTDQAIGKYLIAINPFMDAPIGYNNVTSFATLRYKKTPPNPKTILT  315

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              +P QN TP T  F DSLRSLNS+ YPA VPL+V HSL   I VGVNPC  C +G+++VA
Sbjct  316   KIPPQNDTPKTKAFIDSLRSLNSKQYPAKVPLNVHHSLFLTIAVGVNPCDTCVNGTKLVA  375

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
             DINNVSFV+P+  LLQAHYYNI  VF
Sbjct  376   DINNVSFVLPSIALLQAHYYNIGAVF  401



>ref|XP_003518300.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN46170.1| Laccase-4 [Glycine soja]
Length=557

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/389 (69%), Positives = 319/389 (82%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P+SVE+M+RHYKF V +KN +RLC++KPIV VNGKFPGP +YARE DTV+V+V NHV
Sbjct  15    CMLPLSVEAMVRHYKFNVVVKNVTRLCSTKPIVTVNGKFPGPTIYAREDDTVLVKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ+++YNFTLTGQRGTL WH+HI W R+
Sbjct  75    KYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQAFVYNFTLTGQRGTLWWHAHILWLRS  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPKLGVPYPFPKP  E++I+L EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  135   TVHGALVILPKLGVPYPFPKPHTEKVIILSEWWKSDTEAVINEALKSGLAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG    C+S+ GY L+V+ G TYLLR++NAALNEELFFKIAGH+L VVEVDA Y KPF
Sbjct  195   GHPGSVQNCASQGGYELQVQPGNTYLLRIINAALNEELFFKIAGHQLTVVEVDAVYTKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTT+ LL A++ AGKY +A +PFMD+ +A DN TATATL Y G+     T
Sbjct  255   KTDTIVIAPGQTTSVLLKANRAAGKYLVAATPFMDSPIAVDNVTATATLHYTGSLGSTIT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT +P +NATPV T FTDSLRSLNS+ YPA VP  VDHSL F I +GVNPCP C +GS+
Sbjct  315   TLTSLPPKNATPVATNFTDSLRSLNSKKYPARVPQKVDHSLFFTISLGVNPCPTCVNGSK  374

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA INNV+FVMP   LLQAH++NISGVF
Sbjct  375   VVAAINNVTFVMPKVSLLQAHFFNISGVF  403



>emb|CAA74103.1| laccase [Populus trichocarpa]
Length=555

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/386 (69%), Positives = 310/386 (80%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  VE  +R Y F V + NT++LC+SK I  +NGKFPGP +YAREGD V +R+ N VQ 
Sbjct  16    FPALVECKVRLYNFRVVLTNTTKLCSSKSIPTINGKFPGPTIYAREGDNVNIRLTNQVQY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV++HWHGV    TGW+DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWH+HI+W RAT+
Sbjct  76    NVTVHWHGVSSCFTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHISWLRATI  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVI PK GVPYPFPKPDKE+II+L EWW ++VE V+N A   G+PPN+SDAHT+NG 
Sbjct  136   HGAIVIFPKKGVPYPFPKPDKEKIIILSEWWKADVEAVVNQATMTGLPPNISDAHTVNGH  195

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
              G  P C+S G+ L VESGKTYLLR++NAALN+ELFFKIAGH + VVEVDAT+ KPF TD
Sbjct  196   TGAVPGCTSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDATFTKPFSTD  255

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+GPGQTTNALLTAD+  GKY IA+SPFMDT+VA DN TA A L Y         +LT
Sbjct  256   TIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAFLRYNEPLHSPHLSLT  315

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
               P  NATP T+TF D LRSLNS+ YPANVPL+VDH L F IGVG++PC  C++GS+ VA
Sbjct  316   TTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVGIDPCATCTNGSKAVA  375

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
             DINNVSF+MPTT LLQAHYYNISGVF
Sbjct  376   DINNVSFIMPTTALLQAHYYNISGVF  401



>ref|XP_008233715.1| PREDICTED: laccase-4-like [Prunus mume]
Length=558

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/386 (69%), Positives = 317/386 (82%), Gaps = 1/386 (0%)
 Frame = +3

Query  147   PVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQEN  326
             P  V+S++RHYKF+V  KNT++LC+SKP + VNGKFPGP LYARE DTV+VRV NHV  N
Sbjct  20    PAFVQSLVRHYKFSVVFKNTTKLCSSKPTITVNGKFPGPTLYAREDDTVIVRVINHVNHN  79

Query  327   VSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVH  506
             ++IHWHGVKQ  T W+DGPAYITQCPIQPGQ+++YNFTLTGQRGTLLWH+H +W RAT+H
Sbjct  80    LTIHWHGVKQLGTAWADGPAYITQCPIQPGQNFIYNFTLTGQRGTLLWHAHTSWLRATLH  139

Query  507   GAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLP  686
             GAIVILPK G PYPFP PD+E+ ++L EWW S+VE V+N +++ G+PPNVSDAHTING  
Sbjct  140   GAIVILPKRGTPYPFPTPDEEKTVILAEWWKSDVEAVVNQSIKSGLPPNVSDAHTINGHA  199

Query  687   GPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             GP P CSS+ GY L VESGKTYLLR++NAALN++LFFKIAGH L VVEVDA+Y KPF+TD
Sbjct  200   GPVPGCSSQGGYTLHVESGKTYLLRIINAALNDDLFFKIAGHNLTVVEVDASYTKPFQTD  259

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+ PGQTTNA+LTA+++ GKY IA SPFMD  V  DN T+ A+L YKGT       LT
Sbjct  260   TIFISPGQTTNAILTANRRIGKYLIAASPFMDAPVGFDNLTSIASLRYKGTPANPKAFLT  319

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              +P QNATPVT TF DSLRSLNS+ YPANVPL++DHSL F I VGVNPC  C +GS++VA
Sbjct  320   SIPPQNATPVTNTFMDSLRSLNSKQYPANVPLTIDHSLFFTIAVGVNPCATCVNGSKLVA  379

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
               NNVSFVMPT  LLQA+YYNI GV+
Sbjct  380   AFNNVSFVMPTIALLQAYYYNIKGVY  405



>ref|XP_004500229.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=556

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/389 (68%), Positives = 315/389 (81%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P+  E+++RHYKF V MKN +RLC++KPIV VNGKFPGP +YARE D V+++V NHV
Sbjct  15    CLLPLYAEAIVRHYKFNVVMKNATRLCSTKPIVTVNGKFPGPTIYAREDDNVLIKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGVKQ RTGW+DGPAYITQCPIQ GQ+YLYNFTLTGQRGTL WH+H+ W RA
Sbjct  75    KYNVSIHWHGVKQLRTGWADGPAYITQCPIQSGQTYLYNFTLTGQRGTLWWHAHVLWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPKLGVPYPFPKP  E++IVLGEWW S+ E +IN A++ G+ PN+SDAHTIN
Sbjct  135   TVHGALVILPKLGVPYPFPKPHMEQVIVLGEWWKSDTEAIINEALKSGLAPNISDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CS + G++LEVE   TYLLR+VNAALNEELFFK+A H+L VVEVDATYVKPF
Sbjct  195   GHPGPIQGCSPQGGFSLEVEPKNTYLLRIVNAALNEELFFKVASHQLTVVEVDATYVKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN LLTA    GKY +A SPFMD  +  DN+TATAT+ Y GT     T
Sbjct  255   QTDTIVIAPGQTTNVLLTAKHTTGKYLVAASPFMDAPIVVDNKTATATIHYSGTLGSTIT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT +P +NATP+ TTFTDSLRSLNS+ YPA VPL +DH+L+F + +G+NPCP C + SR
Sbjct  315   TLTSLPPKNATPLATTFTDSLRSLNSKKYPAKVPLKIDHNLLFTVSLGINPCPTCVNNSR  374

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA INNV+FVMP   LLQAH++NI GVF
Sbjct  375   VVAAINNVTFVMPKIALLQAHFFNIKGVF  403



>emb|CAC14719.1| laccase [Populus trichocarpa]
Length=555

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/386 (69%), Positives = 309/386 (80%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  VE  +R Y F V + NT++LC+SK I  +NGKFPGP +YAREGD V +R+ N VQ 
Sbjct  16    FPALVECKVRLYNFRVVLTNTTKLCSSKSIPTINGKFPGPTIYAREGDNVNIRLTNQVQY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV++HWHGV    TGW+DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWH+HI+W RAT+
Sbjct  76    NVTVHWHGVSSCFTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHISWLRATI  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVI PK GVPYPFPKPDKE+II+L EWW ++VE V+N A   G+PPN+SDAHT+NG 
Sbjct  136   HGAIVIFPKKGVPYPFPKPDKEKIIILSEWWKADVEAVVNQATMTGLPPNISDAHTVNGH  195

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
              G  P C+S G+ L VESGKTYLLR++NAALN+ELFFKIAGH + VVEVDAT+ KPF  D
Sbjct  196   TGAVPGCTSPGFTLHVESGKTYLLRIINAALNDELFFKIAGHNITVVEVDATFTKPFSAD  255

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+GPGQTTNALLTAD+  GKY IA+SPFMDT+VA DN TA A L Y         +LT
Sbjct  256   TIFIGPGQTTNALLTADKSIGKYLIAVSPFMDTVVAVDNVTAIAFLRYNEPLHSPHLSLT  315

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
               P  NATP T+TF D LRSLNS+ YPANVPL+VDH L F IGVG++PC  C++GS+ VA
Sbjct  316   TTPAINATPATSTFMDKLRSLNSKKYPANVPLTVDHDLYFTIGVGIDPCATCTNGSKAVA  375

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
             DINNVSF+MPTT LLQAHYYNISGVF
Sbjct  376   DINNVSFIMPTTALLQAHYYNISGVF  401



>ref|XP_003544873.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN40048.1| Laccase-4 [Glycine soja]
Length=557

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/389 (68%), Positives = 318/389 (82%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P+SVE+M+RHYKF V +KN +RLC++KPIV VNGKFPGP +YARE DTV+V+V NHV
Sbjct  15    CMLPLSVEAMVRHYKFNVVVKNVTRLCSTKPIVTVNGKFPGPTIYAREDDTVLVKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q +TGW+DGPAYITQCPIQPGQ+++YNFTLTGQRGTL WH+HI W R+
Sbjct  75    KYNVSIHWHGVRQLQTGWADGPAYITQCPIQPGQAFVYNFTLTGQRGTLWWHAHILWLRS  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPKLGVPYPFPKP  E++I+L EWW S+ E VIN A++ G  PNVSDAHTIN
Sbjct  135   TVHGALVILPKLGVPYPFPKPHTEKVIILSEWWKSDTEAVINEALKSGSAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG    C+S+ GY L+V+ G TYLLR++NAALNEELFFKIAGH+L VVEVDA Y KPF
Sbjct  195   GHPGSVQNCASQGGYKLQVQPGNTYLLRIINAALNEELFFKIAGHQLTVVEVDAVYTKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN LL A++ AGKY +A +PFMD+ +  DN TATATL Y G+     T
Sbjct  255   KTDTIVIAPGQTTNVLLKANRAAGKYLVAATPFMDSPITVDNVTATATLHYTGSLGSTIT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT +P +NATPV T FTDSLRSLNS+ YPA VP  VDHSL F + +GVNPCP C++GS+
Sbjct  315   TLTSLPPKNATPVATNFTDSLRSLNSKKYPARVPQKVDHSLFFTVSLGVNPCPTCANGSK  374

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA INNV+FVMP   LLQAH++NISGVF
Sbjct  375   VVAAINNVTFVMPKVSLLQAHFFNISGVF  403



>ref|XP_010044087.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86093.1| hypothetical protein EUGRSUZ_B02794 [Eucalyptus grandis]
Length=556

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/391 (70%), Positives = 322/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE+ +R+Y F V MKN +RLC+SKPIV VNGKFPGP LYARE D V+VRV NHV
Sbjct  13    CITPAVVEARVRNYSFNVVMKNKTRLCSSKPIVTVNGKFPGPTLYAREDDNVLVRVTNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NV+IHWHGV+Q RTGW+DGPAYITQCPIQ GQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  73    KYNVTIHWHGVRQLRTGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGAIVILPK GVPYPFPKP KE ++VLGEWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVINQAIKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP+  C S+ G+ L VESGK Y+LR++NAALNEELFFKIAGH+L +VEVDATYVKPF
Sbjct  193   GHPGPSSNCPSQGGFTLPVESGKKYMLRIINAALNEELFFKIAGHQLTIVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +T+TI + PGQTTNAL++ DQ +GKY +A SPFMD+ +A DN TATATL Y GT    ST
Sbjct  253   KTNTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTATATLHYSGTLAATST  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P QNAT V   F +SLRSLNS+ YPA VPL+VDHSL+F +G+GVNPCP+C +  G
Sbjct  313   TLTKTPPQNATAVANNFINSLRSLNSKRYPAKVPLTVDHSLLFTVGLGVNPCPSCKAGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMP+T LLQAH++NISGVF
Sbjct  373   SRVVASMNNVTFVMPSTALLQAHFFNISGVF  403



>ref|XP_007220829.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
 gb|EMJ22028.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
Length=558

 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/387 (68%), Positives = 316/387 (82%), Gaps = 1/387 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             +P  V+S++RHYKF+V  KNT++LC+SKP + VNGKFPGP LYARE DTV+VRV NHV  
Sbjct  19    YPAFVQSLVRHYKFSVVFKNTTKLCSSKPTITVNGKFPGPTLYAREDDTVIVRVINHVNH  78

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             N++IHWHGV+Q  T W+DGPAYITQCPIQPGQ+++YNFTLTGQRGTLLWH+H +W RAT+
Sbjct  79    NLTIHWHGVRQLGTAWADGPAYITQCPIQPGQNFIYNFTLTGQRGTLLWHAHTSWLRATL  138

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK G PYPFP PD+E+ ++L EWW S+VE V+N +++ G+PPNVSDAHTING 
Sbjct  139   HGAIVILPKRGTPYPFPTPDEEKTVILAEWWKSDVEAVVNQSIKSGLPPNVSDAHTINGH  198

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
              GP P CSS+ GY L VESGKTYLLR++NAALN++LFFKIAGH L VVEVDA+Y KPF+T
Sbjct  199   AGPVPGCSSQGGYTLHVESGKTYLLRIINAALNDDLFFKIAGHNLTVVEVDASYTKPFQT  258

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DTIF+ PGQTTNA+LTA++  GKY IA SPFMD  V  DN T+ A+L YKGT       L
Sbjct  259   DTIFISPGQTTNAILTANRGIGKYLIAASPFMDAPVGFDNLTSIASLLYKGTPANPKAFL  318

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T +P QNATPVT TF DSLRSLNS+ YPANVPL++DHSL F I VGVNPC  C +GS++V
Sbjct  319   TSIPPQNATPVTNTFMDSLRSLNSKQYPANVPLTIDHSLFFTIAVGVNPCATCVNGSKLV  378

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             A  NNVSFVMPT  LLQA+YYN  GVF
Sbjct  379   AAFNNVSFVMPTIALLQAYYYNTKGVF  405



>ref|XP_008449180.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=556

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/391 (70%), Positives = 319/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  VE  +RHYKF V +KNT++LC+SK IV VNGKFPGP +YARE DTV++ V NHV
Sbjct  13    CIFPALVECRVRHYKFDVVLKNTTKLCSSKQIVTVNGKFPGPTIYAREDDTVLINVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             Q N+SIHWHGV+Q RTGW+DGPAYITQCPI  GQSYLYNFT+TGQRGTLLWH+HI W RA
Sbjct  73    QYNLSIHWHGVRQLRTGWADGPAYITQCPIPSGQSYLYNFTVTGQRGTLLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPKLGVPYPFP P+KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TVHGALVILPKLGVPYPFPAPNKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G  GP   CS++ G+ L V+SG TYLLR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  193   GHSGPISKCSTQGGFTLPVKSGHTYLLRIINAALNEELFFKIAGHKLTVVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTNAL+TADQ +GKY +A SPFMD+ +A DN TATATL Y  T    +T
Sbjct  253   KTDTIVIAPGQTTNALITADQTSGKYLVAASPFMDSPIAVDNNTATATLHYSDTLATTAT  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT+ P QNATPV   F DSLRSLNS  YPA VPL++DH+L F +G+G+NPCP C +  G
Sbjct  313   TLTVPPPQNATPVANNFIDSLRSLNSNTYPAKVPLTIDHNLYFTVGLGINPCPTCKAGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SR VA INNV+FVMPTT LLQAHY+NI+GVF
Sbjct  373   SRAVASINNVTFVMPTTALLQAHYFNINGVF  403



>ref|XP_008392913.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/387 (69%), Positives = 316/387 (82%), Gaps = 1/387 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             +P  VES+IRHY+F+V  K+T+ LC+SKPIV VNGKFPGP LYARE DTV+V+V NHV+ 
Sbjct  19    YPAFVESLIRHYEFSVVYKDTTNLCSSKPIVTVNGKFPGPTLYAREDDTVIVKVTNHVKY  78

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGVKQ  TGWSDGPAYITQCPIQPG++Y+YNFTLTGQRGTLLWH+H +W RAT+
Sbjct  79    NVTIHWHGVKQRGTGWSDGPAYITQCPIQPGRNYIYNFTLTGQRGTLLWHAHDSWLRATL  138

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK G PYPFP PD+E+II++ EWW S+VEDVIN A Q G+PPNVSDAHTING 
Sbjct  139   HGAIVILPKRGTPYPFPTPDEEKIIIMAEWWKSDVEDVINQATQSGLPPNVSDAHTINGR  198

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
              GP P CSS+ GY L VES KTY+LR+VNAALN+ELFFK+AGH L VVEVDA+Y KPF+T
Sbjct  199   VGPLPGCSSQGGYTLHVESDKTYMLRIVNAALNDELFFKVAGHSLTVVEVDASYTKPFQT  258

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DTI+ GPGQTTNA+LTA+Q  GKY I  SPFMD  +  DN T  ATL YKGT    +  L
Sbjct  259   DTIYTGPGQTTNAILTANQGIGKYFITASPFMDAPIGFDNATVIATLRYKGTPANPTAIL  318

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T +P +NATP+T  F DSLRSLNS+ YPA+VPL++DHSL F I VG NPC  C SGS++V
Sbjct  319   TSIPPRNATPLTDAFVDSLRSLNSKQYPADVPLTIDHSLFFTISVGANPCATCVSGSKLV  378

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             +  NNVSFVMP+  LLQA+YYN+ GV+
Sbjct  379   SAFNNVSFVMPSISLLQAYYYNVKGVY  405



>ref|XP_010041000.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW44721.1| hypothetical protein EUGRSUZ_L01734 [Eucalyptus grandis]
Length=556

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/391 (70%), Positives = 322/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE+ +R+Y F V MKN +RLC+SKPIV VNGKFPGP LYARE D V+VRV NHV
Sbjct  13    CITPAVVEARVRNYSFNVVMKNKTRLCSSKPIVTVNGKFPGPTLYAREDDNVLVRVTNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NV+IHWHGV+Q RTGW+DGPAYITQCPIQ GQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  73    KYNVTIHWHGVRQLRTGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGAIVILPK GVPYPFPKP KE ++VLGEWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVINQAIKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP+  C S+ G+ L VESGK Y+LR++NAALNEELFFKIAGH+L +VEVDATYVKPF
Sbjct  193   GHPGPSSNCPSQGGFTLPVESGKKYMLRIINAALNEELFFKIAGHQLTIVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +T+TI + PGQTTNAL++ DQ +GKY +A SPFMD+ +A DN TATATL Y GT    ST
Sbjct  253   KTNTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTATATLHYSGTLAATST  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P QNAT V   F +SLRSLNS+ YPA VPL+VDHSL+F +G+GVNPCP+C +  G
Sbjct  313   TLTKTPPQNATAVANNFINSLRSLNSKRYPAKVPLTVDHSLLFTVGLGVNPCPSCKAGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMP+T LLQAH++NISGVF
Sbjct  373   SRVVASMNNVTFVMPSTALLQAHFFNISGVF  403



>ref|XP_007016183.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY33802.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=557

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/387 (69%), Positives = 322/387 (83%), Gaps = 1/387 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP SVE M+RHYKF V ++NT+RLC+SKPIV VNG++PGP L ARE DTV+V+V NHV+ 
Sbjct  18    FPASVECMVRHYKFNVVLENTTRLCSSKPIVTVNGRYPGPTLVAREDDTVLVKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             N+SIHWHG++Q RTGW+DGP YITQCPIQPGQ+++YNFT+TGQRGTL WH+HI W RATV
Sbjct  78    NLSIHWHGIRQIRTGWADGPGYITQCPIQPGQNFVYNFTITGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFPKP KEE I+LGEWW S+VE VIN A++ G+ PNVSDAHTING 
Sbjct  138   HGAIVILPKRGVPYPFPKPHKEETIILGEWWKSDVEAVINEALKSGMAPNVSDAHTINGH  197

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP  +C ++ GY L V+ GKTY+LR++NAALNEELFFKIAGH L VVEVDATYVKPF+T
Sbjct  198   PGPVSSCPTQGGYTLRVKPGKTYMLRIINAALNEELFFKIAGHLLTVVEVDATYVKPFKT  257

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             +TI + PGQTTN LLTA + AGKY +A SPFMD  +  DN TATATL Y G+    +T L
Sbjct  258   ETIVITPGQTTNVLLTAHRGAGKYLVAASPFMDAPIVVDNVTATATLHYSGSLTSTATTL  317

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T +P +NAT V T FT++LRSLNS+ YPANVPL +DHSL+F +G+G+NPCP+C +GSRVV
Sbjct  318   TSLPPKNATSVATNFTNALRSLNSKQYPANVPLKIDHSLLFTVGLGINPCPSCVNGSRVV  377

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             A INNV+FVMP   LLQAH++NISGVF
Sbjct  378   ASINNVTFVMPKISLLQAHFFNISGVF  404



>ref|XP_009358852.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=559

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/391 (69%), Positives = 320/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VES +RHYKF V ++N ++LC+SKPIV VNGKFPGP LYARE D V+V+V NHV
Sbjct  14    CVLPALVESRVRHYKFNVVLRNKTKLCSSKPIVTVNGKFPGPTLYAREDDNVLVKVTNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGWSDGPAYITQCPI PGQSY+YNFT+TGQRGTLLWH+HINW RA
Sbjct  74    KYNVSIHWHGIRQLRTGWSDGPAYITQCPIPPGQSYVYNFTITGQRGTLLWHAHINWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPK GVPYPFP P KE  +VLGEWW S+ E VIN A++ GI PNVSDAHTIN
Sbjct  134   TVHGALVILPKRGVPYPFPAPHKEVNVVLGEWWKSDTETVINQALKSGIAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG  P CSS+ G+ L VESGKTYLLR++NAALNEELFFKIAGH L +VEVDATYVKPF
Sbjct  194   GHPGVVPNCSSEGGFTLPVESGKTYLLRIINAALNEELFFKIAGHNLTIVEVDATYVKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTNAL+TA+Q +GKY +A SPFMD+ +A DN TATATL Y GT     T
Sbjct  254   KTDTIVIAPGQTTNALVTANQNSGKYMMAASPFMDSPIAVDNLTATATLHYTGTLASTPT  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P QNAT V  +F +SL++LNS  +PA VPL +DH+L+F +G+G+NPCP+C +  G
Sbjct  314   TLTSPPPQNATQVANSFINSLKALNSNKFPAKVPLKIDHNLLFTVGLGINPCPSCKAGNG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMPTT LLQAH++N SGVF
Sbjct  374   SRVVASVNNVTFVMPTTALLQAHFFNKSGVF  404



>ref|XP_010553253.1| PREDICTED: laccase-4 [Tarenaya hassleriana]
Length=559

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/391 (68%), Positives = 318/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C +P   E ++RHYKF + MKNT+RLC+SKPIV VNG++PGP +YARE DT++++V NHV
Sbjct  16    CVYPSLTEGLVRHYKFNIVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHV  75

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ Y+YN+TLTGQRGTL WH+HI W RA
Sbjct  76    KYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQVYVYNYTLTGQRGTLWWHAHILWLRA  135

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPK GVPYPFPKPD E+ IVL EWW S+ E+VIN A++ G+ PNVSDAHTIN
Sbjct  136   TVHGALVILPKRGVPYPFPKPDHEKAIVLSEWWKSDTENVINEALKSGLAPNVSDAHTIN  195

Query  678   GLPGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G  GP  +C SS GY L VE G+TYLLR+VNAALNEELFFK+AGH L VVEVDA YVKPF
Sbjct  196   GHSGPVKSCPSSMGYKLSVERGETYLLRLVNAALNEELFFKVAGHSLTVVEVDALYVKPF  255

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTN LLTA + AGKY + +SPFMD  +A DN TATAT+ Y GT   ++T
Sbjct  256   KTDTVLIAPGQTTNVLLTASKSAGKYLVTVSPFMDAPIAVDNVTATATVHYSGTLSSSAT  315

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
              LT+ P QN+T ++  FT+SLRSLNS+ YPA VP  VDH L F +G+GVNPCP C  ++G
Sbjct  316   VLTLPPPQNSTAISNNFTNSLRSLNSKKYPALVPKEVDHHLFFTVGLGVNPCPTCKAANG  375

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+F MPTT LLQAHY+NISGVF
Sbjct  376   SRVVASINNVTFTMPTTALLQAHYFNISGVF  406



>ref|XP_010067496.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW65638.1| hypothetical protein EUGRSUZ_G03028 [Eucalyptus grandis]
Length=561

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/386 (68%), Positives = 310/386 (80%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
              P + E +IRHYKF+V MKN ++LCASKPI  VNGKFPGP LYARE DTV+VRV NHV  
Sbjct  23    LPAAAEGLIRHYKFSVVMKNVTKLCASKPIATVNGKFPGPTLYAREDDTVLVRVVNHVSY  82

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGWSDGPA+ITQCPIQPGQSY+YNFTLTGQRGTLLWH+HI W R+T+
Sbjct  83    NVTIHWHGVRQLRTGWSDGPAFITQCPIQPGQSYIYNFTLTGQRGTLLWHAHITWLRSTL  142

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFPKP KE+ I+ GEWW ++ E V++ ++Q G+PPN SD+HTING 
Sbjct  143   HGAIVILPKRGVPYPFPKPYKEKTIIFGEWWKADTELVLSQSVQSGMPPNKSDSHTINGY  202

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGP P CSS+GY L+VESGKTYLLR+VNAA+N+ELFFKIAGH L VVEVDA+Y KPF  D
Sbjct  203   PGPLPNCSSQGYELQVESGKTYLLRIVNAAVNDELFFKIAGHNLTVVEVDASYTKPFSID  262

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+ PGQTTNALL AD+  G Y +AISPFMDT+VA DN TAT  + YKGT   A T   
Sbjct  263   TIFIAPGQTTNALLAADKSGGSYIMAISPFMDTVVAVDNLTATGIVQYKGTIASAPTVQA  322

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              +P  NAT    +F +SLRSLNS+ YPA VPL+VDHSL   +  GVNPC  C +G ++VA
Sbjct  323   SIPAINATSFEFSFINSLRSLNSKQYPAKVPLTVDHSLFITMSAGVNPCSTCVNGKKLVA  382

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
              +NNVSFVMP+T +L+AHYY I GV+
Sbjct  383   ALNNVSFVMPSTDILEAHYYKIKGVY  408



>ref|XP_004147923.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004165325.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN54357.1| hypothetical protein Csa_4G308480 [Cucumis sativus]
Length=556

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/391 (70%), Positives = 318/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  VE  +RHYKF V +KNT++LC+SK IV VNGKFPGP +YARE DTV++ V NHV
Sbjct  13    CIFPALVECRVRHYKFDVVLKNTTKLCSSKQIVTVNGKFPGPTIYAREDDTVLINVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             Q N+SIHWHGV+Q RTGW+DGPAYITQCPI  GQSYLYNFT+TGQRGTLLWH+HI W RA
Sbjct  73    QYNLSIHWHGVRQLRTGWADGPAYITQCPIPSGQSYLYNFTVTGQRGTLLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPKLGVPYPFP P+KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TVHGALVILPKLGVPYPFPAPNKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G  GP   CS++ G+ L V+SG TYLLR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  193   GHSGPISNCSTQGGFTLPVKSGHTYLLRIINAALNEELFFKIAGHKLTVVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTNAL+TADQ +GKY +A SPFMD+ +A DN TATATL Y GT    + 
Sbjct  253   KTDTILIAPGQTTNALITADQTSGKYLVAASPFMDSPIAVDNNTATATLHYAGTLATTAA  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P QNATPV   F DSLRSLNS  YPA VPL++DH+L F +G+G+NPCP C +  G
Sbjct  313   TLTAPPPQNATPVANNFIDSLRSLNSNTYPAKVPLTIDHNLYFTVGLGINPCPTCKAGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SR VA INNV+FVMPTT LLQAHY+NI+GVF
Sbjct  373   SRAVASINNVTFVMPTTALLQAHYFNINGVF  403



>ref|XP_004490949.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=554

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/386 (67%), Positives = 313/386 (81%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V+S++RHY F V +KN+++LC++K  V VNGKFPGP +YARE D V+VRV NHV+ 
Sbjct  15    FPTFVQSLVRHYNFNVVLKNSTKLCSTKSFVTVNGKFPGPTIYAREDDNVIVRVTNHVKH  74

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHG+KQ RT WSDGPAYITQCPIQ GQS++YNFT+TGQRGTLLWH+HI W RAT+
Sbjct  75    NVTIHWHGIKQLRTCWSDGPAYITQCPIQTGQSFVYNFTITGQRGTLLWHAHITWLRATM  134

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK  +PYPFPKPDKE+II+LGEWW S+VE V+N A   G+PPN+SDAHTING 
Sbjct  135   HGAIVILPKRDIPYPFPKPDKEKIIILGEWWKSDVEAVVNQATNSGLPPNISDAHTINGH  194

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PG  P C S+GY L VE GKTYLLR++NAALN+ELFFKIAGH+L VVE DA+Y+KPFETD
Sbjct  195   PGSVPGCMSQGYTLHVERGKTYLLRIINAALNDELFFKIAGHKLTVVEADASYIKPFETD  254

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TIF+ PGQTTN LLT +Q  GKY IA +PFMD  +  DN T+ ATL YKGT     T LT
Sbjct  255   TIFLSPGQTTNVLLTTNQSVGKYLIATTPFMDAPIGFDNVTSIATLHYKGTQPDTKTILT  314

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              +P  NAT +T TFTDSL+SLNS+ YP  VPL +D SL+FAI VG++PC  C+SG+++V+
Sbjct  315   NIPPLNATTLTKTFTDSLKSLNSKQYPTKVPLKIDQSLLFAITVGIDPCDTCTSGNKLVS  374

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
              INNV+F+MPT  LLQAHYYNI GVF
Sbjct  375   AINNVTFLMPTISLLQAHYYNIKGVF  400



>ref|XP_003544123.1| PREDICTED: laccase-4-like [Glycine max]
Length=554

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/388 (68%), Positives = 320/388 (82%), Gaps = 1/388 (0%)
 Frame = +3

Query  141   TFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             +F   V+S++RHYKF+V +KNT++LC++K  V VNG+ PGP LYARE DTV+V+V NHV+
Sbjct  14    SFSPFVQSLVRHYKFSVVLKNTTKLCSTKSFVTVNGQCPGPTLYAREDDTVIVKVTNHVK  73

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              N++IHWHG+KQ RTGWSDGPAY+TQCPIQPGQSY+YNFT+ GQRGTLLWH+HI W RAT
Sbjct  74    YNITIHWHGIKQLRTGWSDGPAYVTQCPIQPGQSYVYNFTINGQRGTLLWHAHITWLRAT  133

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             V+G IVILPK G+ YPFPKPDKE+II+LGEWW S+VE ++N A   G+PPN+SDAHTING
Sbjct  134   VYGGIVILPKRGISYPFPKPDKEKIIILGEWWKSDVEAILNQAENSGLPPNISDAHTING  193

Query  681   LPGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
               GP P C+S+GY L VESGKTYLLR++NAALN+ELFFKIAGH+L VVE DA+YVKPFET
Sbjct  194   HTGPIPGCTSQGYTLHVESGKTYLLRIINAALNDELFFKIAGHKLTVVEADASYVKPFET  253

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DTIF+ PGQTTN LLTA+Q  GKY IA++PFMD  +  DN T+ ATL YKGT     T L
Sbjct  254   DTIFMSPGQTTNVLLTANQVVGKYLIAVTPFMDAPIGFDNVTSIATLRYKGTPPYPKTTL  313

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T +P  NATP+T+ F DSLRSLNS+ YPA  PL+VDHSL F+I VG+NPC  C +G+R+V
Sbjct  314   TTIPALNATPLTSDFIDSLRSLNSKEYPAIAPLTVDHSLFFSITVGLNPCHTCLTGARLV  373

Query  1221  ADINNVSFVMP-TTPLLQAHYYNISGVF  1301
             + INN++F+MP TT LL+AHYYNI GVF
Sbjct  374   SAINNITFLMPTTTSLLEAHYYNIKGVF  401



>ref|XP_010044089.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86095.1| hypothetical protein EUGRSUZ_B02796 [Eucalyptus grandis]
Length=556

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/391 (69%), Positives = 322/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +R+Y F V MKNT+RLC+SKPIV VNG FPGP LYARE DTV+VRV+N V
Sbjct  13    CITPAVVEGRVRNYTFNVVMKNTTRLCSSKPIVTVNGMFPGPTLYAREDDTVLVRVSNRV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NV+IHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  73    KYNVTIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGAIVILPK GVPYPFPKP KE ++VLGEWW S+ E VI+ A++ G+ PNVSDAHTIN
Sbjct  133   TLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVISQAIKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP+  C S+ G+ L VESGK Y+LR++NAALNEELFFKIAGH+L +VEVDATYVKPF
Sbjct  193   GHPGPSSNCPSQGGFTLPVESGKKYMLRIINAALNEELFFKIAGHQLTIVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTNAL++ DQ +GKY +A SPFMD+ +A DN TATATL Y GT    ST
Sbjct  253   KTDTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTATATLHYSGTLAATST  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P QNAT V   F +SLRSLNS+ YPA +PL+VDHSL+F +G+G+NPCP+C +  G
Sbjct  313   TLTKTPPQNATAVANNFVNSLRSLNSKRYPAKIPLTVDHSLLFTVGLGINPCPSCKAGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMPTT +LQAH++N SGVF
Sbjct  373   SRVVASMNNVTFVMPTTAILQAHFFNKSGVF  403



>ref|XP_010101806.1| hypothetical protein L484_023595 [Morus notabilis]
 gb|EXB89943.1| hypothetical protein L484_023595 [Morus notabilis]
Length=558

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/391 (69%), Positives = 315/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +R+YKF V   NT+RLC+SKPIV +NGKFPGP LYARE DTV+V+V N V
Sbjct  15    CFSPAFVECRVRNYKFNVVTTNTTRLCSSKPIVTINGKFPGPTLYAREDDTVLVKVVNRV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NV+IHWHGV+Q RTGW+DGPAYITQCPI PGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  75    KYNVTIHWHGVRQLRTGWADGPAYITQCPIPPGQSYVYNFTITGQRGTLLWHAHILWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGA+VILPKLGVPYPFP P KE ++VL EWW S+ E+VIN AM+ G+ PNVSDAHTIN
Sbjct  135   TIHGALVILPKLGVPYPFPAPHKEVVVVLAEWWKSDTENVINEAMKSGLAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C+S+ G+ L V++GKTYLLR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  195   GRPGPVSNCTSEGGFTLPVQTGKTYLLRIINAALNEELFFKIAGHKLTVVEVDATYVKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
               DTI + PGQTTNAL+TADQ +GKY +A SPFMD  +A DN TATATL Y GT   A+T
Sbjct  255   SIDTIVIAPGQTTNALITADQNSGKYLVAASPFMDAPIAVDNATATATLHYAGTLANAAT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT+ P QNAT V   FT+ L+SLNS  +PA VPLSVDH+L F + +G+NPCP C +  G
Sbjct  315   TLTVPPPQNATQVANKFTNGLKSLNSNTFPAKVPLSVDHNLFFTVSLGINPCPTCKAGNG  374

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAHY+   GVF
Sbjct  375   SRVVASINNVTFVMPTTALLQAHYFKTKGVF  405



>ref|XP_007140382.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
 gb|ESW12376.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
Length=560

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/394 (69%), Positives = 318/394 (81%), Gaps = 6/394 (2%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +RHYKF V +KNT+RLC+SKPIV VNGKFPGP LYARE DTV+V+V N V
Sbjct  13    CIVPALVECKVRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTLYAREDDTVLVKVRNLV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
               NV+IHWHGV+Q RTGW+DGPAYITQCPI PGQSYLYNFTLTGQRGTLLWH+H+NW R+
Sbjct  73    NHNVTIHWHGVRQIRTGWADGPAYITQCPILPGQSYLYNFTLTGQRGTLLWHAHVNWLRS  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGAIVILPK GVPYPFPKP KE +++LGEWW S+ EDVIN A++ G+ PNVSDAHTIN
Sbjct  133   TLHGAIVILPKHGVPYPFPKPVKELVVILGEWWKSDTEDVINEALKSGLAPNVSDAHTIN  192

Query  678   GLPGP--TPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVK  848
             GLPG      CS++  Y L VESGKTYLLR++NAALNEE FFKIAGH   VVEVDA+YVK
Sbjct  193   GLPGIVFVANCSTQDVYKLPVESGKTYLLRIINAALNEETFFKIAGHLFTVVEVDASYVK  252

Query  849   PFETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLL  1025
             PF+TDT+ + PGQTTNALLT DQ +GKY I  S FMD+ +VA DN TATATL Y GT   
Sbjct  253   PFKTDTLLIAPGQTTNALLTTDQNSGKYTIVASTFMDSPVVAVDNLTATATLHYTGTLAT  312

Query  1026  ASTALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS  1205
               T L   P +NAT V   FT SL+SLNS+ YPANVPL+VDHSL+F +G+G+NPCP+C++
Sbjct  313   TPTVLITPPPRNATQVANNFTKSLKSLNSKKYPANVPLTVDHSLLFTVGLGINPCPSCTA  372

Query  1206  --GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
               GSRVVA +NNV+FVMPTT LLQAHY+N  GVF
Sbjct  373   GNGSRVVAAVNNVTFVMPTTALLQAHYFNTQGVF  406



>ref|XP_010044090.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044092.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044093.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86096.1| hypothetical protein EUGRSUZ_B02797 [Eucalyptus grandis]
 gb|KCW86097.1| hypothetical protein EUGRSUZ_B02798 [Eucalyptus grandis]
 gb|KCW86098.1| hypothetical protein EUGRSUZ_B02799 [Eucalyptus grandis]
Length=556

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/391 (69%), Positives = 322/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  V+  +R+Y F V MKNT+RLC+SKPIV VNG FPGP LYARE DTV+VRV+N V
Sbjct  13    CITPAVVQGRVRNYTFNVVMKNTTRLCSSKPIVTVNGMFPGPTLYAREDDTVLVRVSNRV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NV+IHWHG++Q R+GW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  73    KYNVTIHWHGIRQLRSGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGAIVILPK GVPYPFPKP KE ++VLGEWW S+ E VI  A++ G+ PNVSDAHTIN
Sbjct  133   TLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVIKQAIKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C S+ G+ L VESGK Y+LR+VNAALNEELFFKIAGH+L +VEVDATYVKPF
Sbjct  193   GHPGPISNCPSQGGFTLPVESGKRYMLRIVNAALNEELFFKIAGHQLTIVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTNAL++ADQ +GKY +A SPFMD+ +  DN TATATL Y GT    ST
Sbjct  253   KTDTIVIAPGQTTNALISADQSSGKYLVAASPFMDSPITVDNMTATATLHYSGTLAATST  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P QNAT V   F +SLRSLNS++YPA VPL+VDH+L+F +G+G+NPCP+C +  G
Sbjct  313   TLTKTPPQNATAVANNFINSLRSLNSKIYPAKVPLTVDHNLLFTVGLGINPCPSCKAGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMPTT LLQAH++NISGVF
Sbjct  373   SRVVASMNNVTFVMPTTALLQAHFFNISGVF  403



>ref|XP_011003662.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=557

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/391 (68%), Positives = 317/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  VE  IRHYKF V MKNT+RLC+SKPIV VNG FPGP LYARE DTV+V+V N V
Sbjct  14    CLFPALVECRIRHYKFNVVMKNTTRLCSSKPIVTVNGLFPGPTLYAREDDTVLVKVVNRV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPA ITQCPIQ GQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  74    KYNLSIHWHGIRQLRTGWADGPANITQCPIQTGQSYVYNFTITGQRGTLLWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIV+LPKLGVPYPFP P KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  134   TVHGAIVVLPKLGVPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG   TCSS+ G+ L V+SGKTY+LR++NAALNEELFFKIAGH+L +VEVDATYVKPF
Sbjct  194   GHPGAVSTCSSQGGFTLPVQSGKTYMLRLINAALNEELFFKIAGHKLTLVEVDATYVKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +T T+ + PGQTTN L+T ++  GKY +A SPFMD  +A DN TATATL Y G    + T
Sbjct  254   KTSTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATATLHYSGALSNSPT  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT+ P +NAT +   FT+SLRSLNS+ +PA VPL+VDHSL F +G+G+NPCP C +  G
Sbjct  314   TLTVPPPKNATAIANQFTNSLRSLNSKTFPAKVPLTVDHSLFFTVGLGINPCPTCKAGNG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH++NISGVF
Sbjct  374   SRVVASINNVTFVMPTTALLQAHFFNISGVF  404



>ref|XP_007026781.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY07283.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
Length=556

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/391 (68%), Positives = 319/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FPV V+  +R+YKF V +KN +RLC+SKPIV VNGKFPGP LYAREGDTV+V+V NHV
Sbjct  13    CLFPVLVDCTVRNYKFDVVLKNKTRLCSSKPIVTVNGKFPGPTLYAREGDTVLVKVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPI  GQSY+YNFT+TGQRGTLLWH+HI W R+
Sbjct  73    KYNVSIHWHGVRQLRTGWADGPAYITQCPIPTGQSYVYNFTITGQRGTLLWHAHILWLRS  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFPKP KE +++L EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TVHGAIVILPKRGVPYPFPKPHKEVVVILAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G  GP  +C S+ G+ L VE+GKTYLLR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  193   GHTGPVSSCPSQGGFTLPVENGKTYLLRLINAALNEELFFKIAGHKLTVVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +T T+ + PGQTTN L++AD+ +GKY +A SPFMD  +A DN TATATL Y GT     T
Sbjct  253   KTKTVIIAPGQTTNVLVSADKSSGKYLVAASPFMDAPIAVDNLTATATLHYSGTLANTPT  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT +P +NATPV   F +SLR+LNS+ YPA VP S+DH+L F +G+G+NPCP C +  G
Sbjct  313   TLTSLPPKNATPVANNFINSLRALNSKQYPALVPQSIDHNLFFTVGLGINPCPTCKAGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SR VA INNV+FVMPTT LLQAH++NISGVF
Sbjct  373   SRAVASINNVTFVMPTTALLQAHFFNISGVF  403



>ref|XP_007142229.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
 gb|ESW14223.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
Length=555

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/389 (67%), Positives = 317/389 (81%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P+SVE+M+RHYKF V +KN +RLC++KPIV VNGKFPGP +YARE DTV+V+V NHV
Sbjct  13    CMLPLSVEAMVRHYKFNVVVKNVTRLCSTKPIVTVNGKFPGPTIYAREDDTVLVKVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ ++YNFTLTGQRGTL WH+HI W R+
Sbjct  73    KYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQVFVYNFTLTGQRGTLWWHAHILWLRS  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGA+VILPKLGVPYPFPKP+ E++I+L EWW S+ E +I  A++ G+ PNVSDAHTIN
Sbjct  133   TLHGALVILPKLGVPYPFPKPNAEKVILLSEWWKSDTEAIIKEALKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G  G    C+S+G Y LEV++G TYLLR++NAALNEELFFKIAGH+L VVEVDA Y KP 
Sbjct  193   GHTGSVQQCASQGVYKLEVDAGNTYLLRIINAALNEELFFKIAGHQLTVVEVDAVYTKPL  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +T+TI + PGQTTN LL A++  GKY +A +PFMD+ +A DN TATATL Y G+     T
Sbjct  253   KTNTIVIAPGQTTNVLLKANRATGKYLVAATPFMDSPIAVDNVTATATLHYSGSLSSTIT  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT +P +NATPV TTFTDSLRSLNS+ YPA VP  VDH+L F + +GVNPCP C +GSR
Sbjct  313   TLTSLPPKNATPVATTFTDSLRSLNSKNYPARVPTKVDHNLFFTVSLGVNPCPTCVNGSR  372

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA INNV+FVMP   LLQAH++NISGVF
Sbjct  373   VVAAINNVTFVMPKISLLQAHFFNISGVF  401



>ref|XP_010044088.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86094.1| hypothetical protein EUGRSUZ_B02795 [Eucalyptus grandis]
Length=556

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/391 (69%), Positives = 320/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +R+Y F V MKNT+RLC+SKPIV VNG FPGP LYARE DTV+VRV+N V
Sbjct  13    CITPAVVEGRVRNYTFNVVMKNTTRLCSSKPIVTVNGMFPGPTLYAREDDTVLVRVSNRV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NV+IHWHG++Q R GW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  73    KYNVTIHWHGIRQLRMGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGAIVILPK GVPYPFPKP KE ++VLGEWW S+ E VIN A++ G+ PNVSDAH IN
Sbjct  133   TLHGAIVILPKRGVPYPFPKPHKEVVVVLGEWWKSDTEAVINQAIKSGLAPNVSDAHMIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP+  C S+ G+ L VESGK Y+LR++NAALNEELFFKIAGH+L +VEVDATYVKPF
Sbjct  193   GHPGPSSNCPSQGGFTLPVESGKKYMLRIINAALNEELFFKIAGHQLTIVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTNAL++ DQ +GKY +A SPFMD+ +A DN TATATL Y GT    ST
Sbjct  253   KTDTIVIAPGQTTNALISTDQSSGKYMVAASPFMDSPIAVDNMTATATLHYSGTLAATST  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P QNAT V   F +SLRSLNS+ YPA +PL+VDHSL+F +G+G+NPCP+C +  G
Sbjct  313   TLTKTPPQNATAVANNFVNSLRSLNSKRYPAKIPLTVDHSLLFTVGLGINPCPSCKAGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMPTT +LQAH++N SGVF
Sbjct  373   SRVVASMNNVTFVMPTTAILQAHFFNKSGVF  403



>emb|CDP06511.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/390 (69%), Positives = 312/390 (80%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V   +RHYKF V +KN +RLC+SKPIV VNGKFPGP LYARE DTV+VRV NHV+ 
Sbjct  19    FPALVHCRVRHYKFDVVLKNFTRLCSSKPIVTVNGKFPGPTLYAREDDTVLVRVVNHVKY  78

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTLLWH+HI W RATV
Sbjct  79    NVSIHWHGVRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRATV  138

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGA+VILPK GV YPFPKP  E ++VLGEWW S+ E VIN A++ G+ PNVSDAHTING 
Sbjct  139   HGAVVILPKRGVLYPFPKPHHENVVVLGEWWKSDTEAVINEALKSGMAPNVSDAHTINGH  198

Query  684   PGPTPTCSSK--GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE  857
             PG    CSS   G+ L VE GK+YLLRV+NAALNEELFFKIAGH L VVEVDATYVKPF+
Sbjct  199   PGAVANCSSDQGGFTLSVEPGKSYLLRVINAALNEELFFKIAGHTLTVVEVDATYVKPFK  258

Query  858   TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA  1037
             TDTI V PGQTTN ++TADQ AGKY ++ S FMD+ +A DN +ATATL Y GT   + T 
Sbjct  259   TDTILVAPGQTTNVIVTADQSAGKYMVSASTFMDSTIAVDNTSATATLHYSGTLSSSPTT  318

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSGS  1211
              T  P  NATPV   FT+SLRSLNS  YPA VP +VDHSL F + +G+NPCP C  ++GS
Sbjct  319   FTTAPALNATPVANKFTNSLRSLNSEKYPAQVPQTVDHSLFFVVSLGINPCPTCKAANGS  378

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVA +NNV+FVMPT  LLQAH++NI+GVF
Sbjct  379   RVVASVNNVTFVMPTVALLQAHFFNINGVF  408



>ref|XP_008442464.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis melo]
Length=559

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/391 (67%), Positives = 317/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P   ES +RHYKF V ++  +RLC+SKPIV VNG+FPGP LYAREGD V+++V NHV
Sbjct  16    CLLPGLAESTVRHYKFNVVLRKATRLCSSKPIVTVNGQFPGPTLYAREGDNVLIKVVNHV  75

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTL WH+HI W RA
Sbjct  76    KYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLFWHAHILWLRA  135

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHG +VILPKLGVPYPFP P+KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  136   TVHGGLVILPKLGVPYPFPTPNKETVLVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  195

Query  678   GLPGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             GLPG  P C S +G+ L V+ GKTYLLR++NAALNEELFFK+AGH+L VVEVDATYVKPF
Sbjct  196   GLPGSIPNCPSQRGFTLPVQRGKTYLLRIINAALNEELFFKVAGHKLTVVEVDATYVKPF  255

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTN LLTA+Q +GKY +A+SPFMD  VA DN+TATAT+ Y GT   + T
Sbjct  256   KTDTVIIAPGQTTNVLLTANQNSGKYMVAVSPFMDAPVAVDNKTATATVHYTGTLATSLT  315

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
               T  P QNAT +   F +SLRSLNS+ YPANVPL++DH L F +G+G+NPCP C  ++G
Sbjct  316   TSTNPPPQNATQIANAFINSLRSLNSKKYPANVPLTIDHHLFFTVGLGINPCPTCKAANG  375

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH++   GVF
Sbjct  376   SRVVASINNVTFVMPTTALLQAHFFKTKGVF  406



>ref|XP_006387495.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
 gb|ERP46409.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
Length=559

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/391 (69%), Positives = 318/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  IRHYKF V MKNT+RLC+ KPIV VNG+FPGP LYARE DTV+V+V NHV
Sbjct  16    CLLPALVECRIRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLYAREHDTVLVKVVNHV  75

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  76    KYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRA  135

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+V+LPK G+PYPFP P KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  136   TVHGAMVVLPKRGIPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  195

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG    CSS+ G+ L V+SG+TY+LR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  196   GHPGAVSACSSQGGFTLPVKSGETYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKPF  255

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTN L+T ++  GKY +A SPFMD  +A DN TATATL Y G    + T
Sbjct  256   KTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATATLQYSGALANSPT  315

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P +NAT V   FT+SLRSLNSR +PA VPL+VDH+L F +G+GVNPCP+C +  G
Sbjct  316   TLTTPPPKNATAVANQFTNSLRSLNSRRFPAKVPLNVDHNLFFTVGLGVNPCPSCKAGNG  375

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH++NISGVF
Sbjct  376   SRVVASINNVTFVMPTTALLQAHFFNISGVF  406



>ref|XP_003616564.1| Laccase [Medicago truncatula]
Length=675

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/387 (67%), Positives = 317/387 (82%), Gaps = 0/387 (0%)
 Frame = +3

Query  141   TFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             +FP+ V+S++RHY F+V +KN ++LC++K  V VNGKFPGP LYARE DT++VRV N VQ
Sbjct  135   SFPLFVQSLVRHYNFSVVLKNETKLCSTKSFVSVNGKFPGPTLYAREDDTLIVRVTNLVQ  194

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              NV+IHWHG+KQ RT WSDGPAY+TQCPIQ GQS++YNFT+TGQRGTLLWH+HI W RAT
Sbjct  195   HNVTIHWHGIKQLRTCWSDGPAYVTQCPIQTGQSFVYNFTITGQRGTLLWHAHITWLRAT  254

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             +HGAIVILPK G PYPFPKPDKE+II+LGEWW S+VE V+N A   G+PPN+SDAHTING
Sbjct  255   MHGAIVILPKRGTPYPFPKPDKEKIIILGEWWKSDVEAVVNQATSSGMPPNISDAHTING  314

