BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25447_g2_i2 len=762 path=[1302:0-639 1942:640-676 1979:677-725
2028:726-761]

Length=762
                                                                      Score     E

ref|XP_009590412.1|  PREDICTED: laccase-4-like                          308   1e-97   
gb|EYU41257.1|  hypothetical protein MIMGU_mgv1a003880mg                307   3e-97   
ref|XP_009767351.1|  PREDICTED: laccase-4-like                          295   1e-95   
ref|XP_011084946.1|  PREDICTED: laccase-4-like                          303   1e-95   
ref|XP_007009094.1|  Laccase/Diphenol oxidase family protein            298   1e-93   
ref|XP_010543748.1|  PREDICTED: laccase-22-like                         295   1e-92   
emb|CDP14064.1|  unnamed protein product                                294   3e-92   
gb|KHG28836.1|  Laccase-22                                              292   2e-91   
gb|EPS61127.1|  laccase 3                                               291   4e-91   
emb|CBI31539.3|  unnamed protein product                                288   3e-90   
ref|XP_002265173.1|  PREDICTED: laccase-4-like                          289   3e-90   Vitis vinifera
ref|XP_010067496.1|  PREDICTED: laccase-4-like                          288   8e-90   
emb|CDP06511.1|  unnamed protein product                                286   4e-89   
ref|XP_009337309.1|  PREDICTED: laccase-4-like                          284   3e-88   
ref|XP_002316233.1|  hypothetical protein POPTR_0010s20050g             283   7e-88   Populus trichocarpa [western balsam poplar]
emb|CAA74103.1|  laccase                                                282   9e-88   Populus trichocarpa [western balsam poplar]
emb|CAC14719.1|  laccase                                                282   9e-88   Populus trichocarpa [western balsam poplar]
ref|XP_011019227.1|  PREDICTED: laccase-4-like                          275   1e-87   
ref|XP_007220829.1|  hypothetical protein PRUPE_ppa027203mg             282   1e-87   
ref|XP_009346884.1|  PREDICTED: laccase-4-like                          281   2e-87   
ref|XP_009374280.1|  PREDICTED: laccase-4-like                          281   2e-87   
ref|XP_011036009.1|  PREDICTED: laccase-4-like                          281   2e-87   
emb|CAA74101.1|  laccase                                                276   3e-87   Populus trichocarpa [western balsam poplar]
emb|CAC14718.1|  laccase                                                276   5e-87   Populus trichocarpa [western balsam poplar]
ref|XP_008355354.1|  PREDICTED: laccase-4                               280   6e-87   
gb|KDO69098.1|  hypothetical protein CISIN_1g008799mg                   280   6e-87   
ref|XP_006435668.1|  hypothetical protein CICLE_v10031134mg             280   7e-87   
ref|XP_008233715.1|  PREDICTED: laccase-4-like                          280   1e-86   
ref|XP_008220423.1|  PREDICTED: laccase-4                               280   1e-86   
ref|XP_007207096.1|  hypothetical protein PRUPE_ppa022440mg             280   1e-86   
gb|ABK96121.1|  unknown                                                 270   1e-86   Populus trichocarpa [western balsam poplar]
ref|XP_002280416.1|  PREDICTED: laccase-4                               278   3e-86   Vitis vinifera
gb|KHG18161.1|  Laccase-4 -like protein                                 278   7e-86   
gb|KDP44830.1|  hypothetical protein JCGZ_01330                         274   1e-85   
ref|XP_010044087.1|  PREDICTED: laccase-4-like                          276   1e-85   
ref|XP_008358974.1|  PREDICTED: laccase-4-like                          276   2e-85   
ref|XP_010104682.1|  hypothetical protein L484_022065                   276   2e-85   
ref|XP_010256659.1|  PREDICTED: laccase-4                               276   2e-85   
ref|XP_002322961.2|  hypothetical protein POPTR_0016s11950g             275   5e-85   Populus trichocarpa [western balsam poplar]
ref|XP_004308920.1|  PREDICTED: laccase-22-like                         275   9e-85   
ref|XP_002308208.2|  laccase family protein                             275   9e-85   Populus trichocarpa [western balsam poplar]
ref|XP_002308209.2|  laccase family protein                             275   1e-84   Populus trichocarpa [western balsam poplar]
ref|XP_010262771.1|  PREDICTED: laccase-4-like                          274   1e-84   
ref|XP_006387495.1|  hypothetical protein POPTR_0958s00200g             275   1e-84   
ref|XP_004294236.1|  PREDICTED: laccase-4-like                          274   1e-84   
ref|XP_010044090.1|  PREDICTED: laccase-4-like                          274   1e-84   
emb|CDY08537.1|  BnaA05g27730D                                          273   2e-84   
ref|XP_011003662.1|  PREDICTED: laccase-4-like                          274   2e-84   
gb|KDO37344.1|  hypothetical protein CISIN_1g009854mg                   273   2e-84   
emb|CDY01010.1|  BnaC05g41900D                                          273   3e-84   
ref|XP_011019150.1|  PREDICTED: laccase-4 isoform X1                    273   3e-84   
ref|XP_011019151.1|  PREDICTED: laccase-4 isoform X2                    273   3e-84   
ref|XP_007026782.1|  Laccase/Diphenol oxidase family protein isof...    271   4e-84   
emb|CAA74102.1|  laccase                                                270   4e-84   Populus trichocarpa [western balsam poplar]
ref|XP_006425016.1|  hypothetical protein CICLE_v10028117mg             273   4e-84   
ref|XP_002322962.2|  laccase family protein                             273   5e-84   Populus trichocarpa [western balsam poplar]
ref|XP_010104683.1|  hypothetical protein L484_022066                   272   7e-84   
ref|XP_011039810.1|  PREDICTED: laccase-4-like                          272   8e-84   
ref|XP_003539958.2|  PREDICTED: laccase-4-like                          272   1e-83   