Query  681   LPGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
              PGP P C S+GY L VESGKTYLLR++NAALN+ELFFKIAGH+L VVE DA+Y+KPFE 
Sbjct  315   HPGPVPGCISQGYTLHVESGKTYLLRIINAALNDELFFKIAGHKLIVVEADASYLKPFEI  374

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DTIF+ PGQTTN LLTA+Q  GKY IAI+PFMD  +  DN ++ ATL YKG      T L
Sbjct  375   DTIFLSPGQTTNVLLTANQPIGKYLIAITPFMDAPIGFDNLSSIATLRYKGIPPYTKTIL  434

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T +P  NATP+T TFTDSLRSLNS+ YP  V L++DHSL+FAI VG+NPC  C + +++V
Sbjct  435   TNIPPLNATPITKTFTDSLRSLNSKTYPTRVSLTIDHSLLFAITVGLNPCDTCITDNKLV  494

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             + INN++F+MPT  LLQA+YYNI GVF
Sbjct  495   SAINNITFLMPTVSLLQANYYNIKGVF  521



>gb|EYU41858.1| hypothetical protein MIMGU_mgv1a003895mg [Erythranthe guttata]
Length=557

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/392 (68%), Positives = 316/392 (81%), Gaps = 4/392 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +R Y+F V MKNT+R+C++K IV VNGKFPGP +YARE DTV++RV N V
Sbjct  13    CLLPCFVECEVRRYQFNVVMKNTTRVCSTKSIVTVNGKFPGPTIYAREDDTVLIRVINRV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGWSDGPAYITQCPIQPG SY+YNFT+TGQRGTL WH+HI W R+
Sbjct  73    KYNVSIHWHGVRQLRTGWSDGPAYITQCPIQPGHSYVYNFTITGQRGTLFWHAHILWLRS  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPKLGVPYPFPKPD E ++VLGEWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TVHGALVILPKLGVPYPFPKPDHESVVVLGEWWKSDTEAVINEALKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C S+ G++L V  GK Y+LR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  193   GHPGPISNCPSTGGFSLNVSPGKNYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLAS  1031
             +TDTI + PGQTTN ++TADQ AGKY +A SPFMDT +VA DN+TATAT+ Y GT   + 
Sbjct  253   KTDTILIAPGQTTNVIVTADQGAGKYMVAASPFMDTPVVAVDNKTATATIHYSGTLANSP  312

Query  1032  TALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--  1205
             T+ T  P QNATPV   F +SLRSLNS+ YPA VP+ +DHSL+F +G+G+N CP+C +  
Sbjct  313   TSFTATPPQNATPVANNFVNSLRSLNSKKYPAKVPMKIDHSLLFTVGLGINRCPSCKAGN  372

Query  1206  GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             GSRVVA +NNV+FVMPT  LLQAH  NI GVF
Sbjct  373   GSRVVASVNNVTFVMPTVALLQAHVQNIKGVF  404



>sp|Q0IQU1.2|LAC22_ORYSJ RecName: Full=Laccase-22; AltName: Full=Benzenediol:oxygen oxidoreductase 
22; AltName: Full=Diphenol oxidase 22; AltName: 
Full=Urishiol oxidase 22; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAX95423.1| laccase (EC 1.10.3.2) precursor - common tobacco [Oryza sativa 
Japonica Group]
 gb|ABA95532.1| Multicopper oxidase family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ19339.1| hypothetical protein OsJ_34890 [Oryza sativa Japonica Group]
Length=564

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/388 (67%), Positives = 314/388 (81%), Gaps = 4/388 (1%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             +S  ++ RHYKF V M+N +RLC++KPI+ VNGKFPGP LYAREGD V+V+V NHV  NV
Sbjct  24    LSAHAITRHYKFNVVMRNMTRLCSTKPILTVNGKFPGPTLYAREGDNVLVKVVNHVAHNV  83

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             +IHWHGV+Q RTGW DGPAYITQCPIQPG S+LYNFT+TGQRGTLLWH+HINW RATVHG
Sbjct  84    TIHWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTITGQRGTLLWHAHINWLRATVHG  143

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVILPKLGVPYPFP P KE +IVLGEWW  + E VIN AMQLG+ PN+SD+HTING PG
Sbjct  144   AIVILPKLGVPYPFPAPHKEAVIVLGEWWKEDTETVINQAMQLGVGPNISDSHTINGHPG  203

Query  690   PTPTCSS--KGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             P   C+S   G+ L VE+GKTY+LR++NAALN++LFFK+AGH L VVEVDA Y KPF+TD
Sbjct  204   PLSECASSQDGFKLSVENGKTYMLRIINAALNDDLFFKVAGHELTVVEVDAVYTKPFKTD  263

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGT--HLLASTA  1037
             T+ + PGQTTN L+ A+Q AG+Y +++SPFMD  V  DN+T TATL Y  T    +AS  
Sbjct  264   TLLITPGQTTNVLVRANQGAGRYLLSVSPFMDAPVQVDNKTGTATLHYANTVSSSMASLT  323

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             L   P QNAT + + FTDSL SLNS+ YPANVP +VDHSL+  +GVGVNPCP+C +G+RV
Sbjct  324   LVKPPPQNATHIVSKFTDSLHSLNSKEYPANVPQTVDHSLLLTVGVGVNPCPSCINGTRV  383

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             V  INNV+F+MP+TP+LQAHYYNI GVF
Sbjct  384   VGTINNVTFIMPSTPILQAHYYNIPGVF  411



>ref|XP_002308209.2| laccase family protein [Populus trichocarpa]
 gb|EEE91732.2| laccase family protein [Populus trichocarpa]
Length=559

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/391 (69%), Positives = 317/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  IRHYKF V MKNT+RLC+ KPIV VNG+FPGP LYARE DTV+V+V NHV
Sbjct  16    CLLPALVECRIRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLYAREHDTVLVKVVNHV  75

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  76    KYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRA  135

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+V+LPK G+PYPFP P KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  136   TVHGALVVLPKRGIPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  195

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG    CSS+ G+ L V+SG+TY+LR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  196   GHPGAVSACSSQGGFTLPVKSGETYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKPF  255

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTN L+T ++  GKY +A SPFMD  +A DN TATATL Y G    + T
Sbjct  256   KTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATATLQYSGALANSPT  315

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P +NAT V   FT+SLRSLNSR +PA VPL+VDH+L F +G+GVNPCP+C +  G
Sbjct  316   TLTTPPPKNATAVANQFTNSLRSLNSRRFPAKVPLNVDHNLFFTVGLGVNPCPSCKAGNG  375

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH+ NISGVF
Sbjct  376   SRVVASINNVTFVMPTTALLQAHFLNISGVF  406



>ref|XP_002308208.2| laccase family protein [Populus trichocarpa]
 gb|EEE91731.2| laccase family protein [Populus trichocarpa]
Length=558

 Score =   563 bits (1450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/391 (68%), Positives = 319/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  V+  +RHYKF V MKNT+RLC+ KPIV VNG+FPGP LYARE DTV+V+V NHV
Sbjct  15    CLFPALVQCRVRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLYAREDDTVLVKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  75    KYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLLWHAHILWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+V+LPK G+PYPFP P KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  135   TVHGALVVLPKRGIPYPFPAPHKEVLVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG   TCSS+ G+ L V+SG+TY+LR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  195   GHPGAVSTCSSQGGFTLPVKSGETYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTN L+T ++  GKY +A SPFMD+ +A DN TATATL Y G    + T
Sbjct  255   KTDTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDSPIAVDNMTATATLQYSGALANSPT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P +NAT V   FT+SLRSLNSR +PA VPL+VDH+L F + +GVNPCP+C +  G
Sbjct  315   TLTTPPPKNATAVANQFTNSLRSLNSRRFPAKVPLNVDHNLFFTVSLGVNPCPSCKAGNG  374

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH+ NISGVF
Sbjct  375   SRVVASINNVTFVMPTTALLQAHFLNISGVF  405



>ref|XP_008239590.1| PREDICTED: laccase-4-like [Prunus mume]
Length=559

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/391 (69%), Positives = 318/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VES IRHYKF V +KNT+RLC++KPIV +NG+FPGP LYARE DTV+V+V NHV
Sbjct  14    CLLPGLVESRIRHYKFNVVLKNTTRLCSTKPIVTINGRFPGPTLYAREDDTVLVKVTNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPI PGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  74    KYNVSIHWHGVRQLRTGWADGPAYITQCPIPPGQSYVYNFTITGQRGTLLWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPK GVPYPFP P KE  ++L EWW S+ E VIN A+  GI PNVSDAH IN
Sbjct  134   TVHGALVILPKRGVPYPFPAPHKEVNVILAEWWKSDTEAVINQALSSGIAPNVSDAHIIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CSS+ G+ L VE+GKTYLLR++NAALNEELFFKIAGH+L +VEVDATYVKPF
Sbjct  194   GHPGPVANCSSEGGFTLPVENGKTYLLRIINAALNEELFFKIAGHKLTIVEVDATYVKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTNAL+TA+Q +GKY +A SPFMD+ +A DN TATATL Y GT     T
Sbjct  254   KTDTIVIAPGQTTNALITANQNSGKYLVAASPFMDSPIAVDNLTATATLHYSGTLATTPT  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P QNAT V   F +SL+SLNS+ +PA VPL VDH+L+F +G+G+NPCP C +  G
Sbjct  314   TLTNPPPQNATQVANNFINSLKSLNSKKFPAKVPLKVDHNLLFTVGLGINPCPTCKAGNG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMPTT LLQAH +NISGVF
Sbjct  374   SRVVASVNNVTFVMPTTALLQAHVFNISGVF  404



>gb|KHG18161.1| Laccase-4 -like protein [Gossypium arboreum]
Length=556

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/389 (70%), Positives = 318/389 (82%), Gaps = 3/389 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FPV V+  +RHYKF V MKNT+RLC+SKPIV VNGKFPGP LYAREGDTV+V+V NHV+ 
Sbjct  15    FPVFVDCTVRHYKFNVVMKNTTRLCSSKPIVTVNGKFPGPTLYAREGDTVLVKVVNHVKY  74

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPIQ GQSY+YNFT+TGQRGTLLWH+HI W R+TV
Sbjct  75    NVSIHWHGIRQLRTGWADGPAYITQCPIQSGQSYVYNFTITGQRGTLLWHAHILWLRSTV  134

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK  VPYPFPKP KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTING 
Sbjct  135   HGAIVILPKRSVPYPFPKPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGH  194

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG    C S+ G++L VESGKTYLLR++NAALNEELFFKIAGH+L VVEVDATYVKPF+ 
Sbjct  195   PGKVSGCPSQGGFSLPVESGKTYLLRLINAALNEELFFKIAGHKLTVVEVDATYVKPFKI  254

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DT+ + PGQTTN L++ADQ +GKY +A SPFMD  VA DN TATATL Y GT     T+L
Sbjct  255   DTVVIAPGQTTNVLVSADQNSGKYMVAASPFMDAPVAVDNLTATATLHYSGTLDNTPTSL  314

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSR  1214
             T  P QNAT V   F DSLRSLNS+ +PA VP ++DH+L F +G+GVNPCP C +  GSR
Sbjct  315   TTPPPQNATSVANNFIDSLRSLNSKQFPALVPPTIDHNLYFTVGLGVNPCPTCKAGNGSR  374

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA INNV+F MPTT LLQAH++NISGVF
Sbjct  375   VVASINNVTFTMPTTALLQAHFFNISGVF  403



>ref|XP_006293932.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
 gb|EOA26830.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
Length=558

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/388 (68%), Positives = 312/388 (80%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP   ESM+RHYKF V MKNT+RLC+SKPIV VNG++PGP +YARE DT++++V NHV+ 
Sbjct  18    FPAPSESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ Y YN+TLTGQRGTL WH+HI W RATV
Sbjct  78    NVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             +GAIVILPK GVPYPFPKPD E++IVLGEWW S+ EDVIN A++ G+ PNVSDAH ING 
Sbjct  138   NGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTEDVINEALKSGLAPNVSDAHMINGH  197

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGP   C S+GY L VE+GKTYLLR++NAALNEELFFK+AGH   VVEVDA YVKPF+ D
Sbjct  198   PGPVKNCPSQGYKLSVENGKTYLLRLINAALNEELFFKVAGHIFTVVEVDAVYVKPFKID  257

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             T+ + PGQTTN LLTA + AGK+ +  SPFMD  +A DN TATAT+ Y GT   + T LT
Sbjct  258   TVLIAPGQTTNVLLTASKSAGKFLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTVLT  317

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSRV  1217
             + P QNAT V   FT+SLRSLNS+ YPA VP ++DH L+F +G+G+N CP C +  GSRV
Sbjct  318   LPPPQNATSVANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLGLNACPTCKAGNGSRV  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VA INNV+F+MP T LL AHY+N SGVF
Sbjct  378   VASINNVTFIMPKTALLSAHYFNKSGVF  405



>ref|XP_002278638.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI30423.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   562 bits (1448),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/391 (69%), Positives = 316/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +R Y F V +KNT+RLCASKPIV VNG+FPGP LY RE DTV+VRV NHV
Sbjct  14    CLLPALVECRVRQYTFNVVLKNTNRLCASKPIVTVNGRFPGPTLYVREDDTVLVRVVNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGWSDGPAYITQCPIQ GQSYLYNFT+TGQRGTLLWH+H+ W RA
Sbjct  74    KYNVSIHWHGIRQLRTGWSDGPAYITQCPIQTGQSYLYNFTVTGQRGTLLWHAHVLWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFPKP KE +++LGEWW S+VE VIN A+  G+ PNVSDAHTIN
Sbjct  134   TVHGAIVILPKRGVPYPFPKPHKEVVVILGEWWKSDVEAVINQALSSGLAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C S+ G++L+VE+GKTYLLR++NAALNEELFFKIAGH+L VVEVDA Y KPF
Sbjct  194   GHPGPVSNCPSQGGFSLQVEAGKTYLLRIINAALNEELFFKIAGHQLSVVEVDAVYTKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             + DT+ + PGQTTNAL+TADQ +GKY +A SPFMD+ +A DN TATATL Y GT   + T
Sbjct  254   KIDTLVIAPGQTTNALITADQSSGKYLMAASPFMDSPIAVDNLTATATLHYSGTLASSPT  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
             +LT  P  NAT V   F +SLRSLNS+ YPA VPL+VDHSL   +G+G+NPC  C   +G
Sbjct  314   SLTSPPPPNATAVANKFVNSLRSLNSKKYPAKVPLTVDHSLFITVGLGINPCATCVAGNG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SR VA +NNV+FVMPTT +LQAHY+NISGV+
Sbjct  374   SRAVASMNNVTFVMPTTAILQAHYFNISGVY  404



>gb|KEH34185.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=556

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/384 (68%), Positives = 312/384 (81%), Gaps = 1/384 (0%)
 Frame = +3

Query  153   SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVS  332
             SV++M+RHYKF V MKN +RLC++KPIV VNGKFPGP +YARE D V+++V NHV+ NVS
Sbjct  20    SVDAMVRHYKFNVVMKNATRLCSTKPIVTVNGKFPGPTIYAREDDNVLIKVVNHVKYNVS  79

Query  333   IHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGA  512
             IHWHGVKQ RTGW+DGPAYITQCPIQPGQ+YLYNFTLTGQRGTL WH+H+ W RATVHGA
Sbjct  80    IHWHGVKQLRTGWADGPAYITQCPIQPGQTYLYNFTLTGQRGTLWWHAHVLWLRATVHGA  139

Query  513   IVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGP  692
             IVILPKLGVPYPFPKP  E++I+LGEWW S+ E +IN A++ G+ PN SDAHTING PGP
Sbjct  140   IVILPKLGVPYPFPKPHMEQVILLGEWWKSDTEAIINEALKSGLAPNTSDAHTINGHPGP  199

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
                C+S+ G++LEV+   TYLLR++NAALNEELFFKIA H+L VVEVDATYVKPF+TDTI
Sbjct  200   VQGCASQGGFSLEVQPKNTYLLRIINAALNEELFFKIANHQLTVVEVDATYVKPFKTDTI  259

Query  870   FVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIM  1049
              + PGQTTN L+TA  K G + +A SPFMD  +  DN+TATATL Y GT   + T LT +
Sbjct  260   VIAPGQTTNVLVTAKHKIGNFLVAASPFMDAPIVVDNKTATATLHYSGTLGSSLTTLTSL  319

Query  1050  PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADI  1229
             P  NAT V  TFTDSLRSLNS+ +PA VPL +DH+L+F + +GVNPC  C + SRVVADI
Sbjct  320   PPTNATSVANTFTDSLRSLNSKKFPAKVPLKIDHNLLFTVSLGVNPCATCVNNSRVVADI  379

Query  1230  NNVSFVMPTTPLLQAHYYNISGVF  1301
             NNV+FVMP   LLQAH++ I GVF
Sbjct  380   NNVTFVMPKIALLQAHFFKIKGVF  403



>ref|XP_010505418.1| PREDICTED: laccase-4 [Camelina sativa]
Length=558

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/388 (68%), Positives = 311/388 (80%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP   ESM+RHYKF V MKNT+RLC+SKPIV VNG++PGP +YARE DT++++V NHV+ 
Sbjct  18    FPAPSESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ Y YN+TLTGQRGTL WH+HI W RATV
Sbjct  78    NVSIHWHGVRQIRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             +GAIVILPK GVPYPFPKPD E++IVLGEWW S+ ED+IN A++ G+ PNVSDAH ING 
Sbjct  138   NGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTEDIINEALKSGLAPNVSDAHMINGH  197

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGP   C S+GY L VE+GKTYLLR++NAALNEELFFK+AGH   VVEVDA YVKPF+ D
Sbjct  198   PGPVKNCPSQGYKLSVENGKTYLLRLINAALNEELFFKVAGHLFTVVEVDAVYVKPFKID  257

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             T+ + PGQTTN LLTA + AGKY +  SPFMD  +A DN TATAT+ Y GT   + T  T
Sbjct  258   TVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTVRT  317

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSRV  1217
             + P QNAT +   FT+SLRSLNS+ YPA VP ++DH L+F +G+G+N CP C +  GSRV
Sbjct  318   LPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLGLNACPTCKAGNGSRV  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VA INNV+FVMP T LL AHY+N SGVF
Sbjct  378   VASINNVTFVMPKTALLSAHYFNKSGVF  405



>ref|XP_011094977.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=558

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/393 (68%), Positives = 311/393 (79%), Gaps = 5/393 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  V+  +RHY+F V MKNT+RLC++K IV VNGKFPGP +YARE DTV++RV N V
Sbjct  13    CLLPAVVQCKVRHYQFNVVMKNTTRLCSTKSIVTVNGKFPGPTIYAREDDTVLIRVINRV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPIQPG SY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  73    KYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGHSYVYNFTITGQRGTLLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGA+VILPKLGVPYPFPKPD E ++VLGEWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TLHGALVILPKLGVPYPFPKPDHEAVVVLGEWWKSDTEAVINEALKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK--GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKP  851
             G PGP   C S   G+ L V  GKTY+LR++NAALNEELFFKIAGH+L VVEVDATYVKP
Sbjct  193   GHPGPVSNCPSTGGGFTLNVSPGKTYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKP  252

Query  852   FETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLA  1028
             F+TDT+ + PGQTTN ++ ADQ AGKY +A SPF+DT IVA DN TATATL Y GT   +
Sbjct  253   FKTDTVLIAPGQTTNVIVVADQGAGKYMLAASPFLDTPIVAVDNMTATATLHYSGTLASS  312

Query  1029  STALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS-  1205
              T  T  P +NATPV   F +SLRSLNS+ YPA VP  VDHSL F +G+G+NPCP+C + 
Sbjct  313   PTTFTSTPARNATPVANNFVNSLRSLNSKKYPAKVPQKVDHSLFFTVGLGINPCPSCKAG  372

Query  1206  -GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
              GSR VA INNV+FVMPT  LLQAH   I GVF
Sbjct  373   NGSRAVASINNVTFVMPTIALLQAHVLKIKGVF  405



>ref|XP_010517091.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/388 (68%), Positives = 311/388 (80%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP   ESM+RHYKF V MKNT+RLC+SKPIV VNG++PGP +YARE DT++++V NHV+ 
Sbjct  18    FPAPSESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ Y YN+TLTGQRGTL WH+HI W RATV
Sbjct  78    NVSIHWHGVRQIRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             +GAIVILPK GVPYPFPKPD E++IVLGEWW S+ ED+IN A++ G+ PNVSDAH ING 
Sbjct  138   NGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTEDIINEALKSGLAPNVSDAHMINGH  197

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGP   C S+GY L VE+GKTYLLR++NAALNEELFFK+AGH   VVEVDA YVKPF+ D
Sbjct  198   PGPVKNCPSQGYKLPVENGKTYLLRLINAALNEELFFKVAGHLFTVVEVDAVYVKPFKID  257

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             T+ + PGQTTN LLTA + AGKY +  SPFMD  +A DN TATAT+ Y GT   + T  T
Sbjct  258   TVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTVRT  317

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSRV  1217
             + P QNAT +   FT+SLRSLNS+ YPA VP ++DH L+F +G+G+NPCP C +  GSRV
Sbjct  318   LPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLGLNPCPTCKAGNGSRV  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VA INNV+FVMP T LL AHY+  SGVF
Sbjct  378   VASINNVTFVMPKTALLSAHYFKKSGVF  405



>ref|XP_002530417.1| laccase, putative [Ricinus communis]
 gb|EEF31987.1| laccase, putative [Ricinus communis]
Length=554

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/386 (71%), Positives = 308/386 (80%), Gaps = 0/386 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  VES +RHY FTV   NT++LC+SK IV VNGKFPGP L+ARE D V VRV N+VQ 
Sbjct  16    FPALVESTVRHYNFTVATTNTTKLCSSKSIVTVNGKFPGPTLFAREDDNVNVRVINNVQY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q  TGW+DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWH+HI+W R TV
Sbjct  76    NVTIHWHGVRQLLTGWADGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHAHISWLRTTV  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFPKP+KE++IVLGEWW ++ E VI  AMQ G+ PN+SD+HTING 
Sbjct  136   HGAIVILPKKGVPYPFPKPNKEKLIVLGEWWKTDTEAVIKQAMQTGLAPNISDSHTINGH  195

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
              GP P C+S GY L VE GKTYL+R+VNAA+N+ELFFKIAGH L VVEVDA Y KPF TD
Sbjct  196   TGPVPGCTSPGYTLHVERGKTYLIRLVNAAVNDELFFKIAGHNLTVVEVDACYTKPFNTD  255

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
              +FVGPGQTT+ LLTADQ  GKY IA+SPFMDTIVA DN T  A L YK T   +   LT
Sbjct  256   IVFVGPGQTTSFLLTADQPTGKYLIAVSPFMDTIVAVDNATGIAFLRYKDTVKFSPPVLT  315

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
               P  NAT  T+ F D LRSLNS+ YP NVPL+VDHSL F IGVG+N CP C +GSR V 
Sbjct  316   TTPAINATSETSIFLDKLRSLNSKRYPCNVPLTVDHSLYFTIGVGINSCPTCVNGSRAVG  375

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
             DINNVSFVMPT  LL+AHYYNISGVF
Sbjct  376   DINNVSFVMPTMDLLEAHYYNISGVF  401



>ref|XP_004249583.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=557

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/391 (68%), Positives = 312/391 (80%), Gaps = 5/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FPV    + RHYKF V MKN SRLC+SKPIV +NG+FPGP +YARE D V+++V NHV
Sbjct  15    CFFPVF--GITRHYKFNVVMKNMSRLCSSKPIVTINGRFPGPTIYARENDRVLIKVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTL WH+HI W RA
Sbjct  73    KYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFPKP+ E ++VLGEWW S+ E V+N A+  G+ PNVSDAHTIN
Sbjct  133   TVHGAIVILPKRGVPYPFPKPNHEAVVVLGEWWKSDTEAVVNEALNSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP P C S+ GY L V  GKTY+LRV+NAALNEELFFKIAGH++ VVEVDATYVKPF
Sbjct  193   GHPGPVPNCPSEGGYTLSVAPGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             ++DTI + PGQTTN +LTADQK GKY +  SPFMD+ +  DN TATATL Y G    A  
Sbjct  253   KSDTILIAPGQTTNVILTADQKFGKYMMIASPFMDSPITVDNVTATATLHYTGALSSAPM  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
              LT  P QNAT V   F DSL+SLNS+ YPA VP +VDHSL+F +G+G+NPCP C  ++G
Sbjct  313   TLTSAPPQNATLVANNFIDSLKSLNSKKYPAKVPNNVDHSLLFTVGLGINPCPTCIPANG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH++ I  VF
Sbjct  373   SRVVASINNVTFVMPTTALLQAHFFGIKNVF  403



>ref|XP_004137913.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN58791.1| hypothetical protein Csa_3G732490 [Cucumis sativus]
Length=559

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/391 (66%), Positives = 316/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C      ES +RHYKF V ++  +RLC+SKPIV VNG+FPGP +YAREGD V+++V NHV
Sbjct  16    CLLSGLAESTVRHYKFNVVLRKATRLCSSKPIVTVNGQFPGPTVYAREGDNVLIKVVNHV  75

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTL WH+HI W RA
Sbjct  76    KYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLFWHAHILWLRA  135

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHG +VILPKLGVPYPFP P+KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  136   TVHGGLVILPKLGVPYPFPTPNKETVLVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  195

Query  678   GLPGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             GLPG    C S +G+ L V+ GKTYLLR++NAALNEELFFK+AGH+L VVEVDATYVKPF
Sbjct  196   GLPGSISNCPSQRGFTLPVQKGKTYLLRIINAALNEELFFKVAGHKLTVVEVDATYVKPF  255

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTN LLTA+Q +GKY +A+SPFMD  VA DN+TATAT+ Y GT   + T
Sbjct  256   KTDTVLIAPGQTTNVLLTANQNSGKYMVAVSPFMDAPVAVDNKTATATVHYTGTLATSLT  315

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
               T  P QNAT +   FT+SLRSLNS+ YPANVPL++DH L F +G+G+NPCP C  ++G
Sbjct  316   TSTNPPPQNATQIANAFTNSLRSLNSKKYPANVPLTIDHHLFFTVGLGINPCPTCKAANG  375

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH++   GVF
Sbjct  376   SRVVASINNVTFVMPTTALLQAHFFKTKGVF  406



>gb|KGN65788.1| hypothetical protein Csa_1G528530 [Cucumis sativus]
Length=562

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/386 (68%), Positives = 316/386 (82%), Gaps = 1/386 (0%)
 Frame = +3

Query  147   PVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQEN  326
             P  VE ++RHYKF V M+  +RLC+SKPIV +NGKFPGP +YARE DTV+++V NHV  N
Sbjct  24    PPPVECLVRHYKFNVVMRKVTRLCSSKPIVTINGKFPGPTIYAREDDTVLIKVVNHVPYN  83

Query  327   VSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVH  506
             VSIHWHG++Q RTGW+DGPAYITQCP+Q GQSY+YNFT+TGQRGTL WH+HI W RAT++
Sbjct  84    VSIHWHGIRQLRTGWADGPAYITQCPLQTGQSYVYNFTITGQRGTLWWHAHILWLRATLY  143

Query  507   GAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLP  686
             GA+VILPKLGVPYPFP P KE +++LGEWW S+VE V++ A + G+ PNVSDAHTING P
Sbjct  144   GAVVILPKLGVPYPFPTPHKELVLILGEWWKSDVEAVVHEAAKSGLAPNVSDAHTINGHP  203

Query  687   GPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDT  866
             GP   C ++G+++ V+ GKTYLLR++NAALNEELFFK+AGH+L VVEVDA Y KPF TDT
Sbjct  204   GPVNGCLTRGFSMPVQPGKTYLLRIINAALNEELFFKVAGHKLTVVEVDAAYTKPFITDT  263

Query  867   IFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTALT  1043
             IF+ PGQTTNALLTAD K+GKY I+ SPF DT IVA DN TATATL Y GT   + T+ T
Sbjct  264   IFIAPGQTTNALLTADLKSGKYAISASPFRDTPIVAVDNVTATATLHYTGTISTSPTSFT  323

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              +P QNAT + T FT+SLRSLNS+ YPA V L VDHSL F +G+GVN C  CSSG++VVA
Sbjct  324   GLPPQNATLIATKFTNSLRSLNSKQYPARVSLEVDHSLFFTVGLGVNRCKTCSSGTQVVA  383

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
             DINNV+FVMPT  LLQAHY+NI GVF
Sbjct  384   DINNVTFVMPTISLLQAHYFNIDGVF  409



>ref|XP_004246339.1| PREDICTED: laccase-4 [Solanum lycopersicum]
Length=561

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/394 (66%), Positives = 316/394 (80%), Gaps = 6/394 (2%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP+ VE  +RHYKF V MKNT+RLC+SK IV VNGKFPGP +YAREGD V+++V NHV
Sbjct  14    CLFPLVVECRVRHYKFNVVMKNTTRLCSSKSIVTVNGKFPGPTIYAREGDNVLIKVVNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTL WH+HI W RA
Sbjct  74    KYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPKLGVPYPFPKP+ E +++L EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  134   TVHGAIVILPKLGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAIKSGLAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C ++ GY L VE GKTY+LRV+NAALNEELFFKIAGH++ VVEVDATY+KPF
Sbjct  194   GHPGPVSNCPAQGGYKLNVEQGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYIKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGT-HLLAS  1031
             +TDTI + PGQTTN ++ A++ +GKY +  SPFMD  +A DN TA ATL Y GT     S
Sbjct  254   QTDTIVIAPGQTTNVIVNANKNSGKYMVVASPFMDAPIAVDNVTAIATLHYSGTLSNNPS  313

Query  1032  TALTI--MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACS-  1202
             T LT    P +NATP+   F D+LRSLNS+ YPA VP+ +DHSL+F +G+G+NPCP+C  
Sbjct  314   TTLTSTNTPPKNATPIANNFLDALRSLNSKKYPAKVPIKIDHSLLFTVGLGINPCPSCKQ  373

Query  1203  -SGSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
              +GSRVVA INNV+FVMPT  LLQAH+  I GVF
Sbjct  374   GNGSRVVASINNVTFVMPTIALLQAHFSGIKGVF  407



>ref|XP_008457399.1| PREDICTED: laccase-4 [Cucumis melo]
Length=562

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/386 (68%), Positives = 316/386 (82%), Gaps = 1/386 (0%)
 Frame = +3

Query  147   PVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQEN  326
             P  VE ++RHYKF V M+  +RLC+SKPIV +NGKFPGP +YARE DTV+V+V NHV  N
Sbjct  24    PPPVECLVRHYKFNVVMRKVTRLCSSKPIVTINGKFPGPTIYAREDDTVLVKVVNHVPYN  83

Query  327   VSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVH  506
             VSIHWHG++Q RTGW+DGPAYITQCP+Q GQSY+YNFT+TGQRGTL WH+HI W RAT++
Sbjct  84    VSIHWHGIRQLRTGWADGPAYITQCPLQTGQSYVYNFTITGQRGTLWWHAHILWLRATLY  143

Query  507   GAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLP  686
             GA+VILPKLGVPYPFP P KE +++LGEWW S+VE V+N A + G+ PNVSDAHTING P
Sbjct  144   GAVVILPKLGVPYPFPTPHKELVLILGEWWKSDVEGVVNEAAKSGLAPNVSDAHTINGHP  203

Query  687   GPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDT  866
             GP   C ++G+++ V+ GKTYLLR++NAALNE+LFFK+AGH+L VVEVDA Y KPF TDT
Sbjct  204   GPVHGCLTRGFSMPVQPGKTYLLRIINAALNEDLFFKVAGHKLTVVEVDAAYTKPFITDT  263

Query  867   IFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTALT  1043
             I + PGQTTNALLTAD K+GKY I+ SPFMDT IVA DN TATATL Y GT     T+ T
Sbjct  264   IVIAPGQTTNALLTADLKSGKYAISASPFMDTPIVAVDNVTATATLHYTGTISTTPTSFT  323

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              +P QNAT + T FT+SLRSLNS+ YPA V L VDHSL+F +G+GVN C  CSSG+++VA
Sbjct  324   GLPPQNATLIATKFTNSLRSLNSKQYPARVSLEVDHSLLFTVGLGVNRCKTCSSGNQLVA  383

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
             DINNV+FVMPT  LLQAHY+NI GVF
Sbjct  384   DINNVTFVMPTISLLQAHYFNIDGVF  409



>ref|XP_006425016.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
 ref|XP_006488481.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR38256.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
Length=557

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/390 (68%), Positives = 312/390 (80%), Gaps = 2/390 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP SV+ M+R YKF V MKN +RLC++KPIV VNG FPGP + ARE DTV+V+V NHV
Sbjct  15    CLFPASVQCMVREYKFNVVMKNATRLCSTKPIVTVNGYFPGPTIVAREDDTVLVKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RT W+DGPAYITQCPIQPGQ+Y+YNFTL GQRGTL WH+HI W RA
Sbjct  75    KYNVSIHWHGVRQLRTCWADGPAYITQCPIQPGQNYIYNFTLAGQRGTLWWHAHILWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFPKP KE  ++L EWW S+VE VIN A++ G+ PNVSDAHTIN
Sbjct  135   TVHGAIVILPKRGVPYPFPKPHKEVTVILSEWWKSDVEAVINEALKSGLAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP  +C S+ G+ L VESGKTY+LR++NAALNEELFFKIAGH+L VVEVDA YVKPF
Sbjct  195   GHPGPLSSCPSQGGFKLPVESGKTYMLRLINAALNEELFFKIAGHKLTVVEVDAAYVKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLAS  1031
              T+T+ + PGQTTN LL+A    GKY +A SPF+DT  +  DN+TATAT+ Y GT    +
Sbjct  255   NTETVLIAPGQTTNVLLSAAHATGKYLVAASPFLDTPAILVDNKTATATVHYSGTLGSTA  314

Query  1032  TALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGS  1211
             T LT+ P +NATPV   FT SLRSLNS+ YPA VPL +DHSL F IG+G+NPC  C +GS
Sbjct  315   TTLTVPPPRNATPVAANFTASLRSLNSKKYPARVPLKIDHSLFFTIGLGINPCATCVNGS  374

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVADINNV+FVMPT  LLQAH++ I GVF
Sbjct  375   RVVADINNVTFVMPTISLLQAHFFKIGGVF  404



>ref|XP_004308920.1| PREDICTED: laccase-22-like [Fragaria vesca subsp. vesca]
Length=556

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/382 (67%), Positives = 313/382 (82%), Gaps = 0/382 (0%)
 Frame = +3

Query  156   VESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSI  335
             VES++RHY F V +K+T++LC+SK I+ VNGKFPGP LYARE DTV++RV NH   NV+I
Sbjct  22    VESLVRHYNFRVVLKSTTKLCSSKAILTVNGKFPGPTLYAREDDTVIIRVTNHGNRNVTI  81

Query  336   HWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAI  515
             HWHGVKQ  T W+DGPAYITQCPIQPGQ+++Y FT+TGQRGTLLWH+H +W RAT+HGAI
Sbjct  82    HWHGVKQLGTCWADGPAYITQCPIQPGQNFIYKFTITGQRGTLLWHAHDSWLRATLHGAI  141

Query  516   VILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPT  695
             VILPKLG PYPFP P KE II+L EWW S+VE V++ + Q G+PPN+SDAHTING PGP 
Sbjct  142   VILPKLGTPYPFPTPQKERIIILSEWWKSDVEAVVDESTQSGLPPNISDAHTINGHPGPA  201

Query  696   PTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFV  875
             P CSS+G+ L VESGKTYLLR++NAALN++LFFKIA H L VVEVDA+Y KPF+TDTIF+
Sbjct  202   PGCSSQGFTLHVESGKTYLLRIINAALNDDLFFKIARHNLTVVEVDASYTKPFQTDTIFI  261

Query  876   GPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPL  1055
              PGQTT ALL A++  G Y I++SPFMD  +  DN T+ ATL YK T   ++T LT +P 
Sbjct  262   SPGQTTTALLEANKDIGNYLISVSPFMDAPIGIDNFTSIATLRYKHTPRNSTTFLTSIPP  321

Query  1056  QNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINN  1235
             QNATP+T TF DSLRSL+S+LYPANVPL++DHSL   +GVG+NPC  C +GS++VA +NN
Sbjct  322   QNATPLTATFIDSLRSLDSKLYPANVPLTIDHSLFLTVGVGINPCDTCVNGSKLVASVNN  381

Query  1236  VSFVMPTTPLLQAHYYNISGVF  1301
             VSFVMPT  LLQA+YYNI GV+
Sbjct  382   VSFVMPTIALLQAYYYNIKGVY  403



>ref|XP_010529771.1| PREDICTED: laccase-4-like [Tarenaya hassleriana]
Length=559

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/391 (67%), Positives = 317/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP   ES++RHYKF V MKNT+RLC+SK IV VNG++PGP +YARE DT++++V NHV
Sbjct  16    CVFPFPTESLVRHYKFNVVMKNTTRLCSSKQIVTVNGRYPGPTIYAREDDTLLIKVVNHV  75

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ Y+YN+TLTGQRGTL WH+HI W RA
Sbjct  76    KYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQVYVYNYTLTGQRGTLWWHAHILWLRA  135

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPK G+PYPFPKPD E++IVL EWW S+ E+VIN A++ G+ PNVSDAHTIN
Sbjct  136   TVHGALVILPKRGIPYPFPKPDNEKVIVLSEWWKSDTENVINEALKSGLAPNVSDAHTIN  195

Query  678   GLPGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG   +C SS+GY L VESGK YLLR++NAALNEELFFK+AGH L VVEVDA YVKPF
Sbjct  196   GHPGLIKSCSSSQGYKLSVESGKIYLLRLINAALNEELFFKVAGHVLTVVEVDAVYVKPF  255

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTN LLTA + AGK+ + +SPFMD+ +A DN TATAT+ Y GT   + T
Sbjct  256   KTDTVLIAPGQTTNVLLTAVKPAGKFLVTVSPFMDSPIAVDNVTATATVHYSGTLSSSPT  315

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
              LT+ P QN+T +   FT SLRSLNS  YPA VP  +DH L F +G+G+NPCP C  ++G
Sbjct  316   VLTLPPPQNSTAMADAFTSSLRSLNSVKYPALVPKKIDHHLFFTVGLGINPCPTCKPANG  375

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+F MPTT LLQAHY+N++GVF
Sbjct  376   SRVVASINNVTFSMPTTALLQAHYFNVNGVF  406



>ref|XP_003558760.1| PREDICTED: laccase-22 [Brachypodium distachyon]
Length=561

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/388 (68%), Positives = 314/388 (81%), Gaps = 5/388 (1%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             +SV ++ RHYKF V M+  SRLC++K I+ VNGKFPGP LYAREGD V+V+V NHV  NV
Sbjct  22    LSVHAITRHYKFNVVMRKMSRLCSTKTILTVNGKFPGPTLYAREGDNVLVKVVNHVPHNV  81

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             +IHWHGV+Q RTGW DGPAYITQCPIQPG S+LYNFT+TGQRGTLLWH+HINW RATVHG
Sbjct  82    TIHWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTITGQRGTLLWHAHINWLRATVHG  141

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVILPKLGVPYPFP P KE ++VLGEWW +++E +IN AMQLG+ PN+SD+HTING PG
Sbjct  142   AIVILPKLGVPYPFPAPHKEAVVVLGEWWKADIETIINRAMQLGVGPNISDSHTINGHPG  201

Query  690   PTPTCSS--KGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             P   C+S   G+ L VESGKTY+LR++NAALN++LFFKIAGH+L VVEVDA Y KP++TD
Sbjct  202   PMSDCASSQDGFKLNVESGKTYMLRIINAALNDDLFFKIAGHKLTVVEVDAVYTKPYKTD  261

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
              + + PGQTTN LL ADQ AG+Y ++ISPFMD  V  DN T TA L Y  T + A+  LT
Sbjct  262   ILLITPGQTTNVLLAADQSAGRYLLSISPFMDAPVQVDNTTGTAILHYTNT-VSAAARLT  320

Query  1044  IM--PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             +   P QNAT + + F DSLRSLNS+ YPANVP +VDHSL F IGVGVNPCP C +G+RV
Sbjct  321   LFKPPPQNATLIASKFADSLRSLNSKEYPANVPRTVDHSLFFTIGVGVNPCPNCINGTRV  380

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             V  INN++FVMP+TP+LQA+YYNI GVF
Sbjct  381   VGTINNLTFVMPSTPILQAYYYNIPGVF  408



>ref|XP_007205010.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
 gb|EMJ06209.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
Length=559

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/391 (69%), Positives = 317/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VES IRHYKF V +KNT+RLC++KPIV +NG+FPGP LYARE DTV+V+V NHV
Sbjct  14    CLLPGLVESRIRHYKFNVVLKNTTRLCSTKPIVTINGRFPGPTLYAREDDTVLVKVTNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q +TGW+DGPAYITQCPI PGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  74    KYNVSIHWHGVRQLQTGWADGPAYITQCPIPPGQSYVYNFTITGQRGTLLWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPK GVPYPFP P KE  ++L EWW S+ E VIN A+  G+ PNVSDAHTIN
Sbjct  134   TVHGALVILPKRGVPYPFPAPHKEVNVILAEWWKSDTEAVINQALSSGVAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG    CSS+ G+ L VE GKTYLLR++NAALNEELFFKIAGH+L +VEVDATYVKPF
Sbjct  194   GHPGSVANCSSQGGFTLPVEKGKTYLLRIINAALNEELFFKIAGHKLTIVEVDATYVKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTNAL+TA+Q +GKY +A SPFMD+ +A DN TATATL Y GT     T
Sbjct  254   KTDTIVIAPGQTTNALITANQNSGKYLVAASPFMDSPIAVDNLTATATLHYSGTLATTPT  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P QNAT V   F +SL+SLNS+ +PA VPL +DH+L+F +G+G+NPCP C +  G
Sbjct  314   TLTNPPPQNATQVANNFINSLKSLNSKKFPAKVPLKIDHNLLFTVGLGINPCPTCKAGNG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMPTT LLQAH +NISGVF
Sbjct  374   SRVVASVNNVTFVMPTTALLQAHVFNISGVF  404



>ref|XP_008388134.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/391 (69%), Positives = 317/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VES +RHYKF V ++N ++LC+SKPIV VNGKFPGP LYARE DTV+V+V NHV
Sbjct  14    CVLPALVESRVRHYKFNVVLRNKTKLCSSKPIVTVNGKFPGPTLYAREDDTVLVKVTNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPI  GQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  74    KYNVSIHWHGIRQLRTGWADGPAYITQCPIPTGQSYVYNFTITGQRGTLLWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPK GVPYPFP P KE  +VLGEWW S+ E VIN A++ GI PNVSDAHTIN
Sbjct  134   TVHGALVILPKRGVPYPFPAPHKEVNVVLGEWWKSDTETVINQALKSGIAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG  P CSS+ G+ L VESGKTYLLR++NAALNEELFFKIAGH L +VEVDATYVKPF
Sbjct  194   GHPGVVPNCSSQGGFTLPVESGKTYLLRIINAALNEELFFKIAGHNLTIVEVDATYVKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTNAL+TA+Q +GKY +A SPFMD+ +A DN TATATL Y GT     T
Sbjct  254   KTDTIVIAPGQTTNALVTANQNSGKYMVAASPFMDSPIAVDNLTATATLHYTGTLASTPT  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P QNAT V  +F +SL++LNS  +PA VPL +DH+L+F +G+G+NPCP+C +  G
Sbjct  314   TLTSPPPQNATQVANSFINSLKALNSNNFPAKVPLKIDHNLLFTVGLGINPCPSCKAGNG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVV  +NNVSFVMPTT LLQAH +N SGVF
Sbjct  374   SRVVGSVNNVSFVMPTTALLQAHVFNKSGVF  404



>gb|KHN20872.1| Laccase-4 [Glycine soja]
Length=562

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/396 (66%), Positives = 320/396 (81%), Gaps = 9/396 (2%)
 Frame = +3

Query  141   TFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             +F   V+S++RHYKF+V +KNT++LC++K  V VNG+ PGP LYARE DTV+V+V NHV+
Sbjct  14    SFSPFVQSLVRHYKFSVVLKNTTKLCSTKSFVTVNGQCPGPTLYAREDDTVIVKVTNHVK  73

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              N++IHWHG+KQ RTGWSDGPAY+TQCPIQPGQSY+YNFT+ GQRGTLLWH+HI W RAT
Sbjct  74    YNITIHWHGIKQLRTGWSDGPAYVTQCPIQPGQSYVYNFTINGQRGTLLWHAHITWLRAT  133

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLG--------EWWNSNVEDVINHAMQLGIPPNV  656
             V+G IVILPK G+ YPFPKPDKE+II+LG        EWW S+VE ++N A   G+PPN+
Sbjct  134   VYGGIVILPKRGISYPFPKPDKEKIIILGKIYVRIKCEWWKSDVEAILNQAENSGLPPNI  193

Query  657   SDAHTINGLPGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDA  836
             SDAHTING  GP P C+S+GY L VESGKTYLLR++NAALN+ELFFKIAGH+L VVE DA
Sbjct  194   SDAHTINGHTGPIPGCTSQGYTLHVESGKTYLLRIINAALNDELFFKIAGHKLTVVEADA  253

Query  837   TYVKPFETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGT  1016
             +YVKPFETDTIF+ PGQTTN LLTA+Q  GKY IA++PFMD  +  DN T+ ATL YKGT
Sbjct  254   SYVKPFETDTIFMSPGQTTNVLLTANQVVGKYLIAVTPFMDAPIGFDNVTSIATLRYKGT  313

Query  1017  HLLASTALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPA  1196
                  T LT +P  NATP+T+ F DSLRSLNS+ YPA  PL+VDHSL F+I VG+NPC  
Sbjct  314   PPYPKTTLTTIPALNATPLTSDFIDSLRSLNSKEYPAIAPLTVDHSLFFSITVGLNPCHT  373

Query  1197  CSSGSRVVADINNVSFVMP-TTPLLQAHYYNISGVF  1301
             C +G+R+V+ INN++F+MP TT LL+AHYYNI GVF
Sbjct  374   CLTGARLVSAINNITFLMPTTTSLLEAHYYNIKGVF  409



>ref|XP_007141799.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
 gb|ESW13793.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
Length=553

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/387 (68%), Positives = 319/387 (82%), Gaps = 0/387 (0%)
 Frame = +3

Query  141   TFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             +F   V S++RHYKF+V  KN++RLC++K  V VNG+ PGP LYARE DTV+VRV NHV+
Sbjct  14    SFSPFVHSLVRHYKFSVISKNSTRLCSTKSFVTVNGQCPGPTLYAREDDTVLVRVTNHVK  73

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              N++IHWHG+KQ R+GWSDGPAY+TQCPIQPGQS++YNFT TGQRGTLLWH+HI W RAT
Sbjct  74    YNITIHWHGIKQLRSGWSDGPAYVTQCPIQPGQSFVYNFTTTGQRGTLLWHAHITWLRAT  133

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             V+GAIVILPK G+ YPFP PDKE+ I+LGEWW S+VE V+N A   G+PPN+SDAHTING
Sbjct  134   VYGAIVILPKRGISYPFPTPDKEKTIILGEWWKSDVEAVLNEAESSGLPPNISDAHTING  193

Query  681   LPGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
               GP P C+S+GY L VESGKTYLLR++NAALN+ELFFKIAGH+L VVE DA+YVKPFET
Sbjct  194   HTGPVPGCTSRGYTLHVESGKTYLLRIINAALNDELFFKIAGHKLTVVEADASYVKPFET  253

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DTIF+ PGQTTN LL+ADQ  GKY IA++PFMD  +  DN T+ ATL YK T    +T L
Sbjct  254   DTIFMSPGQTTNVLLSADQGVGKYLIAVTPFMDAPIGFDNVTSIATLRYKTTPPYPTTTL  313

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T +P  NATP+T+ F DSLRSLNS+ YPA VPL+VDHSL FAI VG+NPC AC +GS++V
Sbjct  314   TTIPALNATPLTSHFIDSLRSLNSKEYPARVPLTVDHSLFFAITVGLNPCDACPTGSKLV  373

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             + +NN++FVMPTT LL+AHYYN+ GVF
Sbjct  374   SALNNITFVMPTTSLLEAHYYNVKGVF  400



>ref|XP_006602642.1| PREDICTED: laccase-4-like isoform X2 [Glycine max]
Length=533

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/394 (70%), Positives = 319/394 (81%), Gaps = 6/394 (2%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +RHYKF V +KNT+RLC+SKPIV VNGKFPGP LYARE DTV+V+V N V
Sbjct  13    CIVPALVECKVRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTLYAREDDTVLVKVNNLV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
               NV+IHWHGV+Q RTGW+DGPAYITQCPI  GQSYLYNFTLTGQRGTLLWH+H+NW R+
Sbjct  73    NHNVTIHWHGVRQLRTGWADGPAYITQCPILSGQSYLYNFTLTGQRGTLLWHAHVNWLRS  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGAIVILPK GVPYPFPKPDKE +++LGEWW S+ EDVIN A++ G+ PNVSDAHTIN
Sbjct  133   TLHGAIVILPKRGVPYPFPKPDKELVVILGEWWKSDTEDVINEALKSGLAPNVSDAHTIN  192

Query  678   GLPG--PTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVK  848
             GLPG      CS++  Y L VESGKTYLLR++NAALNEELFFKIAGH   VVEVDA+YVK
Sbjct  193   GLPGIVSVANCSTQDVYKLPVESGKTYLLRIINAALNEELFFKIAGHPFTVVEVDASYVK  252

Query  849   PFETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLL  1025
             PF+TDT+ + PGQTTNALLTADQ +GKY I  S FMD+ +VA DN TATATL Y GT   
Sbjct  253   PFKTDTLSIAPGQTTNALLTADQNSGKYTIVASTFMDSPVVAVDNLTATATLHYTGTLAT  312

Query  1026  ASTALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS  1205
               T LT  P +NAT V   FT+SL+SLNS+ YPA VP  VDHSL+  +G+G+NPCP+C++
Sbjct  313   TPTLLTTPPPRNATQVANNFTNSLKSLNSKKYPAKVPQKVDHSLLLTVGLGINPCPSCTA  372

Query  1206  --GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
               GSRVVA +NNV+FVMPTT LLQAHY+NI GVF
Sbjct  373   GNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGVF  406



>ref|XP_006411009.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
 gb|ESQ52462.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
Length=557

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/383 (69%), Positives = 310/383 (81%), Gaps = 2/383 (1%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             ESM+RHYKF V MKNT+RLC+SKPIV VNG++PGP +YARE DT++++V NHV+ N+SIH
Sbjct  22    ESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVKYNISIH  81

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHGV+Q RTGW+DGPAYITQCPIQPGQ Y YN+TLTGQRGTL WH+HI W RATV+GAIV
Sbjct  82    WHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATVYGAIV  141

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             ILPK GVPYPFPKPD E++IVLGEWW S+ E+VIN A++ G+ PNVSDAH ING PGP  
Sbjct  142   ILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENVINEAIKSGLAPNVSDAHMINGHPGPVK  201

Query  699   TCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVG  878
              C S+GY L VE+GKTYLLR+VNAALNEELFFK+AGH   VVEVDA YVKPF+ DT+ + 
Sbjct  202   NCPSQGYKLSVENGKTYLLRLVNAALNEELFFKVAGHIFTVVEVDAVYVKPFKIDTVLIA  261

Query  879   PGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQ  1058
             PGQTTN LLTA + AGKY +  SPFMD  VA DN TATAT+ Y GT   + T LT+ P Q
Sbjct  262   PGQTTNVLLTASKSAGKYLVTASPFMDAPVAVDNVTATATVHYSGTLSSSPTTLTLPPPQ  321

Query  1059  NATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSRVVADIN  1232
             NAT V   FT+SLRSLNS+ YPA VP ++DH L F +G+G+N CP C +  GSRVVA IN
Sbjct  322   NATSVANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNSCPTCKAGNGSRVVASIN  381

Query  1233  NVSFVMPTTPLLQAHYYNISGVF  1301
             NV+F+MP T LL AHY+NISGVF
Sbjct  382   NVTFIMPKTALLPAHYFNISGVF  404