gb|KHG11130.1|  Laccase-4 -like protein                                 270   1e-83   
ref|XP_011032153.1|  PREDICTED: laccase-4-like isoform X1               271   1e-83   
ref|XP_010041000.1|  PREDICTED: laccase-4-like                          271   1e-83   
ref|XP_006429309.1|  hypothetical protein CICLE_v10011400mg             271   1e-83   
ref|XP_007026781.1|  Laccase/Diphenol oxidase family protein isof...    271   1e-83   
ref|XP_011035200.1|  PREDICTED: laccase-4                               271   1e-83   
ref|XP_011032154.1|  PREDICTED: laccase-4-like isoform X2               271   2e-83   
ref|XP_010044089.1|  PREDICTED: laccase-4-like                          271   2e-83   
ref|XP_007142229.1|  hypothetical protein PHAVU_008G263100g             271   3e-83   
ref|XP_011077581.1|  PREDICTED: laccase-4-like                          270   5e-83   
ref|XP_002520425.1|  laccase, putative                                  270   5e-83   Ricinus communis
ref|XP_010494695.1|  PREDICTED: laccase-22-like                         270   5e-83   
ref|XP_008775059.1|  PREDICTED: laccase-22-like                         270   5e-83   
ref|XP_004490574.1|  PREDICTED: laccase-4-like                          270   5e-83   
ref|XP_003544873.2|  PREDICTED: laccase-4-like                          270   6e-83   
gb|AES99522.2|  laccase/diphenol oxidase family protein                 269   6e-83   
ref|XP_002311202.1|  laccase family protein                             270   6e-83   Populus trichocarpa [western balsam poplar]
ref|XP_007146741.1|  hypothetical protein PHAVU_006G065800g             270   6e-83   
ref|XP_006300062.1|  hypothetical protein CARUB_v10016290mg             270   6e-83   
ref|XP_002299828.2|  hypothetical protein POPTR_0001s25580g             270   8e-83   Populus trichocarpa [western balsam poplar]
ref|XP_010044088.1|  PREDICTED: laccase-4-like                          269   1e-82   
ref|XP_002314124.1|  hypothetical protein POPTR_0009s04720g             269   1e-82   Populus trichocarpa [western balsam poplar]
ref|XP_008449180.1|  PREDICTED: laccase-4-like                          269   1e-82   
ref|XP_009146739.1|  PREDICTED: laccase-22-like                         269   1e-82   
ref|XP_009799024.1|  PREDICTED: laccase-4-like                          269   1e-82   
ref|XP_011094977.1|  PREDICTED: laccase-4-like                          269   1e-82   
ref|XP_009416212.1|  PREDICTED: laccase-22-like                         269   2e-82   
ref|XP_008457399.1|  PREDICTED: laccase-4                               268   3e-82   
ref|XP_010685615.1|  PREDICTED: laccase-4                               268   3e-82   
ref|XP_002530417.1|  laccase, putative                                  268   3e-82   Ricinus communis
ref|XP_003551299.1|  PREDICTED: laccase-4-like                          268   3e-82   
gb|KHN06247.1|  Laccase-4                                               268   3e-82   
ref|XP_003518300.1|  PREDICTED: laccase-4-like                          268   4e-82   
ref|XP_008239590.1|  PREDICTED: laccase-4-like                          268   4e-82   
gb|AES98533.2|  laccase/diphenol oxidase family protein                 268   4e-82   
ref|XP_002278638.1|  PREDICTED: laccase-4                               268   5e-82   Vitis vinifera
ref|XP_003615575.1|  Laccase 1a                                         268   5e-82   
gb|AAC49538.1|  diphenol oxidase                                        263   6e-82   Nicotiana tabacum [American tobacco]
ref|XP_003616564.1|  Laccase                                            270   6e-82   
ref|XP_003544123.1|  PREDICTED: laccase-4-like                          267   6e-82   
ref|XP_004150626.1|  PREDICTED: laccase-4-like                          266   6e-82   
ref|XP_004246339.1|  PREDICTED: laccase-4                               267   6e-82   
ref|XP_010464832.1|  PREDICTED: laccase-22-like                         267   7e-82   
gb|KHN20872.1|  Laccase-4                                               267   7e-82   
ref|XP_009786393.1|  PREDICTED: laccase-4-like                          267   8e-82   
ref|XP_007016183.1|  Laccase/Diphenol oxidase family protein            267   9e-82   
ref|XP_009350996.1|  PREDICTED: laccase-4-like                          267   1e-81   
gb|KHG17519.1|  Laccase-4 -like protein                                 265   1e-81   
gb|EYU41858.1|  hypothetical protein MIMGU_mgv1a003895mg                267   1e-81   
ref|XP_010486777.1|  PREDICTED: laccase-22-like isoform X1              266   1e-81   
ref|XP_009624727.1|  PREDICTED: laccase-4-like                          266   2e-81   
gb|KGN65788.1|  hypothetical protein Csa_1G528530                       266   2e-81   
ref|XP_008392913.1|  PREDICTED: laccase-4-like                          266   2e-81   
gb|KDP24484.1|  hypothetical protein JCGZ_25048                         264   2e-81   
ref|XP_010486778.1|  PREDICTED: laccase-22-like isoform X2              266   3e-81   
ref|XP_007205010.1|  hypothetical protein PRUPE_ppa003646mg             266   3e-81   
ref|XP_004147923.1|  PREDICTED: laccase-4-like                          265   3e-81   
gb|KCW52562.1|  hypothetical protein EUGRSUZ_J01941                     264   4e-81   
ref|XP_004249084.1|  PREDICTED: laccase-4-like                          265   4e-81   
gb|KHG22893.1|  Laccase-4 -like protein                                 263   5e-81   
ref|XP_010033027.1|  PREDICTED: laccase-4-like                          265   6e-81   
ref|XP_009593041.1|  PREDICTED: laccase-4-like                          265   7e-81   
gb|AAC49536.1|  diphenol oxidase                                        265   8e-81   Nicotiana tabacum [American tobacco]
ref|XP_009384856.1|  PREDICTED: laccase-22-like                         265   8e-81   