>ref|XP_004163861.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=559

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/391 (66%), Positives = 315/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C      ES +RHYKF V ++  +RLC+SKPIV VNG+FPGP +YAREGD V+++V NHV
Sbjct  16    CLLSGLAESTVRHYKFNVVLRKATRLCSSKPIVTVNGQFPGPTVYAREGDNVLIKVVNHV  75

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTL WH+HI W RA
Sbjct  76    KYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYVYNFTITGQRGTLFWHAHILWLRA  135

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHG +VILPKLGVPYPFP P+KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  136   TVHGGLVILPKLGVPYPFPTPNKETVLVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  195

Query  678   GLPGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             GLPG    C S +G+ L V+ GKTYLLR++NAALNEELFFK+AGH+L VVEVDATYVKPF
Sbjct  196   GLPGSISNCPSQRGFTLPVQKGKTYLLRIINAALNEELFFKVAGHKLTVVEVDATYVKPF  255

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTN LLTA+Q +GKY +A+SPFMD  VA DN+TATAT+ Y GT   + T
Sbjct  256   KTDTVLIAPGQTTNVLLTANQNSGKYMVAVSPFMDAPVAVDNKTATATVHYTGTLATSLT  315

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
               T  P QNAT +   FT+SLRSLNS+ YPANVPL++DH L F +G+G+NPCP C  ++G
Sbjct  316   TSTNPPPQNATQIANAFTNSLRSLNSKKYPANVPLTIDHHLFFTVGLGINPCPTCKAANG  375

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQ H++   GVF
Sbjct  376   SRVVASINNVTFVMPTTALLQGHFFKTKGVF  406



>ref|XP_011019151.1| PREDICTED: laccase-4 isoform X2 [Populus euphratica]
Length=558

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/391 (67%), Positives = 317/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  V+  +RHYKF V MKNT+RLC+ KPIV VNG+FPGP LYARE DTV+V+V NHV
Sbjct  15    CLFPALVQCRVRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLYAREDDTVLVKVVNHV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTLLWH+HI W R+
Sbjct  75    KYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLLWHAHILWLRS  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIV+LPK G+PYPFP P KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  135   TVHGAIVVLPKRGIPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  194

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG    CSS+ G+ L V SG+TY+LR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  195   GHPGAVSACSSQGGFTLPVRSGETYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTN L+T ++  G Y +A SPFMD+ +A DN TATATL Y G    + T
Sbjct  255   KTDTVLIAPGQTTNVLVTTNKNTGNYLVAASPFMDSPIAVDNMTATATLQYSGALANSPT  314

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P +NAT V   F +SLRSLNSR +PA VP++VDH+L F +G+GVNPCP+C +  G
Sbjct  315   TLTTPPPKNATAVANQFINSLRSLNSRKFPAKVPMNVDHNLFFTVGLGVNPCPSCKAGNG  374

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH++NISGVF
Sbjct  375   SRVVASINNVTFVMPTTALLQAHFFNISGVF  405



>ref|XP_011019150.1| PREDICTED: laccase-4 isoform X1 [Populus euphratica]
Length=559

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/391 (68%), Positives = 316/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  IRHYKF V MKNT+RLC+ KPIV VNG+FPGP LYARE DTV+V+V NHV
Sbjct  16    CLLPALVECRIRHYKFNVVMKNTTRLCSRKPIVTVNGRFPGPTLYAREDDTVLVKVVNHV  75

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTLLWH+HI W R+
Sbjct  76    KYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLLWHAHILWLRS  135

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIV+LPK G+PYPFP P KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  136   TVHGAIVVLPKRGIPYPFPAPHKEVVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTIN  195

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG    CSS+ G+ L V SG+TY+LR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  196   GHPGAVSACSSQGGFTLPVRSGETYMLRLINAALNEELFFKIAGHKLTVVEVDATYVKPF  255

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTN L+T ++  G Y +A SPFMD+ +A DN TATATL Y G    + T
Sbjct  256   KTDTVLIAPGQTTNVLVTTNKNTGNYLVAASPFMDSPIAVDNMTATATLQYSGALANSPT  315

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT  P +NAT V   F +SLRSLNSR +PA VP++VDH+L F +G+GVNPCP+C +  G
Sbjct  316   TLTTPPPKNATAVANQFINSLRSLNSRKFPAKVPMNVDHNLFFTVGLGVNPCPSCKAGNG  375

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH++NISGVF
Sbjct  376   SRVVASINNVTFVMPTTALLQAHFFNISGVF  406



>ref|XP_002879726.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55985.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/388 (67%), Positives = 311/388 (80%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP   ES+IRHYKF V MKNT+RLC+SKPIV VNG++PGP +YARE DT++++V NHV+ 
Sbjct  17    FPAPSESIIRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVKY  76

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             N+SIHWHGV+Q RTGW+DGPAYITQCPIQPGQ Y YN+TLTGQRGTL WH+HI W RATV
Sbjct  77    NLSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATV  136

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             +GA+VILPK GVPYPFPKPD E++IVLGEWW S+ E++IN A++ G+ PNVSDAH ING 
Sbjct  137   YGALVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENIINEALKSGLAPNVSDAHMINGH  196

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGP   C S+GY L VE+GKTYLLR+VNAALNEELFFK+AGH   VVEVDA YVKPF+TD
Sbjct  197   PGPVKNCPSQGYKLSVENGKTYLLRLVNAALNEELFFKVAGHIFTVVEVDAVYVKPFKTD  256

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             T+ + PGQTTN LLTA + AGKY +  SPFMD  +A DN TATAT+ Y GT   + T LT
Sbjct  257   TVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTILT  316

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSRV  1217
             + P QNAT +   FT SLRSLNS+ YPA VP ++DH L F +G+G+N CP C +  GSRV
Sbjct  317   LPPPQNATSIANNFTKSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNACPTCKAGNGSRV  376

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VA INNV+F+MP T LL AHY+N SGVF
Sbjct  377   VASINNVTFIMPKTALLPAHYFNTSGVF  404



>ref|XP_002322962.2| laccase family protein [Populus trichocarpa]
 gb|EEF04723.2| laccase family protein [Populus trichocarpa]
Length=564

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/389 (69%), Positives = 316/389 (81%), Gaps = 3/389 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  VE  +RHYKF V MKNT+RLC+SKP+V VNG+FPGP LYARE DTV+V+V NHV+ 
Sbjct  23    FPALVECRVRHYKFNVVMKNTTRLCSSKPVVTVNGRFPGPTLYAREDDTVLVKVVNHVKY  82

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPIQ GQSY+YNFT+TGQRGTLLWH+HI W RATV
Sbjct  83    NVSIHWHGIRQLRTGWADGPAYITQCPIQTGQSYVYNFTITGQRGTLLWHAHILWLRATV  142

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIV+LPK GVPYPFP P KE ++VL EWW S+ E VIN A++ G+ PNVSDAHTING 
Sbjct  143   HGAIVVLPKRGVPYPFPAPHKEFVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGH  202

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG    C S+ G+ L VESGKTY+LR++NAALNEELFFKIAGH+L +VEVDATYVKPF+T
Sbjct  203   PGAVSACPSQGGFTLPVESGKTYMLRLINAALNEELFFKIAGHKLTLVEVDATYVKPFKT  262

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DT+ + PGQTTN L+T ++  GKY +A SPFMD  +A DN TATATL Y G      T L
Sbjct  263   DTVLIAPGQTTNVLVTTNKNTGKYLVAASPFMDAPIAVDNMTATATLHYSGALSGTPTTL  322

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSR  1214
             TI P +NAT V   FT+SLRSLNS+ +PA VPL+VDH+L F +G+G+NPCP C +  GSR
Sbjct  323   TIPPPKNATAVANQFTNSLRSLNSKRFPAKVPLTVDHNLFFTVGLGINPCPTCKAGNGSR  382

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA INNV+FVMPTT LLQAH++NISGVF
Sbjct  383   VVASINNVTFVMPTTALLQAHFFNISGVF  411



>ref|XP_004490574.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=570

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/389 (67%), Positives = 315/389 (81%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P+SVE+++RHYKF V MKN +RLC++KPIV +NG FPGP +YARE DT++V+V NHV
Sbjct  29    CLLPLSVEAIVRHYKFNVVMKNATRLCSTKPIVTINGNFPGPTIYAREDDTILVKVVNHV  88

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG+KQ R+GW+DGPAYITQCPIQPGQ Y+YNFTLTGQRGTL WH+HI W RA
Sbjct  89    KYNVSIHWHGIKQLRSGWADGPAYITQCPIQPGQVYVYNFTLTGQRGTLWWHAHILWLRA  148

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPKLGVPYPFP+P  E++++L EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  149   TVHGAIVILPKLGVPYPFPRPHMEQVVILSEWWKSDTEVVINEALKSGLAPNVSDAHTIN  208

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGPT  C+S+ G+ L+VE+GKTYLLR++NAALNE+LFFKIAGH+L VVEVDA+Y KPF
Sbjct  209   GHPGPTQHCASQEGFKLQVEAGKTYLLRIINAALNEDLFFKIAGHKLIVVEVDASYTKPF  268

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN L+ A+  AGKY +A S FMD  +A DN TATATL Y G+     T
Sbjct  269   KTDTILIAPGQTTNVLVKANHLAGKYMVAASTFMDAPIAIDNVTATATLHYTGSLGSTIT  328

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT +P +NAT +   FT+SL+SLNS  YPA VP  VDHSL+F I +GVNPC  C +G R
Sbjct  329   TLTSLPPRNATFLANNFTNSLKSLNSPKYPARVPKKVDHSLLFTISLGVNPCATCVNGGR  388

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA INNV+FVMP   LLQAH++NISGVF
Sbjct  389   VVAAINNVTFVMPKISLLQAHFFNISGVF  417



>ref|XP_003522150.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN02155.1| Laccase-4 [Glycine soja]
Length=557

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/391 (68%), Positives = 314/391 (80%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +RHYKF V  K T+RLC+SK IV +NGKFPGP LYARE DTV+V+V N V
Sbjct  14    CILPALVECRVRHYKFHVVSKQTNRLCSSKSIVTINGKFPGPTLYAREDDTVLVKVINQV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
               NV+IHWHGV+Q RTGW+DGPAY+TQCPIQPGQ+YLYNFTLTGQRGTLL+H+H+NW R+
Sbjct  74    NHNVTIHWHGVRQLRTGWADGPAYVTQCPIQPGQTYLYNFTLTGQRGTLLYHAHVNWLRS  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGA+VILPK GVPYPFPKPD E ++VLGEWW S+ E +IN A++ G+ PNVSDAHTIN
Sbjct  134   TLHGALVILPKRGVPYPFPKPDDELVVVLGEWWKSDTEAIINEALKSGLAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             GLPG    CS++  YNL VESGKTYLLR++NAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  194   GLPGAVTNCSTQDVYNLPVESGKTYLLRIINAALNEELFFKIAGHKLTVVEVDATYVKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             + +TI + PGQTTN LL ADQK GKY +A SPFMD  +A DN TATATL Y GT     T
Sbjct  254   KIETILIAPGQTTNVLLNADQKFGKYLVAASPFMDAPIAVDNLTATATLHYTGTLAATPT  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
              LT  P +N+T +   F  SLR LNS+ YP NVPL+VDHSL F +G+G++PCP+C  ++G
Sbjct  314   ILTTPPPKNSTQIANNFISSLRGLNSKKYPVNVPLTVDHSLFFTVGLGISPCPSCKAANG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+F+MPT  LLQAHY+NI GVF
Sbjct  374   SRVVAAINNVTFIMPTIALLQAHYFNIKGVF  404



>ref|XP_002533894.1| laccase, putative [Ricinus communis]
 gb|EEF28494.1| laccase, putative [Ricinus communis]
Length=556

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/391 (68%), Positives = 314/391 (80%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  PV V+  +R Y F V  K +++LC+SKPIV VNGKFPGP LYARE DTV+VRV N V
Sbjct  13    CFLPVFVDCRVRRYNFNVVTKTSTKLCSSKPIVTVNGKFPGPTLYAREDDTVLVRVVNKV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ+Y+YNFTLTGQRGTLLWH+HI W R+
Sbjct  73    KYNVSIHWHGVRQLRTGWADGPAYITQCPIQPGQNYVYNFTLTGQRGTLLWHAHILWLRS  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFPKP KEE+++L EWW S+ E VIN AM+ G+ PNVSDAHTIN
Sbjct  133   TVHGAIVILPKRGVPYPFPKPHKEEVVILAEWWKSDTEAVINEAMKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG  P C S+ G+ L VESGK YLLR++NAALNEELFFKIAGH+L VVE+DA YVKP 
Sbjct  193   GHPGAVPNCPSQSGFRLPVESGKAYLLRLINAALNEELFFKIAGHQLTVVEIDACYVKPL  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTN L+TA++ +GKY +  SPFMD  VA DN+TATATL Y GT   A T
Sbjct  253   KTDTVLLAPGQTTNVLVTANKNSGKYLVTASPFMDAPVAVDNRTATATLHYSGTLASAPT  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
              +   P QNA+ V   F +SLRSLNS+ YPA VPL VDH+L+F +G+G+N CP+C  ++G
Sbjct  313   TVATPPPQNASAVANNFINSLRSLNSQKYPARVPLKVDHNLLFTVGLGINACPSCKAANG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPTT LLQAH++ ISGVF
Sbjct  373   SRVVASINNVTFVMPTTALLQAHFFKISGVF  403



>ref|XP_008377498.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/391 (67%), Positives = 323/391 (83%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VES +RHYKF V ++N+++LC+SKPIV VNG+FPGP LYARE DTV+V+V NHV
Sbjct  14    CILPALVESRVRHYKFNVVLRNSTKLCSSKPIVTVNGQFPGPTLYAREDDTVLVKVTNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPI+PGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  74    KYNVSIHWHGIRQLRTGWADGPAYITQCPIRPGQSYVYNFTITGQRGTLLWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+++LPK GVPYPFP P KE  +VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  134   TVHGALIVLPKRGVPYPFPAPHKEVPVVLAEWWKSDTEAVINQALKSGLAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP P CSS+ G+ L VE+GKTYLLR++NAALNEELFFKIAGH L +VEVDATYVKPF
Sbjct  194   GHPGPVPNCSSQGGFTLPVENGKTYLLRIINAALNEELFFKIAGHILTIVEVDATYVKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTNAL+TA+Q +GKY ++ SPFMD+ +A DN TATATL Y GT     T
Sbjct  254   KTDTIVIAPGQTTNALVTANQNSGKYMLSASPFMDSPIAVDNLTATATLHYTGTLATTPT  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
              LT  P QNAT V  +F +SL++LNS+ +PA VPL +DH+L+F +G+G+N CP+C  ++G
Sbjct  314   TLTSPPPQNATQVANSFINSLKALNSKKFPAKVPLKIDHNLLFTVGLGINSCPSCKAANG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMPTT LLQAH++N SGVF
Sbjct  374   SRVVASVNNVTFVMPTTALLQAHFFNKSGVF  404



>ref|XP_010037723.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW49475.1| hypothetical protein EUGRSUZ_K02996 [Eucalyptus grandis]
Length=562

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/389 (69%), Positives = 312/389 (80%), Gaps = 4/389 (1%)
 Frame = +3

Query  147   PVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQEN  326
             P  VE  +RHYKF V MKN +RLC++KPIV VNGK PGP LYAREGD V+V+VANHV+ N
Sbjct  19    PAMVECRVRHYKFNVVMKNMTRLCSTKPIVTVNGKLPGPTLYAREGDNVLVKVANHVKYN  78

Query  327   VSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVH  506
             V+IHWHGV+Q RTGW+DGPAYITQCPIQ GQ+++YNFT+TGQRGTLLWH+HI W R T+H
Sbjct  79    VTIHWHGVRQLRTGWADGPAYITQCPIQTGQNFIYNFTITGQRGTLLWHAHILWLRVTLH  138

Query  507   GAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLP  686
             GAIVILPK GVPYPFPKP KE +I+L EWW S+ E VIN AM  G+ PNVSDAHTING P
Sbjct  139   GAIVILPKRGVPYPFPKPSKEYVIILAEWWKSDTETVINQAMSQGLAPNVSDAHTINGHP  198

Query  687   GPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             GP P C S + Y L VESGKTYLLR+VNAALNEELFFKIA H L VVEVDATYVKPF+TD
Sbjct  199   GPVPGCPSERSYTLPVESGKTYLLRIVNAALNEELFFKIAQHNLTVVEVDATYVKPFQTD  258

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTAL  1040
             TI + PGQTTN LLT +Q AGKY I  S FM+T IVA DN TA+A + Y GT   AST L
Sbjct  259   TILITPGQTTNVLLTTNQNAGKYLITASTFMETAIVAIDNVTASAAVHYSGTLASASTVL  318

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSR  1214
             T  P QNA+ V  +F ++LRSLNS+ YPA VP +VDH+L F +G+GVNPCP C++  GSR
Sbjct  319   TKPPPQNASAVANSFNNALRSLNSKKYPAKVPKTVDHNLFFTMGLGVNPCPTCTAGNGSR  378

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA +NN+SFVMPT  LLQAH +NISGVF
Sbjct  379   VVAAVNNISFVMPTIALLQAHVFNISGVF  407



>ref|XP_004294236.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/390 (67%), Positives = 313/390 (80%), Gaps = 2/390 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP   E + RHYKF V +K TSRLC+SKPIV +NGK+PGP +YARE DTV+V+V NHV
Sbjct  18    CLFPAPAECLERHYKFNVVLKKTSRLCSSKPIVTINGKYPGPTIYAREDDTVLVKVVNHV  77

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q R GW+DGPAYITQCPIQPGQ Y+YNFT+TGQRGTL WH+HI W RA
Sbjct  78    KYNVSIHWHGIRQLRNGWADGPAYITQCPIQPGQQYVYNFTVTGQRGTLWWHAHILWLRA  137

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TV+GA+V+LPKLGVPYPFP P KE +++LGEWW S+VE VIN A++ G  PNVSDAHTIN
Sbjct  138   TVYGALVVLPKLGVPYPFPAPKKEVVVILGEWWKSDVEAVINEALKSGAAPNVSDAHTIN  197

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CSS+ GY L V+ G TYLLR++NAALN+ELFFK+A H+L VVEVDA Y KPF
Sbjct  198   GHPGPLSLCSSQGGYKLPVQPGHTYLLRIINAALNDELFFKVANHKLTVVEVDAVYTKPF  257

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLAS  1031
             ET TI + PGQTTN LLTAD+  GKY +A SPFMD   VA DN+TATATL Y+G+    +
Sbjct  258   ETTTILIAPGQTTNVLLTADRSTGKYLVAASPFMDNPTVAVDNKTATATLHYRGSLASTN  317

Query  1032  TALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGS  1211
             T LT+ P QNAT + T+FT SLRSLNS  YPA VPL +DHSL+F + +G+  CP+C++G+
Sbjct  318   TILTVPPPQNATRLATSFTKSLRSLNSDTYPAKVPLKIDHSLMFTVSLGLQTCPSCANGN  377

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVAD+NNV+FVMP   LLQAH +NISGVF
Sbjct  378   RVVADLNNVTFVMPKISLLQAHVFNISGVF  407



>ref|XP_006663136.1| PREDICTED: laccase-22-like [Oryza brachyantha]
Length=566

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/389 (65%), Positives = 315/389 (81%), Gaps = 5/389 (1%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             +S  ++ RHYKF V M+N +RLC++KP++ VNGKFPGP LYAREGD V+V+V NHV  NV
Sbjct  25    LSAHAITRHYKFNVVMRNMTRLCSTKPVLTVNGKFPGPTLYAREGDNVLVKVVNHVANNV  84

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             +IHWHGV+Q RTGW DGPAYITQCPIQPG S+LYNFT+TGQRGTLLWH+HINW RAT+HG
Sbjct  85    TIHWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTITGQRGTLLWHAHINWLRATIHG  144

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVILPKLGVPYPFP P KE++IVLGEWW  + E+VIN AMQLG+ PN+SD+HTING PG
Sbjct  145   AIVILPKLGVPYPFPAPHKEDVIVLGEWWKEDTENVINQAMQLGVGPNISDSHTINGHPG  204

Query  690   PTPTCSS--KGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             P   C+S   G+ L+VE+GKTY+LR++NAALN++LFFK+AGH L VVEVDA Y KPF TD
Sbjct  205   PLSECASSQDGFKLKVENGKTYMLRIINAALNDDLFFKVAGHELTVVEVDAVYTKPFTTD  264

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGT---HLLAST  1034
             T+ + PGQTT+ LL A+Q AG+Y +++SPFMD+ +  DN+T TATL Y  T    + A  
Sbjct  265   TLLITPGQTTSVLLRANQSAGRYLLSVSPFMDSPLQVDNKTGTATLHYANTVSSSMAAPL  324

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              L  +P QNAT + + F D L SLNS+ YPANVP ++DHSL+  +GVGVNPCP+C +G+R
Sbjct  325   ILIKLPPQNATSIVSKFADRLHSLNSKEYPANVPQTIDHSLLLTVGVGVNPCPSCINGTR  384

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VV  INNV+F+MP+TP+LQA+YYNI GVF
Sbjct  385   VVGTINNVTFIMPSTPILQAYYYNIPGVF  413



>ref|XP_008220423.1| PREDICTED: laccase-4 [Prunus mume]
Length=558

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/388 (67%), Positives = 314/388 (81%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP SVE M+RHYKF V  K TSRLC+SKPIV VNG++PGP +YARE DTV+++V NHV+ 
Sbjct  18    FPASVECMVRHYKFNVVQKKTSRLCSSKPIVTVNGRYPGPTIYAREDDTVLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTL WH+HI W RATV
Sbjct  78    NVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTVTGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGA+VILPKLGVPYPFP P KE +++LGEWW S+VE VIN A++ G  PNVSDAHTING 
Sbjct  138   HGALVILPKLGVPYPFPAPQKEVVVILGEWWKSDVESVINQALKSGSAPNVSDAHTINGH  197

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP  TCSS+ G+ L V  GKTY+LR++NAALNEELFFKIA H+L VVEVDA Y KPF+T
Sbjct  198   PGPLSTCSSQGGFKLPVRPGKTYMLRIINAALNEELFFKIANHKLTVVEVDAVYTKPFKT  257

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DT+ + PGQTTN LL+ +   GKY +A SPFMD   +  DN+TATATL Y GT     T 
Sbjct  258   DTVLIAPGQTTNVLLSTNHGTGKYLVAASPFMDNPTILVDNKTATATLHYMGTLESTRTT  317

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             LT  P QNAT V T FT+SLRSLNS  +PA VPL +DHSL+F +G+G++ C +C++G+R+
Sbjct  318   LTAPPPQNATLVATKFTNSLRSLNSVKFPARVPLKIDHSLLFTVGLGLHTCASCANGNRL  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VADINNV+FVMP   LLQAH++NISGVF
Sbjct  378   VADINNVTFVMPKISLLQAHFFNISGVF  405



>ref|XP_006602641.1| PREDICTED: laccase-4-like isoform X1 [Glycine max]
Length=560

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/394 (70%), Positives = 319/394 (81%), Gaps = 6/394 (2%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +RHYKF V +KNT+RLC+SKPIV VNGKFPGP LYARE DTV+V+V N V
Sbjct  13    CIVPALVECKVRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTLYAREDDTVLVKVNNLV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
               NV+IHWHGV+Q RTGW+DGPAYITQCPI  GQSYLYNFTLTGQRGTLLWH+H+NW R+
Sbjct  73    NHNVTIHWHGVRQLRTGWADGPAYITQCPILSGQSYLYNFTLTGQRGTLLWHAHVNWLRS  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGAIVILPK GVPYPFPKPDKE +++LGEWW S+ EDVIN A++ G+ PNVSDAHTIN
Sbjct  133   TLHGAIVILPKRGVPYPFPKPDKELVVILGEWWKSDTEDVINEALKSGLAPNVSDAHTIN  192

Query  678   GLPG--PTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVK  848
             GLPG      CS++  Y L VESGKTYLLR++NAALNEELFFKIAGH   VVEVDA+YVK
Sbjct  193   GLPGIVSVANCSTQDVYKLPVESGKTYLLRIINAALNEELFFKIAGHPFTVVEVDASYVK  252

Query  849   PFETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLL  1025
             PF+TDT+ + PGQTTNALLTADQ +GKY I  S FMD+ +VA DN TATATL Y GT   
Sbjct  253   PFKTDTLSIAPGQTTNALLTADQNSGKYTIVASTFMDSPVVAVDNLTATATLHYTGTLAT  312

Query  1026  ASTALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS  1205
               T LT  P +NAT V   FT+SL+SLNS+ YPA VP  VDHSL+  +G+G+NPCP+C++
Sbjct  313   TPTLLTTPPPRNATQVANNFTNSLKSLNSKKYPAKVPQKVDHSLLLTVGLGINPCPSCTA  372

Query  1206  --GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
               GSRVVA +NNV+FVMPTT LLQAHY+NI GVF
Sbjct  373   GNGSRVVAAVNNVTFVMPTTALLQAHYFNIKGVF  406



>ref|XP_003516941.1| PREDICTED: laccase-4-like [Glycine max]
Length=557

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/391 (68%), Positives = 315/391 (81%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE   RHYKF V  K T+RLC+SK IV +NGKFPGP LYARE DTV+V+V N V
Sbjct  14    CILPALVECRERHYKFHVVSKQTNRLCSSKSIVTINGKFPGPTLYAREDDTVLVKVINQV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
               NV+IHWHGV+Q RTGW+DGPAY+TQCPIQPGQ+Y+YNFTLTGQRGTLL+H+H+NW R+
Sbjct  74    NHNVTIHWHGVRQLRTGWADGPAYVTQCPIQPGQTYVYNFTLTGQRGTLLYHAHVNWLRS  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T++GA+VILPK GVPYPFPKPD E ++VLGEWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  134   TLYGALVILPKRGVPYPFPKPDDELVVVLGEWWKSDTEAVINEALKSGLAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             GLPG    CS++  YNL VESGKTYLLR+VNAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  194   GLPGTVTNCSTQDVYNLPVESGKTYLLRIVNAALNEELFFKIAGHKLTVVEVDATYVKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             + +TI + PGQTTN LL A+QK+GKY +A SPFMD  VA DN TATATL Y GT     T
Sbjct  254   KIETIVIAPGQTTNVLLNANQKSGKYLVAASPFMDAPVAVDNLTATATLHYTGTLAATPT  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
              LT  P +NAT +   F  SLR LNS+ YP NVPL+VDHSL+F +G+G+NPCP+C  ++G
Sbjct  314   ILTTPPPKNATQIANNFISSLRGLNSKKYPVNVPLTVDHSLIFTVGLGINPCPSCKAANG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+F+MPT  LLQAHY+NI GVF
Sbjct  374   SRVVAAINNVTFIMPTIALLQAHYFNIKGVF  404



>ref|XP_009384856.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=558

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/390 (67%), Positives = 314/390 (81%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
              P+  +   RHYKF V  KN +RLC+ K I+ VNG+FPGP LYAREGDTV+V+VANHVQE
Sbjct  16    LPLLTQGRTRHYKFNVVAKNFTRLCSPKSIITVNGRFPGPTLYAREGDTVIVKVANHVQE  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q  TGW+DGPAY+TQCPIQPGQ+Y YNFTLTGQRGTLLWH+HI WQRATV
Sbjct  76    NVTIHWHGVRQLTTGWADGPAYVTQCPIQPGQNYAYNFTLTGQRGTLLWHAHIMWQRATV  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFP P KE ++VL EWW S+VE VIN A+Q G+ PNVSDAHTING 
Sbjct  136   HGAIVILPKRGVPYPFPAPHKEVVLVLAEWWKSDVEAVINEALQSGLGPNVSDAHTINGH  195

Query  684   PGPTPTCSS---KGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
              GPT  C+S    G+ L V+  KTYLLR++NAALN++LFFK+AGH + VVEVDATY KPF
Sbjct  196   AGPTSGCASSARDGFTLRVDQRKTYLLRIINAALNDDLFFKVAGHLMTVVEVDATYTKPF  255

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLAS  1031
               DT+ + PGQTTN LLTADQ AG+Y +  SPFMD+ +VA DN T TAT+ Y      ++
Sbjct  256   TIDTLLIAPGQTTNVLLTADQGAGRYLVTASPFMDSPLVAVDNSTGTATVQYTDAVSTSA  315

Query  1032  TALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGS  1211
              A T +P +N+T + + F DSLRSLNS+ YPANVP +VDHSL+F +G+GVNPCPAC++GS
Sbjct  316   IATTKLPPRNSTSLASQFIDSLRSLNSKQYPANVPSTVDHSLLFTVGLGVNPCPACTNGS  375

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVA +NNV+F+MPTT LLQAHY+N+SGVF
Sbjct  376   RVVAAMNNVTFMMPTTALLQAHYFNMSGVF  405



>ref|NP_565881.1| laccase-4 [Arabidopsis thaliana]
 sp|O80434.2|LAC4_ARATH RecName: Full=Laccase-4; AltName: Full=Benzenediol:oxygen oxidoreductase 
4; AltName: Full=Diphenol oxidase 4; AltName: Full=Protein 
IRREGULAR XYLEM 12; AltName: Full=Urishiol oxidase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96573.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL36080.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL38363.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAC27158.2| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAM47955.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AEC09487.1| laccase-4 [Arabidopsis thaliana]
Length=558

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/388 (67%), Positives = 310/388 (80%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP   ESM+RHYKF V MKN +RLC+SKP V VNG++PGP +YARE DT++++V NHV+ 
Sbjct  18    FPAPSESMVRHYKFNVVMKNVTRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ Y YN+TLTGQRGTL WH+HI W RATV
Sbjct  78    NVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             +GA+VILPK GVPYPFPKPD E++IVLGEWW S+ E++IN A++ G+ PNVSD+H ING 
Sbjct  138   YGALVILPKRGVPYPFPKPDNEKVIVLGEWWKSDTENIINEALKSGLAPNVSDSHMINGH  197

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGP   C S+GY L VE+GKTYLLR+VNAALNEELFFK+AGH   VVEVDA YVKPF+TD
Sbjct  198   PGPVRNCPSQGYKLSVENGKTYLLRLVNAALNEELFFKVAGHIFTVVEVDAVYVKPFKTD  257

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             T+ + PGQTTN LLTA + AGKY +  SPFMD  +A DN TATAT+ Y GT   + T LT
Sbjct  258   TVLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTILT  317

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSRV  1217
             + P QNAT +   FT+SLRSLNS+ YPA VP ++DH L F +G+G+N CP C +  GSRV
Sbjct  318   LPPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNACPTCKAGNGSRV  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VA INNV+F+MP T LL AHY+N SGVF
Sbjct  378   VASINNVTFIMPKTALLPAHYFNTSGVF  405



>ref|XP_010509229.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/387 (67%), Positives = 309/387 (80%), Gaps = 2/387 (1%)
 Frame = +3

Query  147   PVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQEN  326
             P   ESM+RHYKF V MKNT+RLC+SKPIV VNG++PGP +YARE DT++++V NHV+ N
Sbjct  19    PAPSESMVRHYKFNVVMKNTTRLCSSKPIVTVNGRYPGPTIYAREDDTLLIKVVNHVKYN  78

Query  327   VSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVH  506
             VSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ Y YN+TLTGQRGTL WH+HI W RATV+
Sbjct  79    VSIHWHGVRQIRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATVN  138

Query  507   GAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLP  686
             GAIVILPK GVPYPFPK D E++IVLGEWW S+ ED+IN A++ G+ PNVSDAH ING P
Sbjct  139   GAIVILPKRGVPYPFPKADHEKVIVLGEWWKSDTEDIINEALKSGLAPNVSDAHMINGHP  198

Query  687   GPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDT  866
             GP   C S+GY L VE+GKTYLLR++NAALNEELFFK+AGH   VVEVDA YVKPF+ DT
Sbjct  199   GPVKNCPSQGYKLSVENGKTYLLRLINAALNEELFFKVAGHLFTVVEVDAVYVKPFKIDT  258

Query  867   IFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTI  1046
             + + PGQTTN LLTA + AGKY +  SPFMD  +A DN TATAT+ Y GT   + T  T+
Sbjct  259   VLIAPGQTTNVLLTASKSAGKYLVTASPFMDAPIAVDNVTATATVHYSGTLSSSPTVRTL  318

Query  1047  MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSRVV  1220
              P QNAT +   FT+SLRSLNS+ YPA VP ++DH L+F +G+G+N CP C +  GSRVV
Sbjct  319   PPPQNATSIANNFTNSLRSLNSKKYPALVPTTIDHHLLFTVGLGLNACPTCKAGNGSRVV  378

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             A INNV+FVMP T LL AHY+N SGVF
Sbjct  379   ASINNVTFVMPKTALLSAHYFNKSGVF  405



>ref|XP_010907627.1| PREDICTED: laccase-22-like [Elaeis guineensis]
Length=554

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/387 (67%), Positives = 310/387 (80%), Gaps = 1/387 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
              PV V+   RHY F V MK  +RLC++KPIV VNG+FPGP LYAREGD V+V V N V+ 
Sbjct  15    LPVLVDGRTRHYTFNVVMKTATRLCSTKPIVTVNGRFPGPTLYAREGDNVLVNVINQVKY  74

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGW+DGPAYITQCPIQPG SY YNF +TGQRGTL WH+HI W R TV
Sbjct  75    NVTIHWHGVRQLRTGWADGPAYITQCPIQPGNSYAYNFIITGQRGTLFWHAHILWLRVTV  134

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPKL VPYPFP P KEE+I+LGEWW ++ E VIN A++ G+ PNVSDAH ING 
Sbjct  135   HGAIVILPKLNVPYPFPAPYKEEVIILGEWWKADTEAVINQALKTGLAPNVSDAHIINGH  194

Query  684   PGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP   C +SKG+ LEV+SG+TY+LR++NAALNEELFFK+AGH++ VVEVDA+Y KP++T
Sbjct  195   PGPMSDCPTSKGFQLEVKSGETYMLRIINAALNEELFFKVAGHQMTVVEVDASYTKPYKT  254

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DTI + PGQTTN LLTAD++AG+Y +  S FMD+ +A DNQTA AT+ Y  T   +    
Sbjct  255   DTILITPGQTTNVLLTADREAGRYLVTASTFMDSPIAVDNQTAMATVHYTNTLSTSILTT  314

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T  P QNATPV + F DSLRSLNS  YPA VPL+VDHSL+F +G+GVNPCP C +GSRVV
Sbjct  315   TDPPPQNATPVASNFIDSLRSLNSEQYPARVPLTVDHSLLFTVGLGVNPCPTCVNGSRVV  374

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             AD+NNVSF MPTT +LQAHY+NISGVF
Sbjct  375   ADMNNVSFTMPTTAILQAHYFNISGVF  401



>emb|CDX74915.1| BnaA05g06610D [Brassica napus]
Length=558

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/388 (67%), Positives = 308/388 (79%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP   ESM+RHYKF V MKN +RLC+SKP V VNG++PGP +YARE DT++++V NHV+ 
Sbjct  18    FPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHGV+Q RTGW+DGPAYITQCP+QPGQ Y YN+TLTGQRGTL WH+HI W RATV
Sbjct  78    NVSIHWHGVRQVRTGWADGPAYITQCPLQPGQVYTYNYTLTGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFPKPD E++IVL EWW S+ E+VIN A++ G+ PNVSDAH ING 
Sbjct  138   HGAIVILPKRGVPYPFPKPDHEKVIVLAEWWKSDTENVINEALKSGLAPNVSDAHMINGH  197

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
              GP   C S+GY L V +GKTYLLR+VNAALNEELFFK+AGH   VVEVDA YVKPF+TD
Sbjct  198   SGPVNNCPSQGYKLSVTNGKTYLLRLVNAALNEELFFKVAGHLFTVVEVDAVYVKPFKTD  257

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             T+ + PGQTTN LLT  + AGKY +  SPFMD+ +A DN TATAT+ Y GT   + T LT
Sbjct  258   TVLIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSPTTLT  317

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSRV  1217
             + P QNAT +   FT+SLRSLNS+ YPA VP ++DH L F +G+G+NPCP C +  GSRV
Sbjct  318   LPPPQNATTIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNPCPTCKAGNGSRV  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VA INNV+F MP T LL AHY+NISGVF
Sbjct  378   VASINNVTFTMPKTALLPAHYFNISGVF  405



>ref|XP_003604619.1| Laccase 1a [Medicago truncatula]
 gb|AES86816.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=557

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/392 (69%), Positives = 311/392 (79%), Gaps = 4/392 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  VE  +RHYKF V  KNTSRLC+SK IV VNGKFPGP LYARE DTV+V+V N V
Sbjct  13    CIFPALVECKVRHYKFHVVAKNTSRLCSSKAIVTVNGKFPGPTLYAREDDTVIVKVRNQV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
               N++IHWHG++Q RTGW+DGPAYITQCPIQPG SY YNFT+TGQRGTLLWH+H+NW R+
Sbjct  73    NNNITIHWHGIRQLRTGWADGPAYITQCPIQPGHSYTYNFTITGQRGTLLWHAHVNWLRS  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFPKPD E ++VLGEWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TVHGAIVILPKKGVPYPFPKPDDELVLVLGEWWKSDTEAVINEALKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             GLPG    CS++  Y L VESGKTYLLR++NAALNEELFFKIAGH+L VVEVDATY KPF
Sbjct  193   GLPGTVANCSTQDVYKLPVESGKTYLLRIINAALNEELFFKIAGHKLTVVEVDATYTKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKG-THLLAS  1031
             + +TI + PGQTTN LL A+QK+GKY +A SPFMD  VA DN TATATL Y G T     
Sbjct  253   QIETIVIAPGQTTNVLLKANQKSGKYLVAASPFMDAPVAVDNLTATATLHYSGTTLTNTP  312

Query  1032  TALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--  1205
             T LT  P  NAT +   F +SL+ LNS+ YP NVPL +DHSL F +G+GVNPCP+C +  
Sbjct  313   TFLTTPPPTNATQIANNFLNSLKGLNSKKYPVNVPLKIDHSLFFTVGLGVNPCPSCKAGN  372

Query  1206  GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             GSRVVA INNV+FVMPTT LLQAHY+NI  VF
Sbjct  373   GSRVVAAINNVTFVMPTTALLQAHYFNIKNVF  404



>ref|XP_004980096.1| PREDICTED: laccase-22-like [Setaria italica]
Length=589

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/388 (67%), Positives = 315/388 (81%), Gaps = 5/388 (1%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             +S  ++ RHYKF V M+N +RLC++KPI+ VNGKFPGP LYARE D V+V+V NHV  NV
Sbjct  50    LSAHAITRHYKFNVIMRNVTRLCSTKPILTVNGKFPGPTLYAREDDNVLVKVVNHVTHNV  109

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             +IHWHGV+Q RTGWSDGPAYITQCPIQPG S+LYNFT+TGQRGTLLWH+HINW RATVHG
Sbjct  110   TIHWHGVRQIRTGWSDGPAYITQCPIQPGTSFLYNFTVTGQRGTLLWHAHINWLRATVHG  169

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVILPKLGVPYPFP P KE ++VLGEWW ++ E VIN AMQ G+ PNVSD+HTING PG
Sbjct  170   AIVILPKLGVPYPFPTPHKEVVVVLGEWWKADTEVVINQAMQQGVGPNVSDSHTINGHPG  229

Query  690   PTPTCSS--KGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             P   C+S   G+ L VE+GKTY+LR++NAALN++LFFKIAGH+  VVEVDA Y KPF+T 
Sbjct  230   PLSDCASSQDGFKLNVENGKTYMLRIINAALNDDLFFKIAGHKFTVVEVDAVYTKPFKTA  289

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             T+ + PGQTTN LLTAD+ AG+Y +++SPFMD  V  DN+T TATL Y  T + A+  LT
Sbjct  290   TLLITPGQTTNVLLTADRTAGRYLLSVSPFMDAPVQVDNKTGTATLHYANT-ISATAPLT  348

Query  1044  IM--PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             ++  P QNAT + + F +SLRSLNS  YPANVPL+VDHSLVF +GVGVNPC  C + +R+
Sbjct  349   LIKPPPQNATTIVSKFVESLRSLNSEEYPANVPLTVDHSLVFTVGVGVNPCAKCINATRL  408

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             V  INNV+F+MP+TP+LQAHYYNI GVF
Sbjct  409   VGTINNVTFIMPSTPILQAHYYNIPGVF  436



>ref|XP_007207096.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
 gb|EMJ08295.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
Length=558

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/388 (67%), Positives = 313/388 (81%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP SVE M+RHYKF V  K TSRLC+SKPIV VNG++PGP +YARE DTV+++V NHV+ 
Sbjct  18    FPASVECMVRHYKFNVVQKKTSRLCSSKPIVTVNGRYPGPTIYAREDDTVLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTL WH+HI W RAT+
Sbjct  78    NVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLWWHAHILWLRATL  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGA+VILPKLGVPYPFP P KE +++LGEWW S+VE VIN A++ G  PNVSDAHTING 
Sbjct  138   HGALVILPKLGVPYPFPAPQKEVVVILGEWWKSDVESVINQALKSGSAPNVSDAHTINGH  197

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
              GP  TCSS+ G+ L V  GKTY+LR++NAALNEELFFKIA H+L VVEVDA Y KPF+T
Sbjct  198   SGPLSTCSSQGGFKLPVRPGKTYMLRIINAALNEELFFKIANHKLTVVEVDAVYTKPFKT  257

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DT+ + PGQTTN LL+ +   GKY +A SPFMD   +  DN+TATATL Y GT     T 
Sbjct  258   DTVLIAPGQTTNVLLSTNHGTGKYLVAASPFMDNPTILVDNKTATATLHYTGTPESTRTT  317

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             LT  P QNAT V T FT+SLRSLNS  +PA VPL +DHSL+F +G+G++ C +C++G+RV
Sbjct  318   LTAPPPQNATLVATKFTNSLRSLNSVKFPARVPLKIDHSLLFTVGLGLHTCASCANGNRV  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VADINNV+FVMP   LLQAH++NISGVF
Sbjct  378   VADINNVTFVMPKISLLQAHFFNISGVF  405



>ref|XP_010543748.1| PREDICTED: laccase-22-like [Tarenaya hassleriana]
Length=555

 Score =   554 bits (1428),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/378 (70%), Positives = 301/378 (80%), Gaps = 0/378 (0%)
 Frame = +3

Query  168   IRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHG  347
             IR YKF V MKNT++LC++K IV VNGKFPGP LYARE D V+V + NHV  NV+IHWHG
Sbjct  24    IRRYKFDVVMKNTTKLCSTKSIVTVNGKFPGPTLYAREDDQVIVNLTNHVNYNVTIHWHG  83

Query  348   VKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILP  527
             VKQ RTGWSDGPAYITQCPIQPG +++YNFTLTGQRGTLLWH+HI+W RATVHGAIVILP
Sbjct  84    VKQLRTGWSDGPAYITQCPIQPGGTFIYNFTLTGQRGTLLWHAHISWLRATVHGAIVILP  143

Query  528   KLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCS  707
             +  V YPFP+P KE+II+ GEWW S+VE VIN +   G+PPNVSDAHTING  GP   C+
Sbjct  144   RHRVAYPFPRPHKEKIIIFGEWWKSDVEAVINQSTFTGLPPNVSDAHTINGQSGPLLGCN  203

Query  708   SKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQ  887
             S GY L VESGKTY+LR++NAALN+ELFFKIAGH L V+EVDA+Y KPF  DT+F+GPGQ
Sbjct  204   SPGYTLHVESGKTYMLRIINAALNDELFFKIAGHTLTVIEVDASYTKPFSADTLFLGPGQ  263

Query  888   TTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQNAT  1067
             TTNALLTADQ +GKY I ISPFMDTIV  DN T TA L Y  T    S     +P  NAT
Sbjct  264   TTNALLTADQSSGKYLITISPFMDTIVTVDNVTGTAFLHYNDTTSSPSLVSDKIPPVNAT  323

Query  1068  PVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFV  1247
              V   F+D+LRSLNSR YPANVPL VDHSL F IGVG+NPC  C + ++ V DINNVSFV
Sbjct  324   SVALGFSDNLRSLNSRDYPANVPLRVDHSLFFTIGVGINPCETCINNTKAVGDINNVSFV  383

Query  1248  MPTTPLLQAHYYNISGVF  1301
             MPT  +LQAHYYNISGVF
Sbjct  384   MPTIGILQAHYYNISGVF  401



>ref|XP_007146741.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
 gb|ESW18735.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
Length=556

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/384 (68%), Positives = 315/384 (82%), Gaps = 1/384 (0%)
 Frame = +3

Query  153   SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVS  332
             SVE+M+RHYKF V +KN +RLC++KPIV VNGKFPGP +YARE DTV+++V NHV+ NVS
Sbjct  20    SVEAMVRHYKFNVVLKNATRLCSTKPIVTVNGKFPGPTIYAREDDTVLIKVVNHVKYNVS  79

Query  333   IHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGA  512
             IHWHGV+Q RTGW+DGPAYITQCPIQPGQ+Y+YNFTLTGQRGTL WH+HI W RAT+HGA
Sbjct  80    IHWHGVRQVRTGWADGPAYITQCPIQPGQAYVYNFTLTGQRGTLWWHAHILWLRATLHGA  139

Query  513   IVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGP  692
             +VILPKLGVPYPFPKP+ E++I+L EWW S+ E VIN A++ G+ PNVSDAHTING PGP
Sbjct  140   LVILPKLGVPYPFPKPNMEQVIILSEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGP  199

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
                C+S+ G+ L+V+ G TYLLR++NAALNEELFFKIAGH L VVEVDA Y KPF+TDTI
Sbjct  200   VQGCASQEGFKLDVQPGNTYLLRIINAALNEELFFKIAGHELTVVEVDAVYTKPFKTDTI  259

Query  870   FVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIM  1049
              + PGQTTN LLTA   AGKY +A SPFMD  +A DN+TATATL Y GT   + T LT +
Sbjct  260   VITPGQTTNVLLTAKHAAGKYLVAASPFMDAPIAVDNKTATATLHYSGTLSSSLTTLTSL  319

Query  1050  PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADI  1229
             P +N+T + T+FTDSLRSLNS+ YPA VPL +D +L+F + +G+NPC  C + SRVVADI
Sbjct  320   PPKNSTILATSFTDSLRSLNSKKYPARVPLKIDRNLLFTVSLGINPCATCVNNSRVVADI  379

Query  1230  NNVSFVMPTTPLLQAHYYNISGVF  1301
             NNV+FVMP   LLQAH++ I GVF
Sbjct  380   NNVTFVMPKISLLQAHFFKIKGVF  403



>ref|XP_009370205.1| PREDICTED: laccase-4 [Pyrus x bretschneideri]
Length=559

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/391 (67%), Positives = 321/391 (82%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VES +RHYKF V ++N+++LC+SKPIV VNG+FPGP LYARE DTV+V+V NHV
Sbjct  14    CILPALVESRVRHYKFNVVLRNSTKLCSSKPIVTVNGQFPGPTLYAREDDTVLVKVTNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPI PGQSY+YNFT+TGQRGTLLWH+HI W RA
Sbjct  74    KYNVSIHWHGIRQLRTGWADGPAYITQCPIPPGQSYVYNFTITGQRGTLLWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+++LPK GVPYPFP P KE  +VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  134   TVHGALIVLPKRGVPYPFPAPHKEVPVVLAEWWKSDTEAVINQALKSGLAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG  P CSS+ G+ L V++GKTYLLR++NAALNEELFFKIAGH L +VEVDATYVKPF
Sbjct  194   GHPGLVPNCSSQGGFTLPVKNGKTYLLRIINAALNEELFFKIAGHNLTIVEVDATYVKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTNAL+TA+Q +GKY +A SPFMD+ +A DN TATATL Y GT     T
Sbjct  254   KTDTIVIAPGQTTNALVTANQNSGKYMVAASPFMDSPIAVDNLTATATLHYTGTLATTPT  313

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
              LT  P QNAT V  +F +SL++LNS+ +PA VPL +DH+L+F +G+G+N CP+C  ++G
Sbjct  314   TLTSAPPQNATQVANSFINSLKALNSKKFPAKVPLKIDHNLLFTVGLGINSCPSCKAANG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA +NNV+FVMPTT LLQAH++N SGVF
Sbjct  374   SRVVASVNNVTFVMPTTALLQAHFFNKSGVF  404



>ref|XP_006363052.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=561

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/394 (66%), Positives = 314/394 (80%), Gaps = 6/394 (2%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP+ VE  +RHYKF V MKNT+RLC+SK IV VNGKFPGP +YAREGD V+++V NHV
Sbjct  14    CLFPLVVECRVRHYKFNVVMKNTTRLCSSKSIVTVNGKFPGPTIYAREGDNVLIKVVNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             +  VSIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTL WH+HI W RA
Sbjct  74    KYIVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPKLGVPYPFPKP+ E +++L EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  134   TVHGAIVILPKLGVPYPFPKPNHEAVVILAEWWKSDTEAVINEAIKSGLAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C S+ GY L VE GKTY+LRV+NAALNEELFFKIAGH++ VVEVDATY+KPF
Sbjct  194   GHPGPVSNCPSQGGYKLNVEPGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYIKPF  253

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHL-LAS  1031
             +TDTI + PGQTTN ++ A++ +GKY +  SPFMD+ +A DN TA ATL Y  T     S
Sbjct  254   QTDTIVIAPGQTTNVIVNANKNSGKYMVVASPFMDSPIAVDNVTAIATLHYSATLTNNPS  313

Query  1032  TALTI--MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACS-  1202
             T LT    P +NATP+   F DSLRSLNS+ YPA VP+ +DHSL+F + +G+NPCP+C  
Sbjct  314   TTLTSTNTPPKNATPIANNFLDSLRSLNSKKYPAKVPIKIDHSLLFTVSLGINPCPSCKQ  373

Query  1203  -SGSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
              +GSRVVA INNV+FVMPT  LLQAH+  I GVF
Sbjct  374   GNGSRVVASINNVTFVMPTIALLQAHFSGIKGVF  407



>emb|CDX91428.1| BnaC04g07220D [Brassica napus]
Length=558

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/388 (67%), Positives = 307/388 (79%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP   ESM+RHYKF V MKN +RLC+SKP V VNG++PGP +YARE DT++++V NHV+ 
Sbjct  18    FPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHGV+Q RTGW+DGPAYITQCP+QPGQ Y YN+TLTGQRGTL WH+HI W RATV
Sbjct  78    NVSIHWHGVRQVRTGWADGPAYITQCPLQPGQVYTYNYTLTGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFPKPD E++IVL EWW S+ E+VIN A++ G+  NVSDAH ING 
Sbjct  138   HGAIVILPKRGVPYPFPKPDHEKVIVLAEWWKSDTENVINEALKSGLASNVSDAHMINGH  197

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
              GP   C S+GY L V +GKTYLLR+VNAALNEELFFK+AGH   VVEVDA YVKPF+TD
Sbjct  198   SGPVNNCPSQGYKLSVTNGKTYLLRLVNAALNEELFFKVAGHLFTVVEVDAVYVKPFKTD  257

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
             TI + PGQTTN LLT  + AGKY +  SPFMD+ +A DN TATAT+ Y GT   + T LT
Sbjct  258   TILIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSPTTLT  317

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSRV  1217
             + P QNAT +   FT+SLRSLNS+ YPA VP ++DH L F +G+G+NPCP C +  GSRV
Sbjct  318   LPPPQNATTIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNPCPTCKAGNGSRV  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VA INNV+F MP T LL AHY+NISGVF
Sbjct  378   VASINNVTFTMPKTALLPAHYFNISGVF  405



>emb|CDY18406.1| BnaA04g21810D [Brassica napus]
Length=559

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/389 (68%), Positives = 310/389 (80%), Gaps = 3/389 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP   ESM+RHYKF V MKN +RLC+SKP V VNG++PGP +YARE DT++++V NHV+ 
Sbjct  18    FPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ Y YN+TLTGQRGTL WH+HI W RATV
Sbjct  78    NVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             +GAIVILPK GVPYPFPKPD E++IVLGEWW S+ E+VIN A++ G+ PNVSDAH ING 
Sbjct  138   YGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENVINEALKSGLAPNVSDAHMINGR  197