ref|XP_010553253.1|  PREDICTED: laccase-4                               264   1e-80   
ref|XP_004500229.1|  PREDICTED: laccase-4-like                          263   2e-80   
ref|XP_002533894.1|  laccase, putative                                  263   2e-80   Ricinus communis
ref|XP_010037723.1|  PREDICTED: laccase-4-like                          263   2e-80   
ref|XP_010676357.1|  PREDICTED: laccase-4-like                          263   3e-80   
ref|XP_007141799.1|  hypothetical protein PHAVU_008G226700g             263   3e-80   
gb|KFK44563.1|  hypothetical protein AALP_AA1G273400                    263   4e-80   
ref|XP_006363052.1|  PREDICTED: laccase-4-like                          263   4e-80   
ref|XP_006602641.1|  PREDICTED: laccase-4-like isoform X1               262   6e-80   
ref|XP_006349470.1|  PREDICTED: laccase-4-like                          262   6e-80   
ref|XP_008388134.1|  PREDICTED: laccase-4-like                          262   6e-80   
gb|KHN04832.1|  Laccase-4                                               261   7e-80   
gb|EPS65618.1|  hypothetical protein M569_09159                         261   7e-80   
ref|XP_003516941.1|  PREDICTED: laccase-4-like                          262   8e-80   
gb|KHN24301.1|  Laccase-4                                               261   9e-80   
gb|ACN39933.1|  unknown                                                 261   1e-79   Picea sitchensis
ref|XP_010529771.1|  PREDICTED: laccase-4-like                          261   2e-79   
gb|KEH34185.1|  laccase/diphenol oxidase family protein                 261   2e-79   
gb|EYU26646.1|  hypothetical protein MIMGU_mgv1a003805mg                261   2e-79   
ref|XP_009358852.1|  PREDICTED: laccase-4-like                          261   2e-79   
ref|XP_010452014.1|  PREDICTED: laccase-10 isoform X1                   261   2e-79   
gb|AAK37830.1|AF132126_1  laccase                                       261   2e-79   Pinus taeda
ref|XP_009593274.1|  PREDICTED: laccase-4-like                          261   2e-79   
ref|XP_002873023.1|  predicted protein                                  261   2e-79   
ref|XP_010101806.1|  hypothetical protein L484_023595                   260   2e-79   
ref|XP_009787551.1|  PREDICTED: laccase-4-like                          260   3e-79   
ref|XP_004490949.1|  PREDICTED: laccase-4-like                          260   3e-79   
ref|XP_008442464.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     260   3e-79   
ref|XP_003522150.1|  PREDICTED: laccase-4-like                          260   3e-79   
ref|XP_010543228.1|  PREDICTED: laccase-10                              260   3e-79   
ref|XP_004163861.1|  PREDICTED: laccase-4-like                          260   3e-79   
ref|XP_009789474.1|  PREDICTED: laccase-4-like isoform X2               258   6e-79   
ref|XP_004137913.1|  PREDICTED: laccase-4-like                          259   7e-79   
gb|KDP46534.1|  hypothetical protein JCGZ_08506                         259   7e-79   
ref|XP_010490598.1|  PREDICTED: laccase-10-like isoform X1              259   7e-79   
ref|XP_010423919.1|  PREDICTED: laccase-10-like                         259   9e-79   
ref|XP_009407561.1|  PREDICTED: laccase-22-like                         259   1e-78   
ref|XP_009789473.1|  PREDICTED: laccase-4-like isoform X1               258   1e-78   
ref|XP_006398646.1|  hypothetical protein EUTSA_v10015593mg             258   2e-78   
ref|XP_006350822.1|  PREDICTED: laccase-4-like                          258   3e-78   
emb|CDY70510.1|  BnaAnng33960D                                          246   3e-78   
ref|XP_007134763.1|  hypothetical protein PHAVU_010G0738000g            257   3e-78   
gb|AFN53658.1|  hypothetical protein                                    255   4e-78   
ref|XP_006338994.1|  PREDICTED: laccase-4-like                          257   4e-78   
emb|CDY48114.1|  BnaC02g03710D                                          256   9e-78   
emb|CDY55905.1|  BnaAnng13970D                                          256   1e-77   
ref|XP_009125430.1|  PREDICTED: laccase-10                              256   1e-77   
ref|XP_004249583.1|  PREDICTED: laccase-4-like                          256   2e-77   
gb|KFK36706.1|  hypothetical protein AALP_AA4G158700                    256   2e-77   
ref|XP_008377498.1|  PREDICTED: laccase-4-like                          256   2e-77   
emb|CAB69847.1|  laccase-like protein                                   255   2e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411009.1|  hypothetical protein EUTSA_v10016460mg             255   3e-77   
ref|NP_195739.2|  laccase 10                                            255   3e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535416.1|  PREDICTED: laccase-16                              255   3e-77   
sp|Q0IQU1.2|LAC22_ORYSJ  RecName: Full=Laccase-22; AltName: Full=...    255   4e-77   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006287399.1|  hypothetical protein CARUB_v10000605mg             254   4e-77   
gb|AAK37829.1|AF132125_1  laccase                                       254   5e-77   Pinus taeda
emb|CDX91428.1|  BnaC04g07220D                                          254   1e-76   
ref|XP_009370205.1|  PREDICTED: laccase-4                               253   1e-76   
emb|CDX74915.1|  BnaA05g06610D                                          253   1e-76   
ref|XP_009143427.1|  PREDICTED: laccase-4                               253   1e-76   
ref|XP_007140382.1|  hypothetical protein PHAVU_008G107100g             253   1e-76   
ref|XP_007140300.1|  hypothetical protein PHAVU_008G1006001g            243   1e-76   
emb|CDX93330.1|  BnaC04g45660D                                          253   2e-76   
ref|XP_008785423.1|  PREDICTED: laccase-22                              253   3e-76   
ref|XP_009589148.1|  PREDICTED: laccase-4-like                          253   3e-76   