Query  684   PGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG    C S +GY L V++GKTYLLRVVNAALNEELFFK+AGH   VVEVDA YVKPF+ 
Sbjct  198   PGLAKNCPSDQGYKLSVKNGKTYLLRVVNAALNEELFFKVAGHLFTVVEVDAVYVKPFKI  257

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DTI + PGQTTN LLTA +  GKY +  SPFMD+ +A DN TATAT+ Y GT   + T L
Sbjct  258   DTIVIAPGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSPTIL  317

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSR  1214
             T+ P QNAT V T FT+SLRSLNS+ YPA VP ++DH L F +G+G+NPCP C +  GSR
Sbjct  318   TLPPPQNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNPCPTCKAGNGSR  377

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA INNV+FVMP   LL AHY+NISGVF
Sbjct  378   VVASINNVTFVMPKIALLPAHYFNISGVF  406



>ref|XP_009141718.1| PREDICTED: laccase-4-like [Brassica rapa]
Length=559

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/389 (68%), Positives = 310/389 (80%), Gaps = 3/389 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP   ESM+RHYKF V MKN +RLC+SKP V VNG++PGP +YARE DT++++V NHV+ 
Sbjct  18    FPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ Y YN+TLTGQRGTL WH+HI W RATV
Sbjct  78    NVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             +GAIVILPK GVPYPFPKPD E++IVLGEWW S+ E+VIN A++ G+ PNVSDAH ING 
Sbjct  138   YGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENVINEALKSGLAPNVSDAHMINGR  197

Query  684   PGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG    C S +GY L V++GKTYLLRVVNAALNEELFFK+AGH   VVEVDA YVKPF+ 
Sbjct  198   PGLAKNCPSDQGYKLSVKNGKTYLLRVVNAALNEELFFKVAGHLFTVVEVDAVYVKPFKI  257

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DTI + PGQTTN LLTA +  GKY +  SPFMD+ +A DN TATAT+ Y GT   + T L
Sbjct  258   DTIVIAPGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSPTIL  317

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSR  1214
             T+ P QNAT V T FT+SLRSLNS+ YPA VP ++DH L F +G+G+NPCP C +  GSR
Sbjct  318   TLPPPQNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNPCPTCKAGNGSR  377

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA INNV+FVMP   LL AHY+NISGVF
Sbjct  378   VVASINNVTFVMPKIALLPAHYFNISGVF  406



>ref|XP_008355354.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008355361.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008363414.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/388 (67%), Positives = 312/388 (80%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FPVSVE M+RHYKF V  KN SRLC+SKPIV VNG++PGP +YARE DTV+++V NHV+ 
Sbjct  18    FPVSVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTIYAREDDTVLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ Y+YNFT+TGQRGTL WH+HI W RATV
Sbjct  78    NVSIHWHGIRQLRTGWADGPAYITQCPIQPGQQYVYNFTITGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGA+VILPK GVPYPFP P KE +++LGEWW S+ E VIN A++ G+ PN+SDAHTING 
Sbjct  138   HGALVILPKHGVPYPFPAPRKELVVILGEWWKSDTEAVINEALKSGLAPNISDAHTINGH  197

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP  TC S+ G  L V  GKTY+LR++NAALNEELFFKIA H+L VVEVDA Y KPF+T
Sbjct  198   PGPLSTCQSQGGLKLPVRPGKTYMLRIINAALNEELFFKIANHKLTVVEVDAVYTKPFKT  257

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTTN L+T +  +GKY +A SPFMD   +  DN+TATATL Y GT     T 
Sbjct  258   DTILIAPGQTTNVLVTTNLGSGKYLVAASPFMDNPTIVVDNKTATATLHYIGTLQSTKTI  317

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             LT  P QNAT V T FT+SLRSLNS  +PA VPL +DHSL+F +G+G++ C +C++G+RV
Sbjct  318   LTAPPPQNATTVATNFTNSLRSLNSIRFPARVPLKIDHSLLFTVGLGLHTCASCTNGNRV  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VADINNV+FVMP   LLQAH++NISGVF
Sbjct  378   VADINNVTFVMPEIALLQAHFFNISGVF  405



>gb|AES98533.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=558

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/389 (66%), Positives = 308/389 (79%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P+SV++M+RHYKF V MKN +RLC++KPIV +NG FPGP +YARE DTV+V+V NHV
Sbjct  16    CLLPLSVDAMVRHYKFNVVMKNATRLCSTKPIVTINGNFPGPTIYAREDDTVLVKVVNHV  75

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ Y+YNFTLTGQRGTL WH+HI W RA
Sbjct  76    KYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQVYMYNFTLTGQRGTLWWHAHILWLRA  135

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPKLGVPYPFP+P  E++I+L EWW S+ E +IN A++ G+ PNVSDAHTIN
Sbjct  136   TVHGAIVILPKLGVPYPFPRPHMEQVIILSEWWKSDTEAIINEALKSGLAPNVSDAHTIN  195

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C+S+ G+  +VE GKTYLLR++NAALNE+LFFKIAGH+  VVEVDA Y KPF
Sbjct  196   GHPGPVQHCASQEGFKFQVEPGKTYLLRIINAALNEDLFFKIAGHKFTVVEVDAAYTKPF  255

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN LL  +  +GKY +A S FMD  +A DN TATATL Y  T     T
Sbjct  256   KTDTIVITPGQTTNVLLKTNHASGKYMVAASTFMDAPIAIDNVTATATLHYPNTLGSTIT  315

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT +P  N+T +  +FTDSL+SLNS  YPA VP  +DHSL F + +GVNPC  C +GSR
Sbjct  316   TLTSLPPINSTKIANSFTDSLKSLNSHKYPARVPKKIDHSLFFTVSLGVNPCATCPNGSR  375

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA INNV+FVMP   LLQAH++NISG+F
Sbjct  376   VVAAINNVTFVMPKISLLQAHFFNISGIF  404



>gb|KFK36706.1| hypothetical protein AALP_AA4G158700 [Arabis alpina]
Length=560

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/389 (67%), Positives = 312/389 (80%), Gaps = 3/389 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP   E M+RHYKF V MKN +RLC+SKP V VNG++PGP +YARE DT++++V NHV+ 
Sbjct  19    FPPPSECMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVKY  78

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ+Y YN+TLTGQRGTL WH+H+ W RATV
Sbjct  79    NVSIHWHGVRQVRTGWADGPAYITQCPIQPGQAYTYNYTLTGQRGTLWWHAHVLWLRATV  138

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             +GA+VILPK GVPYPFPKP+ E++IVLGEWW S+ E+VIN A++ G+ PNVSD+H ING 
Sbjct  139   YGALVILPKRGVPYPFPKPNHEKVIVLGEWWKSDTENVINEALKSGLAPNVSDSHMINGR  198

Query  684   PGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG    C S +GY L VE+GKTYLLR+VNAALNEELFFK+AGH   VVEVDA YVKPF+ 
Sbjct  199   PGLAKNCPSDQGYKLSVENGKTYLLRIVNAALNEELFFKVAGHLFTVVEVDAVYVKPFKI  258

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DT+ + PGQTTN LLTA + AGKY +A SPFMD  +A DN TATATL Y GT   + T L
Sbjct  259   DTVLIAPGQTTNVLLTASKSAGKYLVAASPFMDAPIAVDNVTATATLHYSGTLSSSPTIL  318

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSR  1214
             T+ P QNAT +   FT+SLRSLNS+ YPA VP ++DH L+F +G+G+NPCP C +  GSR
Sbjct  319   TLPPPQNATSIANNFTNSLRSLNSKKYPAIVPTTIDHHLLFTVGLGLNPCPTCKAGNGSR  378

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA INNV+F+MP T LL AHY+NISGVF
Sbjct  379   VVASINNVTFIMPKTALLPAHYFNISGVF  407



>ref|XP_011080855.1| PREDICTED: laccase-4 [Sesamum indicum]
Length=554

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/389 (67%), Positives = 306/389 (79%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VES +R YKF V M+N SRLC+SKP+V VNG+FPGP +YARE DT++++V NHV
Sbjct  13    CLLPGMVESDLRRYKFNVVMRNKSRLCSSKPVVTVNGRFPGPNIYAREDDTLLIKVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
               N+SIHWHG+KQ  TGW+DGPAYITQCPIQPGQSY+YNFT+ GQRGT LWH+HI W RA
Sbjct  73    NYNISIHWHGIKQLGTGWADGPAYITQCPIQPGQSYVYNFTVNGQRGTFLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIV+LPK GVPYPFPKP +E + +LGEWW S+VEDVIN AM LG+ PNVSDAHTIN
Sbjct  133   TVHGAIVVLPKPGVPYPFPKPHQEAVFILGEWWKSDVEDVINEAMDLGVAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP  +C  + G++L V  GKTYLLRV+NAALNEELFFKIAGH+LRVVE+DA YVKPF
Sbjct  193   GHPGPISSCVGQGGFDLGVMPGKTYLLRVINAALNEELFFKIAGHKLRVVEIDAAYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDT+ + PGQTTNALLTAD   G+YQ+  SPFMD+ +  DN+TATATL Y GT      
Sbjct  253   DTDTLLIAPGQTTNALLTADLPIGRYQVVASPFMDSPIDIDNRTATATLHYTGTLPSTPA  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              LT  P +NAT   T F  SLRSLNS  YP  VP  VDH L+FAIG+G+N C  C++G R
Sbjct  313   VLTDPPSRNATATATKFAHSLRSLNSAEYPCRVPREVDHHLLFAIGLGLNRCSTCANGYR  372

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVADINNV+F MP+  LL AH++NI GVF
Sbjct  373   VVADINNVTFAMPSVSLLNAHFFNIPGVF  401



>ref|XP_009787551.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=554

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/382 (66%), Positives = 309/382 (81%), Gaps = 3/382 (1%)
 Frame = +3

Query  165   MIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWH  344
             + RHYKF V M+N SRLC++KPIV VNG+FPGP +YARE D V+++V NHV+ NVSIHWH
Sbjct  20    ITRHYKFNVVMRNMSRLCSTKPIVTVNGRFPGPTIYAREDDRVLIKVVNHVKYNVSIHWH  79

Query  345   GVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVIL  524
             G++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTL WH+H+ W R+TVHGAIV+L
Sbjct  80    GIRQLRTGWADGPAYITQCPIQPGQSYIYNFTITGQRGTLFWHAHVLWLRSTVHGAIVVL  139

Query  525   PKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTC  704
             PK GVPYPFPKP+ E ++VL EWW S+ E VIN A++ G+ PNVSDAHTING PGP   C
Sbjct  140   PKRGVPYPFPKPNHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVSNC  199

Query  705   SSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGP  881
              ++ GY L V+ GKTY+LRV+NAALNEELFFKIAGH++ VVEVDATYVKPF+TDTI + P
Sbjct  200   PTQGGYTLSVKPGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAP  259

Query  882   GQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQN  1061
             GQTTN ++TADQ  GKY +A SPFMD  +A DN TATATL Y G    + T LT  P QN
Sbjct  260   GQTTNVIVTADQSFGKYMVAASPFMDAPIAVDNITATATLHYSGALGSSPTTLTSTPPQN  319

Query  1062  ATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSGSRVVADINN  1235
             AT V   F D+L+SLNS+ YPA VP +VDHSL F +G+G+NPCP C  ++GSRVVA +NN
Sbjct  320   ATSVANNFLDALKSLNSKKYPAKVPQTVDHSLFFTVGLGINPCPTCKQANGSRVVASVNN  379

Query  1236  VSFVMPTTPLLQAHYYNISGVF  1301
             V+F+MPT  LLQAH++ I+GVF
Sbjct  380   VTFIMPTVALLQAHFFGINGVF  401



>ref|XP_002280416.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI16002.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/387 (67%), Positives = 311/387 (80%), Gaps = 1/387 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP+ V+   RHYKF V ++  +RLC+SKPIV VNG FPGP ++ARE DTV+++V NHV+ 
Sbjct  15    FPILVDCRTRHYKFNVVLRKATRLCSSKPIVTVNGNFPGPTIHAREDDTVLIKVVNHVKY  74

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTLLWH+HI W RATV
Sbjct  75    NVSIHWHGIRQLRTGWADGPAYITQCPIQPGQSYIYNFTITGQRGTLLWHAHILWLRATV  134

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGA+VILPKLGVPYPFP P KE +++LGEWW S+VE VIN AM+ G+ PNVSDAHTING 
Sbjct  135   HGALVILPKLGVPYPFPTPYKEAVVILGEWWKSDVEAVINEAMKSGLAPNVSDAHTINGH  194

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP  +CS + G+ L V+ GKTY+LR++NAALNEELF KIAGH L VVEVDATY KPF T
Sbjct  195   PGPFSSCSLQGGFTLPVDPGKTYMLRIINAALNEELFLKIAGHHLTVVEVDATYTKPFST  254

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DT+ + PGQTTN LLTA   AGKY +  S FMD+ +A DN TATAT+ Y GT     T +
Sbjct  255   DTVLIAPGQTTNVLLTAGLGAGKYLVTASSFMDSPIAVDNMTATATVQYSGTLSSTPTTI  314

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T  P QNAT V T FTDSLRSLNS+ YPA VPL+ DHSL+F +G+G+NPC  C +G +VV
Sbjct  315   TNPPPQNATSVATKFTDSLRSLNSKKYPARVPLATDHSLLFTVGLGINPCATCVNGGKVV  374

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             A+INNV+FVMPTT LLQAHY+ + GV+
Sbjct  375   ANINNVTFVMPTTALLQAHYFKMKGVY  401



>emb|CDX93330.1| BnaC04g45660D [Brassica napus]
Length=560

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/390 (68%), Positives = 312/390 (80%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPV-SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             FP  S ESM+RHYKF V MKN +RLC+SKP V VNG++PGP +YARE DT++++V NHV+
Sbjct  18    FPAPSSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVK  77

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              NVSIHWHGV+Q RTGW+DGPAYITQCPIQPGQ Y YN+TLTGQRGTL WH+HI W RAT
Sbjct  78    YNVSIHWHGVRQVRTGWADGPAYITQCPIQPGQVYTYNYTLTGQRGTLWWHAHILWLRAT  137

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             V+GAIVILPK GVPYPFPKPD E++IVLGEWW S+ E+VIN A++ G+ PNVSDAH ING
Sbjct  138   VYGAIVILPKRGVPYPFPKPDHEKVIVLGEWWKSDTENVINEALKSGLAPNVSDAHMING  197

Query  681   LPGPTPTCSS-KGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE  857
              PG    CSS +GY L V++GKTYLLR+VNAALNEELFFK+AGH   VVEVDA YVKPF+
Sbjct  198   RPGLAKNCSSDQGYKLSVKNGKTYLLRLVNAALNEELFFKVAGHLFTVVEVDAVYVKPFK  257

Query  858   TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA  1037
              DTI + PGQTTN LLTA +  GKY +  SPFMD+ +A DN TATAT+ Y GT   + T 
Sbjct  258   IDTIVIAPGQTTNVLLTASKSTGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSPTI  317

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GS  1211
             LT+ P QNAT V T FT+SLRSLNS+ YPA VP ++DH L F +G+G+NPCP C +  GS
Sbjct  318   LTLPPPQNATSVATNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNPCPTCKAGNGS  377

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVA INNV+FVMP   LL AHY+NISGVF
Sbjct  378   RVVASINNVTFVMPKIALLPAHYFNISGVF  407



>ref|XP_010486777.1| PREDICTED: laccase-22-like isoform X1 [Camelina sativa]
Length=554

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/382 (68%), Positives = 309/382 (81%), Gaps = 2/382 (1%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             E+ IR YKF V MKN ++LC++KPIV +NGKFPGP LYARE D V+V + N+V  NV+IH
Sbjct  22    EANIRRYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNNVNYNVTIH  81

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHGVKQ RTGWSDGPAYITQCP+QPG +++YNFTLTGQRGTLLWH+HI+W RATVHGAIV
Sbjct  82    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  141

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             ILPK GVPYPFP+P  E IIV GEWWNS+VE VI+ + Q G+PPN+SDAHTINGL G  P
Sbjct  142   ILPKRGVPYPFPRPHTERIIVFGEWWNSDVEAVISQSTQSGLPPNISDAHTINGLTGQVP  201

Query  699   TCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVG  878
              C S+GY L VE+GK YLLR++NAA+N+ELFFKIAGH L VVEVDATY+KPF+T+T+F+G
Sbjct  202   GCKSRGYTLHVETGKKYLLRIINAAVNDELFFKIAGHNLTVVEVDATYIKPFDTETLFLG  261

Query  879   PGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQ  1058
             PGQTTNA+LTA+   G + + ISPFMDT+V  +N TATA L YK T   A  +  I P+ 
Sbjct  262   PGQTTNAILTANHPQGNFLMTISPFMDTVVPVNNVTATAFLRYKDTRTQALKSSKIPPV-  320

Query  1059  NATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNV  1238
             NAT +   F+DSLRSLNS  YP NVPL VDHSL FAIGVGVNPC  C +G++ +ADINNV
Sbjct  321   NATSIALGFSDSLRSLNSPDYPTNVPLKVDHSLFFAIGVGVNPCATCINGTKTIADINNV  380

Query  1239  SFVMPTTPLLQAHYYNIS-GVF  1301
             SFVMPT  +LQAHY+N S GVF
Sbjct  381   SFVMPTVAMLQAHYFNKSEGVF  402



>gb|EMS48198.1| Laccase-22 [Triticum urartu]
Length=537

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/388 (66%), Positives = 314/388 (81%), Gaps = 5/388 (1%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             +SV ++ RHYKF V M+N +RLC++K I+ VNGKFPGP LYAREGD V+V+V N    NV
Sbjct  24    LSVHAITRHYKFNVVMRNMTRLCSTKSILTVNGKFPGPTLYAREGDNVLVKVVNQASHNV  83

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             +IHWHGV+Q RTGW DGPAYITQCPIQPG S+LYNFT+TGQRGTLLWH+HINW RATVHG
Sbjct  84    TIHWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTVTGQRGTLLWHAHINWLRATVHG  143

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVILPKLGVPYPFP P KE ++VLGEWW ++ E VIN AMQLG+ PN+SD+HTING PG
Sbjct  144   AIVILPKLGVPYPFPAPHKEAVVVLGEWWKADTETVINQAMQLGVGPNISDSHTINGHPG  203

Query  690   PTPTCSS--KGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             P   C+S   G+NL+VE+ KTY+LR++NA LN++LFFKIAGH L VVEVDA Y KP++TD
Sbjct  204   PMSDCASSQDGFNLDVENDKTYMLRIINAGLNDDLFFKIAGHGLTVVEVDAVYTKPYKTD  263

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
              + + PGQTTN L+TADQ AG+Y +++SPF+D  +  DN+T TATL Y  T + A+  LT
Sbjct  264   ILLITPGQTTNVLVTADQSAGRYLLSVSPFLDAPLQVDNKTGTATLHYANT-VSATARLT  322

Query  1044  IM--PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             ++  P QNATP+ + F++SLRSLNS+ YPANVP +VDHSL F IGVGVNPC  C +G+RV
Sbjct  323   LVKPPPQNATPIASKFSESLRSLNSKEYPANVPQTVDHSLFFTIGVGVNPCANCINGTRV  382

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             V  INN +FVMP+TP+LQA YY+I GVF
Sbjct  383   VGTINNSTFVMPSTPILQARYYSIPGVF  410



>ref|XP_010486778.1| PREDICTED: laccase-22-like isoform X2 [Camelina sativa]
Length=565

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/382 (68%), Positives = 309/382 (81%), Gaps = 2/382 (1%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             E+ IR YKF V MKN ++LC++KPIV +NGKFPGP LYARE D V+V + N+V  NV+IH
Sbjct  22    EANIRRYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNNVNYNVTIH  81

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHGVKQ RTGWSDGPAYITQCP+QPG +++YNFTLTGQRGTLLWH+HI+W RATVHGAIV
Sbjct  82    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  141

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             ILPK GVPYPFP+P  E IIV GEWWNS+VE VI+ + Q G+PPN+SDAHTINGL G  P
Sbjct  142   ILPKRGVPYPFPRPHTERIIVFGEWWNSDVEAVISQSTQSGLPPNISDAHTINGLTGQVP  201

Query  699   TCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVG  878
              C S+GY L VE+GK YLLR++NAA+N+ELFFKIAGH L VVEVDATY+KPF+T+T+F+G
Sbjct  202   GCKSRGYTLHVETGKKYLLRIINAAVNDELFFKIAGHNLTVVEVDATYIKPFDTETLFLG  261

Query  879   PGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQ  1058
             PGQTTNA+LTA+   G + + ISPFMDT+V  +N TATA L YK T   A  +  I P+ 
Sbjct  262   PGQTTNAILTANHPQGNFLMTISPFMDTVVPVNNVTATAFLRYKDTRTQALKSSKIPPV-  320

Query  1059  NATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNV  1238
             NAT +   F+DSLRSLNS  YP NVPL VDHSL FAIGVGVNPC  C +G++ +ADINNV
Sbjct  321   NATSIALGFSDSLRSLNSPDYPTNVPLKVDHSLFFAIGVGVNPCATCINGTKTIADINNV  380

Query  1239  SFVMPTTPLLQAHYYNIS-GVF  1301
             SFVMPT  +LQAHY+N S GVF
Sbjct  381   SFVMPTVAMLQAHYFNKSEGVF  402



>ref|XP_003539958.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN07789.1| Laccase-4 [Glycine soja]
Length=556

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/384 (68%), Positives = 307/384 (80%), Gaps = 1/384 (0%)
 Frame = +3

Query  153   SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVS  332
             SVE+M+RHYKF V  KNT+RL ++KPIV +NGKFPGP +YARE DTV+V+V N V+ NVS
Sbjct  20    SVEAMVRHYKFNVVQKNTTRLGSTKPIVTINGKFPGPTIYAREDDTVLVKVVNQVKYNVS  79

Query  333   IHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGA  512
             IHWHGV+Q RTGW+DGPAYITQCPI P Q+Y+YNFTLTGQRGTL WH+HI W RATVHGA
Sbjct  80    IHWHGVRQLRTGWADGPAYITQCPILPSQAYVYNFTLTGQRGTLWWHAHILWLRATVHGA  139

Query  513   IVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGP  692
             +VILPKLGVPYPFPKP+ E++I+L EWW S+ E VIN A++ G+ PN SDAHTING PGP
Sbjct  140   LVILPKLGVPYPFPKPNMEQVIILSEWWKSDTEAVINEALKSGLAPNASDAHTINGHPGP  199

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
                 +S+ GY L+V+ GKTYLLR++NAALNEELFFKIAGH L VVEVDA Y KP +TDTI
Sbjct  200   IQGYASQGGYKLDVQPGKTYLLRIINAALNEELFFKIAGHELTVVEVDAVYTKPLKTDTI  259

Query  870   FVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIM  1049
              + PGQTTN LLT     GKY +A SPFMD  +A DN+TATATL Y GT     T LT M
Sbjct  260   VIAPGQTTNVLLTTKHATGKYLVAASPFMDAPIAVDNKTATATLHYLGTLGSTITTLTSM  319

Query  1050  PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADI  1229
             P +NATPV TTF DSLRSLNS+ +PA VPL +DH+L+F + +GVNPC  C + SRVVADI
Sbjct  320   PPKNATPVATTFIDSLRSLNSKEHPARVPLKIDHNLLFTVSLGVNPCATCVNNSRVVADI  379

Query  1230  NNVSFVMPTTPLLQAHYYNISGVF  1301
             NNV+FVMP   LLQAH++ I GVF
Sbjct  380   NNVTFVMPKISLLQAHFFKIKGVF  403



>ref|XP_009407561.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=559

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/390 (67%), Positives = 310/390 (79%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
              P+  E + RHYKF V  K  +RLC++K I  VNG+FPGP LYAREGDTV+V+V NHV  
Sbjct  17    LPLLAEGITRHYKFNVAEKKFTRLCSTKSIATVNGQFPGPTLYAREGDTVLVKVVNHVHY  76

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGW+DGPAYITQCPIQPGQ+Y+YNFTLTGQRGTL WH+HI+W RATV
Sbjct  77    NVTIHWHGVRQLRTGWADGPAYITQCPIQPGQNYVYNFTLTGQRGTLWWHAHISWLRATV  136

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIV+LPK  VPYPFP P KE ++VL EWW S+ E VIN A+  G+ PNVSDAHTING 
Sbjct  137   HGAIVVLPKSNVPYPFPAPHKEVVLVLAEWWKSDTEAVINEALNSGLAPNVSDAHTINGH  196

Query  684   PGPTPTCSSK---GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
              GP   CSS    G+ L+V+ GK YLLR++NAALNE+LFFK+AGH+L VVEVDA Y KPF
Sbjct  197   AGPLSGCSSSARDGFTLQVDKGKRYLLRIINAALNEDLFFKVAGHQLTVVEVDAAYTKPF  256

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLAS  1031
              TDT+ + PGQTTN LLTA Q AG+Y +  SPFMD+ +VA DN+TATAT+ Y  +   ++
Sbjct  257   TTDTLLLTPGQTTNVLLTARQGAGRYIVTASPFMDSPLVAVDNRTATATVQYANSVSTSA  316

Query  1032  TALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGS  1211
                T  P QNATPV ++FTDSLRSLNS+ YPA VP +VDHSL+F +G+GVNPC  C++GS
Sbjct  317   ITTTKPPPQNATPVASSFTDSLRSLNSQQYPAKVPATVDHSLLFTVGLGVNPCATCANGS  376

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVADINNVSFVMPTT LLQAHY+N SGVF
Sbjct  377   RVVADINNVSFVMPTTALLQAHYFNASGVF  406



>ref|XP_009143427.1| PREDICTED: laccase-4 [Brassica rapa]
Length=561

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/391 (66%), Positives = 308/391 (79%), Gaps = 5/391 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP   ESM+RHYKF V MKN +RLC+SKP V VNG++PGP +YARE DT++++V NHV+ 
Sbjct  18    FPAPSESMVRHYKFNVVMKNITRLCSSKPTVTVNGRYPGPTIYAREDDTLLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHGV+Q RTGW+DGPAYITQCP+QPGQ Y YN+TLTGQRGTL WH+HI W RATV
Sbjct  78    NVSIHWHGVRQVRTGWADGPAYITQCPLQPGQVYTYNYTLTGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK GVPYPFPKPD E++IVL EWW S+ E+VIN A++ G+ PNVSDAH ING 
Sbjct  138   HGAIVILPKRGVPYPFPKPDHEKVIVLAEWWKSDTENVINEALKSGLAPNVSDAHMINGH  197

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE--  857
              GP   C S+GY L V +GKTYLLR+VNAALNEELFFK+AGH   VVEVDA +VKPF+  
Sbjct  198   SGPVNNCPSQGYKLSVTNGKTYLLRLVNAALNEELFFKVAGHLFTVVEVDAVFVKPFKTA  257

Query  858   -TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
              TDT+ + PGQTTN LLT  + AGKY +  SPFMD+ +A DN TATAT+ Y GT   + T
Sbjct  258   TTDTVLIAPGQTTNVLLTTSKSAGKYLVTASPFMDSPIAVDNVTATATVHYSGTLSSSPT  317

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--G  1208
              LT+ P QNAT +   FT+SLRSLNS+ YPA VP ++DH L F +G+G+NPCP C +  G
Sbjct  318   TLTLPPPQNATTIANNFTNSLRSLNSKKYPALVPTTIDHHLFFTVGLGLNPCPTCKAGNG  377

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+F MP T LL AHY+NISGVF
Sbjct  378   SRVVASINNVTFTMPKTALLPAHYFNISGVF  408



>ref|XP_011032153.1| PREDICTED: laccase-4-like isoform X1 [Populus euphratica]
Length=523

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/370 (70%), Positives = 302/370 (82%), Gaps = 1/370 (0%)
 Frame = +3

Query  195   MKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTGWS  374
             MKN+++LC++KPIV VNG+FPGP L ARE DTV+V+V NHV+ NVSIHWHG++Q RTGW+
Sbjct  1     MKNSTKLCSTKPIVTVNGQFPGPTLVAREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWA  60

Query  375   DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYPFP  554
             DGPAYITQCPIQPGQSY+YNFT+TGQRGTL WH+HI W RATVHGAIVILPK GVPYPFP
Sbjct  61    DGPAYITQCPIQPGQSYVYNFTITGQRGTLFWHAHILWLRATVHGAIVILPKRGVPYPFP  120

Query  555   KPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCSSK-GYNLEV  731
              P KE++IVLGEWW S+VE VIN A + G+ PNVSDAHTING PGP   CSS  GYNL V
Sbjct  121   TPRKEKVIVLGEWWKSDVEAVINEATKSGMAPNVSDAHTINGHPGPVSACSSHGGYNLTV  180

Query  732   ESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTA  911
               GKTY+ R++NAALNEELFFKIAGH+L VVEVDA YVKPF+ DT+ + PGQTTN LLTA
Sbjct  181   HPGKTYMFRIINAALNEELFFKIAGHQLTVVEVDAAYVKPFKIDTVVIAPGQTTNVLLTA  240

Query  912   DQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQNATPVTTTFTD  1091
             ++ +GKY +A SPFMD  +A DN TATA L Y GT     T LT+ P +NATPV T FT+
Sbjct  241   NRGSGKYLVAASPFMDAPIAVDNVTATAILHYSGTLASTITTLTVPPAKNATPVATNFTN  300

Query  1092  SLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPTTPLLQ  1271
             +LRSLNS  YPA VPL +D SL F +G+GVNPC  C +GSRVVADINNV+FVMPT  LLQ
Sbjct  301   ALRSLNSIKYPARVPLKIDRSLFFTVGLGVNPCATCINGSRVVADINNVTFVMPTIALLQ  360

Query  1272  AHYYNISGVF  1301
             AH +NISGVF
Sbjct  361   AHVFNISGVF  370



>ref|XP_009346884.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/388 (66%), Positives = 310/388 (80%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP SVE M+RHYKF V  KN SRLC+SKPIV VNG++PGP +YARE DTV+V+V NH + 
Sbjct  18    FPASVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTIYAREDDTVLVKVVNHAKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ Y+YNFT+TGQRGTL WH+HI W RAT+
Sbjct  78    NVSIHWHGIRQLRTGWADGPAYITQCPIQPGQQYVYNFTITGQRGTLWWHAHILWLRATI  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGA+V+LPKLGVPYPFP P KE +++LGEWW S+ E VI  A++ G+ PNVSDAHTING 
Sbjct  138   HGALVVLPKLGVPYPFPAPQKEVVVILGEWWKSDTERVIRQALKFGLAPNVSDAHTINGH  197

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
              GP  TC S+ G  L V  GKTY+LR++NAALNEELFFKIA H+L VVEVDA Y KPF+T
Sbjct  198   TGPISTCQSQGGIKLPVRPGKTYMLRIINAALNEELFFKIANHKLTVVEVDAVYTKPFKT  257

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTTN L++ +  +GKY +A SPFMD   +  DN+TATATL Y GT    +T 
Sbjct  258   DTILIAPGQTTNVLVSTNHGSGKYLVAASPFMDNPTIVVDNKTATATLHYIGTLESTTTI  317

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             LT  P QNAT V T FT+SLRSLNS  +PA VPL +DHSL+F +G+G++ C +C++G+RV
Sbjct  318   LTFPPPQNATLVATNFTNSLRSLNSIQFPARVPLKIDHSLLFTVGLGLHTCASCANGNRV  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VADINNV+FVMP   LLQAH++NISGVF
Sbjct  378   VADINNVTFVMPKIGLLQAHFFNISGVF  405



>ref|XP_006349470.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=556

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/391 (68%), Positives = 311/391 (80%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  VE  IR Y F V MK T+RLC+SKPI  VNGKFPGP +YAREGD V+V V NHV
Sbjct  13    CLFPAFVECRIRRYNFNVMMKTTTRLCSSKPIATVNGKFPGPTIYAREGDNVLVNVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGWSDGPAYITQCPIQPGQ+Y+YNFT+TGQRGTL WH+HI W RA
Sbjct  73    KYNVSIHWHGVRQLRTGWSDGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGAIVILPKLGVPYPFPKPD E ++VL EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TMHGAIVILPKLGVPYPFPKPDHEAVVVLAEWWKSDTEAVINQAIKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG    C S+ GY L V+ GK+Y+LRV+NAALNEELFFKIAGH++ VVEVDATYVKPF
Sbjct  193   GHPGAISNCPSQGGYTLSVDPGKSYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN ++TA++ +GKY +A SPFMD  +A DN TATATL Y GT   + T
Sbjct  253   KTDTIIIAPGQTTNVIVTANKGSGKYMVAASPFMDAPIAVDNVTATATLHYSGTLASSIT  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACS--SG  1208
              LT  P +NATPV   F DSLRSLNS+ YPA VP  VDHSL F +G+GVNPC +C   +G
Sbjct  313   TLTNTPPKNATPVANNFIDSLRSLNSKKYPAKVPKKVDHSLFFTVGLGVNPCSSCKQGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPT  +LQAH++ I GV+
Sbjct  373   SRVVASINNVTFVMPTVAILQAHFFGIKGVY  403



>gb|EYU26646.1| hypothetical protein MIMGU_mgv1a003805mg [Erythranthe guttata]
Length=563

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/395 (68%), Positives = 311/395 (79%), Gaps = 7/395 (2%)
 Frame = +3

Query  138   CTFPVS-VESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANH  314
             C  PV  VE  +RHYKF V MKNT++LC+SK IV VNGKFPGP +YARE DTV+V+V NH
Sbjct  15    CLSPVLLVECKVRHYKFNVVMKNTTKLCSSKSIVTVNGKFPGPTIYAREDDTVLVKVVNH  74

Query  315   VQENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQR  494
             V  N+SIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTLLWH+HI W R
Sbjct  75    VNYNLSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLLWHAHILWLR  134

Query  495   ATVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTI  674
             +TVHGAIVILPKLGVPYPFPKP+ E +I+L EWW S+ E VIN A+  G+ PNVSDAHTI
Sbjct  135   STVHGAIVILPKLGVPYPFPKPNHERVIILAEWWKSDTEAVINEALTSGLAPNVSDAHTI  194

Query  675   NGLPGPTPTCSSK---GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYV  845
             NG PGP   C S    G+ L+V++GKTYLLR++NAALNEELFFKIAGH L VV+VDATYV
Sbjct  195   NGHPGPVTNCPSSTADGFTLKVKAGKTYLLRLINAALNEELFFKIAGHNLTVVDVDATYV  254

Query  846   KPFETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTI-VATDNQTATATLSYKGTHL  1022
             KPF+T TI + PGQTT A+LTAD+  GKY +A S FMDT  VA DN TATATL Y GT  
Sbjct  255   KPFKTGTIVIAPGQTTTAILTADRNTGKYIVAASTFMDTPGVAVDNTTATATLHYSGTLS  314

Query  1023  LASTALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACS  1202
              + T  T  P QNATPV   F +SLRSLNS+ YPA VP  VD SL+F IG+G+NPC  C 
Sbjct  315   TSPTTFTAPPPQNATPVANNFVNSLRSLNSKNYPAKVPQKVDRSLLFTIGLGINPCATCK  374

Query  1203  S--GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             +  GSRVVADINNV+FVMP   LLQAH +NI GVF
Sbjct  375   AGNGSRVVADINNVTFVMPKIALLQAHVFNIKGVF  409



>gb|EMT26873.1| Laccase-22 [Aegilops tauschii]
Length=563

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/388 (66%), Positives = 314/388 (81%), Gaps = 5/388 (1%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             +SV ++ RHYKF V M+N + LC++K I+ VNGKFPGP LYAREGD V+V+V NH   NV
Sbjct  24    LSVHAITRHYKFNVVMRNMTLLCSTKSILTVNGKFPGPTLYAREGDDVLVKVVNHSPHNV  83

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             +IHWHGV+Q RTGW DGPAYITQCPIQPG S+LYNFT+TGQRGTLLWH+HINW RATVHG
Sbjct  84    TIHWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTVTGQRGTLLWHAHINWLRATVHG  143

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVILPKLGVPYPFP P KE ++VLGEWW ++ E VIN AMQLG+ PN+SD+HTING PG
Sbjct  144   AIVILPKLGVPYPFPAPHKEAVVVLGEWWKADTETVINQAMQLGVGPNISDSHTINGHPG  203

Query  690   PTPTCSS--KGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             P   C+S   G+NL+VE+GKTY+LR++NA LN++LFFKIAGH L VVEVDA Y KP++TD
Sbjct  204   PMSDCASSQDGFNLDVENGKTYMLRIINAGLNDDLFFKIAGHGLTVVEVDAVYTKPYKTD  263

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALT  1043
              + + PGQTTN L+T DQ AG+Y +++SPF+D  +  DN+T TATL Y  T + A+  LT
Sbjct  264   ILLITPGQTTNVLVTTDQSAGRYLLSVSPFLDAPLQVDNKTGTATLQYANT-VSATARLT  322

Query  1044  IM--PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             ++  P QNATP+ + F++SLRSLNS+ YPANVP +VDHSL F IGVGVNPC  C +G+RV
Sbjct  323   LVKPPPQNATPIASKFSESLRSLNSKEYPANVPQTVDHSLFFTIGVGVNPCANCINGTRV  382

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             V  INN +FVMP+TP+LQA YY+I GVF
Sbjct  383   VGTINNSTFVMPSTPILQARYYSIPGVF  410



>ref|XP_006338994.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=557

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/391 (67%), Positives = 305/391 (78%), Gaps = 5/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FPV    + RHYKF V M+N S LC+SKPIV VNG+FPGP +YARE D V+++V NHV
Sbjct  15    CFFPVF--GVTRHYKFNVVMRNMSCLCSSKPIVTVNGRFPGPTIYAREDDRVLIKVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTL WH+HI W RA
Sbjct  73    KYNVSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFPKP+ E ++VLGEWW S+ E V N A+  G+ PNVSDAHTIN
Sbjct  133   TVHGAIVILPKRGVPYPFPKPNHEAVVVLGEWWKSDTEAVANEALNSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   C S+ GY L V  GKTY+LRV+NAALNEELFFKIAGH++ VVEVDATYVKPF
Sbjct  193   GHPGPVSNCPSQGGYRLSVAPGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN LLTADQ  GKY +  SPFMD+ V  DN TATATL Y G    A  
Sbjct  253   KTDTILIAPGQTTNVLLTADQNFGKYMVVASPFMDSPVTVDNVTATATLHYTGALSNAPM  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
              LT  P QNAT V   F  SL+SLNS+ YPA VP ++DHSL+F +G+G+NPCP C  S+G
Sbjct  313   TLTSAPPQNATSVANNFIHSLKSLNSKKYPAKVPKNIDHSLLFTVGLGINPCPTCIPSNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
              RVVA INNV+FVMP T LLQAH++ I  VF
Sbjct  373   IRVVASINNVTFVMPKTALLQAHFFGIKNVF  403



>ref|XP_008358974.1| PREDICTED: laccase-4-like [Malus domestica]
Length=557

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/387 (66%), Positives = 307/387 (79%), Gaps = 1/387 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP SVE M+RHYKF V  KN SRLC+SKPIV VNG++PGP +YARE DTV+V+V NH + 
Sbjct  18    FPASVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTIYAREDDTVLVKVVNHAKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ Y+YNFT+TGQRGTL WH+HI W RAT+
Sbjct  78    NVSIHWHGIRQLRTGWADGPAYITQCPIQPGQQYVYNFTITGQRGTLWWHAHILWLRATI  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGA+V+LPKLGVPYPFP P KE +++LGEWW S+ E VI  A++ G+ PNVSDAHTING 
Sbjct  138   HGALVVLPKLGVPYPFPAPQKEVVVILGEWWKSDTERVIRQALKSGLAPNVSDAHTINGY  197

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PGP  TC S+G  L V  GKTY+LR++NAALNEELFFKIA H+L VVEVDA Y KPF+TD
Sbjct  198   PGPISTCQSQGGLLPVRPGKTYMLRIINAALNEELFFKIANHKLTVVEVDAVYTKPFKTD  257

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTAL  1040
             T  + PGQTTN L++ +  +GKY +A SPFMD   +  DN+TATATL Y GT     T L
Sbjct  258   TXLIAPGQTTNVLVSTNHGSGKYLVAASPFMDNPTIVVDNKTATATLHYIGTLESTRTIL  317

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T  P QNAT V T FT+SLRSLNS  +PA VPL +DHSL+F +G+G++ C +C++G RVV
Sbjct  318   TSPPPQNATLVATNFTNSLRSLNSIRFPARVPLKIDHSLLFTVGLGLHTCDSCANGIRVV  377

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             ADINNV+FVMP   LLQAH++N SGVF
Sbjct  378   ADINNVTFVMPKIALLQAHFFNXSGVF  404



>ref|XP_004249084.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=556

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/391 (68%), Positives = 310/391 (79%), Gaps = 3/391 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C FP  VE  IR Y F V MK T+RLC+SKPI  VNGKFPGP +YAREGD V+V V NHV
Sbjct  13    CLFPAFVECRIRRYNFNVMMKTTTRLCSSKPIATVNGKFPGPTIYAREGDNVLVNVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + NVSIHWHGV+Q RTGWSDGPAYITQCPIQPGQ+Y+YNFT+TGQRGTL WH+HI W RA
Sbjct  73    KYNVSIHWHGVRQLRTGWSDGPAYITQCPIQPGQNYVYNFTITGQRGTLFWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGAIVILPKLGVPYPFPKPD E +++L EWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  133   TMHGAIVILPKLGVPYPFPKPDHEAVVILAEWWKSDTEAVINQAIKSGLAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG    C S+ GY L V+ GK+Y+LRV+NAALNEELFFKIAGH++ VVEVDATYVKPF
Sbjct  193   GHPGAISNCPSQGGYTLSVDPGKSYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             +TDTI + PGQTTN ++TAD+ +GKY +A SPFMD  +A DN TATATL Y GT   + T
Sbjct  253   KTDTIIIAPGQTTNVIVTADKGSGKYMVAASPFMDAPIAVDNVTATATLHYSGTLASSIT  312

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACS--SG  1208
              LT  P +NAT V   F DSLRSLNS+ YPA VP  VDHSL F +G+GVNPC +C   +G
Sbjct  313   TLTKTPPKNATTVANNFIDSLRSLNSKKYPAKVPKKVDHSLFFTVGLGVNPCSSCKQGNG  372

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+FVMPT  +LQAH++ I GV+
Sbjct  373   SRVVASINNVTFVMPTVAILQAHFFGIKGVY  403



>dbj|BAJ98144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/389 (66%), Positives = 316/389 (81%), Gaps = 7/389 (2%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             +SV ++ RHYKF V M+N + LC++K I+ VNGKFPGP LYAREGD V+V+V NH   NV
Sbjct  25    LSVHAIARHYKFNVVMRNMTLLCSTKSILTVNGKFPGPTLYAREGDNVLVKVVNHAPHNV  84

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             +IHWHGV+Q RTGW DGPAYITQCPIQPG S+LYNFT+TGQRGTLLWH+HINW RATVHG
Sbjct  85    TIHWHGVRQIRTGWYDGPAYITQCPIQPGSSFLYNFTVTGQRGTLLWHAHINWLRATVHG  144

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVILPKLGVPYPFP P KE ++VLGEWW ++ E VIN AMQLG+ PN+SD+HTING PG
Sbjct  145   AIVILPKLGVPYPFPAPHKEAVVVLGEWWKADTETVINQAMQLGVGPNISDSHTINGHPG  204

Query  690   PTPTCSS--KGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             P   C+S   G+ L+VE+ KTY+LR++NA LN++LFFKIAGH L VVEVDA Y KP++TD
Sbjct  205   PMSACASSQDGFKLDVENSKTYMLRIINAGLNDDLFFKIAGHGLTVVEVDAVYTKPYKTD  264

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA-L  1040
              + + PGQTTN L+TADQ AG+Y +++SPFMD  +  DN+T TATL Y  T  +++TA L
Sbjct  265   ILLITPGQTTNVLVTADQSAGRYLLSVSPFMDAPLQVDNKTGTATLHYANT--VSTTARL  322

Query  1041  TIM--PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
             T++  P QNATP+ +TF++SLRSLNS+ YPANVP +VDHSL F IGVGVNPC  C +G+R
Sbjct  323   TLVNPPPQNATPIASTFSESLRSLNSKEYPANVPQTVDHSLFFTIGVGVNPCANCINGTR  382

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VV  INN +FVMP+TP+LQA YY+I GVF
Sbjct  383   VVGTINNSTFVMPSTPILQARYYSIPGVF  411



>ref|XP_008775059.1| PREDICTED: laccase-22-like [Phoenix dactylifera]
Length=554

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/387 (68%), Positives = 307/387 (79%), Gaps = 1/387 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
              PV  +   R YKF V +K  +RLC SKPIV VNG+FPGP LYA EGD V+V V N+V+ 
Sbjct  15    LPVLADGRTRKYKFNVAVKKVTRLCYSKPIVTVNGRFPGPTLYAEEGDNVLVEVVNNVKY  74

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGW+DGPAYITQCPIQPG SY+YNFT+TGQRGTL WH+HI W RATV
Sbjct  75    NVTIHWHGVRQIRTGWADGPAYITQCPIQPGHSYVYNFTITGQRGTLFWHAHILWLRATV  134

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIV+LPK  VPYPFP P KEE+I+LGEWW S+ E VIN A++ G+ PNVSDAH ING 
Sbjct  135   HGAIVVLPKPNVPYPFPAPQKEEVIILGEWWKSDTEAVINEALKSGLAPNVSDAHIINGH  194

Query  684   PGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP   C +SKG+ L V+SGKTYLLR+VNAALNEELFFK+AGH+L VVEVDA Y KPF+T
Sbjct  195   PGPMSDCPTSKGFQLTVDSGKTYLLRIVNAALNEELFFKVAGHQLTVVEVDACYTKPFKT  254

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
             DTI + PGQTTN LLTADQ AG Y +  SPFMD+ +A DN+TA AT+ Y  +   A    
Sbjct  255   DTILITPGQTTNVLLTADQGAGSYLVTASPFMDSPIAVDNKTAMATVHYTNSVATADLTT  314

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
             T  P QNATPV + F DSLRSLNS  YPA VPL+VDHSL+F +G+GVNPCP C +GSRVV
Sbjct  315   TNPPPQNATPVASKFIDSLRSLNSEQYPARVPLTVDHSLLFTVGLGVNPCPTCVNGSRVV  374

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             AD+NNVSF MPTT +LQAHY+NISGVF
Sbjct  375   ADMNNVSFTMPTTAILQAHYFNISGVF  401



>ref|XP_009374280.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/388 (66%), Positives = 310/388 (80%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FPVSVE M+RHYKF V  KN SRLC+SKPIV VNG++PGP +YARE DTV+++V NHV+ 
Sbjct  18    FPVSVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTIYAREDDTVLIKVVNHVKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPIQP Q Y+YNFT+TGQRGTL WH+HI W RATV
Sbjct  78    NVSIHWHGIRQLRTGWADGPAYITQCPIQPDQQYVYNFTITGQRGTLWWHAHILWLRATV  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGA+VILPKLGVPYPFP P KE +++LGEWW S+ E VIN A++ G+ PNVSDAHTING 
Sbjct  138   HGALVILPKLGVPYPFPAPQKELVVILGEWWKSDTEAVINEALRSGLAPNVSDAHTINGH  197

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP  TC  + G  L V  GKTY+LR++NAALNEELFFKIA H+L VVEVDA Y KPF+T
Sbjct  198   PGPLSTCQPQGGLKLPVRPGKTYMLRIINAALNEELFFKIANHKLTVVEVDAVYTKPFKT  257

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTTN L+T +  +GK+ +A SPFMD   +  DN+TATATL Y GT     T 
Sbjct  258   DTILIAPGQTTNVLVTTNLGSGKFLVAASPFMDNPTIVVDNKTATATLHYIGTLQSTKTI  317

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             LT  P QNAT V T FT+SL+SLNS  +PA VPL VDHSL+F + +G++ C +C++G+RV
Sbjct  318   LTAPPPQNATIVATNFTNSLKSLNSIRFPARVPLKVDHSLLFTVSLGLHTCASCTNGNRV  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VADINNV+FVMP   LLQAH++NISGVF
Sbjct  378   VADINNVTFVMPKIALLQAHFFNISGVF  405



>ref|XP_009337309.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/388 (66%), Positives = 310/388 (80%), Gaps = 2/388 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP SVE M+RHYKF V  KN SRLC+SKPIV VNG++PGP +YARE DTV+V+V NH + 
Sbjct  18    FPASVECMVRHYKFNVVQKNISRLCSSKPIVTVNGRYPGPTIYAREDDTVLVKVVNHAKY  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPIQPGQ Y+YNFT+TGQRGTL WH+HI W RAT+
Sbjct  78    NVSIHWHGIRQLRTGWADGPAYITQCPIQPGQQYVYNFTITGQRGTLWWHAHILWLRATI  137

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGA+V+LPKLGVPYPFP P KE +++LGEWW S+ E VI  A++ G+ PNVSDAHTING 
Sbjct  138   HGALVVLPKLGVPYPFPAPQKEVVVILGEWWKSDTERVIRQALKSGLAPNVSDAHTINGH  197

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
              GP  TC S+ G  L V  GKTY+LR++NAALNEELFFKIA H+L VVEVDA Y KPF+T
Sbjct  198   TGPISTCQSQGGIKLPVRPGKTYMLRIINAALNEELFFKIANHKLTVVEVDAVYTKPFKT  257

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTTN L++ +  +GKY +A SPFMD   +  DN+TATATL Y GT    +T 
Sbjct  258   DTILIAPGQTTNVLVSTNHGSGKYLVAASPFMDNPTIVVDNKTATATLHYIGTLESTTTI  317

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             LT  P QNAT V T FT+SLRSLNS  +PA VPL +DHSL+F +G+G++ C +C++G+RV
Sbjct  318   LTFPPPQNATLVATNFTNSLRSLNSIQFPARVPLKIDHSLLFTVGLGLHTCASCANGNRV  377

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VADINNV+FVMP   LLQAH++NISGVF
Sbjct  378   VADINNVTFVMPKIGLLQAHFFNISGVF  405



>ref|XP_010535416.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535417.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535418.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535419.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
Length=568

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/395 (68%), Positives = 310/395 (78%), Gaps = 7/395 (2%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P +V SM+RHYKF V MKNT++LC+SKPIV VNG FPGP + ARE DTV+V+V NHV
Sbjct  21    CLLPTTVHSMVRHYKFNVVMKNTTKLCSSKPIVTVNGMFPGPTIVAREDDTVLVKVVNHV  80

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPAYITQCPIQ GQSY YNFTL GQRGTL WH+HI W RA
Sbjct  81    KYNLSIHWHGIRQLRTGWADGPAYITQCPIQTGQSYTYNFTLAGQRGTLWWHAHILWLRA  140

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPKLGVPYPFP+P KE+IIVLGEWW S+VE VIN A + G+ PNVSDAHTIN
Sbjct  141   TVHGAIVILPKLGVPYPFPQPHKEKIIVLGEWWKSDVEAVINEATRSGLAPNVSDAHTIN  200

Query  678   GLPGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G  GP P C S +GY L V+ GKTY+LR+VNAALNEELFFKIAGH L VVEVDA Y KPF
Sbjct  201   GHTGPLPNCPSQQGYGLPVKPGKTYMLRIVNAALNEELFFKIAGHELTVVEVDAVYTKPF  260

Query  855   ETDTIFVGPGQTTNALLTADQKAG-KYQIAISPFMDTIVATDNQTATATLSYKG-----T  1016
             +TDT+ + PGQTTN LLTA+  AG  Y +A + +MD  +A DN TATATL Y G      
Sbjct  261   KTDTVVIAPGQTTNVLLTANAYAGSNYMVAATTYMDAPIAFDNVTATATLHYVGPTTANA  320

Query  1017  HLLASTALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPA  1196
             +  A T L  +P QNAT V T F  SLRSLNS  YPA VP++VDHSL F +G+GVNPC +
Sbjct  321   NAAAKTVLATLPPQNATWVATKFIKSLRSLNSEEYPARVPMNVDHSLFFTVGLGVNPCRS  380

Query  1197  CSSGSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             C +GSRVVADINNV+FVMP   LLQAH++N+ GVF
Sbjct  381   CVNGSRVVADINNVTFVMPKIALLQAHFFNLPGVF  415