ref|XP_003604619.1|  Laccase 1a                                         252   3e-76   
ref|NP_565881.1|  laccase-4                                             252   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663136.1|  PREDICTED: laccase-22-like                         253   3e-76   
ref|XP_010690098.1|  PREDICTED: laccase-4-like                          252   5e-76   
ref|XP_002879726.1|  IRX12/LAC4                                         251   8e-76   
emb|CDY18406.1|  BnaA04g21810D                                          251   9e-76   
ref|XP_006293932.1|  hypothetical protein CARUB_v10022927mg             251   2e-75   
emb|CBI30530.3|  unnamed protein product                                241   2e-75   
ref|XP_004302643.1|  PREDICTED: laccase-4-like                          250   2e-75   
ref|XP_010509229.1|  PREDICTED: laccase-4-like                          250   3e-75   
ref|XP_009120399.1|  PREDICTED: laccase-16                              250   3e-75   
gb|KDP29119.1|  hypothetical protein JCGZ_16508                         244   4e-75   
ref|XP_010098906.1|  hypothetical protein L484_006544                   249   4e-75   
ref|XP_010923124.1|  PREDICTED: laccase-22                              249   5e-75   
ref|XP_010505418.1|  PREDICTED: laccase-4                               249   5e-75   
ref|XP_004241179.1|  PREDICTED: laccase-4-like                          249   5e-75   
ref|XP_004980096.1|  PREDICTED: laccase-22-like                         250   6e-75   
ref|XP_006282033.1|  hypothetical protein CARUB_v10028274mg             248   8e-75   
emb|CDX80325.1|  BnaC09g34170D                                          249   8e-75   
ref|XP_009141718.1|  PREDICTED: laccase-4-like                          248   9e-75   
ref|XP_010517091.1|  PREDICTED: laccase-4-like                          248   1e-74   
ref|XP_010483503.1|  PREDICTED: laccase-16-like isoform X3              248   1e-74   
ref|XP_011080855.1|  PREDICTED: laccase-4                               248   2e-74   
ref|NP_200699.1|  laccase 16                                            246   3e-74   Arabidopsis thaliana [mouse-ear cress]
gb|EMT07841.1|  Laccase-4                                               242   3e-74   
dbj|BAN10308.1|  laccase                                                247   3e-74   
gb|ABE66261.1|  laccase/diphenol oxidase                                246   3e-74   
gb|ABK28766.1|  unknown                                                 246   3e-74   
dbj|BAJ98144.1|  predicted protein                                      246   6e-74   
sp|Q1PDH6.2|LAC16_ARATH  RecName: Full=Laccase-16; AltName: Full=...    246   6e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008449246.1|  PREDICTED: laccase-11                              246   7e-74   
ref|XP_003558760.1|  PREDICTED: laccase-22                              246   7e-74   
ref|XP_004159811.1|  PREDICTED: laccase-4-like                          240   9e-74   
ref|XP_003632636.1|  PREDICTED: laccase-11                              245   2e-73   
gb|EPS60103.1|  laccase 1a                                              244   2e-73   
gb|KDO50695.1|  hypothetical protein CISIN_1g036540mg                   245   3e-73   
ref|XP_002519529.1|  laccase, putative                                  244   3e-73   Ricinus communis
ref|XP_007140298.1|  hypothetical protein PHAVU_008G100400g             246   3e-73   
ref|XP_008441433.1|  PREDICTED: laccase-4-like                          244   3e-73   
ref|XP_006428774.1|  hypothetical protein CICLE_v10013446mg             244   4e-73   
ref|XP_004143251.1|  PREDICTED: laccase-11-like                         244   4e-73   
ref|XP_010454388.1|  PREDICTED: laccase-16                              244   4e-73   
gb|KDO48719.1|  hypothetical protein CISIN_1g0085922mg                  239   5e-73   
ref|XP_008811561.1|  PREDICTED: laccase-11-like                         243   6e-73   
ref|XP_010924287.1|  PREDICTED: laccase-11-like                         244   6e-73   
ref|XP_010483501.1|  PREDICTED: laccase-16-like isoform X1              244   7e-73   
ref|XP_010907627.1|  PREDICTED: laccase-22-like                         243   8e-73   
ref|XP_010107530.1|  hypothetical protein L484_024383                   243   8e-73   
gb|EMT26873.1|  Laccase-22                                              244   8e-73   
ref|XP_002866298.1|  hypothetical protein ARALYDRAFT_496014             243   9e-73   
ref|NP_001147942.1|  L-ascorbate oxidase precursor                      244   9e-73   Zea mays [maize]
ref|XP_002458747.1|  hypothetical protein SORBIDRAFT_03g039530          244   1e-72   Sorghum bicolor [broomcorn]
ref|XP_010443638.1|  PREDICTED: laccase-16-like                         243   2e-72   
gb|KHG01609.1|  Laccase-11 -like protein                                243   2e-72   
ref|XP_010654256.1|  PREDICTED: laccase-17-like isoform X2              243   2e-72   
gb|ACN34362.1|  unknown                                                 243   3e-72   Zea mays [maize]
ref|XP_008246065.1|  PREDICTED: laccase-11-like                         236   3e-72   
gb|KHN16225.1|  Laccase-17                                              241   3e-72   
dbj|BAF01776.1|  laccase (diphenol oxidase)-like protein                236   4e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CDM84967.1|  unnamed protein product                                242   5e-72   
gb|KHN16226.1|  Laccase-17                                              242   6e-72   
ref|XP_006602563.1|  PREDICTED: laccase-17-like                         241   7e-72   
gb|AFK41498.1|  unknown                                                 235   8e-72   
ref|XP_009392410.1|  PREDICTED: laccase-11                              241   8e-72   