>ref|XP_004302643.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/387 (68%), Positives = 316/387 (82%), Gaps = 5/387 (1%)
 Frame = +3

Query  156   VESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSI  335
             VES +R+YKF V ++NT+RLC++KPIV +NG+FPGP LYARE DTV+V+V NHV  NVSI
Sbjct  20    VESRVRNYKFNVVLRNTTRLCSTKPIVTINGRFPGPTLYAREDDTVLVKVTNHVTYNVSI  79

Query  336   HWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAI  515
             HWHG++Q RTGWSDGPAYITQCPI  GQS+ YNFT+TGQRGTLLWH+HI W RATVHGA+
Sbjct  80    HWHGIRQIRTGWSDGPAYITQCPIPQGQSFTYNFTITGQRGTLLWHAHILWLRATVHGAL  139

Query  516   VILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG-P  692
             VILPK GVPYPFP P KE  +VL EWW S+ E VIN A++ G+ PNVSDAHTING PG  
Sbjct  140   VILPKRGVPYPFPTPHKEVPVVLAEWWKSDTEAVINEALKGGLAPNVSDAHTINGHPGLV  199

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
             +P C++  G+ L VESGKTYLLR++NAALNEELFFKIAGH+L +VEVDATYVKPF+TDTI
Sbjct  200   SPNCTTDGGFKLSVESGKTYLLRIINAALNEELFFKIAGHKLTIVEVDATYVKPFKTDTI  259

Query  870   FVGPGQTTNALLTADQKAGKYQIAISPFMDTI-VATDNQTATATLSYKGTHLLASTALTI  1046
              + PGQTTNAL+TA+QK+GKY +  SPF+DT  +A DN T+TAT+ Y GT   + T LT 
Sbjct  260   VIAPGQTTNALITANQKSGKYLVTASPFLDTPGIAVDNLTSTATVHYSGTLSNSPTTLTS  319

Query  1047  MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSRVV  1220
              P QNAT V  +FTDSLRSLN+  +PA VPL +DH+L+F IG+G+NPCP+C +  GSRVV
Sbjct  320   PPPQNATQVANSFTDSLRSLNTMKFPAKVPLKIDHNLLFTIGLGINPCPSCKAGNGSRVV  379

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             A INNV+FVMPTT LLQAH++   GVF
Sbjct  380   ASINNVTFVMPTTALLQAHFFKTKGVF  406



>gb|AES99522.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=529

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/371 (68%), Positives = 303/371 (82%), Gaps = 0/371 (0%)
 Frame = +3

Query  189   VEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTG  368
             V +KN ++LC++K  V VNGKFPGP LYARE DT++VRV N VQ NV+IHWHG+KQ RT 
Sbjct  5     VVLKNETKLCSTKSFVSVNGKFPGPTLYAREDDTLIVRVTNLVQHNVTIHWHGIKQLRTC  64

Query  369   WSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYP  548
             WSDGPAY+TQCPIQ GQS++YNFT+TGQRGTLLWH+HI W RAT+HGAIVILPK G PYP
Sbjct  65    WSDGPAYVTQCPIQTGQSFVYNFTITGQRGTLLWHAHITWLRATMHGAIVILPKRGTPYP  124

Query  549   FPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCSSKGYNLE  728
             FPKPDKE+II+LGEWW S+VE V+N A   G+PPN+SDAHTING PGP P C S+GY L 
Sbjct  125   FPKPDKEKIIILGEWWKSDVEAVVNQATSSGMPPNISDAHTINGHPGPVPGCISQGYTLH  184

Query  729   VESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLT  908
             VESGKTYLLR++NAALN+ELFFKIAGH+L VVE DA+Y+KPFE DTIF+ PGQTTN LLT
Sbjct  185   VESGKTYLLRIINAALNDELFFKIAGHKLIVVEADASYLKPFEIDTIFLSPGQTTNVLLT  244

Query  909   ADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQNATPVTTTFT  1088
             A+Q  GKY IAI+PFMD  +  DN ++ ATL YKG      T LT +P  NATP+T TFT
Sbjct  245   ANQPIGKYLIAITPFMDAPIGFDNLSSIATLRYKGIPPYTKTILTNIPPLNATPITKTFT  304

Query  1089  DSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPTTPLL  1268
             DSLRSLNS+ YP  V L++DHSL+FAI VG+NPC  C + +++V+ INN++F+MPT  LL
Sbjct  305   DSLRSLNSKTYPTRVSLTIDHSLLFAITVGLNPCDTCITDNKLVSAINNITFLMPTVSLL  364

Query  1269  QAHYYNISGVF  1301
             QA+YYNI GVF
Sbjct  365   QANYYNIKGVF  375



>ref|XP_004506788.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=557

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/392 (66%), Positives = 310/392 (79%), Gaps = 4/392 (1%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +R YKF V  KN SRLC+SK IV VNG+FPGP LYARE DTV+VRV N V
Sbjct  13    CILPALVECKVRRYKFHVVAKNISRLCSSKSIVTVNGEFPGPTLYAREDDTVLVRVVNKV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
               N++IHWHG++Q RTGW+DGPAY+TQCPI PG SY+YNFT+TGQRGTLLWH+H+NW R+
Sbjct  73    NHNITIHWHGIRQLRTGWADGPAYVTQCPILPGHSYVYNFTITGQRGTLLWHAHVNWLRS  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFPKPD+E ++VLGEWW S+ E +IN A++ G+ PNVSD+HTIN
Sbjct  133   TVHGAIVILPKRGVPYPFPKPDEELVLVLGEWWKSDTEAIINEALKSGMAPNVSDSHTIN  192

Query  678   GLPGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PG    CS++  YNL VESGK+YLLR++NAALNEELFFKIA H+L +VEVDATYVKPF
Sbjct  193   GFPGKVSNCSNQEVYNLPVESGKSYLLRIINAALNEELFFKIANHKLTIVEVDATYVKPF  252

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLL-AS  1031
             E +TI + PGQTTN LL A+QK+GKY +A SPFMD  VA DN TATATL Y G  L    
Sbjct  253   EIETIVIAPGQTTNVLLKANQKSGKYLVAASPFMDAPVAVDNLTATATLHYSGLTLSNTP  312

Query  1032  TALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SS  1205
             T LT  P +N+T     F +SLR LNS+ YP N+PL +DHSL F IG+G+ PCP+C  ++
Sbjct  313   TFLTTPPPKNSTENANNFLNSLRGLNSKTYPVNLPLKIDHSLYFTIGLGLQPCPSCKAAN  372

Query  1206  GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             GSRVVA +NNV+FVMPTT LLQAHY+NI GVF
Sbjct  373   GSRVVAAVNNVTFVMPTTALLQAHYFNIGGVF  404



>ref|XP_010464832.1| PREDICTED: laccase-22-like [Camelina sativa]
Length=554

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/382 (67%), Positives = 307/382 (80%), Gaps = 2/382 (1%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             E+ IR YKF V MKN ++LC++KPIV +NGKFPGP LYARE D V+V + N+V  N++IH
Sbjct  22    EANIRRYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNNVNYNITIH  81

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHGVKQ RTGWSDGPAYITQCP+QPG +++YNFTLTGQRGTLLWH+HI+W RATVHGAIV
Sbjct  82    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  141

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             ILPK GVPYPFP+P  E+IIV GEWWNS+VE VI+ + Q G+PPN+SD HTINGL G  P
Sbjct  142   ILPKRGVPYPFPRPHTEKIIVFGEWWNSDVEAVISQSTQSGLPPNISDGHTINGLTGQVP  201

Query  699   TCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVG  878
              C S+GY L VE+GK YLLR++NAA+N+ELFFKI GH L VVEVDATY KPF+T+T+F+G
Sbjct  202   GCKSRGYTLHVETGKKYLLRIINAAVNDELFFKITGHNLTVVEVDATYTKPFDTETLFLG  261

Query  879   PGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQ  1058
             PGQTTNA+LTA+   G + + ISPFMDT+V  +N TATA L YK T   +  +  I P+ 
Sbjct  262   PGQTTNAILTANHPQGNFLMTISPFMDTVVPVNNVTATAILRYKYTRTQSLKSSKIPPV-  320

Query  1059  NATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNV  1238
             NAT +   F+DSLRSLNS  YP NVPL VDHSL FAIGVGVNPC  C +G++ +ADINNV
Sbjct  321   NATSIALGFSDSLRSLNSPDYPTNVPLKVDHSLFFAIGVGVNPCATCINGTKTIADINNV  380

Query  1239  SFVMPTTPLLQAHYYNIS-GVF  1301
             SFVMPT  +LQAHY+N S GVF
Sbjct  381   SFVMPTVAMLQAHYFNKSEGVF  402



>ref|XP_009593274.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=554

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/382 (67%), Positives = 309/382 (81%), Gaps = 3/382 (1%)
 Frame = +3

Query  165   MIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWH  344
             + RHYKF V M+N SRLC++KPIV VNG+FPGP +YARE D V+++V NHV+ NV+IHWH
Sbjct  20    ITRHYKFNVVMRNMSRLCSTKPIVTVNGRFPGPTIYAREDDRVLIKVVNHVKYNVTIHWH  79

Query  345   GVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVIL  524
             G++Q RTGW+DGPAYITQCPIQPGQSY+YNFT+TGQRGTL WH+H+ W R+TVHGAIV+L
Sbjct  80    GIRQLRTGWADGPAYITQCPIQPGQSYIYNFTITGQRGTLFWHAHVLWLRSTVHGAIVVL  139

Query  525   PKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTC  704
             PK GVPYPFPKP+ E ++VL EWW S+ E VIN A++ G+ PNVSDAHTING PGP   C
Sbjct  140   PKRGVPYPFPKPNHEAVVVLAEWWKSDTEAVINEALKSGLAPNVSDAHTINGHPGPVSNC  199

Query  705   SSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGP  881
              ++ GY+L VE GKTY+LRV+NAALNEELFFKIAGH++ VVEVDATYVKPF+TDTI + P
Sbjct  200   PTQGGYSLSVEPGKTYMLRVINAALNEELFFKIAGHKMTVVEVDATYVKPFKTDTIVIAP  259

Query  882   GQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQN  1061
             GQTTN ++TADQ  GKY +A SPFMD  +A DN TATATL Y G    + T LT  P QN
Sbjct  260   GQTTNVIVTADQSFGKYMVAASPFMDAPIAVDNITATATLHYSGALGTSPTTLTSTPPQN  319

Query  1062  ATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSGSRVVADINN  1235
             AT V   F D+L+SLNS+ YPA VP +VDHSL F  G+G+NPCP C  ++GSRVVA +NN
Sbjct  320   ATSVANNFLDALKSLNSKKYPAKVPQTVDHSLFFTAGLGINPCPTCKQANGSRVVASVNN  379

Query  1236  VSFVMPTTPLLQAHYYNISGVF  1301
             V+FVMPT  LLQAH++ I+GVF
Sbjct  380   VTFVMPTVALLQAHFFGINGVF  401



>ref|XP_007134763.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
 gb|ESW06757.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
Length=527

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/374 (70%), Positives = 304/374 (81%), Gaps = 3/374 (1%)
 Frame = +3

Query  189   VEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTG  368
             V  K T RLC+SK IV +NGKFPGP LYARE DTV+V+V N V  NV+IHWHGV+Q RTG
Sbjct  1     VVAKQTPRLCSSKSIVTINGKFPGPTLYAREDDTVLVKVINQVNHNVTIHWHGVRQLRTG  60

Query  369   WSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYP  548
             W+DGPAY+TQCPIQPGQ+YLYNFTLTGQRGTLL+H+H+NW R+T+HGA+VILPK GVPYP
Sbjct  61    WADGPAYVTQCPIQPGQTYLYNFTLTGQRGTLLYHAHVNWLRSTLHGALVILPKRGVPYP  120

Query  549   FPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCSSKG-YNL  725
             FPKPD E ++VLGEWW S+ E +IN A++ G+ PNVSDAHTINGLPG    CSSK  YNL
Sbjct  121   FPKPDDELVVVLGEWWKSDTEAIINEALKSGLAPNVSDAHTINGLPGTVTNCSSKDVYNL  180

Query  726   EVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALL  905
              VE GKTYLLR+VNAALNEELFFKIAGH+L VVEVDATYVKPF+ +TI + PGQTTN LL
Sbjct  181   PVEGGKTYLLRIVNAALNEELFFKIAGHKLTVVEVDATYVKPFKIETIVIAPGQTTNVLL  240

Query  906   TADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQNATPVTTTF  1085
             +ADQK+GKY +A SPFM+  VA DN TATATL Y GT     T LT  P +NAT V T F
Sbjct  241   SADQKSGKYLVAASPFMNAPVAVDNLTATATLHYTGTLATTPTVLTTPPPKNATQVATNF  300

Query  1086  TDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSGSRVVADINNVSFVMPTT  1259
               SLR LNS+ YP NVPL+VDHSL F  G+G+NPCP+C  ++GSRVVA INNV+F+MPT 
Sbjct  301   ISSLRGLNSKKYPVNVPLTVDHSLFFTAGLGINPCPSCKAANGSRVVASINNVTFLMPTI  360

Query  1260  PLLQAHYYNISGVF  1301
              LLQAHY+NI GVF
Sbjct  361   ALLQAHYFNIKGVF  374



>ref|XP_010494695.1| PREDICTED: laccase-22-like [Camelina sativa]
Length=554

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/382 (66%), Positives = 307/382 (80%), Gaps = 2/382 (1%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             ++ IR Y+F V MKN ++LC++KPIV +NGKFPGP LYARE D V+V + N+V  N++IH
Sbjct  22    DANIRRYRFNVVMKNMTKLCSTKPIVTINGKFPGPALYAREDDNVIVNLINNVNYNITIH  81

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHGVKQ RTGWSDGPAYITQCP+QPG +++YNFTLTGQRGTLLWH+HI+W RATVHGAIV
Sbjct  82    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  141

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             ILPK GV YPFP+P  E IIV GEWWNS+VE VI+ + Q G+PPN+SDAHTINGL G  P
Sbjct  142   ILPKRGVLYPFPRPHTERIIVFGEWWNSDVEAVISQSTQSGLPPNISDAHTINGLIGQVP  201

Query  699   TCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVG  878
             +C S+GY L VE+GK YLLR++NAA+N+ELFFKI GH L VVEVDA+Y KPF+T+T+F+G
Sbjct  202   SCKSRGYTLNVETGKKYLLRIINAAVNDELFFKITGHNLTVVEVDASYTKPFDTETLFLG  261

Query  879   PGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQ  1058
             PGQTTNA+LTA+   G + + ISPFMDT+V  +N TATA L YK T      +  I P+ 
Sbjct  262   PGQTTNAILTANHPQGNFLMTISPFMDTVVPVNNVTATAFLRYKDTRTQVLKSSKIPPV-  320

Query  1059  NATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNV  1238
             NAT +   F+DSLRSLNS+ YP NVPL VDHSL FAIGVGVNPC  C +G++ +ADINNV
Sbjct  321   NATSIALGFSDSLRSLNSQDYPTNVPLKVDHSLFFAIGVGVNPCATCINGTKTIADINNV  380

Query  1239  SFVMPTTPLLQAHYYNIS-GVF  1301
             SFVMPT  +LQAHY+N S GVF
Sbjct  381   SFVMPTVAMLQAHYFNKSEGVF  402



>ref|XP_009146739.1| PREDICTED: laccase-22-like [Brassica rapa]
Length=560

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/383 (66%), Positives = 304/383 (79%), Gaps = 2/383 (1%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             E+ IRHYKF V MKN ++LC++KPIV +NGKFPGP LYARE D V+V + N V  NV+IH
Sbjct  21    EANIRHYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNSVSYNVTIH  80

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHGVKQ RTGWSDGPAYITQCP+QPG +++YNFTLTGQRGTLLWH+HI+W RATVHGAIV
Sbjct  81    WHGVKQLRTGWSDGPAYITQCPVQPGGNFIYNFTLTGQRGTLLWHAHISWLRATVHGAIV  140

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             ILPK GVPYPFP+P  +++IV GEWW S+VEDVI  + Q G+PPN+SDAHTINGL GP  
Sbjct  141   ILPKRGVPYPFPRPHTDKVIVFGEWWKSDVEDVIKQSTQSGLPPNLSDAHTINGLTGPIT  200

Query  699   TC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFV  875
              C +S GY + VE+GK+YLLR++NAA+N+ELFFKIA H L VVEVDA+Y KP+ T+T+F+
Sbjct  201   GCNNSHGYTIHVETGKSYLLRIINAAVNDELFFKIAQHNLTVVEVDASYTKPYNTETLFL  260

Query  876   GPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPL  1055
             GPGQT NA+LTA+   G + + ISPFMDT+V  DN TATA L YK T    S  ++  P 
Sbjct  261   GPGQTANAVLTANHPTGNFLMTISPFMDTVVPVDNATATAFLRYKNTTTTDSLTMSNTPP  320

Query  1056  QNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINN  1235
              NAT +   F+DSLRSLNS  YP NVPL +DHSL FAIGVGVNPC  C +G++ +ADINN
Sbjct  321   INATSIAQNFSDSLRSLNSLKYPTNVPLKIDHSLFFAIGVGVNPCATCINGTKTIADINN  380

Query  1236  VSFVMPTTPLLQAHYYNIS-GVF  1301
             V+FVMP   LLQAHY+N S GVF
Sbjct  381   VTFVMPAMALLQAHYFNKSQGVF  403



>emb|CDY01010.1| BnaC05g41900D [Brassica napus]
Length=559

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/383 (67%), Positives = 308/383 (80%), Gaps = 3/383 (1%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             E+ IRHYKF V MKN ++LC++KPIV +NGKFPGP LYARE D V+V + N+V  NV+IH
Sbjct  21    EANIRHYKFNVVMKNMTKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNNVSYNVTIH  80

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHGVKQ RTGWSDGPAYITQCP+QPG +++YNFTLTGQRGTLLWH+HI+W RATVHGAIV
Sbjct  81    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  140

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             ILPK GVPYPFP+P  ++IIV GEWW S+VEDVI  + Q G+PPN+SDAHTINGL GP  
Sbjct  141   ILPKRGVPYPFPRPHTDKIIVFGEWWKSDVEDVIKQSTQSGLPPNLSDAHTINGLTGPIT  200

Query  699   TC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFV  875
              C +S GY + VE+GK+YLLR++NAA+N+ELFFKIA H L VVEVDA+Y KPF T+T+F+
Sbjct  201   GCNNSHGYTIHVETGKSYLLRIINAAVNDELFFKIAQHNLTVVEVDASYTKPFNTETLFL  260

Query  876   GPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPL  1055
             GPGQT NA+LTA+   G + + ISPFMDT+V  +N TATA L YK T   + T   I P+
Sbjct  261   GPGQTANAILTANHPTGNFLMTISPFMDTVVPVNNATATAFLRYKTTTTQSLTLSKIPPI  320

Query  1056  QNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINN  1235
              NAT +   F+D+LRSLNSR YP NVPL VDHSL FAIGVGVNPC  C +G++ +ADINN
Sbjct  321   -NATSIAQNFSDALRSLNSRDYPTNVPLKVDHSLFFAIGVGVNPCATCINGTKNIADINN  379

Query  1236  VSFVMPTTPLLQAHYYNIS-GVF  1301
             V+FVMPT  LLQAHY+N S GVF
Sbjct  380   VTFVMPTMALLQAHYFNKSKGVF  402



>gb|KDO37344.1| hypothetical protein CISIN_1g009854mg [Citrus sinensis]
Length=524

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/371 (68%), Positives = 300/371 (81%), Gaps = 2/371 (1%)
 Frame = +3

Query  195   MKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTGWS  374
             MKN +RLC++KPIV VNG FPGP + ARE DTV+V+V NHV+ NVSIHWHGV+Q RT W+
Sbjct  1     MKNATRLCSTKPIVTVNGYFPGPTIVAREDDTVLVKVVNHVKYNVSIHWHGVRQLRTCWA  60

Query  375   DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYPFP  554
             DGPAYITQCPIQPGQ+Y+YNFTL GQRGTL WH+HI W RATVHGAIVILPK GVPYPFP
Sbjct  61    DGPAYITQCPIQPGQNYIYNFTLAGQRGTLWWHAHILWLRATVHGAIVILPKRGVPYPFP  120

Query  555   KPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCSSK-GYNLEV  731
             KP KE  ++L EWW S+VE VIN A++ G+ PNVSDAHTING PGP  +C S+ G+ L V
Sbjct  121   KPHKEVTVILSEWWKSDVEAVINEALKSGLAPNVSDAHTINGHPGPLSSCPSQGGFKLPV  180

Query  732   ESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTA  911
             ESGKTY+LR++NAALNEELFFKIAGH+L VVEVDA YVKPF+T+T+ + PGQTTN LL+A
Sbjct  181   ESGKTYMLRLINAALNEELFFKIAGHKLTVVEVDAAYVKPFKTETVLIAPGQTTNVLLSA  240

Query  912   DQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTALTIMPLQNATPVTTTFT  1088
                 GKY +A SPF+DT  +  DN+TATAT+ Y GT    +T LT+ P +NATPV   FT
Sbjct  241   AHATGKYLVAASPFLDTPAILVDNKTATATVHYSGTLGSTATTLTVPPPRNATPVAANFT  300

Query  1089  DSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPTTPLL  1268
              SLRSLNS+ YPA VPL +DHSL F IG+G+NPC  C +GSRVVADINNV+FVMPT  LL
Sbjct  301   ASLRSLNSKKYPARVPLKIDHSLFFTIGLGINPCATCVNGSRVVADINNVTFVMPTISLL  360

Query  1269  QAHYYNISGVF  1301
             QAH++ I GVF
Sbjct  361   QAHFFKIGGVF  371



>ref|XP_010676357.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=561

 Score =   535 bits (1379),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/392 (66%), Positives = 305/392 (78%), Gaps = 4/392 (1%)
 Frame = +3

Query  138   CTFP-VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANH  314
             C  P + VE  +RHYKF V MKN +R C++K IV VNGKFPGP + ARE DTV+V+V NH
Sbjct  16    CILPAILVECRVRHYKFNVVMKNHTRQCSTKSIVTVNGKFPGPTIVAREDDTVLVKVVNH  75

Query  315   VQENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQR  494
             V+ N++IHWHG++Q RTGWSDGPAYI QCPIQPGQ+Y YNFT+TGQRGTL +H+HI W R
Sbjct  76    VKYNLTIHWHGIRQIRTGWSDGPAYIAQCPIQPGQTYTYNFTVTGQRGTLFYHAHILWLR  135

Query  495   ATVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTI  674
             ATVHGAIVILPKLGVPYPFPKPDKE IIVLGEWW S+VE VIN A++ G+ PNVSDAHTI
Sbjct  136   ATVHGAIVILPKLGVPYPFPKPDKENIIVLGEWWKSDVEAVINEALKSGLAPNVSDAHTI  195

Query  675   NGLPGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKP  851
             NG   P   C+SK  +N+ V+ GK Y+LR++NAALNEELFFKIA H+L VVEVDATYVKP
Sbjct  196   NGYTRPVKNCNSKEMFNIHVKPGKRYMLRIINAALNEELFFKIADHKLTVVEVDATYVKP  255

Query  852   FETDTIFVGPGQTTNALLTADQKA-GKYQIAISPFMDTIVATDNQTATATLSYKG-THLL  1025
             F+TDTI + PGQTTN +L A+ KA GKY + +SPFMD  V  DN T  ATL Y    H  
Sbjct  256   FKTDTIVISPGQTTNVILEANNKAMGKYLVVVSPFMDAPVPVDNATGFATLRYPAFRHKT  315

Query  1026  ASTALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS  1205
              S  LT  P  NAT V   FT++LRSLN++ +PA VP  VDHSL F +G+GVNPC  C +
Sbjct  316   LSATLTAPPPINATAVADNFTNALRSLNTKEFPAKVPQKVDHSLFFTVGLGVNPCKTCVN  375

Query  1206  GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             GSR+VADINN++FVMP   +LQAHYYNISGVF
Sbjct  376   GSRIVADINNITFVMPDISILQAHYYNISGVF  407



>ref|XP_003615575.1| Laccase 1a [Medicago truncatula]
Length=593

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/424 (60%), Positives = 308/424 (73%), Gaps = 36/424 (8%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFT-----------------------------------VEMKNTSR  212
             C  P+SV++M+RHYKF                                    V MKN +R
Sbjct  16    CLLPLSVDAMVRHYKFNMLHVMHLDFIFVLVDSYIYFMTIKVDNVLLLLLIQVVMKNATR  75

Query  213   LCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTGWSDGPAYI  392
             LC++KPIV +NG FPGP +YARE DTV+V+V NHV+ NVSIHWHG++Q RTGW+DGPAYI
Sbjct  76    LCSTKPIVTINGNFPGPTIYAREDDTVLVKVVNHVKYNVSIHWHGIRQLRTGWADGPAYI  135

Query  393   TQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYPFPKPDKEE  572
             TQCPIQPGQ Y+YNFTLTGQRGTL WH+HI W RATVHGAIVILPKLGVPYPFP+P  E+
Sbjct  136   TQCPIQPGQVYMYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFPRPHMEQ  195

Query  573   IIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCSSK-GYNLEVESGKTY  749
             +I+L EWW S+ E +IN A++ G+ PNVSDAHTING PGP   C+S+ G+  +VE GKTY
Sbjct  196   VIILSEWWKSDTEAIINEALKSGLAPNVSDAHTINGHPGPVQHCASQEGFKFQVEPGKTY  255

Query  750   LLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTADQKAGK  929
             LLR++NAALNE+LFFKIAGH+  VVEVDA Y KPF+TDTI + PGQTTN LL  +  +GK
Sbjct  256   LLRIINAALNEDLFFKIAGHKFTVVEVDAAYTKPFKTDTIVITPGQTTNVLLKTNHASGK  315

Query  930   YQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQNATPVTTTFTDSLRSLN  1109
             Y +A S FMD  +A DN TATATL Y  T     T LT +P  N+T +  +FTDSL+SLN
Sbjct  316   YMVAASTFMDAPIAIDNVTATATLHYPNTLGSTITTLTSLPPINSTKIANSFTDSLKSLN  375

Query  1110  SRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPTTPLLQAHYYNI  1289
             S  YPA VP  +DHSL F + +GVNPC  C +GSRVVA INNV+FVMP   LLQAH++NI
Sbjct  376   SHKYPARVPKKIDHSLFFTVSLGVNPCATCPNGSRVVAAINNVTFVMPKISLLQAHFFNI  435

Query  1290  SGVF  1301
             SG+F
Sbjct  436   SGIF  439



>gb|KFK27419.1| hypothetical protein AALP_AA8G380300 [Arabis alpina]
Length=524

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/389 (65%), Positives = 305/389 (78%), Gaps = 4/389 (1%)
 Frame = +3

Query  147   PVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQEN  326
             P++V SMIRHYKF V + NT++LC+SKPIV VNG+FPGP + ARE DTV+++V NHV+ N
Sbjct  22    PITVHSMIRHYKFNVVLTNTTKLCSSKPIVTVNGQFPGPTIVAREDDTVLIKVVNHVKYN  81

Query  327   VSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVH  506
             VSIHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y+YNFT+TGQRGTL WH+HI W RATVH
Sbjct  82    VSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYIYNFTVTGQRGTLWWHAHILWLRATVH  141

Query  507   GAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLP  686
             GAIVILPKLGVPYPFPKP KE+ IVL EWW S+VE++IN A ++G  P  SDAHTING  
Sbjct  142   GAIVILPKLGVPYPFPKPYKEKTIVLSEWWKSDVEELINEASKIGTAPIASDAHTINGHS  201

Query  687   GPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             GP   C S+ GY L V  GKTY+LR++NAALNEELFFKIAGH+L VVEVDA Y KPF+TD
Sbjct  202   GPVSNCPSQNGYGLPVRLGKTYMLRIINAALNEELFFKIAGHKLTVVEVDAVYTKPFKTD  261

Query  864   TIFVGPGQTTNALLTADQKAG-KYQIAISPFMDTIVATDNQTATATLSYKGTHLLAS--T  1034
             T+ + PGQTTN LLTA+  AG KY +A + FMD  +  DN TATA L Y G  +  S  T
Sbjct  262   TVLIAPGQTTNVLLTANANAGSKYMVAATTFMDAPLPFDNVTATAILHYIGHTVPTSKKT  321

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              L  +P QNAT V + F  SLRSLNSR YP  VP  +DHSL F +G+G NPCP+C +G+R
Sbjct  322   VLASLPPQNATWVASKFIRSLRSLNSREYPVRVPTKIDHSLSFTVGLGANPCPSCINGTR  381

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             +VA INN++F MP T LLQAH++NIS VF
Sbjct  382   LVAGINNITFTMPKTALLQAHFFNISNVF  410



>ref|XP_010685615.1| PREDICTED: laccase-4 [Beta vulgaris subsp. vulgaris]
Length=560

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/392 (65%), Positives = 308/392 (79%), Gaps = 4/392 (1%)
 Frame = +3

Query  138   CTFP-VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANH  314
             C  P V VE  +RHYKF V +KN +RLC++KPIV +NGK+PGP + ARE DTV+V+V NH
Sbjct  16    CILPAVLVECRVRHYKFNVVLKNHTRLCSTKPIVTINGKYPGPTIVAREDDTVLVKVVNH  75

Query  315   VQENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQR  494
             V+ N+SIHWHG++Q RTGWSDGPAYITQCPI+ GQ+Y YNFTLTGQRGTL +H+HI W R
Sbjct  76    VKYNLSIHWHGIRQIRTGWSDGPAYITQCPIETGQTYTYNFTLTGQRGTLFYHAHILWLR  135

Query  495   ATVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTI  674
             ATVHGAIVILPKLGVPYPFPKP KE +IVLGEWW S+VE VIN A++ G+ PNVSDAHTI
Sbjct  136   ATVHGAIVILPKLGVPYPFPKPHKENVIVLGEWWKSDVEAVINEALKSGLAPNVSDAHTI  195

Query  675   NGLPGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKP  851
             NG PGP  +C+S+  +NL V  GK Y+LR++NAALNEELFFKIAGH L VVEVDATYVKP
Sbjct  196   NGYPGPVRSCNSQELFNLHVRPGKKYMLRIINAALNEELFFKIAGHHLTVVEVDATYVKP  255

Query  852   FETDTIFVGPGQTTNALLTADQKA-GKYQIAISPFMDTIVATDNQTATATLSYKGTH-LL  1025
             F+TDTI + PGQTTN +L A+ K  GKY + +SPFMD  +  DN T  AT+ Y  +    
Sbjct  256   FKTDTIVISPGQTTNVILEANNKVLGKYLMVVSPFMDAPIPVDNATGLATVRYTTSKSAT  315

Query  1026  ASTALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS  1205
              ST LT  P  NAT V   FT++L++LNS+ +PA VP  +DHSL F IG+GVNPC  C +
Sbjct  316   LSTTLTAPPPINATKVADNFTNALKALNSKEFPAKVPQKIDHSLFFTIGLGVNPCSTCVN  375

Query  1206  GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             GSRVVA INNV+F+MPT  LLQAHY+N+SGVF
Sbjct  376   GSRVVASINNVTFIMPTISLLQAHYFNLSGVF  407



>ref|XP_009120399.1| PREDICTED: laccase-16 [Brassica rapa]
Length=565

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/390 (67%), Positives = 306/390 (78%), Gaps = 6/390 (2%)
 Frame = +3

Query  147   PVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQEN  326
             P +V S+IRHYKF V M NT++LC+SKPIV VNG+FPGP + ARE DTV+++V NHV+ N
Sbjct  22    PTTVHSIIRHYKFNVVMTNTTKLCSSKPIVTVNGQFPGPTIVAREDDTVLIKVVNHVKYN  81

Query  327   VSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVH  506
             VSIHWHGV+Q RTGW+DGPAYITQCPIQP Q+YLYNFTLTGQRGTL WH+HI W RATVH
Sbjct  82    VSIHWHGVRQLRTGWADGPAYITQCPIQPRQNYLYNFTLTGQRGTLWWHAHILWLRATVH  141

Query  507   GAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLP  686
             GAIVILPKLGVPYPFPKP KE+ IVL EWW S+VE +IN A + G  PN SDAHTING  
Sbjct  142   GAIVILPKLGVPYPFPKPYKEKTIVLAEWWKSDVEQLINEATKNGTAPNASDAHTINGHS  201

Query  687   GPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             GP   C S+ GY L V  GKTY+LR++NAALNEELFFKIAGH+L VVEVDA Y KP++TD
Sbjct  202   GPISNCPSQSGYGLPVRPGKTYMLRIINAALNEELFFKIAGHKLTVVEVDAVYTKPYKTD  261

Query  864   TIFVGPGQTTNALLTADQKAG-KYQIAISPFMDTIVATDNQTATATLSYKGTHLLAS---  1031
             T+ + PGQTTN LLTA+   G KY +A + FMD  ++ DN TATATL Y G H ++S   
Sbjct  262   TVLIAPGQTTNVLLTANANTGSKYMVAATTFMDAPISFDNVTATATLHYIG-HTVSSSKK  320

Query  1032  TALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGS  1211
             T L  +P  NAT V + F  SLRSLNSR YPA VP +VDHSL F +G+G NPCP+C++G 
Sbjct  321   TVLASLPQPNATLVASKFIKSLRSLNSREYPAKVPTTVDHSLFFTVGLGANPCPSCNNGF  380

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             R+VA INNV+F MP T LLQAHY+NIS VF
Sbjct  381   RLVAGINNVTFTMPETALLQAHYFNISHVF  410



>ref|XP_010033027.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
Length=553

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/388 (66%), Positives = 289/388 (74%), Gaps = 0/388 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C     VE M+RHYKF V  K T RLC+SKPIV VNG+FPGP +YARE DTV V+V NHV
Sbjct  13    CLLATHVEGMVRHYKFNVVEKRTDRLCSSKPIVTVNGRFPGPTIYAREDDTVFVKVVNHV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
               NV+IHWHGV+Q RT W+DGPAYITQCPIQPGQ Y YNFT+TGQRGTLLWH+HI W RA
Sbjct  73    SYNVTIHWHGVRQLRTCWADGPAYITQCPIQPGQIYTYNFTITGQRGTLLWHAHILWLRA  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGA+VILPK GVPYPFPKP KE++IVL EWW S+VE VI  A++ G  PNVSDAHTIN
Sbjct  133   TVHGALVILPKRGVPYPFPKPHKEKVIVLAEWWKSDVEAVIGEAIKSGGAPNVSDAHTIN  192

Query  678   GLPGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE  857
               PGP   C   GY L V  GKTY+LR++NAALNEELFFKIA H+L VVEVDA YVKP  
Sbjct  193   SHPGPVANCPKGGYELAVRPGKTYMLRIINAALNEELFFKIARHQLTVVEVDAAYVKPLR  252

Query  858   TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA  1037
             TD I VGPGQTT ALL A    GKY + +SPFMD  V+ DN TATAT+ Y GT   +   
Sbjct  253   TDAILVGPGQTTTALLMAYHTTGKYLMIVSPFMDAPVSVDNVTATATVRYAGTPAASPAV  312

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
                 P  NAT V   F  SLRSLN+  YPA VPL +DHSL F +G+GVNPC  C+SG RV
Sbjct  313   PIAPPSPNATWVAEGFVGSLRSLNTGAYPARVPLEIDHSLFFTVGIGVNPCATCASGFRV  372

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VAD NN+SFVMP T LL AHYY ++GVF
Sbjct  373   VADFNNISFVMPKTALLSAHYYKMTGVF  400



>ref|XP_008441433.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=553

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/385 (64%), Positives = 301/385 (78%), Gaps = 1/385 (0%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             V VES++RHY F V +KN  ++C  K I+ VNGKFPGP LYARE DTV+VRV N    N+
Sbjct  16    VVVESLVRHYSFIVLLKNEKKVCGRKNIMTVNGKFPGPTLYAREDDTVIVRVTNRANHNL  75

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             +IHWHGV+Q R+GW+DGPAYITQCPIQPGQ+Y+YNFTL  QRGTLLWH+HI+W RATVHG
Sbjct  76    TIHWHGVRQLRSGWADGPAYITQCPIQPGQNYVYNFTLNSQRGTLLWHAHISWIRATVHG  135

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVILPKLGVPYPFP+P K++II+LGEWW S+VE ++N + QLG PPNVSDAHTING PG
Sbjct  136   AIVILPKLGVPYPFPRPHKQKIIILGEWWKSDVEAMVNKSTQLGQPPNVSDAHTINGHPG  195

Query  690   PTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDT  866
               P C++K G+ L VE+GKTYLLR++NAALNE+ FFKIA H   +VEVDA+Y KPF+T+T
Sbjct  196   HVPGCAAKGGFTLNVETGKTYLLRIINAALNEDFFFKIASHHFTIVEVDASYTKPFKTNT  255

Query  867   IFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTI  1046
             IF+ PGQTTNAL+TA +  GKY I  SPFMD  VA DN TATA L YK T   +    T 
Sbjct  256   IFISPGQTTNALITAHKPIGKYLITASPFMDAPVAIDNLTATAFLRYKRTPRNSPIVFTK  315

Query  1047  MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVAD  1226
             +P  N+T +T  F +SLRSLNS  YPA VPL +DH+L F +GVG NPC  C +G R+VA 
Sbjct  316   IPPPNSTFLTNQFINSLRSLNSEEYPAKVPLFIDHNLFFTVGVGANPCETCVNGMRLVAA  375

Query  1227  INNVSFVMPTTPLLQAHYYNISGVF  1301
             +NNV+F+MP   LLQ+HYYNI G+F
Sbjct  376   VNNVTFIMPKISLLQSHYYNIPGIF  400



>emb|CDX80325.1| BnaC09g34170D [Brassica napus]
Length=570

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/394 (65%), Positives = 303/394 (77%), Gaps = 9/394 (2%)
 Frame = +3

Query  147   PVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQEN  326
             P +V S+IRHYKF V M NT++LC+SKPIV VNG+FPGP + ARE DTV+++V NHV+ N
Sbjct  22    PTTVHSIIRHYKFNVVMTNTTKLCSSKPIVTVNGQFPGPTIVAREDDTVLIKVVNHVKYN  81

Query  327   VSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVH  506
             VSIHWHGV+Q RTGW+DGPAYITQCPIQP Q+Y YNFTLTGQRGTL WH+HI W RATVH
Sbjct  82    VSIHWHGVRQLRTGWADGPAYITQCPIQPRQNYFYNFTLTGQRGTLWWHAHILWLRATVH  141

Query  507   GAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLP  686
             GAIVILPKLGVPYPFPKP KE+ IVLGEWW S+VE +IN A + G  PN SDAHTING  
Sbjct  142   GAIVILPKLGVPYPFPKPYKEKTIVLGEWWKSDVEQLINEATKHGTAPNASDAHTINGHS  201

Query  687   GPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             GP   C S+ GY L V  GKTY+LR++NAALNEELFFKIAGH+L VVEVDA Y KP++TD
Sbjct  202   GPISNCPSQSGYGLPVRPGKTYMLRIINAALNEELFFKIAGHKLTVVEVDAVYTKPYKTD  261

Query  864   TIFVGPGQTTNALLTADQKAG-KYQIAISPFMDTIVATDNQTATATLSYKGTHLLA----  1028
             T+ + PGQTTN LLTA+   G KY +A + FMD  ++ DN TATATL     H +     
Sbjct  262   TVLIAPGQTTNVLLTANANTGSKYMVAATTFMDAPISFDNVTATATLHSNALHYIGHTVS  321

Query  1029  ---STALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC  1199
                 T L  +P  NAT V++ F  SLRSLNSR YPA VP +VDHSL F +G+G NPCP+C
Sbjct  322   SSKKTVLASLPQPNATLVSSKFIKSLRSLNSREYPAKVPTTVDHSLFFTVGLGANPCPSC  381

Query  1200  SSGSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             ++G R+VA INNV+F MP T LLQAHY+NIS VF
Sbjct  382   NNGIRLVAGINNVTFTMPETALLQAHYFNISHVF  415



>gb|KHN04832.1| Laccase-4 [Glycine soja]
Length=524

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/391 (65%), Positives = 303/391 (77%), Gaps = 28/391 (7%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +RHYKF V  K T+RLC+SK IV +NGKFPGP LYARE DTV+V+V N V
Sbjct  6     CILPALVECRVRHYKFHVVSKQTNRLCSSKSIVTINGKFPGPTLYAREDDTVLVKVINQV  65

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
               NV+IHWHGV+Q RTGW+DGPAY+TQCPIQPGQ+Y+YNFTLTGQRGTLL+H+H+NW R+
Sbjct  66    NHNVTIHWHGVRQLRTGWADGPAYVTQCPIQPGQTYVYNFTLTGQRGTLLYHAHVNWLRS  125

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T++GA+VILPK GVPYPFPKPD E ++VLGEWW S+ E VIN A++ G+ PNVSDAHTIN
Sbjct  126   TLYGALVILPKRGVPYPFPKPDDELVVVLGEWWKSDTEAVINEALKSGLAPNVSDAHTIN  185

Query  678   GLPGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             GLPG    CS++  YNL VESGKTYLLR+VNAALNEELFFKIAGH+L VVEVDATYVKPF
Sbjct  186   GLPGTVTNCSTQDVYNLPVESGKTYLLRIVNAALNEELFFKIAGHKLTVVEVDATYVKPF  245

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
             + +TI + PGQTTN LL A+QK+GKY +A SPFMD  VA                     
Sbjct  246   KIETIVIAPGQTTNVLLNANQKSGKYLVAASPFMDAPVA---------------------  284

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPAC--SSG  1208
                 +P +NAT +   F  SLR LNS+ YP NVPL+VDHSL+F +G+G+NPCP+C  ++G
Sbjct  285   ----VPPKNATQIANNFISSLRGLNSKKYPVNVPLTVDHSLIFTVGLGINPCPSCKAANG  340

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INNV+F+MPT  LLQAHY+NI GVF
Sbjct  341   SRVVAAINNVTFIMPTIALLQAHYFNIKGVF  371



>ref|XP_010454388.1| PREDICTED: laccase-16 [Camelina sativa]
Length=540

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/385 (66%), Positives = 301/385 (78%), Gaps = 6/385 (2%)
 Frame = +3

Query  165   MIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWH  344
             MIRHYKF V M NT++LC+SKPIV VNGKFPGP + AREGDTV+++V NHV+ NVSIHWH
Sbjct  1     MIRHYKFNVVMTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTVLIKVVNHVKYNVSIHWH  60

Query  345   GVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVIL  524
             G++Q RTGW+DGPAYITQCPIQPGQ+Y++NFTLTGQRGTL WH+HI W RATVHGAIVIL
Sbjct  61    GIRQLRTGWADGPAYITQCPIQPGQNYIHNFTLTGQRGTLWWHAHILWLRATVHGAIVIL  120

Query  525   PKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTC  704
             PKLGVPYPFPKP KE+ IVLGEWW S+VE++IN A ++G  P+ SDAHTING  G    C
Sbjct  121   PKLGVPYPFPKPYKEKTIVLGEWWKSDVEELINEASKIGTAPSASDAHTINGHSGSISNC  180

Query  705   SSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGP  881
              S+  Y L V +GKTY+LR++NAALNEELFFKIAGH L VVEVDA Y KP++TDT+++ P
Sbjct  181   PSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVYIAP  240

Query  882   GQTTNALLTADQKAG-KYQIAISPFMDTIVATDNQTATATLSYKG----THLLASTALTI  1046
             GQTTN LLTA+  AG  Y IA + F D  +  DN TATATL Y G          T L  
Sbjct  241   GQTTNVLLTANANAGSNYMIAATTFTDAHIPYDNVTATATLHYIGPTATVPTFKKTILAS  300

Query  1047  MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVAD  1226
             +P QNAT V   FT SLRSLNSR YPA VP +VD SL F +G+G NPCP+CS+G R+VA 
Sbjct  301   LPPQNATWVAAKFTKSLRSLNSREYPARVPTTVDRSLFFTVGLGANPCPSCSNGIRLVAG  360

Query  1227  INNVSFVMPTTPLLQAHYYNISGVF  1301
             INNV+F MP T LLQAH++NISGVF
Sbjct  361   INNVTFTMPKTALLQAHFFNISGVF  385



>ref|XP_010483503.1| PREDICTED: laccase-16-like isoform X3 [Camelina sativa]
Length=567

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/390 (65%), Positives = 304/390 (78%), Gaps = 7/390 (2%)
 Frame = +3

Query  153   SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVS  332
             +V++MIRHYKF V M NT++LC+SKPIV VNGKFPGP + AREGDT++++V NHV+ NVS
Sbjct  25    TVQAMIRHYKFNVVMTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTILIKVVNHVKYNVS  84

Query  333   IHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGA  512
             IHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y++NFTLTGQRGTL WH+HI W RATVHGA
Sbjct  85    IHWHGIRQLRTGWADGPAYITQCPIQPGQNYIHNFTLTGQRGTLWWHAHILWLRATVHGA  144

Query  513   IVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGP  692
             IVILPKLGVPYPFPKP KE+ IVLGEWW S+VE++IN A ++G  P+ SDAHTING  G 
Sbjct  145   IVILPKLGVPYPFPKPYKEKTIVLGEWWKSDVEELINVASKIGTAPSASDAHTINGHSGS  204

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
                C S+  Y L V +GKTY+LR++NAALNEELFFKIAGH L VVEVDA Y KP++TDT+
Sbjct  205   ISNCPSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTV  264

Query  870   FVGPGQTTNALLTADQKAG-KYQIAISPFMDTIVATDNQTATATLSYKG-----THLLAS  1031
             ++ PGQTTN LLTA+  AG  Y +A + F D  +  DN TATATL Y G           
Sbjct  265   YIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGPTATSVPTFKK  324

Query  1032  TALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGS  1211
             T L  +P QNAT V   FT SLRSLNSR YPA VP +VD SL F +G+G NPCP+CS G 
Sbjct  325   TILASLPPQNATWVAAKFTKSLRSLNSREYPARVPSTVDRSLFFTVGLGANPCPSCSKGI  384

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             R+VA INNV+F MP T LLQAH++NISGVF
Sbjct  385   RLVAGINNVTFTMPKTALLQAHFFNISGVF  414



>ref|XP_010483501.1| PREDICTED: laccase-16-like isoform X1 [Camelina sativa]
 ref|XP_010483502.1| PREDICTED: laccase-16-like isoform X2 [Camelina sativa]
Length=569

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/390 (65%), Positives = 304/390 (78%), Gaps = 7/390 (2%)
 Frame = +3

Query  153   SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVS  332
             +V++MIRHYKF V M NT++LC+SKPIV VNGKFPGP + AREGDT++++V NHV+ NVS
Sbjct  25    TVQAMIRHYKFNVVMTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTILIKVVNHVKYNVS  84

Query  333   IHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGA  512
             IHWHG++Q RTGW+DGPAYITQCPIQPGQ+Y++NFTLTGQRGTL WH+HI W RATVHGA
Sbjct  85    IHWHGIRQLRTGWADGPAYITQCPIQPGQNYIHNFTLTGQRGTLWWHAHILWLRATVHGA  144

Query  513   IVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGP  692
             IVILPKLGVPYPFPKP KE+ IVLGEWW S+VE++IN A ++G  P+ SDAHTING  G 
Sbjct  145   IVILPKLGVPYPFPKPYKEKTIVLGEWWKSDVEELINVASKIGTAPSASDAHTINGHSGS  204

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
                C S+  Y L V +GKTY+LR++NAALNEELFFKIAGH L VVEVDA Y KP++TDT+
Sbjct  205   ISNCPSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTV  264

Query  870   FVGPGQTTNALLTADQKAG-KYQIAISPFMDTIVATDNQTATATLSYKG-----THLLAS  1031
             ++ PGQTTN LLTA+  AG  Y +A + F D  +  DN TATATL Y G           
Sbjct  265   YIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGPTATSVPTFKK  324

Query  1032  TALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGS  1211
             T L  +P QNAT V   FT SLRSLNSR YPA VP +VD SL F +G+G NPCP+CS G 
Sbjct  325   TILASLPPQNATWVAAKFTKSLRSLNSREYPARVPSTVDRSLFFTVGLGANPCPSCSKGI  384

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             R+VA INNV+F MP T LLQAH++NISGVF
Sbjct  385   RLVAGINNVTFTMPKTALLQAHFFNISGVF  414



>ref|XP_010443638.1| PREDICTED: laccase-16-like [Camelina sativa]
Length=568

 Score =   527 bits (1358),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 256/389 (66%), Positives = 304/389 (78%), Gaps = 6/389 (2%)
 Frame = +3

Query  153   SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVS  332
             +V++MIRHYKF V M NT++LC+SKPIV VNGKFPGP + AREGDTV+++V NHV+ NVS
Sbjct  25    TVQAMIRHYKFNVVMTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTVLIKVVNHVKYNVS  84

Query  333   IHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGA  512
             IHWHG++Q RTGW+D PAYITQCPIQPGQ+Y++NFTLTGQRGTL WH+HI W RATVHGA
Sbjct  85    IHWHGIRQLRTGWADEPAYITQCPIQPGQNYIHNFTLTGQRGTLWWHAHILWLRATVHGA  144

Query  513   IVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGP  692
             IVILPKLGVPYPFPKP KE+ IVLGEWW S+VE++IN A ++G  P+ SDAHTING  G 
Sbjct  145   IVILPKLGVPYPFPKPYKEKTIVLGEWWKSDVEELINVASKIGTAPSASDAHTINGHSGS  204

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
                C S+  Y L V +GKTY+LR++NAALNEELFFKIAGH L VVEVDA Y KP++TDT+
Sbjct  205   LSNCPSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTV  264

Query  870   FVGPGQTTNALLTADQKAG-KYQIAISPFMDTIVATDNQTATATLSYKG----THLLAST  1034
             ++ PGQTTN LLTA+  AG  Y IA + F D  +  DN TATATL Y G          T
Sbjct  265   YIAPGQTTNVLLTANANAGSNYMIAATTFTDAHIPYDNVTATATLHYIGPTATVPTFKKT  324

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              L  +P QNAT V   FT SLRSLNSR YPA VP +VD SL F +G+G NPCP+CS+G R
Sbjct  325   ILASLPPQNATWVAAKFTKSLRSLNSREYPARVPSTVDRSLFFTVGLGSNPCPSCSNGIR  384

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             +VA INNV+F MP T LLQAH++NISGVF
Sbjct  385   LVAGINNVTFTMPKTALLQAHFFNISGVF  413



>ref|XP_009789473.1| PREDICTED: laccase-4-like isoform X1 [Nicotiana sylvestris]
Length=557

 Score =   527 bits (1357),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 255/391 (65%), Positives = 307/391 (79%), Gaps = 4/391 (1%)
 Frame = +3

Query  141   TFPVSVESM--IRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANH  314
             ++PV VE    IRHYKF V MKN +RLC++K  V VNGKFPGP +YARE DT++++V N 
Sbjct  14    SWPVLVECRGNIRHYKFNVVMKNITRLCSTKATVTVNGKFPGPTIYAREDDTLLIKVVNQ  73

Query  315   VQENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQR  494
             V  N++IHWHGVKQ RTGW+DGPAYITQCPIQPG+SY+YNFT+T QRGTL WH+HI W R
Sbjct  74    VHYNLTIHWHGVKQIRTGWADGPAYITQCPIQPGKSYVYNFTVTDQRGTLFWHAHILWLR  133

Query  495   ATVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTI  674
             ATVHGAIVILPKL +PYPFP P KE +I+LGEWW S+VE V++ A QLG+PPN+SDAHTI
Sbjct  134   ATVHGAIVILPKLALPYPFPNPQKEILIILGEWWKSDVEAVVDEATQLGLPPNISDAHTI  193

Query  675   NGLPGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKP  851
             NGLPGP  TC S +G+   VE GK YLLR+VNAALNEELFFKIAGH+L VVEVDA+YVKP
Sbjct  194   NGLPGPVSTCLSQEGFTFLVEPGKKYLLRIVNAALNEELFFKIAGHKLTVVEVDASYVKP  253

Query  852   FETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKG-THLLA  1028
             F+ DTI   PGQTTN +L+AD   GKY +  SP+MD+ +  +N+TATATL Y G      
Sbjct  254   FKADTILTTPGQTTNVILSADLGTGKYLMVTSPYMDSPILVNNRTATATLQYVGTNTSST  313