ref|XP_004292037.1|  PREDICTED: laccase-11-like                         241   1e-71   
ref|XP_004961859.1|  PREDICTED: laccase-12/13-like                      241   1e-71   
ref|XP_010543401.1|  PREDICTED: laccase-11-like                         240   1e-71   
ref|XP_007016607.1|  Laccase 17                                         241   2e-71   
ref|XP_007022468.1|  Laccase 17                                         240   2e-71   
ref|XP_004138572.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4-like     240   2e-71   
ref|XP_008240716.1|  PREDICTED: laccase-17-like                         241   2e-71   
gb|ACF87758.1|  unknown                                                 234   2e-71   Zea mays [maize]
gb|KHN41965.1|  Laccase-11                                              238   2e-71   
gb|KHN36103.1|  Laccase-11                                              239   2e-71   
gb|EMS48628.1|  Laccase-12/13                                           240   2e-71   
ref|XP_009793780.1|  PREDICTED: laccase-11-like                         240   2e-71   
ref|XP_003623041.1|  Laccase                                            240   2e-71   
ref|XP_009354528.1|  PREDICTED: laccase-17-like                         240   2e-71   
ref|XP_003564593.1|  PREDICTED: laccase-12/13-like                      240   2e-71   
gb|KGN45770.1|  hypothetical protein Csa_6G009490                       239   3e-71   
gb|AAN59950.1|  laccase LAC12                                           228   3e-71   Lolium perenne [perennial ryegrass]
ref|XP_007208294.1|  hypothetical protein PRUPE_ppa003308mg             240   3e-71   
ref|XP_003622947.1|  Laccase                                            239   3e-71   
gb|KDO37152.1|  hypothetical protein CISIN_1g040938mg                   238   3e-71   
ref|XP_010926015.1|  PREDICTED: laccase-11-like                         244   3e-71   
gb|AES79165.2|  laccase/diphenol oxidase family protein                 239   4e-71   
emb|CAA74105.1|  laccase                                                239   4e-71   Populus trichocarpa [western balsam poplar]
ref|XP_002269038.2|  PREDICTED: laccase-17 isoform X2                   239   4e-71   Vitis vinifera
ref|XP_004232419.1|  PREDICTED: laccase-11-like                         239   4e-71   
dbj|BAJ96691.1|  predicted protein                                      239   5e-71   
ref|XP_010654257.1|  PREDICTED: laccase-17 isoform X1                   239   6e-71   
ref|XP_006644994.1|  PREDICTED: laccase-12/13-like                      239   6e-71   
ref|XP_010683865.1|  PREDICTED: laccase-17-like                         239   6e-71   
gb|KHN24985.1|  Laccase-17                                              238   6e-71   
gb|EEC71780.1|  hypothetical protein OsI_04394                          239   6e-71   
ref|XP_008797558.1|  PREDICTED: laccase-11-like                         244   6e-71   
dbj|BAJ84890.1|  predicted protein                                      239   7e-71   
ref|XP_010037821.1|  PREDICTED: laccase-17-like                         239   8e-71   
ref|XP_002268628.2|  PREDICTED: laccase-17-like isoform X1              239   8e-71   
ref|XP_004137934.1|  PREDICTED: laccase-17-like                         238   8e-71   
ref|XP_011000403.1|  PREDICTED: laccase-11-like                         238   9e-71   
ref|XP_008358843.1|  PREDICTED: laccase-17-like                         239   9e-71   
ref|XP_004289138.1|  PREDICTED: laccase-11-like                         238   9e-71   
ref|XP_002278232.1|  PREDICTED: laccase-17-like                         239   1e-70   
emb|CBI30529.3|  unnamed protein product                                238   1e-70   
ref|XP_004160985.1|  PREDICTED: laccase-11-like                         238   1e-70   
ref|XP_004146556.1|  PREDICTED: laccase-11-like                         238   1e-70   
emb|CAN60069.1|  hypothetical protein VITISV_012401                     238   1e-70   
ref|XP_006480875.1|  PREDICTED: laccase-17-like isoform X2              237   1e-70   
emb|CBI17500.3|  unnamed protein product                                237   1e-70   
ref|XP_002308164.1|  hypothetical protein POPTR_0006s08740g             238   1e-70   
ref|XP_006445791.1|  hypothetical protein CICLE_v10018047mg             238   1e-70   
ref|XP_002313847.2|  hypothetical protein POPTR_0009s10550g             238   1e-70   
ref|XP_010024157.1|  PREDICTED: laccase-11                              238   1e-70   
ref|XP_004512055.1|  PREDICTED: laccase-11-like                         238   2e-70   
ref|XP_009590676.1|  PREDICTED: laccase-11-like                         238   2e-70   
ref|XP_008452071.1|  PREDICTED: laccase-11-like                         238   2e-70   
ref|XP_004232420.1|  PREDICTED: laccase-11                              238   2e-70   
ref|XP_008352457.1|  PREDICTED: laccase-11-like                         238   2e-70   
ref|XP_006340638.1|  PREDICTED: laccase-11-like                         237   2e-70   
ref|XP_006340637.1|  PREDICTED: laccase-11-like                         237   2e-70   
ref|XP_006429124.1|  hypothetical protein CICLE_v10011358mg             238   2e-70   
emb|CBI16199.3|  unnamed protein product                                238   2e-70   
ref|XP_002317505.2|  hypothetical protein POPTR_0011s12100g             238   2e-70   
emb|CDO97037.1|  unnamed protein product                                237   2e-70   
ref|XP_006840270.1|  hypothetical protein AMTR_s00045p00045490          237   2e-70   
ref|XP_008236999.1|  PREDICTED: laccase-11-like                         237   2e-70   
ref|XP_007207546.1|  hypothetical protein PRUPE_ppa017421mg             238   2e-70   
ref|XP_002266464.1|  PREDICTED: laccase-11                              237   2e-70   
ref|XP_009772835.1|  PREDICTED: laccase-11-like                         237   2e-70   
ref|XP_009354571.1|  PREDICTED: laccase-17-like                         237   2e-70   
ref|XP_002309069.1|  hypothetical protein POPTR_0006s08780g             238   3e-70   
ref|XP_009342664.1|  PREDICTED: laccase-11-like                         238   3e-70   
ref|XP_002284473.1|  PREDICTED: laccase-17                              238   3e-70   
emb|CAN71338.1|  hypothetical protein VITISV_008643                     237   3e-70   
ref|NP_001044773.1|  Os01g0842500                                       237   3e-70   
ref|XP_009126628.1|  PREDICTED: laccase-17-like                         237   3e-70   
ref|XP_004970542.1|  PREDICTED: laccase-4-like                          237   3e-70   
ref|XP_006480874.1|  PREDICTED: laccase-17-like isoform X1              237   3e-70   
ref|XP_002275392.1|  PREDICTED: laccase-11                              237   3e-70   
ref|XP_007200216.1|  hypothetical protein PRUPE_ppa015544mg             237   3e-70   
ref|XP_009338594.1|  PREDICTED: laccase-17-like                         238   3e-70   
ref|XP_011089492.1|  PREDICTED: laccase-17                              237   3e-70   
ref|XP_011019838.1|  PREDICTED: laccase-17-like                         237   3e-70   
ref|XP_008800741.1|  PREDICTED: laccase-11-like                         243   3e-70   
ref|XP_007205004.1|  hypothetical protein PRUPE_ppa003572mg             237   3e-70   
ref|XP_006370271.1|  hypothetical protein POPTR_0001s41170g             237   3e-70   
ref|XP_006424671.1|  hypothetical protein CICLE_v10030166mg             237   3e-70   
ref|XP_004970543.1|  PREDICTED: laccase-12/13-like                      237   4e-70   
gb|EPS68485.1|  hypothetical protein M569_06281                         235   4e-70   
ref|XP_009371609.1|  PREDICTED: laccase-11-like                         236   4e-70   
ref|XP_002282823.1|  PREDICTED: laccase-17                              237   4e-70   
gb|KDP35652.1|  hypothetical protein JCGZ_09090                         233   4e-70   
ref|XP_008222577.1|  PREDICTED: laccase-17-like                         237   5e-70   
ref|XP_007156959.1|  hypothetical protein PHAVU_002G031700g             236   5e-70   
ref|XP_002298223.2|  hypothetical protein POPTR_0001s18500g             236   5e-70   
ref|XP_003532315.1|  PREDICTED: laccase-17-like                         237   5e-70   
emb|CAN60348.1|  hypothetical protein VITISV_005802                     236   5e-70   
gb|KHG06904.1|  Laccase-10                                              226   5e-70   
ref|XP_004969263.1|  PREDICTED: laccase-2-like                          236   6e-70   
ref|XP_002873085.1|  hypothetical protein ARALYDRAFT_487097             236   6e-70   
gb|KHN24986.1|  Laccase-17                                              236   6e-70   
ref|XP_007046899.1|  Laccase 11                                         236   6e-70   
ref|XP_010690891.1|  PREDICTED: laccase-17-like                         236   7e-70   
ref|XP_003632204.1|  PREDICTED: laccase-17                              236   7e-70   
ref|XP_007042164.1|  Laccase 11                                         241   7e-70   
ref|XP_002531824.1|  laccase, putative                                  236   8e-70   
ref|XP_007198990.1|  hypothetical protein PRUPE_ppa003590mg             236   8e-70   
ref|XP_007140513.1|  hypothetical protein PHAVU_008G119000g             236   8e-70   
ref|XP_004492318.1|  PREDICTED: laccase-17-like                         236   8e-70   
ref|XP_010452196.1|  PREDICTED: laccase-11                              236   9e-70   
emb|CAN73336.1|  hypothetical protein VITISV_033042                     235   9e-70   
ref|XP_011019845.1|  PREDICTED: laccase-2-like                          236   9e-70   
ref|XP_002299296.1|  laccase family protein                             236   9e-70   
ref|XP_006398771.1|  hypothetical protein EUTSA_v10013135mg             235   1e-69   
ref|XP_003612035.1|  Laccase-11                                         236   1e-69   
sp|Q8RYM9.1|LAC2_ORYSJ  RecName: Full=Laccase-2; AltName: Full=Be...    235   1e-69   
ref|XP_010092993.1|  hypothetical protein L484_007174                   236   1e-69   
ref|XP_008385897.1|  PREDICTED: laccase-11-like                         236   1e-69   
ref|XP_002458746.1|  hypothetical protein SORBIDRAFT_03g039520          236   1e-69   
ref|XP_002282815.1|  PREDICTED: laccase-17                              236   1e-69   
gb|AFW84624.1|  putative laccase family protein                         236   1e-69   
ref|NP_001146658.1|  uncharacterized protein LOC100280258 precursor     236   1e-69   
gb|EAZ12812.1|  hypothetical protein OsJ_02731                          235   1e-69   
ref|XP_010490794.1|  PREDICTED: laccase-11-like                         235   1e-69   
ref|XP_006350913.1|  PREDICTED: laccase-2-like                          236   1e-69   
gb|AFK35326.1|  unknown                                                 223   1e-69   
gb|KDP44151.1|  hypothetical protein JCGZ_05618                         236   1e-69   
ref|XP_007026975.1|  Laccase 17                                         236   1e-69   
ref|XP_011043780.1|  PREDICTED: laccase-2-like                          236   1e-69   
gb|ACJ85871.1|  unknown                                                 224   1e-69   
ref|XP_010043648.1|  PREDICTED: laccase-17-like                         236   1e-69   
ref|XP_004148786.1|  PREDICTED: laccase-17-like                         236   1e-69   
ref|XP_008463808.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    235   1e-69   
ref|XP_004514392.1|  PREDICTED: laccase-17-like                         235   1e-69   
gb|KDP41783.1|  hypothetical protein JCGZ_26801                         240   2e-69   
ref|XP_010558158.1|  PREDICTED: laccase-11                              235   2e-69   
ref|XP_011032272.1|  PREDICTED: laccase-2-like                          235   2e-69   