Query  1029  STALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG  1208
             +T LT+ P  NATP+   F DSLRSLNSR YPA VPL++DHSL F I +G+NPC +C  G
Sbjct  314   TTTLTVPPPTNATPIAIKFMDSLRSLNSRKYPAKVPLTIDHSLFFTISLGLNPCESCYRG  373

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
              R+VA INNV+FVMP+  LL AH++N SGVF
Sbjct  374   FRIVAAINNVTFVMPSVSLLNAHFFNKSGVF  404



>gb|EPS60103.1| laccase 1a, partial [Genlisea aurea]
Length=546

 Score =   525 bits (1351),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 256/392 (65%), Positives = 313/392 (80%), Gaps = 7/392 (2%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP+ V+S +RHYKF V +KNT+++C++K I+ VNG+FPGP +YARE DTV+V+V N V  
Sbjct  3     FPLIVQSRVRHYKFHVVLKNTTKICSTKQILTVNGRFPGPTIYAREDDTVLVKVVNLVNY  62

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHGV+Q RTGWSDGPAYITQCPI+P  S++YNFT+ GQRGTLLWH+H+ W RATV
Sbjct  63    NVSIHWHGVRQLRTGWSDGPAYITQCPIRPDGSFVYNFTIAGQRGTLLWHAHVLWLRATV  122

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGA+V+LP++GVPYPFPKPD E ++VL EWW S+ E VIN AM  G+ PNVSD HTINGL
Sbjct  123   HGALVVLPRIGVPYPFPKPDHERVVVLAEWWKSDTEAVINEAMSSGLAPNVSDGHTINGL  182

Query  684   PGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
              GP   C SS+ YNL V  GKTYLLR++NAALNEELFFKIAGH L VVE DA YVKPF+T
Sbjct  183   TGPVEGCSSSESYNLAVAPGKTYLLRLINAALNEELFFKIAGHSLTVVEADAVYVKPFQT  242

Query  861   DTIFVGPGQTTNALLTA-DQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA  1037
             D I + PGQTTNA+LTA D+ AGK+ I  +PF D  +  DN+TATAT++Y GT +L+S+A
Sbjct  243   DVIVIAPGQTTNAILTASDKLAGKFTILATPFQDAPLPVDNRTATATVNYAGT-VLSSSA  301

Query  1038  LTIM--PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--  1205
             LT+   P  NATP+   FTDSLRSLNS+ +PANVPL +DHSL F +G+GV PC  C +  
Sbjct  302   LTLATPPRVNATPIANGFTDSLRSLNSKNFPANVPLEIDHSLFFTVGLGVIPCATCRAGN  361

Query  1206  GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             GSR+VADINNV+FVMPTT LLQAH++   GVF
Sbjct  362   GSRIVADINNVTFVMPTTALLQAHFFKTKGVF  393



>ref|XP_006300062.1| hypothetical protein CARUB_v10016290mg [Capsella rubella]
 gb|EOA32960.1| hypothetical protein CARUB_v10016290mg [Capsella rubella]
Length=548

 Score =   524 bits (1349),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 250/382 (65%), Positives = 297/382 (78%), Gaps = 7/382 (2%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             E+ IR YKF V MKN ++LC++KPIV +NGKFPGP LYARE D V+V + N+V  NV+IH
Sbjct  21    EANIRRYKFNVVMKNITKLCSTKPIVTINGKFPGPTLYAREDDNVIVNLTNNVNYNVTIH  80

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHGVKQ RTGWSDGPAYITQCP+QPG +++YNFTLTGQRGTLLWH+HI+W RATVHGAIV
Sbjct  81    WHGVKQLRTGWSDGPAYITQCPVQPGGTFVYNFTLTGQRGTLLWHAHISWLRATVHGAIV  140

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             ILPK GVPYPFP+P  E+IIV GEWW S+VE VIN + Q G+PPN+SDAHTINGL G   
Sbjct  141   ILPKRGVPYPFPRPHTEKIIVFGEWWKSDVEAVINQSTQSGLPPNISDAHTINGLTG---  197

Query  699   TCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVG  878
                  GY L V++GK YLLR++NAA+N+ELFFKIAGH   VVEVDA+Y KPF TDT+F+G
Sbjct  198   ---RSGYTLHVKTGKKYLLRIINAAVNDELFFKIAGHNFTVVEVDASYTKPFNTDTLFLG  254

Query  879   PGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQ  1058
             PGQTTNA+LTA    G + + ISPFMDT+V  +N T TA L YK T    S   + +P  
Sbjct  255   PGQTTNAILTATHPPGNFLMTISPFMDTVVPVNNATGTALLRYKDTTTTQSLTSSKIPPI  314

Query  1059  NATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNV  1238
             NAT +   F+DSLRSLNS  YP  VPL +DHSL F IGVGVNPC  C +G++ +ADINNV
Sbjct  315   NATSIALGFSDSLRSLNSPDYPTKVPLKIDHSLFFTIGVGVNPCTTCINGTKTIADINNV  374

Query  1239  SFVMPTTPLLQAHYYNIS-GVF  1301
             SFVMPT  +LQAHY+N S GVF
Sbjct  375   SFVMPTVAMLQAHYFNKSEGVF  396



>gb|KGN45770.1| hypothetical protein Csa_6G009490 [Cucumis sativus]
Length=555

 Score =   523 bits (1348),  Expect = 9e-179, Method: Compositional matrix adjust.
 Identities = 247/385 (64%), Positives = 297/385 (77%), Gaps = 1/385 (0%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             V VES++RHY F V +KN  + C  K I+ VNGKFPGP LYARE DTV+VRV N    N+
Sbjct  18    VVVESLVRHYSFIVLLKNERKACGRKDIMTVNGKFPGPTLYAREDDTVIVRVTNRANHNL  77

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             +IHWHGV+Q R+GW+DGPAYITQCPIQPGQ+Y+YNFTL+ QRGTLLWH+H +W RATVHG
Sbjct  78    TIHWHGVRQLRSGWADGPAYITQCPIQPGQNYVYNFTLSSQRGTLLWHAHFSWIRATVHG  137

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVI PK GVPYPFP P K++ I+LGEWW S+VE ++N + QLG PPNVSDA TING PG
Sbjct  138   AIVIFPKHGVPYPFPHPYKQKTIILGEWWKSDVEAMVNKSTQLGQPPNVSDAQTINGHPG  197

Query  690   PTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDT  866
               P C++K G+ L VE+GKTYLLR++NAALNE+ FFKIA H   +VEVDA+Y KPF+T+T
Sbjct  198   HVPGCATKRGFTLHVETGKTYLLRIINAALNEDFFFKIASHHFTIVEVDASYTKPFKTNT  257

Query  867   IFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTI  1046
             IF+ PGQTTNAL+ A +  GKY IA SPFMD  VA DN TATA L YK T   +    T 
Sbjct  258   IFISPGQTTNALVRAHRPIGKYLIAASPFMDAPVAIDNLTATAFLRYKRTPKNSPIVFTH  317

Query  1047  MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVAD  1226
             +P  N+T +T  FTDSLRSLNS  YPA VPL +DH+L F +GVGVNPC  C +G R+VA 
Sbjct  318   IPPPNSTLLTNQFTDSLRSLNSEEYPAKVPLFIDHNLFFTVGVGVNPCETCVNGVRLVAA  377

Query  1227  INNVSFVMPTTPLLQAHYYNISGVF  1301
             +NNV+F+MP   LLQ+HYYNI GVF
Sbjct  378   VNNVTFLMPQISLLQSHYYNIPGVF  402



>sp|Q1PDH6.2|LAC16_ARATH RecName: Full=Laccase-16; AltName: Full=Benzenediol:oxygen oxidoreductase 
16; AltName: Full=Diphenol oxidase 16; AltName: 
Full=Urishiol oxidase 16; Flags: Precursor [Arabidopsis thaliana]
Length=566

 Score =   523 bits (1347),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 255/391 (65%), Positives = 306/391 (78%), Gaps = 7/391 (2%)
 Frame = +3

Query  147   PVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQEN  326
             P +V S+IRHYKF V M NT++LC+SKPIV VNG+FPGP + AREGDT++++V NHV+ N
Sbjct  22    PTTVHSIIRHYKFNV-MTNTTKLCSSKPIVTVNGQFPGPTIVAREGDTILIKVVNHVKYN  80

Query  327   VSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVH  506
             VSIHWHG++Q RTGW+DGPAYITQCPIQPGQ+YL+NFTLTGQRGTL WH+HI W RATVH
Sbjct  81    VSIHWHGIRQLRTGWADGPAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVH  140

Query  507   GAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLP  686
             GAIVILPKLGVPYPFPKP KE+ IVL EWW S+VE++IN A ++G  P+ SDAHTING  
Sbjct  141   GAIVILPKLGVPYPFPKPYKEKTIVLSEWWKSDVEELINEASRIGTAPSASDAHTINGHS  200

Query  687   GPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             G    C S+  Y L V +GKTY+LR++NAALNEELFFKIAGH L VVEVDA Y KP++TD
Sbjct  201   GSISNCPSQSSYGLPVRAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTD  260

Query  864   TIFVGPGQTTNALLTADQKAG-KYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA-  1037
             T+F+ PGQTTN LLTA+  AG  Y +A + F D  +  DN TATATL Y G     ST+ 
Sbjct  261   TVFIAPGQTTNVLLTANANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSTSK  320

Query  1038  ---LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG  1208
                L  +P QNAT V T FT SLRSLNS  YPA VP +V+HSL F +G+G NPC +C++G
Sbjct  321   KTVLASLPPQNATWVATKFTRSLRSLNSLEYPARVPTTVEHSLFFTVGLGANPCQSCNNG  380

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
              R+VA INNV+F MP T LLQAH++NISGVF
Sbjct  381   VRLVAGINNVTFTMPKTALLQAHFFNISGVF  411



>ref|XP_009589148.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score =   521 bits (1341),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 253/390 (65%), Positives = 306/390 (78%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPVSVESM--IRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             +PV VE    IRHYKF V MKN +RLC++K  V VNGKFPGP +Y RE DT++++V N V
Sbjct  15    WPVLVECRGNIRHYKFNVVMKNITRLCSTKATVTVNGKFPGPTIYTREDDTLLIKVVNQV  74

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
               N++IHWHGVKQ RTGW+DGPAYITQCPIQPG+SY+YNFT+T QRGTL WH+HI W RA
Sbjct  75    HYNLTIHWHGVKQIRTGWADGPAYITQCPIQPGKSYVYNFTVTDQRGTLFWHAHILWLRA  134

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPKL  PYPFPKP KE +I+LGEWW S+VE VI+ A +LG+PPN+SDAHTIN
Sbjct  135   TVHGAIVILPKLVFPYPFPKPQKEILIILGEWWKSDVEAVIDEATKLGLPPNISDAHTIN  194

Query  678   GLPGPTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             GLPGP  TC S +G+   VE GK YLLR+VNAALNEELFFKIAGH+L VVEVDA+YVKPF
Sbjct  195   GLPGPLSTCLSQEGFTFLVEPGKKYLLRIVNAALNEELFFKIAGHKLTVVEVDASYVKPF  254

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKG-THLLAS  1031
             +T+TI   PGQTTN +L+AD ++GKY +  S +MD+ +  +N+TATATL Y+G      +
Sbjct  255   KTETILTTPGQTTNVILSADLESGKYLMVTSAYMDSPILVNNRTATATLQYRGTNTSSTT  314

Query  1032  TALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGS  1211
             T LT+ P  NATP+   F DSLRSLNSR YPA VPL +DHSL F I +G+NPC +C    
Sbjct  315   TTLTVPPPTNATPIAIKFMDSLRSLNSRKYPAKVPLKIDHSLFFTISLGLNPCESCYREF  374

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             R+VA INNV+FVMP+  LL AH++N SGVF
Sbjct  375   RIVAAINNVTFVMPSVSLLNAHFFNKSGVF  404



>ref|XP_006840270.1| hypothetical protein AMTR_s00045p00045490 [Amborella trichopoda]
 gb|ERN01945.1| hypothetical protein AMTR_s00045p00045490 [Amborella trichopoda]
Length=565

 Score =   520 bits (1340),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 259/399 (65%), Positives = 301/399 (75%), Gaps = 14/399 (4%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +RHYKF V +KNT+RLC +KPIV VNG FPGP +YAREGD V+V+V NHV
Sbjct  14    CLLPALVECRVRHYKFNVVVKNTTRLCQTKPIVTVNGGFPGPTVYAREGDNVLVKVVNHV  73

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             + N+SIHWHG++Q RTGW+DGPAYITQCPIQ GQ+Y YNFT+TGQRGTLLWH+HI W RA
Sbjct  74    KYNLSIHWHGIRQVRTGWADGPAYITQCPIQTGQTYTYNFTITGQRGTLLWHAHILWLRA  133

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TVHGAIVILPK GVPYPFPKP KE +++L EWWNS+VE VIN AM+ G  PNVSDAHTIN
Sbjct  134   TVHGAIVILPKRGVPYPFPKPHKEVVVILAEWWNSDVEAVINTAMKSGAAPNVSDAHTIN  193

Query  678   GLPGPTPTCSSK---GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVK  848
             G PGP   CSS+   G+ LEVESGKTYLLR++NAALNEELFF +AGH L VVEVDATY K
Sbjct  194   GHPGPLSNCSSQGGGGFKLEVESGKTYLLRIINAALNEELFFGVAGHPLTVVEVDATYNK  253

Query  849   PFETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGT--HL  1022
             PF T T+ + PGQTTN LL AD+  G+Y  A SPFMD  +A DN TATA L Y  T    
Sbjct  254   PFTTTTVLIAPGQTTNVLLKADKSGGRYIAAASPFMDAPIAVDNATATALLHYTDTPSSS  313

Query  1023  LASTALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPL----SVDHSLVFAIGVGVNPC  1190
               ST    +P  NATPV + F DSLRSL     P +  L     VDHSL   +G+G+ PC
Sbjct  314   SVSTTFVSLPPLNATPVASKFMDSLRSLKK---PPSSSLPRHSRVDHSLFITVGLGIFPC  370

Query  1191  PACSS--GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             P C++  GSRV+A +NN+SFVMPT  LLQAHY+NISGVF
Sbjct  371   PTCTANNGSRVLAAMNNISFVMPTFNLLQAHYFNISGVF  409



>ref|XP_010543228.1| PREDICTED: laccase-10 [Tarenaya hassleriana]
Length=558

 Score =   519 bits (1337),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 254/390 (65%), Positives = 312/390 (80%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
              PV+V+  +R Y F V  K  +RLC++K IV VNGKFPGP +YARE DT++V V N+V+ 
Sbjct  16    LPVTVQGDVRKYTFNVVTKQMTRLCSTKQIVTVNGKFPGPTIYAREDDTILVNVVNNVKY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPI+PGQ+Y+YNFT+TGQRGTL WH+HI W RATV
Sbjct  76    NVSIHWHGIRQLRTGWADGPAYITQCPIRPGQNYVYNFTVTGQRGTLWWHAHILWLRATV  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK G+PYPFPKP +EE+I+LGEWW S+ E VIN A++ G+ PNVSDAH ING 
Sbjct  136   HGAIVILPKPGLPYPFPKPHREEVIMLGEWWKSDTEAVINEALKSGLAPNVSDAHIINGH  195

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP  TC S+ G+ L VE+GKTY+LR++NAA+NEELFFKIAGHR  VVEVDA YVKPF T
Sbjct  196   PGPVSTCPSQGGFKLSVETGKTYMLRLINAAMNEELFFKIAGHRFTVVEVDAVYVKPFST  255

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMD-TIVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTT AL++A + +GKY IA SPF D   VA DN+TATAT+ Y GT   A T+
Sbjct  256   DTILIAPGQTTTALVSAVRTSGKYLIAASPFQDAAAVAVDNRTATATVHYSGTLSAAPTS  315

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GS  1211
             LT  P +NAT V  +F  SLRSLNS+ +PANVP +VDH L+FA+G+G+N C +C +  G+
Sbjct  316   LTSPPPRNATSVANSFIGSLRSLNSKNFPANVPATVDHDLLFAVGLGINRCHSCKAGNGT  375

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVA INNV+F MPTT LLQAHY+N+SGV+
Sbjct  376   RVVAGINNVTFKMPTTALLQAHYFNLSGVY  405



>ref|XP_004138572.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis sativus]
Length=561

 Score =   518 bits (1335),  Expect = 8e-177, Method: Compositional matrix adjust.
 Identities = 248/391 (63%), Positives = 297/391 (76%), Gaps = 7/391 (2%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             V VES++RHY F V +KN  + C  K I+ VNGKFPGP LYARE DTV+VRV N    N+
Sbjct  18    VVVESLVRHYSFIVLLKNERKACGRKDIMTVNGKFPGPTLYAREDDTVIVRVTNRANHNL  77

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             +IHWHGV+Q R+GW+DGPAYITQCPIQPGQ+Y+YNFTL+ QRGTLLWH+H +W RATVHG
Sbjct  78    TIHWHGVRQLRSGWADGPAYITQCPIQPGQNYVYNFTLSSQRGTLLWHAHFSWIRATVHG  137

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVE----DV---INHAMQLGIPPNVSDAH  668
             AIVI PK GVPYPFP P K++ I+LGEWW S+VE    DV   +N + QLG PPNVSDA 
Sbjct  138   AIVIFPKHGVPYPFPHPYKQKTIILGEWWKSDVEAMVNDVEAMVNKSTQLGQPPNVSDAQ  197

Query  669   TINGLPGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVK  848
             TING PG  P C++K + L VE+GKTYLLR++NAALNE+ FFKIA H   +VEVDA+Y K
Sbjct  198   TINGHPGHVPGCATKSFTLHVETGKTYLLRIINAALNEDFFFKIASHHFTIVEVDASYTK  257

Query  849   PFETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLA  1028
             PF+T+TIF+ PGQTTNAL+ A +  GKY IA SPFMD  VA DN TATA L YK T   +
Sbjct  258   PFKTNTIFISPGQTTNALVRAHRPIGKYLIAASPFMDAPVAIDNLTATAFLRYKRTPKNS  317

Query  1029  STALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG  1208
                 T +P  N+T +T  FTDSLRSLNS  YPA VPL +DH+L F +GVGVNPC  C +G
Sbjct  318   PIVFTHIPPPNSTLLTNQFTDSLRSLNSEEYPAKVPLFIDHNLFFTVGVGVNPCETCVNG  377

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
              R+VA +NNV+F+MP   LLQ+HYYNI GVF
Sbjct  378   VRLVAAVNNVTFLMPQISLLQSHYYNIPGVF  408



>ref|XP_010690098.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=565

 Score =   518 bits (1335),  Expect = 9e-177, Method: Compositional matrix adjust.
 Identities = 248/391 (63%), Positives = 298/391 (76%), Gaps = 5/391 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP   E+ +RHY F V MKN ++LC++KPI  VNGKFPGP L AREGD V+V+V N V  
Sbjct  21    FPALAEAKVRHYNFKVVMKNYTKLCSTKPIATVNGKFPGPTLRAREGDNVLVKVINDVSY  80

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHG++Q RTGWSDGPAYI QCPIQPGQSYLYNF++ GQRGTL WH+HI+W RAT+
Sbjct  81    NVTIHWHGIRQLRTGWSDGPAYIAQCPIQPGQSYLYNFSIIGQRGTLFWHAHISWLRATM  140

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK G PYPFP+P KE+IIVL EWW ++ E VIN     G+PPNVSDAHT+NG 
Sbjct  141   HGAIVILPKKGTPYPFPQPVKEKIIVLAEWWKADTEAVINQGTLSGMPPNVSDAHTMNGY  200

Query  684   PGPTPTC--SSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
              GP   C  SS+G Y L VE  KTYLLR++NAA+N+E+FF+IAGH+  VVEVDA+Y KPF
Sbjct  201   TGPIRNCSISSQGTYTLHVEHNKTYLLRIINAAINDEIFFRIAGHKFTVVEVDASYTKPF  260

Query  855   ETDTIFVGPGQTTNALLTADQK-AGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLA  1028
              TDTI++ PGQTTNALL ADQ  + KY I +S FMD   VA DN T    L Y G  L +
Sbjct  261   VTDTIYIAPGQTTNALLKADQSPSKKYLIGMSSFMDAPSVAVDNTTNYGLLRYNGGPLGS  320

Query  1029  STALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG  1208
                LT MP  NAT     F+++LRSLNS+ YPA VPL++DHSL+F  GVGVNPC  C +G
Sbjct  321   RLVLTTMPPINATKAQLNFSNALRSLNSKKYPAQVPLTIDHSLLFTTGVGVNPCATCLNG  380

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             S++V +INNV+FVMP+  LLQA+YYNISGVF
Sbjct  381   SKLVGNINNVTFVMPSIALLQAYYYNISGVF  411



>ref|XP_009416212.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=562

 Score =   518 bits (1334),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 261/392 (67%), Positives = 310/392 (79%), Gaps = 6/392 (2%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
              P+  + M RHYKF V  K+ +RLC++K IV VNG+FPGP LYARE DTVVV+V N V+ 
Sbjct  18    LPLLAQGMTRHYKFDVVEKSFTRLCSTKSIVTVNGQFPGPTLYAREDDTVVVKVVNRVKV  77

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NV+IHWHGV+Q RTGW+DGPAYITQCPIQPGQSY+YNFTL GQRGTLLWH+HI+WQRATV
Sbjct  78    NVTIHWHGVRQLRTGWADGPAYITQCPIQPGQSYVYNFTLAGQRGTLLWHAHISWQRATV  137

Query  504   HGAIVILPKLGVPYP-FPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             HGAIVILPK GV YP FP P KE ++VL EWW S+VE VI+ AM  G  PNVSDAHTING
Sbjct  138   HGAIVILPKRGVAYPFFPTPHKEVVLVLAEWWRSDVEAVIDEAMNSGRAPNVSDAHTING  197

Query  681   LPGPTPTCSS---KGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKP  851
               GP   C+S    G  + V+ GKTYL R++NAALNE+LFFK+AGH+L VVEVDATY KP
Sbjct  198   HAGPVSGCASSAQDGLTVRVDKGKTYLFRIINAALNEDLFFKVAGHQLTVVEVDATYTKP  257

Query  852   FETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLA  1028
             F TDT+ + PGQTTN LLTADQ AG+Y +A SPF D+ +VA DN+TATAT+ Y  +   +
Sbjct  258   FTTDTLLITPGQTTNVLLTADQGAGRYLVAASPFADSPLVAVDNRTATATVQYASSVSAS  317

Query  1029  STALTIM-PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS  1205
             +   T   P QNATPV ++F D+LRSLNS+ YPA VPL VD SL+F +G+GVNPC  C++
Sbjct  318   AVVTTTKPPPQNATPVASSFVDTLRSLNSKQYPAKVPLMVDRSLLFTVGLGVNPCATCTN  377

Query  1206  GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             GSRVVADINNV+FVMPTT LLQAHY+N SGVF
Sbjct  378   GSRVVADINNVTFVMPTTALLQAHYFNTSGVF  409



>ref|XP_004150626.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004169234.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=517

 Score =   515 bits (1327),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 250/371 (67%), Positives = 297/371 (80%), Gaps = 9/371 (2%)
 Frame = +3

Query  195   MKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTGWS  374
             M+  +RLC+SKPIV +NGKFPGP +YARE DTV+++V NHV  NVSIHW       TGW+
Sbjct  1     MRKVTRLCSSKPIVTINGKFPGPTIYAREDDTVLIKVVNHVPYNVSIHW-------TGWA  53

Query  375   DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYPFP  554
             DGPAYITQCP+Q GQSY+YNFT+TGQRGTL WH+HI W RAT++GA+VILPKLGVPYPFP
Sbjct  54    DGPAYITQCPLQTGQSYVYNFTITGQRGTLWWHAHILWLRATLYGAVVILPKLGVPYPFP  113

Query  555   KPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCSSKGYN-LEV  731
              P KE +++LGEWW S+VE V++ A + G+ PNVSDAHTING PGP   C ++G   + V
Sbjct  114   TPHKELVLILGEWWKSDVEAVVHEAAKSGLAPNVSDAHTINGHPGPVNGCLTRGKGIMPV  173

Query  732   ESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTA  911
             + GKTYLLR++NAALNEELFFK+AGH+L VVEVDA Y KPF TDTIF+ PGQTTNALLTA
Sbjct  174   QPGKTYLLRIINAALNEELFFKVAGHKLTVVEVDAAYTKPFITDTIFIAPGQTTNALLTA  233

Query  912   DQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTALTIMPLQNATPVTTTFT  1088
             D K+GKY I+ SPF DT IVA DN TATATL Y GT   + T+ T +P QNAT + T FT
Sbjct  234   DLKSGKYAISASPFRDTPIVAVDNVTATATLHYTGTISTSPTSFTGLPPQNATLIATKFT  293

Query  1089  DSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPTTPLL  1268
             +SLRSLNS+ YPA V L VDHSL F +G+GVN C  CSSG++VVADINNV+FVMPT  LL
Sbjct  294   NSLRSLNSKQYPARVSLEVDHSLFFTVGLGVNRCKTCSSGTQVVADINNVTFVMPTISLL  353

Query  1269  QAHYYNISGVF  1301
             QAHY+NI GVF
Sbjct  354   QAHYFNIDGVF  364



>ref|XP_006282033.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
 gb|EOA14931.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
Length=530

 Score =   514 bits (1325),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 249/375 (66%), Positives = 294/375 (78%), Gaps = 6/375 (2%)
 Frame = +3

Query  195   MKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTGWS  374
             M NT++LC+SKPIV VNGKFPGP + AREGDT++++V NHV  NVSIHWHG++Q RTGW+
Sbjct  1     MTNTTKLCSSKPIVTVNGKFPGPTIVAREGDTILIKVVNHVNYNVSIHWHGIRQLRTGWA  60

Query  375   DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYPFP  554
             DGPAYITQCPIQPGQ+YL+NFTLTGQRGTL WH+HI W RATVHGAIVILPKLGVPYPFP
Sbjct  61    DGPAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFP  120

Query  555   KPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCSSK-GYNLEV  731
             KP KE+ IVLGEWW S+VE+++N A ++G  P  SDAHTING  G  P C S+  Y L V
Sbjct  121   KPYKEKTIVLGEWWKSDVEELVNEASKIGTAPMASDAHTINGHSGSIPNCPSQSSYGLPV  180

Query  732   ESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTA  911
              +GKTY+LR++NAALNEELFFKIAGH L VVEVDA Y KP++TDT+++ PGQTTN LLTA
Sbjct  181   RAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVYIAPGQTTNVLLTA  240

Query  912   DQKAG-KYQIAISPFMDTIVATDNQTATATLSYKGTHLLAS----TALTIMPLQNATPVT  1076
             +  AG  Y +A + F D  +  DN TATATL Y G     S    T L  +P QNAT V 
Sbjct  241   NANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSASKKTVLASLPPQNATWVA  300

Query  1077  TTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPT  1256
             T FT SLRSLNS  YPA VP +VDHSL F +G+G NPCP+CS+G R+VA INNV+F MP 
Sbjct  301   TKFTRSLRSLNSHEYPARVPTTVDHSLFFTVGLGANPCPSCSNGVRLVAGINNVTFTMPK  360

Query  1257  TPLLQAHYYNISGVF  1301
             T LLQAH++NISGVF
Sbjct  361   TALLQAHFFNISGVF  375



>ref|XP_004241179.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=560

 Score =   514 bits (1323),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 241/385 (63%), Positives = 295/385 (77%), Gaps = 2/385 (1%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             V  +  IRHYKF V M N +RLC++KP V VNGKFPGP +YARE DT++++V N V  N+
Sbjct  23    VLCKGNIRHYKFNVMMTNVTRLCSTKPTVTVNGKFPGPSIYAREDDTLLIKVVNQVHYNL  82

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             SIHWHGVKQ RT W+DGPAYI QCPIQPG+SY+YNFT+  QRGTL WH+HI W RATVHG
Sbjct  83    SIHWHGVKQLRTCWADGPAYIAQCPIQPGKSYVYNFTVREQRGTLFWHAHILWLRATVHG  142

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVILPKL +PYPF KP KE +I+LGEWW S+VE V++ A Q G+PPN+SDAHTINGL G
Sbjct  143   AIVILPKLALPYPFSKPKKEVVIILGEWWKSDVEAVVDEATQSGLPPNISDAHTINGLTG  202

Query  690   PTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDT  866
             P  TC S +G+N +VE GK YLLR++NAALNEELFFKIAGH L V EVDA YVKPFET+T
Sbjct  203   PVSTCLSQEGFNFQVEPGKKYLLRIINAALNEELFFKIAGHNLTVEEVDAAYVKPFETET  262

Query  867   IFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTI  1046
             I   PGQTTN +L+ + K GKY +  SP+MD+ +  +N+ ATATL Y GT+  +ST  T+
Sbjct  263   ILTAPGQTTNVILSTNHKNGKYLMVTSPYMDSPILVNNKAATATLQYTGTN-NSSTTFTV  321

Query  1047  MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVAD  1226
              P +NAT +   F DSL+SLNS+ YPA VP+ ++HSL F I +G+NPC  C  G R+VA 
Sbjct  322   PPPRNATSIAFNFMDSLQSLNSKRYPAKVPIKINHSLFFIISLGLNPCATCYRGFRIVAA  381

Query  1227  INNVSFVMPTTPLLQAHYYNISGVF  1301
             INNV+FVMP+  LL  H+ N SGVF
Sbjct  382   INNVTFVMPSVSLLGTHFLNKSGVF  406



>gb|KCW52562.1| hypothetical protein EUGRSUZ_J01941, partial [Eucalyptus grandis]
Length=524

 Score =   512 bits (1319),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 246/368 (67%), Positives = 278/368 (76%), Gaps = 0/368 (0%)
 Frame = +3

Query  198   KNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTGWSD  377
             K T RLC+SKPIV VNG+FPGP +YARE DTV V+V NHV  NV+IHWHGV+Q RT W+D
Sbjct  4     KRTDRLCSSKPIVTVNGRFPGPTIYAREDDTVFVKVVNHVSYNVTIHWHGVRQLRTCWAD  63

Query  378   GPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYPFPK  557
             GPAYITQCPIQPGQ Y YNFT+TGQRGTLLWH+HI W RATVHGA+VILPK GVPYPFPK
Sbjct  64    GPAYITQCPIQPGQIYTYNFTITGQRGTLLWHAHILWLRATVHGALVILPKRGVPYPFPK  123

Query  558   PDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCSSKGYNLEVES  737
             P KE++IVL EWW S+VE VI  A++ G  PNVSDAHTIN  PGP   C   GY L V  
Sbjct  124   PHKEKVIVLAEWWKSDVEAVIGEAIKSGGAPNVSDAHTINSHPGPVANCPKGGYELAVRP  183

Query  738   GKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTADQ  917
             GKTY+LR++NAALNEELFFKIA H+L VVEVDA YVKP  TD I VGPGQTT ALL A  
Sbjct  184   GKTYMLRIINAALNEELFFKIARHQLTVVEVDAAYVKPLRTDAILVGPGQTTTALLMAYH  243

Query  918   KAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPLQNATPVTTTFTDSL  1097
               GKY + +SPFMD  V+ DN TATAT+ Y GT   +       P  NAT V   F  SL
Sbjct  244   TTGKYLMIVSPFMDAPVSVDNVTATATVRYAGTPAASPAVPIAPPSPNATWVAEGFVGSL  303

Query  1098  RSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPTTPLLQAH  1277
             RSLN+  YPA VPL +DHSL F +G+GVNPC  C+SG RVVAD NN+SFVMP T LL AH
Sbjct  304   RSLNTGAYPARVPLEIDHSLFFTVGIGVNPCATCASGFRVVADFNNISFVMPKTALLSAH  363

Query  1278  YYNISGVF  1301
             YY ++GVF
Sbjct  364   YYKMTGVF  371



>ref|XP_009789474.1| PREDICTED: laccase-4-like isoform X2 [Nicotiana sylvestris]
Length=524

 Score =   510 bits (1313),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 244/371 (66%), Positives = 294/371 (79%), Gaps = 2/371 (1%)
 Frame = +3

Query  195   MKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTGWS  374
             MKN +RLC++K  V VNGKFPGP +YARE DT++++V N V  N++IHWHGVKQ RTGW+
Sbjct  1     MKNITRLCSTKATVTVNGKFPGPTIYAREDDTLLIKVVNQVHYNLTIHWHGVKQIRTGWA  60

Query  375   DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYPFP  554
             DGPAYITQCPIQPG+SY+YNFT+T QRGTL WH+HI W RATVHGAIVILPKL +PYPFP
Sbjct  61    DGPAYITQCPIQPGKSYVYNFTVTDQRGTLFWHAHILWLRATVHGAIVILPKLALPYPFP  120

Query  555   KPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTC-SSKGYNLEV  731
              P KE +I+LGEWW S+VE V++ A QLG+PPN+SDAHTINGLPGP  TC S +G+   V
Sbjct  121   NPQKEILIILGEWWKSDVEAVVDEATQLGLPPNISDAHTINGLPGPVSTCLSQEGFTFLV  180

Query  732   ESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTA  911
             E GK YLLR+VNAALNEELFFKIAGH+L VVEVDA+YVKPF+ DTI   PGQTTN +L+A
Sbjct  181   EPGKKYLLRIVNAALNEELFFKIAGHKLTVVEVDASYVKPFKADTILTTPGQTTNVILSA  240

Query  912   DQKAGKYQIAISPFMDTIVATDNQTATATLSYKG-THLLASTALTIMPLQNATPVTTTFT  1088
             D   GKY +  SP+MD+ +  +N+TATATL Y G      +T LT+ P  NATP+   F 
Sbjct  241   DLGTGKYLMVTSPYMDSPILVNNRTATATLQYVGTNTSSTTTTLTVPPPTNATPIAIKFM  300

Query  1089  DSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPTTPLL  1268
             DSLRSLNSR YPA VPL++DHSL F I +G+NPC +C  G R+VA INNV+FVMP+  LL
Sbjct  301   DSLRSLNSRKYPAKVPLTIDHSLFFTISLGLNPCESCYRGFRIVAAINNVTFVMPSVSLL  360

Query  1269  QAHYYNISGVF  1301
              AH++N SGVF
Sbjct  361   NAHFFNKSGVF  371



>ref|XP_006401026.1| hypothetical protein EUTSA_v10013285mg [Eutrema salsugineum]
 gb|ESQ42479.1| hypothetical protein EUTSA_v10013285mg [Eutrema salsugineum]
Length=512

 Score =   509 bits (1312),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 247/374 (66%), Positives = 294/374 (79%), Gaps = 5/374 (1%)
 Frame = +3

Query  195   MKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTGWS  374
             M NT++LC+SKPIV VNG+FPGP + ARE DTV+++V NHV+ NVSIHWHG++Q RTGW+
Sbjct  1     MTNTTKLCSSKPIVTVNGQFPGPTIVAREDDTVLIKVVNHVKYNVSIHWHGIRQLRTGWA  60

Query  375   DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYPFP  554
             DGPAYITQCPIQPGQ+Y+YNFTLTGQRGTL WH+HI W RATVHGAIVILPKLGV YPFP
Sbjct  61    DGPAYITQCPIQPGQNYIYNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVTYPFP  120

Query  555   KPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTC-SSKGYNLEV  731
             KP KE+ IVLGEWW S+VE +IN A ++G  P  SDAHTING  GP   C S +GYNL V
Sbjct  121   KPYKEKTIVLGEWWKSDVEQLINDASRIGTAPIASDAHTINGHSGPISNCPSQRGYNLPV  180

Query  732   ESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTA  911
               GKTY+LR++NAALNE+LFFKIAGH L VVEVDA Y KPF+TDT+ + PGQTTN LLTA
Sbjct  181   RPGKTYMLRIINAALNEDLFFKIAGHELTVVEVDAVYTKPFKTDTVLIAPGQTTNVLLTA  240

Query  912   DQKAG-KYQIAISPFMDTIVATDNQTATATLSYKGTHLLAS---TALTIMPLQNATPVTT  1079
             +  AG KY +A + FMD  +  DN TATATL Y G   + +   T L  +P QNAT V T
Sbjct  241   NANAGSKYMVAATTFMDAPILFDNVTATATLHYIGNTTVPASKKTVLASLPPQNATWVAT  300

Query  1080  TFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPTT  1259
              FT SLRSLNSR YPA VP +V+HSL+F +G+G NPC +C +G R+VA INNV+F MP+T
Sbjct  301   RFTRSLRSLNSREYPARVPTTVEHSLLFTVGLGANPCRSCINGVRLVAGINNVTFTMPST  360

Query  1260  PLLQAHYYNISGVF  1301
              LLQAH++NI  VF
Sbjct  361   ALLQAHFFNIPHVF  374



>ref|NP_195739.2| laccase 10 [Arabidopsis thaliana]
 sp|Q6ID18.1|LAC10_ARATH RecName: Full=Laccase-10; AltName: Full=Benzenediol:oxygen oxidoreductase 
10; AltName: Full=Diphenol oxidase 10; AltName: 
Full=Urishiol oxidase 10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAT41838.1| At5g01190 [Arabidopsis thaliana]
 gb|AED90308.1| laccase 10 [Arabidopsis thaliana]
Length=558

 Score =   511 bits (1316),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 248/390 (64%), Positives = 307/390 (79%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V   IR Y F V  K  +R+C++K IV VNGKFPGP +YA E DT++V V N+V+ 
Sbjct  16    FPACVHGAIRKYTFNVVTKQVTRICSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPI+PG SY+YNFT+TGQRGTL WH+H+ W RATV
Sbjct  76    NVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATV  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPKLG+PYPFPKP +EE+I+LGEWW S+ E V+N A++ G+ PNVSDAH ING 
Sbjct  136   HGAIVILPKLGLPYPFPKPHREEVIILGEWWKSDTETVVNEALKSGLAPNVSDAHVINGH  195

Query  684   PGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG  P C S+G + L VESGKTY+LR++NAALNEELFFKIAGHR  VVEVDA YVKPF T
Sbjct  196   PGFVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAVYVKPFNT  255

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTT AL++A + +G+Y IA +PF D+ +VA DN+TATAT+ Y GT     T 
Sbjct  256   DTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTK  315

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG--S  1211
              T  P QNAT V  TF +SLRSLNS+ YPANVP++VDH L+F +G+G+N C +C +G  S
Sbjct  316   TTSPPPQNATSVANTFVNSLRSLNSKTYPANVPITVDHDLLFTVGLGINRCHSCKAGNFS  375

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVA INN++F MP T LLQAHY+N++G++
Sbjct  376   RVVAAINNITFKMPKTALLQAHYFNLTGIY  405



>ref|XP_006398646.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
 gb|ESQ40099.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
Length=558

 Score =   509 bits (1312),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 247/390 (63%), Positives = 305/390 (78%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V   IR Y F V  K  +RLC++K IV VNGKFPGP +YA E DT++V V N+V+ 
Sbjct  16    FPACVHGAIRKYTFNVITKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPI+PG SY+YNFT+TGQRGTL WH+H+ W RATV
Sbjct  76    NVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATV  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK G+PYPFPKP +EE+IVLGEWW S+ E V+N A++ G+ PNVSDAH ING 
Sbjct  136   HGAIVILPKPGLPYPFPKPHREEVIVLGEWWKSDTETVVNEALKSGLAPNVSDAHVINGH  195

Query  684   PGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG  P C S+G + L VESGKTY+LR+VNAA+NEELFFKIAGHR  VVEVDA YVKPF T
Sbjct  196   PGLVPNCPSQGNFKLAVESGKTYMLRLVNAAMNEELFFKIAGHRFTVVEVDAVYVKPFTT  255

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTT AL++A + +G+Y IA +PF D+ +VA DN+TATAT+ Y GT    +T 
Sbjct  256   DTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTFSATATK  315

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG--S  1211
              T  P QNAT V  +F +SLRSLNS  YPA VP++VDH L+F +G+G+N C +C +G  S
Sbjct  316   TTSPPPQNATSVANSFVNSLRSLNSITYPAKVPITVDHDLLFTVGLGINRCHSCKAGNFS  375

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVA INN++F MP T LLQAHY+N++G++
Sbjct  376   RVVAAINNITFKMPKTALLQAHYFNLTGIY  405



>ref|XP_006350822.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=559

 Score =   509 bits (1311),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 240/385 (62%), Positives = 292/385 (76%), Gaps = 2/385 (1%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             V     IR YKF V M N +RLC++KP V VNGKFPGP +YARE DT++++V N V  N+
Sbjct  23    VQCRGNIRQYKFNVMMTNVTRLCSTKPTVTVNGKFPGPTIYAREDDTLLIKVVNQVHYNL  82

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             SIHWHGVKQ RT W+DGPAYI QCPIQPG+SY+YNFT+T QRGTL WH+HI W RATVHG
Sbjct  83    SIHWHGVKQLRTCWADGPAYIAQCPIQPGKSYVYNFTVTEQRGTLFWHAHILWLRATVHG  142

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             A+VILPK  +PYPF KP KE +I+LGEWW S+VE V++ A Q G+PPN+SDAHTINGL G
Sbjct  143   AVVILPKHTLPYPFSKPKKEVVIILGEWWKSDVEAVVDEATQSGLPPNISDAHTINGLTG  202

Query  690   PTPTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDT  866
             P  TC S +G+N  VE GK YLLR++NAALNEELFFKIAGH L VVEVDA YVKPFET+T
Sbjct  203   PVSTCLSQEGFNFLVEPGKKYLLRIINAALNEELFFKIAGHNLTVVEVDAAYVKPFETET  262

Query  867   IFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTI  1046
             I   PGQTTN +L+   K GKY +  SP+MD+ +  +N+ ATATL Y GT+  +ST  T+
Sbjct  263   ILTAPGQTTNVILSTTYKNGKYSMVTSPYMDSPILVNNKAATATLQYIGTN-NSSTTFTV  321

Query  1047  MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVAD  1226
              P +NAT +   F DSL+SLNS+ YPA VP+ ++HSL F I +G+NPC  C  G R+VA 
Sbjct  322   PPPRNATFIAFNFMDSLKSLNSKKYPAKVPIKINHSLFFIISLGLNPCATCYRGFRIVAA  381

Query  1227  INNVSFVMPTTPLLQAHYYNISGVF  1301
             INNV+FVMP+  LL  H+ N SGVF
Sbjct  382   INNVTFVMPSVSLLSTHFLNKSGVF  406



>gb|EPS65618.1| hypothetical protein M569_09159, partial [Genlisea aurea]
Length=539

 Score =   508 bits (1308),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 241/386 (62%), Positives = 293/386 (76%), Gaps = 4/386 (1%)
 Frame = +3

Query  156   VESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSI  335
             V+S IR Y+F V M  T+RLC++K I+ VNGKFPGP +YARE DT+ VRV N    N+SI
Sbjct  1     VQSKIRRYQFNVMMTKTTRLCSTKSILTVNGKFPGPTIYAREDDTLHVRVINSSPYNISI  60

Query  336   HWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAI  515
             HWHG++Q RTGW+DGPAYITQCPI+PG SY+YNFT+ GQRGTLLWH+HI+W RATVHG +
Sbjct  61    HWHGIRQLRTGWADGPAYITQCPIRPGHSYVYNFTIAGQRGTLLWHAHISWLRATVHGGL  120

Query  516   VILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPT  695
             V+LPK G PYPF KPD E ++VLGEWW S+ E V+N A   G+ PN+SDAHTING PG  
Sbjct  121   VVLPKAGAPYPFTKPDHERVVVLGEWWKSDTEAVVNQATTSGLAPNISDAHTINGQPGLR  180

Query  696   PTC-SSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIF  872
               C SS G+ L V  GK Y+LR++NAALN+ELFFKIAGH + VVEVDA YVKPF T T+ 
Sbjct  181   SNCASSGGFTLGVSPGKRYMLRLINAALNDELFFKIAGHEMTVVEVDAVYVKPFTTHTVL  240

Query  873   VGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTALTIM  1049
             + PGQTTN +++A Q +GKY +A+SPFMD   +A DN TATATL Y GT   + TA    
Sbjct  241   LTPGQTTNVIISATQGSGKYMVAVSPFMDNPSLAVDNITATATLQYYGTLTDSPTAPARP  300

Query  1050  PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS--GSRVVA  1223
             P QNAT +   F  SLRSLNS  +PA VPL VDHSL+F +G+G+NPC  C +  GSRVVA
Sbjct  301   PSQNATTIAEAFASSLRSLNSARFPALVPLKVDHSLLFTVGLGINPCATCRAGNGSRVVA  360

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
              +NNV+F MPTT +LQAHYY I+GVF
Sbjct  361   SVNNVTFAMPTTSILQAHYYKIAGVF  386



>emb|CDY48114.1| BnaC02g03710D [Brassica napus]
Length=559

 Score =   508 bits (1308),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 249/391 (64%), Positives = 305/391 (78%), Gaps = 5/391 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V   +R Y F V  K  +RLC++K IV VNGKFPGP +YA E DT++V V N+V+ 
Sbjct  16    FPACVHGAVRKYTFNVVTKQMTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPI+PG SY+YNFT+TGQRGTL WH+H+ W RATV
Sbjct  76    NVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATV  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPKLG+PYPFPKP +EE+IVLGEWW S+ E+VIN A++ G+ PNVSDAH ING 
Sbjct  136   HGAIVILPKLGLPYPFPKPHREEVIVLGEWWKSDTENVINEALKSGLAPNVSDAHVINGH  195

Query  684   PGPTPTCSSKGYN--LEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE  857
             PG  P C S+G N  L VESGKTY+LR+VNAA+NEELFFKIAGHR  +VEVDA YVKPF 
Sbjct  196   PGLVPNCPSQGSNFKLAVESGKTYMLRLVNAAMNEELFFKIAGHRFTIVEVDAVYVKPFT  255

Query  858   TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLAST  1034
             TDTI + PGQTT AL++A + +GKY IA +PF D+ +VA DN+TATAT+ Y GT     T
Sbjct  256   TDTILIAPGQTTTALVSAARPSGKYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPT  315

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG--  1208
               T  P QNAT V  +F +SLRSLNS  YPA VP +VDH L+F +G+G+N C +C +G  
Sbjct  316   KTTSPPPQNATSVANSFVNSLRSLNSATYPAKVPTTVDHDLLFTVGLGINRCHSCKAGNF  375

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INN++F MP T LLQAHY+N++G++
Sbjct  376   SRVVAAINNITFKMPKTALLQAHYFNLTGIY  406



>gb|ABE66261.1| laccase/diphenol oxidase [Arabidopsis thaliana]
Length=530

 Score =   506 bits (1302),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 245/375 (65%), Positives = 294/375 (78%), Gaps = 6/375 (2%)
 Frame = +3

Query  195   MKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTGWS  374
             M NT++LC+SKPIV VNG+FPGP + AREGDT++++V NHV+ NVSIHWHG++Q RTGW+
Sbjct  1     MTNTTKLCSSKPIVTVNGQFPGPTIVAREGDTILIKVVNHVKYNVSIHWHGIRQLRTGWA  60

Query  375   DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYPFP  554
             DGPAYITQCPIQPGQ+YL+NFTLTGQRGTL WH+HI W RATVHGAIVILPKLGVPYPFP
Sbjct  61    DGPAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFP  120

Query  555   KPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCSSK-GYNLEV  731
             KP KE+ IVL EWW S+VE++IN A ++G  P+ SDAHTING  G    C S+  Y L V
Sbjct  121   KPYKEKTIVLSEWWKSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPV  180

Query  732   ESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTA  911
              +GKTY+LR++NAALNEELFFKIAGH L VVEVDA Y KP++TDT+F+ PGQTTN LLTA
Sbjct  181   RAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTA  240

Query  912   DQKAG-KYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA----LTIMPLQNATPVT  1076
             +  AG  Y +A + F D  +  DN TATATL Y G     ST+    L  +P QNAT V 
Sbjct  241   NANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVA  300

Query  1077  TTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPT  1256
             T FT SLRSLNS  YPA VP +V+HSL F +G+G NPC +C++G R+VA INNV+F MP 
Sbjct  301   TKFTRSLRSLNSLEYPARVPTTVEHSLFFTVGLGANPCQSCNNGVRLVAGINNVTFTMPK  360

Query  1257  TPLLQAHYYNISGVF  1301
             T LLQAH++NISGVF
Sbjct  361   TALLQAHFFNISGVF  375



>ref|XP_009125430.1| PREDICTED: laccase-10 [Brassica rapa]
Length=559

 Score =   507 bits (1305),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 247/391 (63%), Positives = 305/391 (78%), Gaps = 5/391 (1%)
 Frame = +3

Query  144   FPVS-VESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             FP + V   IR Y F V  K  +RLC++K IV VNGKFPGP +YA E DT++V V N+V+
Sbjct  16    FPAACVHGAIRKYTFNVVTKQMTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVK  75

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              NVSIHWHG++Q RTGW+DGPAYITQCPI+PG SY+YNFT+TGQRGTL WH+H+ W RAT
Sbjct  76    YNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYMYNFTVTGQRGTLWWHAHVLWLRAT  135

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             VHGAIVILPK G+PYPFPKP +EE+IVLGEWW S+ E+VIN A++ G+ PNVSDAH ING
Sbjct  136   VHGAIVILPKPGLPYPFPKPHREEVIVLGEWWKSDTENVINEALKSGLAPNVSDAHVING  195

Query  681   LPGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE  857
              PG  P C S+G + L VESGKTY+LR+VNAA+NEELFFKIAGHR  +VEVDA YVKPF 
Sbjct  196   HPGLVPNCPSQGNFKLAVESGKTYMLRLVNAAMNEELFFKIAGHRFTIVEVDAVYVKPFT  255

Query  858   TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLAST  1034
             TDTI + PGQTT AL++A + +GKY IA +PF D+ +VA DN+TATAT+ Y GT     T
Sbjct  256   TDTILIAPGQTTTALVSAARPSGKYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPT  315

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG--  1208
               T  P QNAT V  +F +SLRSLNS  YPA VP+ +DH L+F +G+G+N C +C +G  
Sbjct  316   KTTSPPAQNATSVANSFVNSLRSLNSVTYPAKVPIKIDHDLLFTVGLGINRCHSCKAGNL  375

Query  1209  SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             SRVVA INN++F MP T LLQAHY+N++G++
Sbjct  376   SRVVAAINNITFKMPKTALLQAHYFNLTGIY  406



>gb|ABK28766.1| unknown [Arabidopsis thaliana]
Length=531

 Score =   506 bits (1302),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 245/375 (65%), Positives = 294/375 (78%), Gaps = 6/375 (2%)
 Frame = +3

Query  195   MKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTGWS  374
             M NT++LC+SKPIV VNG+FPGP + AREGDT++++V NHV+ NVSIHWHG++Q RTGW+
Sbjct  1     MTNTTKLCSSKPIVTVNGQFPGPTIVAREGDTILIKVVNHVKYNVSIHWHGIRQLRTGWA  60

Query  375   DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYPFP  554
             DGPAYITQCPIQPGQ+YL+NFTLTGQRGTL WH+HI W RATVHGAIVILPKLGVPYPFP
Sbjct  61    DGPAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFP  120

Query  555   KPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCSSK-GYNLEV  731
             KP KE+ IVL EWW S+VE++IN A ++G  P+ SDAHTING  G    C S+  Y L V
Sbjct  121   KPYKEKTIVLSEWWKSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPV  180

Query  732   ESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTA  911
              +GKTY+LR++NAALNEELFFKIAGH L VVEVDA Y KP++TDT+F+ PGQTTN LLTA
Sbjct  181   RAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTA  240

Query  912   DQKAG-KYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA----LTIMPLQNATPVT  1076
             +  AG  Y +A + F D  +  DN TATATL Y G     ST+    L  +P QNAT V 
Sbjct  241   NANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVA  300

Query  1077  TTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPT  1256
             T FT SLRSLNS  YPA VP +V+HSL F +G+G NPC +C++G R+VA INNV+F MP 
Sbjct  301   TKFTRSLRSLNSLEYPARVPTTVEHSLFFTVGLGANPCQSCNNGVRLVAGINNVTFTMPK  360