ref|XP_011094887.1|  PREDICTED: laccase-17-like                         235   2e-69   
ref|XP_002310245.1|  hypothetical protein POPTR_0007s13050g             235   2e-69   
ref|XP_009764219.1|  PREDICTED: laccase-11-like                         235   2e-69   
ref|XP_006347000.1|  PREDICTED: laccase-11-like                         235   2e-69   
gb|KDO73109.1|  hypothetical protein CISIN_1g047497mg                   235   2e-69   
gb|EMT20803.1|  Laccase-4                                               235   2e-69   
ref|XP_008442529.1|  PREDICTED: laccase-17-like                         235   2e-69   
ref|XP_002512915.1|  laccase, putative                                  234   2e-69   
ref|XP_003564592.1|  PREDICTED: laccase-4-like                          235   2e-69   
gb|KHG14663.1|  Laccase-4                                               233   2e-69   
ref|XP_004233973.1|  PREDICTED: laccase-11                              234   2e-69   
ref|XP_007016584.1|  Laccase 17                                         235   3e-69   
ref|XP_004294637.1|  PREDICTED: laccase-17-like                         235   3e-69   
ref|XP_007199239.1|  hypothetical protein PRUPE_ppa022262mg             231   3e-69   
dbj|BAJ99773.1|  predicted protein                                      234   3e-69   
emb|CAB86093.1|  laccase precursor-like                                 234   3e-69   
ref|NP_195946.2|  laccase 11                                            234   3e-69   
ref|XP_011002147.1|  PREDICTED: laccase-17-like                         234   3e-69   
ref|XP_006603494.1|  PREDICTED: laccase-17-like                         233   3e-69   
ref|XP_008385213.1|  PREDICTED: laccase-17-like                         234   3e-69   
gb|KHF97742.1|  Laccase-17 -like protein                                234   3e-69   
gb|AAC04576.1|  putative high-pI laccase                                234   3e-69   
ref|XP_002313424.1|  hypothetical protein POPTR_0009s03940g             234   4e-69   
ref|XP_006379354.1|  hypothetical protein POPTR_0009s15860g             234   4e-69   
ref|XP_009603099.1|  PREDICTED: laccase-2-like                          234   4e-69   
ref|XP_008338086.1|  PREDICTED: laccase-11-like                         234   4e-69   
ref|NP_001105875.1|  putative laccase precursor                         234   4e-69   
ref|XP_006379352.1|  hypothetical protein POPTR_0009s15840g             234   4e-69   
gb|EAZ14115.1|  hypothetical protein OsJ_04039                          234   4e-69   
emb|CAN72263.1|  hypothetical protein VITISV_037366                     234   4e-69   
gb|KHN41966.1|  Laccase-11                                              234   4e-69   
ref|NP_001044772.1|  Os01g0842400                                       234   4e-69   
gb|KEH22917.1|  laccase/diphenol oxidase family protein                 234   4e-69   
ref|XP_004972357.1|  PREDICTED: laccase-2-like                          234   4e-69   
ref|XP_008241697.1|  PREDICTED: laccase-11-like                         234   5e-69   
gb|KDO70945.1|  hypothetical protein CISIN_1g008484mg                   229   5e-69   
ref|XP_007156958.1|  hypothetical protein PHAVU_002G031600g             234   5e-69   
ref|XP_011029469.1|  PREDICTED: laccase-17-like                         234   5e-69   
ref|XP_004292029.1|  PREDICTED: laccase-11-like                         234   5e-69   
ref|XP_003538856.1|  PREDICTED: laccase-11-like                         234   5e-69   
gb|EEC71777.1|  hypothetical protein OsI_04389                          234   5e-69   
gb|KHN24984.1|  Laccase-17                                              233   6e-69   
ref|XP_010275879.1|  PREDICTED: laccase-17-like                         234   6e-69   
ref|XP_010541371.1|  PREDICTED: laccase-17-like                         234   6e-69   
gb|AAT75349.1|  laccase-like multicopper oxidase 15                     228   6e-69   
ref|XP_004506788.1|  PREDICTED: laccase-4-like                          233   6e-69   
ref|XP_011025818.1|  PREDICTED: laccase-11-like                         233   6e-69   
gb|KDO70944.1|  hypothetical protein CISIN_1g008484mg                   230   6e-69   
ref|XP_004241217.1|  PREDICTED: laccase-2-like                          234   6e-69   
ref|XP_008385215.1|  PREDICTED: laccase-17-like                         234   7e-69   
ref|XP_003530894.1|  PREDICTED: laccase-17-like                         234   7e-69   
ref|XP_008665185.1|  PREDICTED: laccase-4-like                          234   7e-69   
ref|XP_006878556.1|  hypothetical protein AMTR_s00011p00235480          233   7e-69   
ref|XP_006644993.1|  PREDICTED: laccase-4-like                          233   8e-69   
ref|XP_003516567.1|  PREDICTED: laccase-11-like                         233   8e-69   
ref|XP_008785574.1|  PREDICTED: laccase-17-like                         233   8e-69   
gb|KEH22816.1|  laccase/diphenol oxidase family protein                 233   9e-69   
ref|XP_006592190.1|  PREDICTED: laccase-2-like isoform X2               233   9e-69   
ref|XP_006429125.1|  hypothetical protein CICLE_v10011362mg             233   9e-69   
ref|XP_009340732.1|  PREDICTED: laccase-11-like                         233   9e-69   
ref|XP_004492322.1|  PREDICTED: laccase-17-like                         233   1e-68   
ref|XP_007204198.1|  hypothetical protein PRUPE_ppa003577mg             233   1e-68   
ref|XP_010541373.1|  PREDICTED: laccase-17                              234   1e-68   
ref|XP_006592189.1|  PREDICTED: laccase-2-like isoform X1               233   1e-68   
gb|AAB17192.1|  laccase                                                 233   1e-68   
ref|XP_010654259.1|  PREDICTED: laccase-2-like                          233   1e-68   
gb|KHN14004.1|  Laccase-17                                              233   1e-68   