Query  1257  TPLLQAHYYNISGVF  1301
             T LLQAH++NISGVF
Sbjct  361   TALLQAHFFNISGVF  375



>ref|XP_010490598.1| PREDICTED: laccase-10-like isoform X1 [Camelina sativa]
 ref|XP_010490599.1| PREDICTED: laccase-10-like isoform X2 [Camelina sativa]
Length=558

 Score =   506 bits (1304),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 251/390 (64%), Positives = 306/390 (78%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V   IR Y F V  K  +RLC++K IV VNGKFPGP +YA E DTV+V V N+V+ 
Sbjct  16    FPACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTVLVNVVNNVKY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPI+PG SY+YNFT+TGQRGTL WH+H+ W RATV
Sbjct  76    NVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATV  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK G+PYPFPKP +EE+I+LGEWW S+ E VIN A++ G+ PNVSDAH ING 
Sbjct  136   HGAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTEMVINEALKSGLAPNVSDAHVINGH  195

Query  684   PGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG  P C S+G + L VESGKTY+LR++NAALNEELFFKIAGHR  VVEVDA YVKPF T
Sbjct  196   PGLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAVYVKPFNT  255

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTT AL++A + +G+Y IA +PF D+ +VA DN+TATAT+ Y GT     T 
Sbjct  256   DTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTK  315

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG--S  1211
              T  P QNAT V  +F +SLRSLNS  YPANVP++VDH L+F +G+G+N C +C +G  S
Sbjct  316   TTSPPPQNATSVANSFVNSLRSLNSNTYPANVPINVDHDLLFTVGLGINRCHSCKAGNFS  375

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVA INN++F MPTT LLQAHY+N++GV+
Sbjct  376   RVVAAINNITFKMPTTALLQAHYFNLTGVY  405



>ref|XP_002873023.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49282.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=559

 Score =   506 bits (1304),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 247/390 (63%), Positives = 305/390 (78%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V   IR Y F V  K  +RLC++K IV VNGKFPGP +YA E DT++V V N+V+ 
Sbjct  17    FPACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKY  76

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPI+PG SY+YNFT+TGQRGTL WH+H+ W RATV
Sbjct  77    NVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATV  136

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK G+PYPFPKP +EE+I+LGEWW S+ E V+N A++ G+ PNVSDAH ING 
Sbjct  137   HGAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTETVVNEALKSGLAPNVSDAHVINGH  196

Query  684   PGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG  P C S+G + L VESGKTY+LR++NAA+NEELFFKIAGHR  VVEVDA YVKPF T
Sbjct  197   PGLVPNCPSQGNFKLAVESGKTYMLRLINAAMNEELFFKIAGHRFTVVEVDAVYVKPFNT  256

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTT AL++A + +G+Y IA +PF D+ +VA DN+TATAT+ Y GT     T 
Sbjct  257   DTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTK  316

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG--S  1211
              T  P QNAT V  TF +SLRSLNS+ YPA VP++VDH L+F +G+GVN C +C +G  S
Sbjct  317   TTSPPPQNATSVANTFINSLRSLNSKTYPAKVPITVDHDLLFTVGLGVNRCHSCKAGNFS  376

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVA INN++F MP T LLQAHY+N++G++
Sbjct  377   RVVAAINNITFKMPKTALLQAHYFNLTGIY  406



>ref|XP_010452014.1| PREDICTED: laccase-10 isoform X1 [Camelina sativa]
 ref|XP_010452015.1| PREDICTED: laccase-10 isoform X2 [Camelina sativa]
Length=559

 Score =   506 bits (1302),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 250/390 (64%), Positives = 306/390 (78%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V   IR Y F V  K  +RLC++K IV VNGKFPGP +YA E DTV+V V N+V+ 
Sbjct  17    FPACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTVLVNVVNNVKY  76

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPI+PG SY+YNFT+TGQRGTL WH+H+ W RATV
Sbjct  77    NVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATV  136

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK G+PYPFPKP +EE+I+LGEWW S+ E V+N A++ G+ PNVSDAH ING 
Sbjct  137   HGAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTEMVVNEALKSGLAPNVSDAHVINGH  196

Query  684   PGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG  P C S+G + L VESGKTY+LR++NAALNEELFFKIAGHR  VVEVDA YVKPF T
Sbjct  197   PGLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAVYVKPFNT  256

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTT AL++A + +G+Y IA +PF D+ +VA DN+TATAT+ Y GT     T 
Sbjct  257   DTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTK  316

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG--S  1211
              T  P QNAT V  +F +SLRSLNS  YPANVP++VDH L+F +G+G+N C +C +G  S
Sbjct  317   TTSPPPQNATSVANSFVNSLRSLNSNTYPANVPINVDHDLLFTVGLGINRCHSCKAGNFS  376

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVA INN++F MPTT LLQAHY+N++GV+
Sbjct  377   RVVAAINNITFKMPTTALLQAHYFNLTGVY  406



>emb|CDY55905.1| BnaAnng13970D [Brassica napus]
Length=563

 Score =   505 bits (1301),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 247/395 (63%), Positives = 305/395 (77%), Gaps = 9/395 (2%)
 Frame = +3

Query  144   FPVS-VESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             FP + V   IR Y F V  K  +RLC++K IV VNGKFPGP +YA E DT++V V N+V+
Sbjct  16    FPAACVHGAIRKYTFNVVTKQMTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVK  75

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              NVSIHWHG++Q RTGW+DGPAYITQCPI+PG SY+YNFT+TGQRGTL WH+H+ W RAT
Sbjct  76    YNVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYMYNFTVTGQRGTLWWHAHVLWLRAT  135

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             VHGAIVILPK G+PYPFPKP +EE+IVLGEWW S+ E+VIN A++ G+ PNVSDAH ING
Sbjct  136   VHGAIVILPKPGLPYPFPKPHREEVIVLGEWWKSDTENVINEALKSGLAPNVSDAHVING  195

Query  681   LPGPTPTCSSKG-----YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYV  845
              PG  P C S+G     + L VESGKTY+LR+VNAA+NEELFFKIAGHR  +VEVDA YV
Sbjct  196   HPGLVPNCPSQGSLSCNFKLAVESGKTYMLRLVNAAMNEELFFKIAGHRFTIVEVDAVYV  255

Query  846   KPFETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHL  1022
             KPF TDTI + PGQTT AL++A + +GKY IA +PF D+ +VA DN+TATAT+ Y GT  
Sbjct  256   KPFTTDTILIAPGQTTTALVSAARPSGKYLIAAAPFQDSAVVAVDNRTATATVHYSGTLS  315

Query  1023  LASTALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACS  1202
                T  T  P QNAT V  +F +SLRSLNS  YPA VP+ +DH L+F +G+G+N C +C 
Sbjct  316   ATPTKTTSPPAQNATSVANSFVNSLRSLNSVTYPAKVPIKIDHDLLFTVGLGINRCHSCK  375

Query  1203  SG--SRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             +G  SRVVA INN++F MP T LLQAHY+N++G++
Sbjct  376   AGNLSRVVAAINNITFKMPKTALLQAHYFNLTGIY  410



>emb|CAB69847.1| laccase-like protein [Arabidopsis thaliana]
Length=553

 Score =   504 bits (1299),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 246/389 (63%), Positives = 304/389 (78%), Gaps = 7/389 (2%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V   IR Y F V  K  +R+C++K IV VNGKFPGP +YA E DT++V V N+V+ 
Sbjct  16    FPACVHGAIRKYTFNVVTKQVTRICSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPI+PG SY+YNFT+TGQRGTL WH+H+ W RATV
Sbjct  76    NVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATV  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPKLG+PYPFPKP +EE+I+LGEWW S+ E V+N A++ G+ PNVSDAH ING 
Sbjct  136   HGAIVILPKLGLPYPFPKPHREEVIILGEWWKSDTETVVNEALKSGLAPNVSDAHVINGH  195

Query  684   PGPTPTCSSKGYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETD  863
             PG  P C S+     VESGKTY+LR++NAALNEELFFKIAGHR  VVEVDA YVKPF TD
Sbjct  196   PGFVPNCPSQA----VESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAVYVKPFNTD  251

Query  864   TIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTAL  1040
             TI + PGQTT AL++A + +G+Y IA +PF D+ +VA DN+TATAT+ Y GT     T  
Sbjct  252   TILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTKT  311

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG--SR  1214
             T  P QNAT V  TF +SLRSLNS+ YPANVP++VDH L+F +G+G+N C +C +G  SR
Sbjct  312   TSPPPQNATSVANTFVNSLRSLNSKTYPANVPITVDHDLLFTVGLGINRCHSCKAGNFSR  371

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VVA INN++F MP T LLQAHY+N++G++
Sbjct  372   VVAAINNITFKMPKTALLQAHYFNLTGIY  400



>ref|XP_006287399.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
 gb|EOA20297.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
Length=558

 Score =   504 bits (1298),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 249/390 (64%), Positives = 303/390 (78%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V   IR Y F V  K  +RLC++K IV VNGKFPGP +YA E DT++V V N+V+ 
Sbjct  16    FPACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPI+PG SY+YNFT+TGQRGTL WH+H+ W RATV
Sbjct  76    NVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATV  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK G+PYPFPKP +EE+I+LGEWW S+ E VIN A++ G+ PNVSDAH ING 
Sbjct  136   HGAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTEMVINEALRSGLAPNVSDAHVINGH  195

Query  684   PGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG  P C S+G + L VESGKTY+LR++NAALNEELFFKIAGHR  VVEVDA YVKPF T
Sbjct  196   PGLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAAYVKPFNT  255

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTT AL++A + +G+Y IA +PF D+ +VA DN+TATAT+ Y GT     T 
Sbjct  256   DTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTK  315

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG--S  1211
              T  P QNAT V  +F  SLRSLNS  YPA VP++VDH L+F +G+G+N C +C +G  S
Sbjct  316   TTSPPPQNATSVANSFVKSLRSLNSNTYPAKVPVTVDHDLLFTVGLGINRCHSCKAGNFS  375

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVA INN++F MPTT LLQAHY+N +GV+
Sbjct  376   RVVAAINNITFKMPTTALLQAHYFNQTGVY  405



>ref|XP_010423919.1| PREDICTED: laccase-10-like [Camelina sativa]
Length=558

 Score =   504 bits (1298),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 249/390 (64%), Positives = 306/390 (78%), Gaps = 4/390 (1%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V   IR Y F V  K  +RLC++K IV VNGKFPGP +YA E DTV+V V N+V+ 
Sbjct  16    FPACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTVLVNVVNNVKY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPI+PG SY+YNFT+TGQRGTL WH+H+ W RATV
Sbjct  76    NVSIHWHGIRQLRTGWADGPAYITQCPIKPGHSYVYNFTVTGQRGTLWWHAHVLWLRATV  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPK G+PYPFPKP +EE+I+LGEWW S+ E V+N A++ G+ PNVSDAH ING 
Sbjct  136   HGAIVILPKPGLPYPFPKPHREEVIILGEWWKSDTEMVVNEALKSGLAPNVSDAHVINGH  195

Query  684   PGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG  P C S+G + L VESGKTY+LR++NAALNEELFFKIAGHR  VVEVDA YVKPF T
Sbjct  196   PGLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAVYVKPFNT  255

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTT AL++A + +G+Y IA +PF D+ +VA DN+TATAT+ Y GT     T 
Sbjct  256   DTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTK  315

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG--S  1211
              T  P QNAT V  +F +SLRSLNS  YPANVP++VDH L+F +G+G+N C +C +G  S
Sbjct  316   TTSPPPQNATSVANSFVNSLRSLNSNTYPANVPINVDHDLLFTVGLGINRCHSCKAGNFS  375

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVA INN++F MPTT LL+AHY+N++GV+
Sbjct  376   RVVAAINNITFKMPTTALLEAHYFNLTGVY  405



>ref|XP_009590676.1| PREDICTED: laccase-11-like [Nicotiana tomentosiformis]
Length=559

 Score =   500 bits (1287),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 288/385 (75%), Gaps = 1/385 (0%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             +  E+ I+ Y+F +++ N SRLC +KPIV VNG+FPGP +Y REGD V + V NH Q N+
Sbjct  21    LPAEAAIKKYQFDIQVANVSRLCHAKPIVTVNGRFPGPTIYVREGDRVQINVTNHAQYNM  80

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             SIHWHG+KQ+R GW+DGPAYITQCPI+ G SY+Y+F +TGQRGTL WH+HI W RATV+G
Sbjct  81    SIHWHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWWHAHILWLRATVYG  140

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVILP+ G P+PFP+PD+EE+IVLGEWWN++VE V N    LG+PPN+SDAHTING PG
Sbjct  141   AIVILPQQGTPFPFPQPDREEVIVLGEWWNADVEQVENQGNALGLPPNMSDAHTINGKPG  200

Query  690   PTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDT  866
             P   CS K  Y +EVE GKTYLLR++NAALN+ELFF +A H L VVE+DA Y KPF T+ 
Sbjct  201   PLFPCSEKYTYAMEVEKGKTYLLRIINAALNDELFFSVANHTLTVVEIDAVYTKPFSTEA  260

Query  867   IFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTI  1046
             I + PGQTTN L+ A+Q  G+Y +A  PFMD  ++ DN+TATA   YKG        L  
Sbjct  261   ILIAPGQTTNVLVRANQIPGRYFMAARPFMDAPISVDNKTATAIFQYKGVSETVIPKLPD  320

Query  1047  MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVAD  1226
             +P  N T    ++ + LRSLNS  YPANVPL VD +L + IG+G+N CP C +G+R+ A 
Sbjct  321   LPAPNDTEFALSYDNKLRSLNSPKYPANVPLKVDRNLFYTIGLGINACPTCLNGTRLTAS  380

Query  1227  INNVSFVMPTTPLLQAHYYNISGVF  1301
             +NN+SFVMP T LLQAHY+NI GV+
Sbjct  381   LNNISFVMPQTALLQAHYFNIKGVY  405



>ref|XP_009764219.1| PREDICTED: laccase-11-like [Nicotiana sylvestris]
Length=562

 Score =   499 bits (1286),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 288/385 (75%), Gaps = 1/385 (0%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             +  E+ I+ Y+F +++ N SRLC +KPIV VNG+FPGP +Y REGD V + V NH Q N+
Sbjct  24    LPAEAAIKKYQFDIQVANVSRLCHAKPIVTVNGRFPGPTIYIREGDRVQINVINHAQYNI  83

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             SIHWHG+KQ+R GW+DGPAYITQCPI+ G SY+Y+F +TGQRGTL WH+HI W RATV+G
Sbjct  84    SIHWHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWWHAHILWLRATVYG  143

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVILP+ G P+PFP+PD+EE+IVLGEWWN++VE V N    LG+PPN+SDAHTING PG
Sbjct  144   AIVILPQQGTPFPFPQPDREEVIVLGEWWNADVEQVENQGNALGLPPNMSDAHTINGKPG  203

Query  690   PTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDT  866
             P   CS K  Y +EVE GKTYLLR++NAALN+ELFF +A H L VVE+DA Y KPF T+ 
Sbjct  204   PLFPCSEKYTYAMEVEKGKTYLLRIINAALNDELFFSVANHTLTVVEIDAVYTKPFSTNA  263

Query  867   IFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTI  1046
             I + PGQTTN L+ A+Q  G+Y +A  PFMD  ++ DN+TATA   YKG        L  
Sbjct  264   ILIAPGQTTNVLVRANQIPGRYFMAARPFMDAPISVDNKTATAIFQYKGVSETVIPKLPD  323

Query  1047  MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVAD  1226
             +P  N T    ++ + LRSLNS  YPANVPL VD +L + IG+G+N CP C +G+R+ A 
Sbjct  324   LPAPNDTEFALSYDNKLRSLNSPKYPANVPLKVDRNLFYTIGLGINACPTCLNGTRLTAS  383

Query  1227  INNVSFVMPTTPLLQAHYYNISGVF  1301
             +NN+SFVMP T LLQAHY+NI GV+
Sbjct  384   LNNISFVMPQTALLQAHYFNIKGVY  408



>gb|KFK44563.1| hypothetical protein AALP_AA1G273400 [Arabis alpina]
Length=556

 Score =   499 bits (1284),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 247/390 (63%), Positives = 303/390 (78%), Gaps = 6/390 (2%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             FP  V   IR Y F V  K  +RLC++K IV VNGKFPGP +YA E DT++V V N+V+ 
Sbjct  16    FPACVHGAIRKYTFNVVTKQVTRLCSTKQIVTVNGKFPGPTIYANEDDTILVNVVNNVKY  75

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             NVSIHWHG++Q RTGW+DGPAYITQCPI+PG +Y+YNFT+TGQRGTL WH+H+ W RATV
Sbjct  76    NVSIHWHGIRQLRTGWADGPAYITQCPIKPGHNYVYNFTVTGQRGTLWWHAHVLWLRATV  135

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             HGAIVILPKL  PYPFPKP +EE+I+LGEWW S+ E V+N A++ G+ PNVSDAH ING 
Sbjct  136   HGAIVILPKL--PYPFPKPHREEVIILGEWWISDTEAVVNEALRSGLAPNVSDAHVINGH  193

Query  684   PGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PG  P C S+G + L VESGKTY+LR++NAALNEELFFKIAGHR  VVEVDA YVKPF T
Sbjct  194   PGLVPNCPSQGNFKLAVESGKTYMLRLINAALNEELFFKIAGHRFTVVEVDAVYVKPFNT  253

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDT-IVATDNQTATATLSYKGTHLLASTA  1037
             DTI + PGQTT AL++A + +G+Y IA +PF D+ +VA DN+TATAT+ Y GT     T 
Sbjct  254   DTILIAPGQTTTALVSAARPSGQYLIAAAPFQDSAVVAVDNRTATATVHYSGTLSATPTK  313

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSG--S  1211
              T  P QNAT V  TF +SLRSLNS  YPA VP+++DH L+F +G+G+N C +C  G  S
Sbjct  314   TTSPPPQNATSVANTFVNSLRSLNSNTYPAKVPITIDHDLLFTVGLGINRCHSCKKGNFS  373

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             RVVA INN++F MPTT LLQAHY+N++GV+
Sbjct  374   RVVAAINNITFKMPTTGLLQAHYFNLTGVY  403



>ref|XP_004233973.1| PREDICTED: laccase-11 [Solanum lycopersicum]
Length=563

 Score =   499 bits (1284),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 231/382 (60%), Positives = 285/382 (75%), Gaps = 1/382 (0%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             E+ I+ Y+F +++ N SRLC +KP+V VNG+FPGP +YAREGD V + V NH Q N+SIH
Sbjct  28    EAAIKKYQFDIQVANVSRLCHAKPMVTVNGRFPGPTIYAREGDRVQINVTNHAQYNMSIH  87

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHG+KQ+R GW+DGPAYITQCPI+ G SY+Y+F +TGQRGTL WH+HI W RATV+GAIV
Sbjct  88    WHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWWHAHILWLRATVYGAIV  147

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             ILP  G P+PFP+PD+EE+IVLGEWWN++VE V N    LGIPPN+SDAHTING PGP  
Sbjct  148   ILPSQGTPFPFPQPDREEVIVLGEWWNADVEQVENQGNALGIPPNMSDAHTINGKPGPLF  207

Query  699   TCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFV  875
              CS K  + +EVE GKTYLLR+VNAALN+ELFF IA H L VVE+DA Y KPF T+ I +
Sbjct  208   PCSEKYTFAMEVEKGKTYLLRIVNAALNDELFFTIANHTLTVVEIDAVYTKPFSTEAILI  267

Query  876   GPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPL  1055
              PGQTTN L+ A+Q  G+Y +A  PFMD  V  DN+TATA   YKG        L  +P 
Sbjct  268   APGQTTNVLVRANQVPGRYFMAARPFMDAPVPVDNKTATAIFQYKGIPETVLPKLPNLPA  327

Query  1056  QNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINN  1235
              N T    ++   LRSLNS+ YPANVPL VD +L + IG+G+N CP C +G+R  A +NN
Sbjct  328   PNDTEFALSYDKKLRSLNSQKYPANVPLKVDRNLFYTIGLGINACPTCINGTRFSASLNN  387

Query  1236  VSFVMPTTPLLQAHYYNISGVF  1301
             +SFVMP T LLQAHY+NI GV+
Sbjct  388   ISFVMPKTALLQAHYFNIKGVY  409



>ref|XP_010924287.1| PREDICTED: laccase-11-like [Elaeis guineensis]
Length=559

 Score =   498 bits (1282),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 232/385 (60%), Positives = 288/385 (75%), Gaps = 1/385 (0%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             +  E+ I++Y+F V +KN SRLC +KPIV VNG+FPGP +YAREGD VV+ V N+ Q N+
Sbjct  21    LPAEAAIKNYQFDVVLKNVSRLCHAKPIVTVNGRFPGPTIYAREGDRVVINVTNYAQYNI  80

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             SIHWHG+KQFR GW+DGPAYITQCPIQ G+SY Y+F +TGQRGTL WH+HI W RAT+HG
Sbjct  81    SIHWHGLKQFRNGWADGPAYITQCPIQSGRSYTYDFNVTGQRGTLWWHAHILWLRATIHG  140

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVI+PK GVPYPFP+P  E  +VLGEWW+++VE+V      LG+PPN+SDAHTING PG
Sbjct  141   AIVIMPKEGVPYPFPQPHAEAELVLGEWWHADVEEVEKQGNMLGLPPNMSDAHTINGKPG  200

Query  690   PTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDT  866
             P   CS K  + +EVE GKTYLLR+VNAALN+ELFF IAGH + +VE+DA Y KPF T+ 
Sbjct  201   PLFPCSEKHTFAMEVEWGKTYLLRIVNAALNDELFFAIAGHSMTMVEIDAVYCKPFTTNA  260

Query  867   IFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTI  1046
             I + PGQTT+ L+ AD+  G+Y +A  PFMD  +A DN+TATA L YKG        L  
Sbjct  261   IVIAPGQTTSVLVKADKNPGRYFMAARPFMDAPIAVDNRTATAILQYKGIPTTIVPILPQ  320

Query  1047  MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVAD  1226
             +P  N T     F D LRSLNS  +PANVPLSVD  L +   +GV+PCP C +G+R+ A 
Sbjct  321   LPAPNDTEFVNDFLDKLRSLNSPQFPANVPLSVDRHLFYTASLGVDPCPTCLNGTRLTAS  380

Query  1227  INNVSFVMPTTPLLQAHYYNISGVF  1301
             +NN++FVMPT  LLQAHY+NI GVF
Sbjct  381   LNNITFVMPTIGLLQAHYFNIKGVF  405



>gb|AES94995.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=561

 Score =   497 bits (1280),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 233/384 (61%), Positives = 283/384 (74%), Gaps = 1/384 (0%)
 Frame = +3

Query  153   SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVS  332
             S E+ I+ Y+F +++KN SRLC +KPIV VNG+FPGP +YAREGD V V V NH Q N+S
Sbjct  24    SSEAAIKKYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTIYAREGDQVFVNVTNHAQYNMS  83

Query  333   IHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGA  512
             IHWHG+KQ+R GW+DGPAYITQCPIQ G SY Y F +TGQRGTL WH+HI W RATV+GA
Sbjct  84    IHWHGLKQYRNGWADGPAYITQCPIQTGNSYTYEFNVTGQRGTLWWHAHIFWLRATVYGA  143

Query  513   IVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGP  692
             IVI+PKLG P+PFP+P +E  IVLGEWWN++VE++     +LG+PPN+SDAHTING PGP
Sbjct  144   IVIMPKLGTPFPFPQPAREFEIVLGEWWNNDVEEIEKQGNKLGLPPNMSDAHTINGKPGP  203

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
                CS K  + +EVE GKTYL+R+VNAALN+ELFF IAGH + VVEVDA Y KPF T  I
Sbjct  204   LFPCSEKHTFAMEVEQGKTYLMRIVNAALNDELFFAIAGHNMTVVEVDAVYTKPFTTQAI  263

Query  870   FVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIM  1049
              + PGQTTN L+ A+Q AG+Y +A   FMD  +  DN+TATA L YK         L  +
Sbjct  264   LIAPGQTTNVLVHANQVAGRYFVATKAFMDAPIQVDNKTATAILQYKDIPNTVQPILPQL  323

Query  1050  PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADI  1229
             P  N T    ++   LRSLNS  YPANVPL VD +L + IG+G N CP C +G+R +A I
Sbjct  324   PASNDTGFALSYNKKLRSLNSAKYPANVPLKVDRNLFYTIGLGKNSCPTCLNGTRFLASI  383

Query  1230  NNVSFVMPTTPLLQAHYYNISGVF  1301
             NNVSFVMP   LLQAHY+NI GVF
Sbjct  384   NNVSFVMPQIALLQAHYFNIKGVF  407



>ref|XP_006347000.1| PREDICTED: laccase-11-like [Solanum tuberosum]
Length=563

 Score =   496 bits (1277),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 230/382 (60%), Positives = 284/382 (74%), Gaps = 1/382 (0%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             E+ I+ Y+F +++ N SRLC +KP+V VNG+FPGP +YAREGD V + V NH Q N+SIH
Sbjct  28    EAAIKKYQFDIQVANVSRLCHAKPMVTVNGRFPGPTIYAREGDRVQINVTNHAQYNMSIH  87

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHG+KQ+R GW+DGPAYITQCPI+ G SY+Y+F +TGQRGTL WH+HI W RATV+GAIV
Sbjct  88    WHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWWHAHILWLRATVYGAIV  147

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             ILP  G P+PFP+PD+EE+IVLGEWWN++VE V N    LGIPPN+SDAHTING PGP  
Sbjct  148   ILPSQGTPFPFPQPDREEVIVLGEWWNADVEQVENQGNALGIPPNMSDAHTINGKPGPLF  207

Query  699   TCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFV  875
              CS K  + +EVE GK+YLLR+VNAALN+ELFF IA H L VVE+DA Y KPF T+ I +
Sbjct  208   PCSEKYTFAMEVEKGKSYLLRIVNAALNDELFFTIANHTLTVVEIDAVYTKPFSTEAILI  267

Query  876   GPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPL  1055
              PGQTTN L+ A+Q  G+Y +A  PFMD  V  DN+TATA   YKG        L  +P 
Sbjct  268   APGQTTNVLVRANQIPGRYFMAARPFMDAPVPVDNKTATAIFQYKGIPETVIPKLPNLPA  327

Query  1056  QNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINN  1235
              N T    ++   LRSLNS  YPANVPL VD +L + IG+G+N CP C +G+R  A +NN
Sbjct  328   PNDTEFALSYDKKLRSLNSPKYPANVPLKVDRNLFYTIGLGINACPTCINGTRFSASLNN  387

Query  1236  VSFVMPTTPLLQAHYYNISGVF  1301
             +SFVMP T LLQAHY+NI GV+
Sbjct  388   ISFVMPKTALLQAHYFNIKGVY  409



>gb|ACN39933.1| unknown [Picea sitchensis]
Length=559

 Score =   496 bits (1276),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 238/386 (62%), Positives = 290/386 (75%), Gaps = 2/386 (1%)
 Frame = +3

Query  150   VSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENV  329
             +  E   RHYKF V +KN SRLC +KPIV VNG+FPGP +YAREGDTV+V V NHV+ NV
Sbjct  21    MEAEGKTRHYKFDVGLKNVSRLCQTKPIVTVNGEFPGPTIYAREGDTVIVNVTNHVKYNV  80

Query  330   SIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHG  509
             SIHWHGV+Q RTGW+DGPAYITQCPIQ GQSY YNFT+TGQRGTL WH+HI W RAT+HG
Sbjct  81    SIHWHGVRQLRTGWADGPAYITQCPIQTGQSYAYNFTITGQRGTLWWHAHILWLRATIHG  140

Query  510   AIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPG  689
             AIVILP     YPFPKP KE  ++LGEWWN++VE VIN A++ G  PNVSDAHTING PG
Sbjct  141   AIVILPPKHHLYPFPKPHKEITLLLGEWWNADVEAVINEALKSGGAPNVSDAHTINGKPG  200

Query  690   PTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDT  866
             P   C +K  + + VE GKTYLLR++N ALN+ELFF +A H L+VVEVDA Y KP  T +
Sbjct  201   PLFKCPTKDTFVVSVEHGKTYLLRIINVALNDELFFDVADHHLKVVEVDAVYTKPLRTKS  260

Query  867   IFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAS-TALT  1043
             I + PGQTTNALL A++ +G+Y IA   FMD  VA DN+TATA L Y  ++      A+ 
Sbjct  261   IVIAPGQTTNALLYANKGSGRYFIATRTFMDAPVAVDNKTATAILQYVNSNSNTDFIAMP  320

Query  1044  IMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVA  1223
              +P QN T   T F++SLRSLNS  +PA VP +VD  L+F +G+ ++ CP C++GSRV A
Sbjct  321   RIPSQNDTSFATNFSNSLRSLNSARFPAKVPQTVDRHLLFTVGLAMDSCPTCNNGSRVAA  380

Query  1224  DINNVSFVMPTTPLLQAHYYNISGVF  1301
              INN+SFVMP   LLQAH++NI+GVF
Sbjct  381   SINNISFVMPKISLLQAHFFNITGVF  406



>ref|XP_009593898.1| PREDICTED: laccase-11-like [Nicotiana tomentosiformis]
Length=562

 Score =   494 bits (1271),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 223/389 (57%), Positives = 289/389 (74%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C   +  E+ ++ Y+F V++ N SRLC +KPIV VNG+FPGP +YA+EGD V + V N+ 
Sbjct  20    CFICLPAEAALKKYQFDVQVANVSRLCHAKPIVTVNGRFPGPTIYAKEGDRVQINVTNYA  79

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             Q N+SIHWHG+KQ+R GW+DGPAYITQCPIQ G SY+Y+F +TGQRGTL WH+HI W RA
Sbjct  80    QYNLSIHWHGLKQYRNGWADGPAYITQCPIQTGNSYVYDFNITGQRGTLWWHAHILWLRA  139

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TV+GAIVI+P+ G P+PFP+PD+EE++VLGEWWN++VE+V      LGIPPN+SDAHTIN
Sbjct  140   TVYGAIVIMPQQGTPFPFPQPDREEVLVLGEWWNADVEEVEKQGNALGIPPNMSDAHTIN  199

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CS K  + +EVE GKTYLLR++NAALN+ELFF +A H   VVE+DA Y KPF
Sbjct  200   GKPGPLFPCSEKHTFAMEVEKGKTYLLRIINAALNDELFFSLANHTFTVVEIDAVYTKPF  259

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
              T+ I + PGQTTN L+ A+Q  G+Y +A   FMD  ++ DN+TATA   YKG       
Sbjct  260   TTEAILIAPGQTTNVLVRANQIPGRYFMAARAFMDAPISVDNKTATAIFQYKGIPQTLLP  319

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              L  +P QN T    T+   L+SLN+  YPANVPL+VD  L+F +G+G+NPCP C +G+R
Sbjct  320   KLPTLPEQNDTDFALTYNSKLKSLNTPKYPANVPLNVDRHLLFTVGLGINPCPTCLNGTR  379

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             + A +NN++F MP T LLQAHY+NI GV+
Sbjct  380   LTASLNNITFSMPQTALLQAHYFNIKGVY  408



>ref|XP_004512055.1| PREDICTED: laccase-11-like [Cicer arietinum]
Length=566

 Score =   494 bits (1271),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 230/388 (59%), Positives = 289/388 (74%), Gaps = 3/388 (1%)
 Frame = +3

Query  141   TFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             +FPV  E+ I+ Y+F ++MKN SRLC +KPIV VNG+FPGP +YAREGD V + V NHV 
Sbjct  26    SFPV--EAAIKKYQFDIQMKNVSRLCHAKPIVTVNGRFPGPTIYAREGDRVQINVTNHVN  83

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              N+SIHWHG+KQ+R GW+DGPAYITQCPIQ G SY Y+F +TGQRGTL WH+HI W RAT
Sbjct  84    YNLSIHWHGLKQYRNGWADGPAYITQCPIQTGGSYTYDFNVTGQRGTLWWHAHILWLRAT  143

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             V+GAIVI+PK G P+PFP+P  E  I+LGEWW+ +VE+V     Q+G+PPN+SDAHTING
Sbjct  144   VYGAIVIMPKQGTPFPFPQPAGEFEILLGEWWHKDVEEVEKQGNQMGLPPNMSDAHTING  203

Query  681   LPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE  857
              PGP   CS K  Y +EVE GKTYLLR++NAALN+ELFF I+GH + VVEVDA Y KPF 
Sbjct  204   KPGPLFPCSEKHTYAMEVEKGKTYLLRIINAALNDELFFAISGHNMTVVEVDAVYTKPFT  263

Query  858   TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA  1037
             T +I +GPGQTTN L+ A++ A +Y IA   FMD  ++ DN+TATA   YKG       +
Sbjct  264   TQSILIGPGQTTNVLVKANKIASRYFIATRTFMDAPLSVDNKTATAIFQYKGVSNTIIPS  323

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
               ++P  N T     ++  L+SLNS  YP NVPL VD +L F IG+G+N CP C +G+R+
Sbjct  324   FPLLPFANDTNFALNYSKKLKSLNSAKYPVNVPLKVDRNLFFTIGLGMNSCPTCINGTRL  383

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             VA +NNV+FVMP T LLQAH++NI GVF
Sbjct  384   VASLNNVTFVMPKTALLQAHHFNIKGVF  411



>ref|XP_009793780.1| PREDICTED: laccase-11-like [Nicotiana sylvestris]
Length=562

 Score =   494 bits (1271),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 225/389 (58%), Positives = 287/389 (74%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C   +  E+ ++ Y+F V++ N SRLC +KPIV VNG+FPGP +YAREGD V + V N+ 
Sbjct  20    CFICLPAEAALKKYQFDVQVANVSRLCHAKPIVTVNGRFPGPTIYAREGDRVQINVTNYA  79

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             Q N+SIHWHG+KQ+R GW+DGPAYITQCPIQ G SY+Y+F +TGQRGTL WH+HI W RA
Sbjct  80    QYNLSIHWHGLKQYRNGWADGPAYITQCPIQTGNSYVYDFNITGQRGTLWWHAHILWLRA  139

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TV+GAIVI+P+ G P+PFP+PD+EE++VLGEWWN++VE+V      LGIPPN+SDAHTIN
Sbjct  140   TVYGAIVIMPQQGTPFPFPQPDREEVLVLGEWWNADVEEVEKQGNALGIPPNMSDAHTIN  199

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CS K  + +EVE GKTYLLR+VNAALN+ELFF +A H   VVE+DA Y KPF
Sbjct  200   GKPGPLFPCSEKHTFAMEVEKGKTYLLRIVNAALNDELFFALANHTFTVVEIDAVYTKPF  259

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
              T+ I + PGQTTN L+ A+Q  G+Y +A   FMD  ++ DN+TATA   YKG       
Sbjct  260   STEAILIAPGQTTNVLVRANQVPGRYFMAARAFMDAPISVDNKTATAIFQYKGIPQTLLP  319

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              L  +P QN T    T+   LRSLN+  YPANVPL+VD  L+  +G+G+NPCP C +G+R
Sbjct  320   KLPTLPEQNDTNFALTYNSKLRSLNTPKYPANVPLNVDRHLLLTVGLGINPCPTCLNGTR  379

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
               A +NN++F MP T LLQAHY+NI GV+
Sbjct  380   FTASLNNITFSMPQTALLQAHYFNIKGVY  408



>ref|XP_009772835.1| PREDICTED: laccase-11-like [Nicotiana sylvestris]
Length=562

 Score =   493 bits (1268),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 225/389 (58%), Positives = 287/389 (74%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C   +  E+ ++ Y+F V++ N SRLC +KPIV VNG+FPGP +YAREGD V + V N  
Sbjct  20    CFICLPAEAALKKYQFDVQVANVSRLCHAKPIVTVNGRFPGPTIYAREGDRVQINVTNFA  79

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             Q N+SIHWHG+KQ+R GW+DGPAYITQCPIQ G SY+Y+F +TGQRGTL WH+HI W RA
Sbjct  80    QYNLSIHWHGLKQYRNGWADGPAYITQCPIQTGNSYVYDFNITGQRGTLWWHAHILWLRA  139

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TV+G IVILP+ G P+PFP+PD+EE++VLGEWWN++VE+V      LGIPPN+SDAHTIN
Sbjct  140   TVYGPIVILPQQGTPFPFPQPDREEVLVLGEWWNADVEEVEKQGNALGIPPNMSDAHTIN  199

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CS K  + +EVE GKTYLLR++NAALN+ELFF +A H   VVE+DA Y KPF
Sbjct  200   GKPGPLFPCSEKHTFAMEVEKGKTYLLRIINAALNDELFFALANHTFTVVEIDAVYTKPF  259

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
              T+ I + PGQTTN L+ A+Q  G+Y +A   FMD  ++ DN+TATA   YKG       
Sbjct  260   TTEAILIAPGQTTNVLVRANQIPGRYFMAARAFMDAPISVDNKTATAIFQYKGIPQTVLP  319

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              L  +P QN T    T+   L+SLN+  YPANVPL+VD  L+F IG+G+NPCP C +G+R
Sbjct  320   KLPTLPEQNDTNFALTYNSKLKSLNTPKYPANVPLNVDRHLLFTIGLGINPCPTCLNGTR  379

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             + A +NN++F MP T LLQAHY+NI GV+
Sbjct  380   LTASLNNITFSMPQTALLQAHYFNIKGVY  408



>gb|KHN36103.1| Laccase-11 [Glycine soja]
Length=554

 Score =   491 bits (1265),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 230/384 (60%), Positives = 285/384 (74%), Gaps = 1/384 (0%)
 Frame = +3

Query  153   SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVS  332
             S E+ I+ Y+F +++ N SRLC +KPIV VNG+FPGP +Y REGD V++ V NHV  N+S
Sbjct  17    SSEAAIKKYQFDIQVTNVSRLCHAKPIVTVNGRFPGPTIYVREGDRVLINVTNHVLYNMS  76

Query  333   IHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGA  512
             IHWHG+KQFR GW DGPAYITQCPIQ G SY Y+F +TGQRGTL WH+HI W RATV+GA
Sbjct  77    IHWHGLKQFRNGWVDGPAYITQCPIQTGSSYTYDFNVTGQRGTLWWHAHILWLRATVYGA  136

Query  513   IVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGP  692
             IVI+PK G P+PFP+P +E  I+LGEWWN++VE++ N   ++G+PPN+SDAH+ING PGP
Sbjct  137   IVIMPKPGTPFPFPQPAREFEILLGEWWNNDVEEIENQGNKMGLPPNMSDAHSINGKPGP  196

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
                CS K  + +EVE GKTYLLR++NAALN+ELFF IAGH L VVEVDA Y KPF T  I
Sbjct  197   LFPCSEKHTFAMEVEQGKTYLLRIINAALNDELFFAIAGHSLTVVEVDAVYTKPFTTPAI  256

Query  870   FVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIM  1049
              + PGQTTN L+ A+Q AG+Y +A   FMD  +  DN+TATA L YKG        L  +
Sbjct  257   LIAPGQTTNVLVQANQVAGRYFMATKAFMDAPIPVDNKTATAILQYKGIPNTVLPVLPQL  316

Query  1050  PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADI  1229
             P  N T    ++   LRSLNS  YPANVPL VD +L + IG+G N CP C +G+++VA +
Sbjct  317   PASNDTRFALSYNKKLRSLNSAQYPANVPLKVDRNLFYTIGLGQNSCPTCLNGTQLVASL  376

Query  1230  NNVSFVMPTTPLLQAHYYNISGVF  1301
             NNVSFVMP T LLQAHY+NI GVF
Sbjct  377   NNVSFVMPQTALLQAHYFNIKGVF  400



>gb|KHG01609.1| Laccase-11 -like protein [Gossypium arboreum]
Length=562

 Score =   491 bits (1265),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 223/388 (57%), Positives = 287/388 (74%), Gaps = 3/388 (1%)
 Frame = +3

Query  141   TFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             +FP   E+ +R Y+F +++KN SRLC +KPIV VNG+FPGP +YAREGD V+V V NH +
Sbjct  23    SFPA--EAAVRKYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTIYAREGDRVIVNVTNHAK  80

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              N+SIHWHG+KQ+R GW+DGPAYITQCPI+ G SY+Y+F +TGQRGTL WH+HI W RAT
Sbjct  81    YNMSIHWHGLKQYRNGWADGPAYITQCPIKTGNSYVYDFNVTGQRGTLWWHAHILWLRAT  140

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             V+GAIVI+PK G+PYPFPKP+ E+++VLGEWW+ +VE+++     +G+PPN+SDAHTING
Sbjct  141   VYGAIVIMPKQGMPYPFPKPNMEQLVVLGEWWHKDVEEIVKQGNNMGLPPNMSDAHTING  200

Query  681   LPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE  857
              PGP   CS K  + +EVESGKTYLLR++NAALN+ELFF IA H + VVEVDA Y KPF 
Sbjct  201   KPGPLFPCSEKHTFAMEVESGKTYLLRIINAALNDELFFAIASHNMTVVEVDAVYTKPFV  260

Query  858   TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA  1037
             T  I + PGQTTN L+ A+Q  G+Y +A  PFMD  +  DN+TAT    Y G        
Sbjct  261   TQAILIAPGQTTNVLIQANQSPGRYFMAARPFMDAPIPVDNKTATGIFQYNGIPNTVLPT  320

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             L  +P  N T    ++   L+SLNS  +PANVPL VD  L + +G G + CP C +G+R+
Sbjct  321   LPQLPASNDTDFALSYNKKLKSLNSANFPANVPLKVDRKLFYTVGFGKDSCPTCVNGTRI  380

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             +A +NN+SFVMP   LLQAHY+NISGVF
Sbjct  381   LASLNNISFVMPKIGLLQAHYFNISGVF  408



>ref|XP_009593896.1| PREDICTED: laccase-11-like [Nicotiana tomentosiformis]
Length=562

 Score =   491 bits (1264),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 223/389 (57%), Positives = 288/389 (74%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C   +  E+ ++ Y+F V++ N SRLC +KPIV VNG+FPGP +YAREGD V + V N  
Sbjct  20    CFICLPAEAALKKYQFDVQVANVSRLCHAKPIVTVNGRFPGPTIYAREGDRVQINVTNFA  79

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             Q N+SIHWHG+KQ+R GW+DGPAYITQCPIQ G SY+Y+F +TGQRGTL WH+HI W RA
Sbjct  80    QYNLSIHWHGLKQYRNGWADGPAYITQCPIQTGNSYVYDFNITGQRGTLWWHAHILWLRA  139

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TV+GAIVI+P+ G P+PFP+PD+EE++VLGEWW+++VE+V      LGIPPN+SDAHTIN
Sbjct  140   TVYGAIVIMPQQGTPFPFPQPDREEVLVLGEWWDADVEEVEKQGNALGIPPNMSDAHTIN  199

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CS K  + +EV+ GKTYLLR+VNAALN+ELFF +A H   VVE+DA Y KPF
Sbjct  200   GKPGPLFPCSEKHTFAMEVKKGKTYLLRIVNAALNDELFFALANHTFTVVEIDAVYTKPF  259

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
              T+ I + PGQTTN L+ A+Q  G+Y +A   FMD  ++ DN+TATA   YKG       
Sbjct  260   STEAILIAPGQTTNVLVRANQVPGRYFMAARAFMDAPISVDNKTATAIFQYKGIPESVLP  319

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              L  +P QN T    T+   L+SLN+  YPANVPL+VD  L+F +G+G+NPCP C +G+R
Sbjct  320   KLPSLPAQNDTDFALTYNSKLKSLNTPKYPANVPLNVDRHLLFTVGLGINPCPTCLNGTR  379

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             + A +NN++F MP T LLQAHY+NI GV+
Sbjct  380   LTASLNNITFSMPQTALLQAHYFNIKGVY  408



>ref|XP_003612035.1| Laccase-11 [Medicago truncatula]
 gb|AES94993.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=566

 Score =   491 bits (1264),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 229/389 (59%), Positives = 294/389 (76%), Gaps = 4/389 (1%)
 Frame = +3

Query  141   TFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             +FPV  E+ I+ Y+F ++MKN SRLC +KPIV VNG++PGP +YA EGD V + V NHV+
Sbjct  26    SFPV--EAAIKKYQFDIQMKNVSRLCHAKPIVTVNGRYPGPTIYATEGDRVQINVTNHVK  83

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              N+SIHWHG+KQ+R GW+DGPAYITQCPIQ G SY Y+F +TGQRGTL WH+HI W RAT
Sbjct  84    YNISIHWHGLKQYRNGWADGPAYITQCPIQTGGSYTYDFNVTGQRGTLWWHAHILWLRAT  143

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             V+GAIVI+PK G P+PFP+P +E  IVLGEWW+ +VE+++N   Q+G+PPN+SDAHTING
Sbjct  144   VYGAIVIMPKPGTPFPFPQPAREFEIVLGEWWHKDVEEIVNQGNQMGLPPNMSDAHTING  203

Query  681   LPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE  857
              PGP   CS K  Y +EVE GKTYLLR++NAALN+ELFF +AGH + VVEVDA Y KPF 
Sbjct  204   KPGPLFPCSEKHTYAMEVEKGKTYLLRIINAALNDELFFSLAGHNMTVVEVDAVYTKPFT  263

Query  858   TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGT-HLLAST  1034
             T +I +GPGQTTN L+ A++   +Y IA   FMD  ++ DN+TATA   YKG  + +  +
Sbjct  264   TQSILIGPGQTTNVLVKANKIPSRYFIATRTFMDAPLSVDNKTATAIFQYKGIPNTIIPS  323

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
               T +P  N T     ++  +RSLNS  YPANVPL VD +L + IG+GVN CP C +G+R
Sbjct  324   FPTTLPNANDTNFALNYSKKIRSLNSAKYPANVPLKVDRNLFYTIGLGVNSCPTCINGTR  383

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             +VA +NNV+FVMP T LLQAH+++I GVF
Sbjct  384   LVASLNNVTFVMPKTALLQAHHFDIKGVF  412



>ref|XP_002866298.1| hypothetical protein ARALYDRAFT_496014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42557.1| hypothetical protein ARALYDRAFT_496014 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   489 bits (1259),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 243/375 (65%), Positives = 286/375 (76%), Gaps = 13/375 (3%)
 Frame = +3

Query  195   MKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTGWS  374
             M NT++LC+SKPIV VNGKFPGP + ARE DT++++V NHV  NVSIHW       TGW+
Sbjct  1     MTNTTKLCSSKPIVTVNGKFPGPTIVAREDDTLLIKVVNHVNYNVSIHW-------TGWA  53

Query  375   DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYPFP  554
             DGPAYITQCPIQPGQ+YL+NFTLTGQRGTL WH+HI W RATVHGAIVILPKLGVPYPFP
Sbjct  54    DGPAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFP  113

Query  555   KPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCSSK-GYNLEV  731
             KP KE+ IVL EWW S+VE++IN A ++G  P+ SDAHTING  G    C S+  Y L V
Sbjct  114   KPYKEKTIVLSEWWKSDVEELINEASKIGTAPSASDAHTINGHSGSISNCPSQSSYGLPV  173

Query  732   ESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTA  911
              +GKTY+LR++NAALNEELFFKIAGH L VVEVDA Y KP++TDT+F+ PGQTTN LLTA
Sbjct  174   RAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTA  233

Query  912   DQKAG-KYQIAISPFMDTIVATDNQTATATLSYKGTHLLAS----TALTIMPLQNATPVT  1076
             +  AG  Y +A + F D  +  DN TATATL Y G     S    T L  +P QNAT V 
Sbjct  234   NANAGSNYMVAATTFTDAQIPYDNVTATATLHYIGHTATVSASKKTVLASLPPQNATWVA  293

Query  1077  TTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPT  1256
             T FT SLRSLNSR YPA VP +VDHSL F +G+G NPC +C++G R+VA INNV+F MP 
Sbjct  294   TKFTRSLRSLNSREYPARVPTTVDHSLFFTVGLGANPCQSCNNGVRLVAGINNVTFTMPE  353

Query  1257  TPLLQAHYYNISGVF  1301
             T LLQAH++NISGVF
Sbjct  354   TALLQAHFFNISGVF  368



>ref|XP_004232420.1| PREDICTED: laccase-11 [Solanum lycopersicum]
Length=559

 Score =   490 bits (1262),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 223/389 (57%), Positives = 289/389 (74%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C   + VE+ ++ Y+F V++ N SRLC +K +V VNG FPGP +YAREGD V + V N+V
Sbjct  17    CFICLPVEAALKKYQFDVKLSNVSRLCNAKQMVTVNGGFPGPTIYAREGDRVQINVTNYV  76

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             Q N+SIHWHG+KQ+R GW+DGPAYITQCPIQ G SY+Y+F +TGQRGTL WH+HI W RA
Sbjct  77    QYNLSIHWHGLKQYRNGWADGPAYITQCPIQTGNSYVYDFNVTGQRGTLWWHAHILWLRA  136

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TV+GAIVI+P+ G P+PFP+PD+EE++VLGEWWN++VE V      LGIPPN+SDAHTIN
Sbjct  137   TVYGAIVIMPQKGTPFPFPQPDREEVLVLGEWWNADVEAVEKQGNALGIPPNMSDAHTIN  196

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CS K  + +EVE GKTYLLR+VNAALN+ELFF +A H   VVE+DA Y KPF
Sbjct  197   GKPGPLFPCSEKHTFAMEVEKGKTYLLRIVNAALNDELFFALANHTFTVVEIDAVYTKPF  256

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
              TD I + PGQTTN L+ A++  G+Y +A   FMD  ++ DN+TATA   YKG       
Sbjct  257   TTDAILIAPGQTTNVLVRANRVPGRYFMAARAFMDAPISVDNKTATAIFQYKGIPETVIP  316

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              L  +P QN +    ++   L+SLN+  YPANVPL+VD  L+F +G+G+NPCP C +G+R
Sbjct  317   KLPTLPAQNDSDFALSYNFKLKSLNTPKYPANVPLNVDRHLLFTVGLGINPCPTCLNGTR  376

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             + A +NN+SF+MP T LLQ+HY+NI GV+
Sbjct  377   LTASLNNISFIMPQTALLQSHYFNIKGVY  405



>gb|KHN24301.1| Laccase-4 [Glycine soja]
Length=522

 Score =   489 bits (1258),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 247/393 (63%), Positives = 289/393 (74%), Gaps = 42/393 (11%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  VE  +RHYKF V +KNT+RLC+SKPIV VNGKFPGP LYARE DTV+V+V N V
Sbjct  13    CIVPALVECKVRHYKFNVVLKNTTRLCSSKPIVTVNGKFPGPTLYAREDDTVLVKVNNLV  72

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
               NV+IHWHGV+Q RTGW+DGPAYITQCPI  GQSYLYNFTLTGQRGTLLWH+H+NW R+
Sbjct  73    NHNVTIHWHGVRQLRTGWADGPAYITQCPILSGQSYLYNFTLTGQRGTLLWHAHVNWLRS  132

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             T+HGAIVILPK GVPYPFPKPDKE +++LGEWW S+ EDVIN A++ G+ PNVSDAHTIN
Sbjct  133   TLHGAIVILPKRGVPYPFPKPDKELVVILGEWWKSDTEDVINEALKSGLAPNVSDAHTIN  192

Query  678   GLPG--PTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVK  848
             GLPG      CS++  Y L VESGKTYLLR++NAALNEELFFKIAGH   VVEVDA+YVK
Sbjct  193   GLPGIVSVANCSTQDVYKLPVESGKTYLLRIINAALNEELFFKIAGHPFTVVEVDASYVK  252

Query  849   PFETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLA  1028
             PF+TDT+ + P                                     ATL Y GT    
Sbjct  253   PFKTDTLSIAP-------------------------------------ATLHYTGTLATT  275

Query  1029  STALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSS-  1205
              T LT  P +NAT V   FT+SL+SLNS+ YPA VP  VDHSL+  +G+G+NPCP+C++ 
Sbjct  276   PTLLTTPPPRNATQVANNFTNSLKSLNSKKYPAKVPQKVDHSLLLTVGLGINPCPSCTAG  335

Query  1206  -GSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
              GSRVVA +NNV+FVMPTT LLQAHY+NI GVF
Sbjct  336   NGSRVVAAVNNVTFVMPTTALLQAHYFNIKGVF  368



>ref|XP_004160985.1| PREDICTED: laccase-11-like [Cucumis sativus]
Length=563

 Score =   490 bits (1261),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 229/384 (60%), Positives = 285/384 (74%), Gaps = 1/384 (0%)
 Frame = +3

Query  153   SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVS  332
             SVE+ I+ Y+F V+++N SRLC +KPIV VNGKFPGP +Y +EGD V+V V NH Q N+S
Sbjct  26    SVEAAIKRYQFDVQVQNISRLCHAKPIVTVNGKFPGPTIYVQEGDRVLVNVTNHAQYNMS  85

Query  333   IHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGA  512
             IHWHG+KQ+R GW+DGPAYITQCPIQ G SY Y+F +TGQRGTL WH+HI W RATV+GA
Sbjct  86    IHWHGLKQYRNGWADGPAYITQCPIQRGNSYTYDFNVTGQRGTLWWHAHILWLRATVYGA  145

Query  513   IVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGP  692
             IVILPK G PYPFP+P+ E  I+LGEWWN++VE V+N   ++G+PPN+SDAHTING PGP
Sbjct  146   IVILPKQGTPYPFPQPNGEFEILLGEWWNNDVEAVVNQGSRMGLPPNMSDAHTINGKPGP  205

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
                CS K  + +EVE+GKTYLLR++NAALN+ELFF IAGH + VVEVDA Y KPF T  I
Sbjct  206   LFPCSEKHTFAMEVEAGKTYLLRIINAALNDELFFAIAGHSMTVVEVDAVYTKPFTTQAI  265

Query  870   FVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIM  1049
              + PGQTTN LL A+Q   +Y +A   FMD  +  DN+TAT  L Y+G       AL  +
Sbjct  266   LIAPGQTTNVLLQANQAPNRYFMASRSFMDVPIPVDNKTATGILQYRGIPNTVLPALPQL  325

Query  1050  PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADI  1229
             P  N T    ++   L+SLNS  YPANVPL VD  L + IG+G N CP C +G+++VA +
Sbjct  326   PASNDTSFALSYNKKLKSLNSPQYPANVPLKVDRKLFYTIGLGQNECPTCLNGTQLVASL  385

Query  1230  NNVSFVMPTTPLLQAHYYNISGVF  1301
             NN+SFVMP   LLQ+HY+NI GVF
Sbjct  386   NNISFVMPQIGLLQSHYFNIGGVF  409



>ref|XP_008452071.1| PREDICTED: laccase-11-like [Cucumis melo]
Length=563

 Score =   489 bits (1259),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 229/384 (60%), Positives = 285/384 (74%), Gaps = 1/384 (0%)
 Frame = +3

Query  153   SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVS  332
             SVE+ I+ Y+F V+++N SRLC +KPIV VNGKFPGP +Y +EGD V+V V NH Q N+S
Sbjct  26    SVEAAIKRYQFDVQVQNISRLCHAKPIVTVNGKFPGPTIYVQEGDRVLVNVTNHAQYNMS  85

Query  333   IHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGA  512
             IHWHG+KQ+R GW+DGPAYITQCPIQ G SY Y+F +TGQRGTL WH+HI W RATV+GA
Sbjct  86    IHWHGLKQYRNGWADGPAYITQCPIQRGNSYTYDFNVTGQRGTLWWHAHILWLRATVYGA  145

Query  513   IVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGP  692
             IVILPK G PYPFP+P+ E  I+LGEWWN++VE V+N   ++G+PPN+SDAHTING PGP
Sbjct  146   IVILPKQGTPYPFPQPNGEFEILLGEWWNNDVEAVVNQGSRMGVPPNMSDAHTINGKPGP  205

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
                CS K  + +EVE+GKTYLLR++NAALN+ELFF IAGH + VVEVDA Y KPF T  I
Sbjct  206   LFPCSEKHTFAMEVEAGKTYLLRIINAALNDELFFAIAGHNMTVVEVDAVYTKPFTTQAI  265

Query  870   FVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIM  1049
              + PGQTTN LL A+Q   +Y +A   FMD  +  DN+TAT  L Y+G        L  +
Sbjct  266   LIAPGQTTNVLLQANQAPNRYFMASRSFMDVPIPVDNKTATGILQYRGIPNTILPILPQL  325

Query  1050  PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADI  1229
             P  N T    ++   L+SLNS  YPANVPL VD  L + IG+G N CP C +G+++VA +
Sbjct  326   PASNDTSFALSYNKKLKSLNSPQYPANVPLEVDRKLFYTIGLGQNDCPTCLNGTQLVASL  385

Query  1230  NNVSFVMPTTPLLQAHYYNISGVF  1301
             NN+SFVMP   LLQ+HY+NISGVF
Sbjct  386   NNISFVMPQIGLLQSHYFNISGVF  409



>gb|EYU42613.1| hypothetical protein MIMGU_mgv1a003791mg [Erythranthe guttata]
Length=564

 Score =   489 bits (1259),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 222/382 (58%), Positives = 284/382 (74%), Gaps = 1/382 (0%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
              + ++ Y+F +++KN SRLC SKPIV VN  FPGP +Y REGD +++ V NH Q N+SIH
Sbjct  27    RAEVKKYQFDIQVKNVSRLCHSKPIVTVNRMFPGPTIYVREGDRLLINVTNHAQYNMSIH  86

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHG+KQ+R GW+DGPAYITQCP+Q GQSY Y++ +TGQRGTL WH+HI W RATV+GAIV
Sbjct  87    WHGMKQYRNGWADGPAYITQCPVQTGQSYTYDYNVTGQRGTLWWHAHIFWLRATVYGAIV  146

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             I+PK+GVPYPFP+P  E  +VLGEWWN +VE+++    +LG+PP +SDAHTING PGP  
Sbjct  147   IMPKIGVPYPFPQPAFEFNLVLGEWWNDDVEEIVKQGNKLGLPPKMSDAHTINGKPGPLY  206

Query  699   TCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFV  875
              CS K  Y +EVE GKTYLLR++NAALN+ELFF IA H L VVEVDA Y KPF T+ I +
Sbjct  207   PCSEKHTYAIEVEQGKTYLLRIINAALNDELFFAIANHTLTVVEVDAVYTKPFSTEAILI  266

Query  876   GPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPL  1055
              PGQTTN L+ A+Q  G+Y +A  PFMD  ++ DN TAT+ L YKGT       +  +PL
Sbjct  267   APGQTTNVLVRANQARGRYFMAAGPFMDAPLSIDNNTATSILQYKGTPKTIIPKIPKLPL  326

Query  1056  QNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINN  1235
              N T    T+   +RSL SR +PANVPL VD  L + IG+G+NPCP C +G+++ A +NN
Sbjct  327   LNDTTFALTYNSKIRSLASRNFPANVPLKVDRHLFYTIGLGINPCPNCQNGTKLSASLNN  386

Query  1236  VSFVMPTTPLLQAHYYNISGVF  1301
             ++F+MP   LLQAHYYN+ GVF
Sbjct  387   ITFIMPKIGLLQAHYYNLKGVF  408



>ref|XP_003632636.1| PREDICTED: laccase-11 [Vitis vinifera]
 emb|CBI32739.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   489 bits (1258),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 225/382 (59%), Positives = 283/382 (74%), Gaps = 1/382 (0%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             ++ ++ Y+F +++KN SRLC +KPIV VNG FPGP +Y REGD V+V V NH Q N+SIH
Sbjct  27    DAAVKKYQFDIQVKNVSRLCHAKPIVTVNGMFPGPTIYVREGDQVLVNVTNHAQYNISIH  86

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHG+KQFR GW+DGPAYITQCPI+ G SY YNF ++GQRGTL WH+HI W RATV+GAIV
Sbjct  87    WHGLKQFRNGWADGPAYITQCPIKTGHSYTYNFQVSGQRGTLWWHAHILWLRATVYGAIV  146

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             I+PK G P+PFP+P  E  IVLGEWW+S+VE ++N A +LG+PP +SDAHTING PGP  
Sbjct  147   IMPKQGTPFPFPQPYFEANIVLGEWWSSDVETIVNQANKLGLPPPMSDAHTINGKPGPLF  206

Query  699   TCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFV  875
              CS K  + +EVESGKTYLLR+VNAALN+ELFF IAGH + VVE+DA Y KPF T  + +
Sbjct  207   PCSEKHTFAMEVESGKTYLLRIVNAALNDELFFAIAGHNMTVVEIDAVYTKPFTTQALLI  266

Query  876   GPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPL  1055
              PGQTTN L+ ADQ   +Y +A+ PFMD  V  DN+TATA L YKG        L  +P 
Sbjct  267   APGQTTNVLVKADQSPSRYFMAVRPFMDAPVPVDNKTATAILQYKGIPNTVLPTLAQLPA  326

Query  1056  QNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINN  1235
              N T    ++   L+SLN+  +PANVPL VD  L + IG+G NPCP C +G+++ A +NN
Sbjct  327   PNDTNFALSYNSKLKSLNTPQFPANVPLQVDRHLFYTIGLGQNPCPTCQNGTQLTASLNN  386

Query  1236  VSFVMPTTPLLQAHYYNISGVF  1301
             ++FVMP   LLQAHY+NI GVF
Sbjct  387   ITFVMPKVALLQAHYFNIKGVF  408



>gb|KDP41783.1| hypothetical protein JCGZ_26801 [Jatropha curcas]
Length=840

 Score =   498 bits (1282),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 223/383 (58%), Positives = 289/383 (75%), Gaps = 1/383 (0%)
 Frame = +3

Query  156   VESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSI  335
             VE+ ++ Y+F +++KN SRLC +KPIV VNG+FPGP +YAREGD V++ V NH Q N+SI
Sbjct  304   VEADVKKYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTIYAREGDRVLINVTNHAQYNMSI  363

Query  336   HWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAI  515
             HWHG+KQFR GW+DGPAYITQCPI+ G SY Y+F +TGQRGTL WH+HI W RATV+GAI
Sbjct  364   HWHGLKQFRNGWADGPAYITQCPIKTGNSYTYDFNITGQRGTLWWHAHIFWLRATVYGAI  423

Query  516   VILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPT  695
             VI+P+LG P+PFP+P++EE+++LGEWWN++VE ++N   +LG+PPN SDAHTING PGP 
Sbjct  424   VIMPQLGTPFPFPQPEREEVLLLGEWWNNDVEQLVNQGNKLGLPPNASDAHTINGKPGPL  483

Query  696   PTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIF  872
               CS K  + +EVE GKTYLLR++NAALN+ELFF +AGH L VVE+DA Y KPF T  I 
Sbjct  484   FPCSEKHTFAMEVEQGKTYLLRIINAALNDELFFAVAGHNLTVVEIDAVYTKPFTTQAIL  543

Query  873   VGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMP  1052
             + PGQTT+ L+ A Q  G+Y +A  PFMD  ++ DN+TATA L YKG        L  +P
Sbjct  544   IAPGQTTSVLIQATQSPGRYFMAARPFMDAPISIDNKTATAILQYKGIPNTILPILPQLP  603

Query  1053  LQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADIN  1232
               N T     +   LRSLNS+ +PANVPL VD  L+F  G+G+N CP+C +G+++ A +N
Sbjct  604   SPNDTAFALDYNSKLRSLNSKQFPANVPLKVDRHLLFTAGLGINACPSCLNGTKLTASLN  663

Query  1233  NVSFVMPTTPLLQAHYYNISGVF  1301
             N++FVMP   LLQAHY+ I GVF
Sbjct  664   NITFVMPQIGLLQAHYFKIKGVF  686



>ref|XP_006466813.1| PREDICTED: laccase-11-like [Citrus sinensis]
Length=566

 Score =   489 bits (1258),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 225/388 (58%), Positives = 287/388 (74%), Gaps = 3/388 (1%)
 Frame = +3

Query  141   TFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             +FP   E+ I+ Y+F V++KN SRLC +KPIV VNG+FPGP +Y REGD V+V V NH Q
Sbjct  27    SFPA--EAAIKKYQFDVQVKNVSRLCHAKPIVTVNGRFPGPTIYVREGDRVLVNVTNHAQ  84

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              N+SIHWHG+KQ+R GW+DGPAYITQCPI+ G SY Y+F +TGQRGTL WH+HI W RAT
Sbjct  85    YNMSIHWHGLKQYRNGWADGPAYITQCPIKTGNSYTYDFNVTGQRGTLWWHAHIFWLRAT  144

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             V+GAIVI+PK G P+PFP+P++EE+I+LGEWW+++VE+V     ++G+PPN+SDAHTING
Sbjct  145   VYGAIVIMPKPGSPFPFPQPNREEVILLGEWWHTDVEEVEKQGQKMGLPPNMSDAHTING  204

Query  681   LPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE  857
              PGP   CS K  + +EVESGKTYLLR++NAALN+ELFF IAGH   VVEVDA Y KPF 
Sbjct  205   KPGPLFPCSEKHTFAMEVESGKTYLLRIINAALNDELFFAIAGHNFTVVEVDAVYTKPFT  264

Query  858   TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA  1037
             T+ I + PGQTTN L+ A+QK G+Y +A  PF D  +  DN+TAT  L YKG        
Sbjct  265   TEAILIAPGQTTNVLVQANQKPGRYFMAARPFNDAPIPVDNKTATGILQYKGIPNSLLPT  324

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             L  +P  N +     +   LRSLNS  +PA+VP  VD  L + IG G + CP C +G+R+
Sbjct  325   LAQLPASNDSEFALNYNKKLRSLNSPKFPADVPQKVDRKLFYTIGFGKDSCPTCVNGTRL  384

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             +A +NN+SFVMP T LLQAHY+N+ GVF
Sbjct  385   LATLNNISFVMPQTALLQAHYFNLKGVF  412



>ref|XP_006340638.1| PREDICTED: laccase-11-like [Solanum tuberosum]
Length=559

 Score =   488 bits (1257),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 221/389 (57%), Positives = 288/389 (74%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C   + VE+ ++ Y+F V++ N SRLC +K +V VNG FPGP +YAREGD V + V N+V
Sbjct  17    CFICLPVEAALKKYQFDVKLSNVSRLCNAKQMVTVNGGFPGPTIYAREGDRVQINVTNYV  76

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             Q N+SIHWHG+KQ+R GW+DGPAYITQCPIQ G SY+Y+F +TGQRGTL WH+HI W RA
Sbjct  77    QYNLSIHWHGLKQYRNGWADGPAYITQCPIQTGNSYVYDFNVTGQRGTLWWHAHILWLRA  136

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TV+GAIVI+P+ G P+PFP+PD+EE++VLGEWWN++VE V      LGIPPN+SDAHTIN
Sbjct  137   TVYGAIVIMPQQGTPFPFPQPDREEVLVLGEWWNADVEAVEKQGNALGIPPNMSDAHTIN  196

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CS K  + +EVE GKTYLLR++NAALN+ELFF +A H   VVE+DA Y KPF
Sbjct  197   GKPGPLFPCSEKYTFAMEVEKGKTYLLRIINAALNDELFFALANHTFTVVEIDAVYTKPF  256

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
              T+ I + PGQTTN L+ A+Q  G+Y +A   FMD  ++ DN+TATA   YKG       
Sbjct  257   STEAILIAPGQTTNVLVRANQVPGRYFMAARAFMDAPISVDNKTATAIFQYKGIPETVLP  316

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
                 +P QN +    ++   L+SLN+  YPANVPL+VD  L+F +G+G+NPCP C +G+R
Sbjct  317   KPPTLPAQNDSDFALSYNSKLKSLNTPKYPANVPLNVDRHLLFTVGLGINPCPTCLNGTR  376

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             + A +NN+SF+MP T LLQ+HY+NI GV+
Sbjct  377   LTASLNNISFIMPQTALLQSHYFNIKGVY  405



>ref|NP_200699.1| laccase 16 [Arabidopsis thaliana]
 gb|AED97116.1| laccase 16 [Arabidopsis thaliana]
Length=523

 Score =   487 bits (1253),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 241/375 (64%), Positives = 288/375 (77%), Gaps = 13/375 (3%)
 Frame = +3

Query  195   MKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIHWHGVKQFRTGWS  374
             M NT++LC+SKPIV VNG+FPGP + AREGDT++++V NHV+ NVSIHW       TGW+
Sbjct  1     MTNTTKLCSSKPIVTVNGQFPGPTIVAREGDTILIKVVNHVKYNVSIHW-------TGWA  53

Query  375   DGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIVILPKLGVPYPFP  554
             DGPAYITQCPIQPGQ+YL+NFTLTGQRGTL WH+HI W RATVHGAIVILPKLGVPYPFP
Sbjct  54    DGPAYITQCPIQPGQNYLHNFTLTGQRGTLWWHAHILWLRATVHGAIVILPKLGVPYPFP  113

Query  555   KPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTPTCSSK-GYNLEV  731
             KP KE+ IVL EWW S+VE++IN A ++G  P+ SDAHTING  G    C S+  Y L V
Sbjct  114   KPYKEKTIVLSEWWKSDVEELINEASRIGTAPSASDAHTINGHSGSISNCPSQSSYGLPV  173

Query  732   ESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTA  911
              +GKTY+LR++NAALNEELFFKIAGH L VVEVDA Y KP++TDT+F+ PGQTTN LLTA
Sbjct  174   RAGKTYMLRIINAALNEELFFKIAGHVLTVVEVDAVYTKPYKTDTVFIAPGQTTNVLLTA  233

Query  912   DQKAG-KYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA----LTIMPLQNATPVT  1076
             +  AG  Y +A + F D  +  DN TATATL Y G     ST+    L  +P QNAT V 
Sbjct  234   NANAGSNYMVAATTFTDAHIPYDNVTATATLHYIGHTSTVSTSKKTVLASLPPQNATWVA  293

Query  1077  TTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINNVSFVMPT  1256
             T FT SLRSLNS  YPA VP +V+HSL F +G+G NPC +C++G R+VA INNV+F MP 
Sbjct  294   TKFTRSLRSLNSLEYPARVPTTVEHSLFFTVGLGANPCQSCNNGVRLVAGINNVTFTMPK  353

Query  1257  TPLLQAHYYNISGVF  1301
             T LLQAH++NISGVF
Sbjct  354   TALLQAHFFNISGVF  368



>ref|XP_004146556.1| PREDICTED: laccase-11-like [Cucumis sativus]
 gb|KGN53314.1| hypothetical protein Csa_4G046770 [Cucumis sativus]
Length=563

 Score =   488 bits (1256),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 228/384 (59%), Positives = 284/384 (74%), Gaps = 1/384 (0%)
 Frame = +3

Query  153   SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVS  332
             SVE+ I+ Y+F V+++N SRLC +KPIV VNGKFPGP +Y +EGD V+V V NH Q N+S
Sbjct  26    SVEAAIKRYQFDVQVQNISRLCHAKPIVTVNGKFPGPTIYVQEGDRVLVNVTNHAQYNMS  85

Query  333   IHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGA  512
             IHWHG+KQ+R GW+DGPAYITQCPIQ G SY Y+F +TGQRGTL WH+HI W RATV+GA
Sbjct  86    IHWHGLKQYRNGWADGPAYITQCPIQRGNSYTYDFNVTGQRGTLWWHAHILWLRATVYGA  145

Query  513   IVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGP  692
             IVILPK G PYPFP+P+ E  I+LGEWWN++VE V+N   ++G+PPN+SDAHTING PGP
Sbjct  146   IVILPKQGTPYPFPQPNGEFEILLGEWWNNDVEAVVNQGSRMGLPPNMSDAHTINGKPGP  205

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
                CS K  + +EVE+GKTYLLR++NAALN+ELFF IAGH + VVEVDA Y KPF T  I
Sbjct  206   LFPCSEKHTFAMEVEAGKTYLLRIINAALNDELFFAIAGHSMTVVEVDAVYTKPFTTQAI  265

Query  870   FVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIM  1049
              + PGQTTN LL A+Q   +Y +A   FMD  +  DN+TAT  L Y+G        L  +
Sbjct  266   LIAPGQTTNVLLQANQAPNRYFMASRSFMDVPIPVDNKTATGILQYRGIPNTVLPTLPQL  325

Query  1050  PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADI  1229
             P  N T    ++   L+SLNS  YPANVPL VD  L + IG+G N CP C +G+++VA +
Sbjct  326   PASNDTSFALSYNKKLKSLNSPQYPANVPLKVDRKLFYTIGLGQNECPTCLNGTQLVASL  385

Query  1230  NNVSFVMPTTPLLQAHYYNISGVF  1301
             NN+SFVMP   LLQ+HY+NI GVF
Sbjct  386   NNISFVMPQIGLLQSHYFNIGGVF  409



>ref|XP_006425656.1| hypothetical protein CICLE_v10025287mg [Citrus clementina]
 gb|ESR38896.1| hypothetical protein CICLE_v10025287mg [Citrus clementina]
 gb|KDO70943.1| hypothetical protein CISIN_1g008484mg [Citrus sinensis]
Length=564

 Score =   488 bits (1256),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 225/388 (58%), Positives = 287/388 (74%), Gaps = 3/388 (1%)
 Frame = +3

Query  141   TFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             +FP   E+ I+ Y+F V++KN SRLC +KPIV VNG+FPGP +Y REGD V+V V NH Q
Sbjct  25    SFPA--EAAIKKYQFDVQVKNVSRLCHAKPIVTVNGRFPGPTIYVREGDRVLVNVTNHAQ  82

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              N+SIHWHG+KQ+R GW+DGPAYITQCPI+ G SY Y+F +TGQRGTL WH+HI W RAT
Sbjct  83    YNMSIHWHGLKQYRNGWADGPAYITQCPIKTGNSYTYDFNVTGQRGTLWWHAHIFWLRAT  142

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             V+GAIVI+PK G P+PFP+P++EE+I+LGEWW+++VE+V     ++G+PPN+SDAHTING
Sbjct  143   VYGAIVIMPKPGSPFPFPQPNREEVILLGEWWHTDVEEVEKQGQKMGLPPNMSDAHTING  202

Query  681   LPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE  857
              PGP   CS K  + +EVESGKTYLLR++NAALN+ELFF IAGH   VVEVDA Y KPF 
Sbjct  203   KPGPLFPCSEKHTFAMEVESGKTYLLRIINAALNDELFFAIAGHNFTVVEVDAVYTKPFT  262

Query  858   TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA  1037
             T+ I + PGQTTN L+ A+QK G+Y +A  PF D  +  DN+TAT  L YKG        
Sbjct  263   TEAILIAPGQTTNVLVQANQKPGRYFMAARPFNDAPIPVDNKTATGILQYKGIPNSLLPT  322

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             L  +P  N +     +   LRSLNS  +PA+VP  VD  L + IG G + CP C +G+R+
Sbjct  323   LAQLPASNDSEFALNYNKKLRSLNSPKFPADVPQKVDRKLFYTIGFGKDSCPTCVNGTRL  382

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             +A +NN+SFVMP T LLQAHY+N+ GVF
Sbjct  383   LATLNNISFVMPQTALLQAHYFNLKGVF  410



>ref|XP_003612037.1| Laccase-11 [Medicago truncatula]
Length=576

 Score =   488 bits (1256),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 234/399 (59%), Positives = 282/399 (71%), Gaps = 16/399 (4%)
 Frame = +3

Query  153   SVESMIRHYKFTVEM---------------KNTSRLCASKPIVVVNGKFPGPVLYAREGD  287
             S E+ I+ Y+F + M               KN SRLC +KPIV VNG+FPGP +YAREGD
Sbjct  24    SSEAAIKKYQFDLAMHGSLNSISFFLQIQVKNVSRLCHAKPIVTVNGRFPGPTIYAREGD  83

Query  288   TVVVRVANHVQENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLL  467
              V V V NH Q N+SIHWHG+KQ+R GW+DGPAYITQCPIQ G SY Y F +TGQRGTL 
Sbjct  84    QVFVNVTNHAQYNMSIHWHGLKQYRNGWADGPAYITQCPIQTGNSYTYEFNVTGQRGTLW  143

Query  468   WHSHINWQRATVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIP  647
             WH+HI W RATV+GAIVI+PKLG P+PFP+P +E  IVLGEWWN++VE++     +LG+P
Sbjct  144   WHAHIFWLRATVYGAIVIMPKLGTPFPFPQPAREFEIVLGEWWNNDVEEIEKQGNKLGLP  203

Query  648   PNVSDAHTINGLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVV  824
             PN+SDAHTING PGP   CS K  + +EVE GKTYL+R+VNAALN+ELFF IAGH + VV
Sbjct  204   PNMSDAHTINGKPGPLFPCSEKHTFAMEVEQGKTYLMRIVNAALNDELFFAIAGHNMTVV  263

Query  825   EVDATYVKPFETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLS  1004
             EVDA Y KPF T  I + PGQTTN L+ A+Q AG+Y +A   FMD  +  DN+TATA L 
Sbjct  264   EVDAVYTKPFTTQAILIAPGQTTNVLVHANQVAGRYFVATKAFMDAPIQVDNKTATAILQ  323

Query  1005  YKGTHLLASTALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVN  1184
             YK         L  +P  N T    ++   LRSLNS  YPANVPL VD +L + IG+G N
Sbjct  324   YKDIPNTVQPILPQLPASNDTGFALSYNKKLRSLNSAKYPANVPLKVDRNLFYTIGLGKN  383

Query  1185  PCPACSSGSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
              CP C +G+R +A INNVSFVMP   LLQAHY+NI GVF
Sbjct  384   SCPTCLNGTRFLASINNVSFVMPQIALLQAHYFNIKGVF  422



>ref|XP_009378520.1| PREDICTED: laccase-11-like [Pyrus x bretschneideri]
 ref|XP_009378525.1| PREDICTED: laccase-11-like [Pyrus x bretschneideri]
Length=562

 Score =   488 bits (1255),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 228/382 (60%), Positives = 281/382 (74%), Gaps = 1/382 (0%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             E+ I+ Y+F V++ N SRLC SKPIV VNG FPGP +YAREGDT+VV V NH + N+SIH
Sbjct  27    EAAIKTYQFDVKVINVSRLCHSKPIVTVNGMFPGPTVYAREGDTLVVNVTNHAKYNMSIH  86

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHG+KQ+R GW+DGPAYITQCPI  G SY YN T+T QRGTL WH+HI W RATV+GAIV
Sbjct  87    WHGLKQYRNGWADGPAYITQCPIMTGHSYTYNITITAQRGTLWWHAHIFWLRATVYGAIV  146

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             I+PK G  +PFP+P +E  IVLGEWWN++VE+++    +LG+PPN+SDAHTING PGP  
Sbjct  147   IMPKQGAGFPFPQPYREANIVLGEWWNNDVEEIVKQGNKLGLPPNMSDAHTINGKPGPLF  206

Query  699   TCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFV  875
              CS K  Y LEVE GKTYLLR++NAALN+ELFF IAGH L VVE+DA Y KPF T  I +
Sbjct  207   PCSEKHTYALEVEQGKTYLLRIINAALNDELFFAIAGHNLTVVEIDAVYTKPFTTQAILI  266

Query  876   GPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPL  1055
              PGQTTN L+ A Q  G+Y +A  PFMD  V+ DN+TATA L YKG        L  +P 
Sbjct  267   APGQTTNVLVQATQAPGRYFMAARPFMDAPVSVDNKTATAILQYKGIPNSVQPLLPQLPA  326

Query  1056  QNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINN  1235
              N T     + D LRSLN+  +PANVPL VD  L + IG+G+NPCP C +G+++ A +NN
Sbjct  327   LNNTAFALNYDDKLRSLNTAQFPANVPLKVDRHLFYTIGLGINPCPTCLNGTQLTASLNN  386

Query  1236  VSFVMPTTPLLQAHYYNISGVF  1301
             ++FVMP   LLQAH++N  GVF
Sbjct  387   ITFVMPKIGLLQAHFFNTKGVF  408



>ref|XP_011099634.1| PREDICTED: laccase-11-like [Sesamum indicum]
Length=565

 Score =   488 bits (1255),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 224/389 (58%), Positives = 285/389 (73%), Gaps = 1/389 (0%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C     VE+ ++ Y+F +++KN SRLC +KPIV VNG FPGP +Y REGD V+V V NH 
Sbjct  23    CFVSSPVEAAVKRYQFDIQVKNVSRLCHAKPIVTVNGMFPGPTIYVREGDRVLVNVTNHA  82

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             Q N+SIHWHG+KQ+R GW+DGPAYITQCPI  G SY+Y+F +TGQRGTL WH+HI W RA
Sbjct  83    QYNMSIHWHGLKQYRNGWADGPAYITQCPIMMGSSYVYDFNVTGQRGTLWWHAHILWLRA  142

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTIN  677
             TV+GAIVI+PK G P+PFP+PD+EE+I+LGEWWN++VE V      LG+PPN+SDAHTIN
Sbjct  143   TVYGAIVIMPKQGTPFPFPQPDREEVILLGEWWNADVEAVEKQGNSLGLPPNMSDAHTIN  202

Query  678   GLPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPF  854
             G PGP   CS K  + +EVE GKTYLLR++NAALN+ELFF IAGH + VVE+DA Y KPF
Sbjct  203   GKPGPLFPCSEKYTFAMEVEQGKTYLLRLINAALNDELFFAIAGHNMTVVEIDAVYTKPF  262

Query  855   ETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLAST  1034
              T  + + PGQTTN L+ A+Q  G+Y +A  PFMD  +  DN+TATA L YKG       
Sbjct  263   STQALLIAPGQTTNVLVRANQIPGRYFMATRPFMDVPIPIDNKTATAILQYKGIPNTIIP  322

Query  1035  ALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSR  1214
              L  +P  N +    ++ + LRSLNS  +PA VPL VD  L + IG+G N CP+C +G+R
Sbjct  323   TLPNLPRPNDSAFAFSYEEKLRSLNSPQFPAKVPLKVDRHLFYTIGLGRNACPSCINGTR  382

Query  1215  VVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             + A +NN+SFVMP   LLQAHY+N+ GV+
Sbjct  383   LTASLNNISFVMPQVGLLQAHYFNMKGVY  411



>ref|XP_008449246.1| PREDICTED: laccase-11 [Cucumis melo]
Length=563

 Score =   487 bits (1254),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 229/387 (59%), Positives = 286/387 (74%), Gaps = 1/387 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
              P   ES I+ Y+F +++KN SRLC +KPIV VNG FPGP +Y REGD V++ V N+ Q 
Sbjct  23    LPFLAESAIKKYQFDIQVKNVSRLCNAKPIVTVNGMFPGPTIYVREGDRVLINVTNNAQY  82

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             N+SIHWHG+KQ R GW+DGPAYITQCPI+ G SY Y+ T+TGQRGTL WH+HI W RATV
Sbjct  83    NMSIHWHGLKQQRNGWADGPAYITQCPIKTGNSYTYDITVTGQRGTLWWHAHILWLRATV  142

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             +GA VI+PKLG P+PFP+P+ E  IVLGEWWNS+VE ++N A +LG+PP  SDAHTING 
Sbjct  143   YGAFVIMPKLGTPFPFPQPNLEANIVLGEWWNSDVETIVNQANKLGLPPQTSDAHTINGK  202

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP   CS K  Y LEVESGKTYLLR++NAALN+ELFF IAGH L VVE+DA Y KPF T
Sbjct  203   PGPLFPCSDKHTYALEVESGKTYLLRIINAALNDELFFAIAGHSLTVVEIDAVYTKPFTT  262

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
               I + PGQTTN L+ ADQ  G+Y +A  PFMD  +  DN+T TA L YKG       +L
Sbjct  263   TAILIAPGQTTNVLVKADQAPGRYFMAARPFMDAPIPVDNKTVTAILQYKGIPTTILPSL  322

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
               +PL N T    ++ + LRSLN+ L+P NVP+ +D  L + IG+G NPC +C +G+++ 
Sbjct  323   PTLPLPNDTNFALSYNNKLRSLNTPLFPTNVPIKIDRHLFYTIGLGANPCASCLNGTQLT  382

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             A +NN++FVMP T LLQAHY+NI GVF
Sbjct  383   ASLNNITFVMPKTGLLQAHYFNIPGVF  409



>ref|XP_004143251.1| PREDICTED: laccase-11-like [Cucumis sativus]
 ref|XP_004170658.1| PREDICTED: laccase-11-like [Cucumis sativus]
 gb|KGN48155.1| hypothetical protein Csa_6G445190 [Cucumis sativus]
Length=563

 Score =   487 bits (1253),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 229/387 (59%), Positives = 285/387 (74%), Gaps = 1/387 (0%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
              P  VES ++ Y+F +++KN SRLC +KPIV VNG FPGP +Y REGD V++ V NH Q 
Sbjct  23    LPFLVESAVKEYQFDIQVKNVSRLCNAKPIVTVNGMFPGPTIYVREGDRVLINVTNHAQY  82

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             N+SIHWHG+KQ R GW+DGPAYITQCPI+ G SY Y+ T+TGQRGTL WH+HI W RATV
Sbjct  83    NMSIHWHGLKQQRNGWADGPAYITQCPIKTGNSYTYDITVTGQRGTLWWHAHILWLRATV  142

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             +GA VI+PKLG P+PFP+P  E  IVLGEWWNS+VE ++N A +LG+PP  SDAHTING 
Sbjct  143   YGAFVIMPKLGTPFPFPQPYLEANIVLGEWWNSDVETIVNQANKLGLPPQASDAHTINGK  202

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP   CS K  Y LEVESGKTYLLR++NAALN+ELFF IAGH L VVE+DA Y KPF T
Sbjct  203   PGPLFPCSDKHTYALEVESGKTYLLRIINAALNDELFFAIAGHSLTVVEIDAVYTKPFTT  262

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
               I + PGQTTN L+ ADQ  G+Y +A  PFMD  +  DN+T TA L YKG       +L
Sbjct  263   TAILIAPGQTTNVLVKADQAPGRYFMAARPFMDAPIPVDNKTVTAILQYKGIPTTILPSL  322

Query  1041  TIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVV  1220
               +PL N T    ++ + LRSLN+ L+P NVP+ +D  L + IG+G NPC +C +G+++ 
Sbjct  323   PTLPLPNDTNFALSYNNKLRSLNTPLFPTNVPIKIDRHLFYTIGLGANPCASCLNGTQLT  382

Query  1221  ADINNVSFVMPTTPLLQAHYYNISGVF  1301
             A +NN++FVMP T LLQAHY+ I GVF
Sbjct  383   ASLNNITFVMPKTGLLQAHYFKIPGVF  409



>ref|XP_010024157.1| PREDICTED: laccase-11 [Eucalyptus grandis]
 gb|KCW60585.1| hypothetical protein EUGRSUZ_H03315 [Eucalyptus grandis]
Length=562

 Score =   486 bits (1252),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 224/384 (58%), Positives = 284/384 (74%), Gaps = 1/384 (0%)
 Frame = +3

Query  153   SVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVS  332
             S E+ I+ Y+F +++KN SRLC +KPIV VNG +PGP +YAREGD V++ V NH Q N+S
Sbjct  25    SSEAAIKKYQFDIQVKNVSRLCHAKPIVTVNGMYPGPTIYAREGDRVLINVTNHAQYNMS  84

Query  333   IHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGA  512
             IHWHG+KQ+R GW+DGPAYITQCPIQ G SY Y+F +TGQRGTL WH+HI W RATVHGA
Sbjct  85    IHWHGLKQYRNGWADGPAYITQCPIQTGNSYTYDFNVTGQRGTLWWHAHILWLRATVHGA  144

Query  513   IVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGP  692
             IVI+P  G P+PFP+P  E+II+LGEWWN++VE +     Q+G+PPN+SDAHTING PGP
Sbjct  145   IVIMPPQGTPFPFPQPHSEQIILLGEWWNADVEAIEKQGNQMGLPPNMSDAHTINGKPGP  204

Query  693   TPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTI  869
                CS K  + +EVE GKTYLLR++NAALN+ELFF IAGH + VVEVDA Y KPF TD+I
Sbjct  205   LFPCSEKHTFAMEVEPGKTYLLRIINAALNDELFFAIAGHNMTVVEVDAVYAKPFSTDSI  264

Query  870   FVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIM  1049
              + PGQTTN L+ A++  G+Y +A   F+D  V  DN+TATA L YKG       AL  +
Sbjct  265   LIAPGQTTNVLVQANRVPGRYFMAARSFIDAPVPVDNKTATAILQYKGIPNTVMPALAEL  324

Query  1050  PLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADI  1229
             P  N T    +++  LRSLNS  +PANVPL+V  +L + +G+G NPC  C +G+R +A +
Sbjct  325   PAPNDTAFALSYSQKLRSLNSPQFPANVPLNVSRNLFYTVGLGKNPCATCLNGTRFLASL  384

Query  1230  NNVSFVMPTTPLLQAHYYNISGVF  1301
             NN+SF MP   LLQAHY+N  GVF
Sbjct  385   NNISFTMPQVGLLQAHYFNTKGVF  408



>ref|XP_010679744.1| PREDICTED: laccase-11 [Beta vulgaris subsp. vulgaris]
Length=566

 Score =   486 bits (1252),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 226/382 (59%), Positives = 279/382 (73%), Gaps = 1/382 (0%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
              + +++Y+F +E+KN SRLC +KPIV VNG +PGP +YAREGD V++ V NH Q N+SIH
Sbjct  29    HAAVKNYQFDIEVKNVSRLCHAKPIVTVNGMYPGPTIYAREGDRVMINVTNHAQYNMSIH  88

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHG+KQ+R GW+DGPAYITQCPIQ G SY Y+F +TGQRGTL WH+HI+W RATV+GAIV
Sbjct  89    WHGLKQYRNGWADGPAYITQCPIQTGNSYTYDFNVTGQRGTLWWHAHISWLRATVYGAIV  148

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             I+PK G PYPFP+P  E  I+LGEWWN +VE ++    QLGIPPN+SDAHTING PGP  
Sbjct  149   IMPKEGTPYPFPQPHMEANIILGEWWNGDVETIVKQGDQLGIPPNMSDAHTINGKPGPLF  208

Query  699   TCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFV  875
              CS K  Y LEVE GKTYLLR++NAALN+ELF  IAGH + VVE+DA YVKPF T TI +
Sbjct  209   PCSEKHTYALEVEQGKTYLLRIINAALNDELFIGIAGHTMTVVEIDAVYVKPFTTKTILI  268

Query  876   GPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPL  1055
              PGQTTN L+ ADQ   +Y +A   FMD  +  DN+TATA   YKG       +   +P 
Sbjct  269   APGQTTNVLVRADQIPNRYFMATRTFMDVPIPVDNKTATAIFQYKGIPNSVIPSFPQLPA  328

Query  1056  QNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINN  1235
              N T    ++   LRSLN+  +PA VPL VD  L F IG+G NPC  C +G+R  A +NN
Sbjct  329   PNDTLFALSYNRKLRSLNTPQFPAKVPLKVDRKLFFTIGLGANPCATCLNGTRFTASLNN  388

Query  1236  VSFVMPTTPLLQAHYYNISGVF  1301
             ++FVMP T LLQAHY+N+SGVF
Sbjct  389   ITFVMPKTALLQAHYFNMSGVF  410



>ref|XP_008357173.1| PREDICTED: laccase-11-like [Malus domestica]
Length=562

 Score =   486 bits (1250),  Expect = 6e-164, Method: Compositional matrix adjust.
 Identities = 227/382 (59%), Positives = 283/382 (74%), Gaps = 1/382 (0%)
 Frame = +3

Query  159   ESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSIH  338
             E+ ++ Y+F V++ N SRLC SKPIV VNG FPGP +YAREGDT+VV V NH + N+SIH
Sbjct  27    EAALKTYQFDVKVTNVSRLCHSKPIVTVNGMFPGPTVYAREGDTLVVNVTNHAKYNMSIH  86

Query  339   WHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAIV  518
             WHG+KQ+R GW+DGPAYITQCPI+ G SY YN T+TGQRGTL WH+HI W RATV+GAIV
Sbjct  87    WHGLKQYRNGWADGPAYITQCPIKTGHSYTYNITITGQRGTLWWHAHIFWLRATVYGAIV  146

Query  519   ILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPTP  698
             I+PK G  +PFP+P +E  IVLGEWWN++VE+V+    + G+PPN+SDAHTING PGP  
Sbjct  147   IMPKQGEGFPFPQPYREANIVLGEWWNNDVEEVVKQGNKKGLPPNMSDAHTINGKPGPLF  206

Query  699   TCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIFV  875
              CS K  Y LEVE GKTYLLR++NAALN+ELFF IAGH L VVE+DA Y KPF T  I +
Sbjct  207   PCSEKHTYALEVEQGKTYLLRIINAALNDELFFAIAGHNLTVVEIDAVYTKPFTTQAILI  266

Query  876   GPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMPL  1055
              PGQTTN L+ A Q  G+Y +A  PFMD  V+ DN+TATA L YKG        L  +P 
Sbjct  267   APGQTTNVLVQATQAPGRYFMAARPFMDAPVSVDNKTATAILQYKGIPNSVQPVLPQLPA  326

Query  1056  QNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADINN  1235
              N T     + D+LRSLN+  +PA+VPL VD  L + IG+G+NPCP C +G+++ A +NN
Sbjct  327   PNNTAFALNYDDNLRSLNTAQFPAHVPLKVDRHLFYTIGLGINPCPTCLNGTQLTASLNN  386

Query  1236  VSFVMPTTPLLQAHYYNISGVF  1301
             ++FVMP   LLQAH++N  GVF
Sbjct  387   ITFVMPKIGLLQAHFFNTKGVF  408



>emb|CDP09155.1| unnamed protein product [Coffea canephora]
Length=744

 Score =   492 bits (1266),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 237/406 (58%), Positives = 292/406 (72%), Gaps = 18/406 (4%)
 Frame = +3

Query  138   CTFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHV  317
             C  P  ++  IR YKF V   NT+RLC++KP V VNG FPGP ++A E D ++V+V N V
Sbjct  198   CLLPSFIQCKIRIYKFNVMATNTTRLCSTKPAVTVNGLFPGPTIFANEDDDLLVKVVNQV  257

Query  318   QENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRA  497
             Q N++IHWHG+KQ R+GW+DGPA+ITQCPIQPGQ+Y+YNFT+T QRGTL WH+HI W RA
Sbjct  258   QYNLTIHWHGIKQLRSGWADGPAFITQCPIQPGQTYVYNFTITDQRGTLWWHAHIGWLRA  317

Query  498   TVHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSN-----------------VEDVINH  626
             TVHGA+VILPKLG+PYPFP PD E +I+L    N N                 +E +IN 
Sbjct  318   TVHGALVILPKLGLPYPFPPPDSEVVIILDLAENKNLMDYLFYMVAAIVFYSDIETLINS  377

Query  627   AMQLGIPPNVSDAHTINGLPGPTPTCSSKG-YNLEVESGKTYLLRVVNAALNEELFFKIA  803
             AM+ G+P  VSDA+TING   P   CSS+G ++  VE GK Y+LR++NAALNEELFFKIA
Sbjct  378   AMKEGLPFQVSDAYTINGQSRPISNCSSEGGFSFPVEPGKKYMLRIINAALNEELFFKIA  437

Query  804   GHRLRVVEVDATYVKPFETDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQ  983
             GH L VVEVDATYVKPF+T TIF+ PGQTTNA+L AD   G Y +A SPFM   V  D  
Sbjct  438   GHSLTVVEVDATYVKPFKTGTIFITPGQTTNAILEADLGTGNYLMAASPFMAEPVPIDYT  497

Query  984   TATATLSYKGTHLLASTALTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVF  1163
              ATAT+ Y GT   A+T  T +P +NATP+ T F DSL+SLNS+ YPA VPL+VDHSL+F
Sbjct  498   AATATVHYSGTQSSAATTFTDLPPRNATPLATAFVDSLKSLNSQRYPARVPLTVDHSLLF  557

Query  1164  AIGVGVNPCPACSSGSRVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
              +G+G NPC  C  GSR+ A  NN+SF+ P   LL AH++NISGVF
Sbjct  558   TMGLGFNPCATCIRGSRIAAYFNNISFIRPAISLLNAHFFNISGVF  603



>ref|XP_007156958.1| hypothetical protein PHAVU_002G031600g [Phaseolus vulgaris]
 gb|ESW28952.1| hypothetical protein PHAVU_002G031600g [Phaseolus vulgaris]
Length=564

 Score =   485 bits (1249),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 227/390 (58%), Positives = 289/390 (74%), Gaps = 7/390 (2%)
 Frame = +3

Query  144   FPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQE  323
             F  +VE+  + Y+F +++KN SRLC +KPIV VNG+FPGP +Y REGD V V V NH + 
Sbjct  24    FSFTVEAATKKYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTIYVREGDRVQVNVTNHAKY  83

Query  324   NVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATV  503
             N+SIHWHG+KQ+R GW+DGPAYITQCPIQ G SY Y+F +TGQRGTL WH+HI W RATV
Sbjct  84    NMSIHWHGIKQYRNGWADGPAYITQCPIQTGSSYTYDFNVTGQRGTLWWHAHILWLRATV  143

Query  504   HGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGL  683
             +GAIVI+PK G P+PFP+P +E  I+LGEWW+++VE V     Q+G+PPN+SDAHTING 
Sbjct  144   YGAIVIMPKPGTPFPFPQPAREFEILLGEWWHNDVEAVETQGNQMGLPPNMSDAHTINGK  203

Query  684   PGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFET  860
             PGP   CS K  Y +EVE GK+YLLR++NAAL++ELFF IAGH + VVEVDA Y KPF T
Sbjct  204   PGPLFPCSEKHTYAMEVEQGKSYLLRIINAALDDELFFAIAGHNMTVVEVDAVYTKPFTT  263

Query  861   DTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTAL  1040
              TI + PGQTTN L+ A+Q AG+Y +A   FMD  +  DN++ATA   YKG   + +T L
Sbjct  264   QTIIIAPGQTTNVLVKANQVAGRYFMATRTFMDAPIPVDNKSATAIFQYKG---IPNTVL  320

Query  1041  TI---MPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGS  1211
                  +P  N TP   ++ + +RSLNS  YPANVPL VD +L + IG+  N CP C +G+
Sbjct  321   PFPPSLPAANDTPFALSYNNKIRSLNSPQYPANVPLEVDRNLFYTIGLAQNSCPTCVNGT  380

Query  1212  RVVADINNVSFVMPTTPLLQAHYYNISGVF  1301
             R++A +NNVSFVMP T LLQAHY+NI GV+
Sbjct  381   RLLASLNNVSFVMPQTALLQAHYFNIKGVY  410



>ref|XP_007046899.1| Laccase 11 [Theobroma cacao]
 gb|EOX91056.1| Laccase 11 [Theobroma cacao]
Length=562

 Score =   485 bits (1248),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 223/388 (57%), Positives = 285/388 (73%), Gaps = 3/388 (1%)
 Frame = +3

Query  141   TFPVSVESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQ  320
             +FP   E+ ++ Y+F +++KN SRLC +KPIV VNG+FPGP +Y REGD V+V V NH +
Sbjct  23    SFPA--EAAVKKYQFDIQVKNVSRLCHAKPIVTVNGRFPGPTIYVREGDRVIVNVTNHAK  80

Query  321   ENVSIHWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRAT  500
              N+SIHWHG+KQ+R GW+DGPAYITQCPI+ G SY Y+F +TGQRGTL WH+HI W RAT
Sbjct  81    YNMSIHWHGLKQYRNGWADGPAYITQCPIKTGNSYSYDFNVTGQRGTLWWHAHILWLRAT  140

Query  501   VHGAIVILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTING  680
             V+GAIVI+PK G P+PFP P+ E+II+LGEWW+ +VE+++     +G+PPN+SDAHTING
Sbjct  141   VYGAIVIMPKEGTPFPFPHPNMEQIIILGEWWHKDVEEIVKQGTNMGLPPNMSDAHTING  200

Query  681   LPGPTPTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFE  857
              PGP   CS K  + +EVESGKTYLLR++NAALN+ELFF IAGH + VVEVDA Y KPF 
Sbjct  201   KPGPLFPCSEKHTFAMEVESGKTYLLRIINAALNDELFFAIAGHNMTVVEVDAVYTKPFI  260

Query  858   TDTIFVGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTA  1037
             T  I + PGQTTN L+ A+Q  G+Y +A  PFMD  +  DN+TAT  L YKG        
Sbjct  261   TQAILIAPGQTTNVLVRANQMPGRYFMASRPFMDAPLPIDNKTATGILQYKGIPNTVLPT  320

Query  1038  LTIMPLQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRV  1217
             L  +P  N T    ++   LRSLNS  +PANVPL VD  L + IG G + CP C +G+R+
Sbjct  321   LPQLPDPNDTTFALSYNKKLRSLNSAKFPANVPLKVDRKLFYTIGFGKDTCPTCLNGTRL  380

Query  1218  VADINNVSFVMPTTPLLQAHYYNISGVF  1301
             +A +NN+SFVMP   LLQAHY+N+ GVF
Sbjct  381   LASLNNISFVMPEVGLLQAHYFNMKGVF  408



>ref|XP_007205004.1| hypothetical protein PRUPE_ppa003572mg [Prunus persica]
 gb|EMJ06203.1| hypothetical protein PRUPE_ppa003572mg [Prunus persica]
Length=564

 Score =   485 bits (1248),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 223/383 (58%), Positives = 279/383 (73%), Gaps = 1/383 (0%)
 Frame = +3

Query  156   VESMIRHYKFTVEMKNTSRLCASKPIVVVNGKFPGPVLYAREGDTVVVRVANHVQENVSI  335
              E+ I+ Y+F V++ N SRLC +KPIV +NG+FPGP +Y REGD V++ V NH Q N+SI
Sbjct  28    AEAAIKKYQFDVQVNNVSRLCHAKPIVTINGRFPGPTVYVREGDRVLINVTNHAQYNMSI  87

Query  336   HWHGVKQFRTGWSDGPAYITQCPIQPGQSYLYNFTLTGQRGTLLWHSHINWQRATVHGAI  515
             HWHG+KQ+R GW+DGPAY+TQCPIQ G SY Y+F +TGQRGTL WH+HI W RATV+GAI
Sbjct  88    HWHGLKQYRNGWADGPAYVTQCPIQTGSSYTYDFNVTGQRGTLWWHAHILWLRATVYGAI  147

Query  516   VILPKLGVPYPFPKPDKEEIIVLGEWWNSNVEDVINHAMQLGIPPNVSDAHTINGLPGPT  695
             VILPK G P+PFP+P +E  I+LGEWWN NVE+ +N A  LG+PPN SDAHTING PGP 
Sbjct  148   VILPKPGTPFPFPQPYREAEIILGEWWNGNVEEFVNKANNLGLPPNSSDAHTINGKPGPL  207

Query  696   PTCSSK-GYNLEVESGKTYLLRVVNAALNEELFFKIAGHRLRVVEVDATYVKPFETDTIF  872
               CS K  +++E E GKTYLLR++NAALN+ELFF IAGH L VVEVDA Y KPF T+ I 
Sbjct  208   FPCSEKHTFSMEAEQGKTYLLRIINAALNDELFFGIAGHNLTVVEVDAVYTKPFTTEAIL  267

Query  873   VGPGQTTNALLTADQKAGKYQIAISPFMDTIVATDNQTATATLSYKGTHLLASTALTIMP  1052
             + PGQTTN L+ A+Q +G+Y +A  PFMD  VA DN+TAT    Y+G       +L  +P
Sbjct  268   IAPGQTTNVLVQANQASGRYFMAARPFMDAPVAIDNKTATGIFQYRGIPNTVLPSLPQLP  327

Query  1053  LQNATPVTTTFTDSLRSLNSRLYPANVPLSVDHSLVFAIGVGVNPCPACSSGSRVVADIN  1232
               N T    ++   L+SLN+  +PANVPL VD  L + IG G   CP C +G+R VA +N
Sbjct  328   ASNDTAFALSYNKKLKSLNTPNFPANVPLKVDRKLFYIIGFGKESCPTCLNGTRFVASLN  387

Query  1233  NVSFVMPTTPLLQAHYYNISGVF  1301
             N+SF MP   LLQAHY+N+ GVF
Sbjct  388   NISFEMPQVGLLQAHYFNLKGVF  410



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3448167354420