ref|XP_009796361.1|  PREDICTED: laccase-17-like                         233   1e-68   
ref|XP_002317504.2|  hypothetical protein POPTR_0011s12090g             233   1e-68   
ref|XP_009593896.1|  PREDICTED: laccase-11-like                         233   1e-68   
ref|XP_011088411.1|  PREDICTED: laccase-11-like                         233   1e-68   
ref|XP_009593898.1|  PREDICTED: laccase-11-like                         233   1e-68   
ref|XP_010106521.1|  hypothetical protein L484_025281                   233   1e-68   
ref|XP_006424707.1|  hypothetical protein CICLE_v10028090mg             233   1e-68   
ref|XP_007026973.1|  Laccase 17                                         233   1e-68   
ref|XP_008349706.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-17-like    228   1e-68   
gb|KDO73032.1|  hypothetical protein CISIN_1g008109mg                   233   1e-68   
gb|KHN16229.1|  Laccase-17                                              233   1e-68   
gb|AES94995.2|  laccase/diphenol oxidase family protein                 232   1e-68   
ref|XP_010263632.1|  PREDICTED: laccase-11-like                         237   2e-68   
ref|XP_003552179.1|  PREDICTED: laccase-17-like                         233   2e-68   
ref|XP_008387787.1|  PREDICTED: laccase-17-like                         233   2e-68   
ref|XP_003612037.1|  Laccase-11                                         233   2e-68   
emb|CDM80721.1|  unnamed protein product                                233   2e-68   
gb|KDO52342.1|  hypothetical protein CISIN_1g008085mg                   233   2e-68   
ref|XP_002520232.1|  laccase, putative                                  233   2e-68   
ref|XP_010423743.1|  PREDICTED: laccase-11-like                         232   2e-68   
ref|XP_010690924.1|  PREDICTED: laccase-17-like                         233   2e-68   
ref|XP_003622953.1|  Laccase                                            233   2e-68   
ref|XP_010922297.1|  PREDICTED: laccase-17-like                         233   2e-68   
ref|XP_004300985.1|  PREDICTED: laccase-11-like                         232   2e-68   
gb|EYU26602.1|  hypothetical protein MIMGU_mgv1a003840mg                232   2e-68   
ref|XP_009120521.1|  PREDICTED: laccase-17-like                         232   2e-68   
emb|CDY31581.1|  BnaA10g12900D                                          232   2e-68   
emb|CDY09232.1|  BnaA02g06580D                                          232   2e-68   
gb|KHN40289.1|  Laccase-17                                              230   2e-68   
ref|XP_008778964.1|  PREDICTED: laccase-17-like                         232   2e-68   
gb|EMS50562.1|  Laccase-12/13                                           230   2e-68   
ref|XP_009416147.1|  PREDICTED: laccase-4-like                          232   2e-68   
gb|EYU26609.1|  hypothetical protein MIMGU_mgv1a003496mg                232   3e-68   
ref|XP_002520231.1|  laccase, putative                                  232   3e-68   
ref|XP_009403441.1|  PREDICTED: laccase-4-like                          232   3e-68   
emb|CDY44351.1|  BnaC02g03260D                                          231   3e-68   
ref|XP_009621093.1|  PREDICTED: laccase-17-like                         232   3e-68   
ref|XP_002864664.1|  hypothetical protein ARALYDRAFT_496140             232   3e-68   
ref|XP_008801588.1|  PREDICTED: LOW QUALITY PROTEIN: laccase-4          231   3e-68   
ref|XP_011077639.1|  PREDICTED: laccase-17-like                         232   3e-68   
emb|CDX70319.1|  BnaA10g26680D                                          231   3e-68   
ref|XP_002531562.1|  laccase, putative                                  232   3e-68   
ref|XP_007026983.1|  Laccase 17 isoform 1                               232   3e-68   
ref|XP_006280235.1|  hypothetical protein CARUB_v10026150mg             232   4e-68   
ref|XP_010483648.1|  PREDICTED: laccase-17-like                         233   4e-68   
ref|NP_200810.1|  laccase 17                                            232   4e-68   



>ref|XP_009590412.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGV+T DFPG P IPFNYTGTPP N+QTQNGTKVY++ FNSTVQ+V+QGTSIIAPESH
Sbjct  398  NISGVYTADFPGNPSIPFNYTGTPPTNLQTQNGTKVYKVEFNSTVQVVLQGTSIIAPESH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGFNF+VVGKG+GN+DP+NDPKKFNL+DPVERNT+SVPTAGWTAIRFRADNPGVWF
Sbjct  458  PTHLHGFNFFVVGKGVGNYDPKNDPKKFNLVDPVERNTMSVPTAGWTAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKM FLVENGKGPN+SILPPPSDLPKC
Sbjct  518  MHCHLEVHTTWGLKMGFLVENGKGPNQSILPPPSDLPKC  556



>gb|EYU41257.1| hypothetical protein MIMGU_mgv1a003880mg [Erythranthe guttata]
Length=558

 Score =   307 bits (786),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 136/159 (86%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N+SGV+TDDFPG P +P+NYTG+PP NMQT NGTKVYRLG+NSTVQIV+QGT+IIAPESH
Sbjct  400  NVSGVYTDDFPGNPPVPYNYTGSPPTNMQTTNGTKVYRLGYNSTVQIVLQGTAIIAPESH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGFNFYVVGKG+GN+DP+NDPK FNL+DP+ERNT+SVPT GWTAIRFRADNPGVWF
Sbjct  460  PTHLHGFNFYVVGKGIGNYDPKNDPKSFNLVDPIERNTISVPTGGWTAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLEIHTTWGLKMAF+VENGKGPN+SILPPPSDLPKC
Sbjct  520  LHCHLEIHTTWGLKMAFVVENGKGPNQSILPPPSDLPKC  558



>ref|XP_009767351.1| PREDICTED: laccase-4-like, partial [Nicotiana sylvestris]
Length=321

 Score =   295 bits (756),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 149/159 (94%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NIS V+T DFP  P IPFNYTGTPP N+QTQNGTKVY++ FNSTVQ+V+QGTSIIAPESH
Sbjct  163  NISDVYTTDFPENPAIPFNYTGTPPTNLQTQNGTKVYKVEFNSTVQVVLQGTSIIAPESH  222

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGFNF+VVGKG+GN+DP+NDPKKFNL+DPVERNT+SVPTAG TAIRFRADNPGVWF
Sbjct  223  PTHLHGFNFFVVGKGVGNYDPKNDPKKFNLVDPVERNTMSVPTAGRTAIRFRADNPGVWF  282

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKM F VENG+GPN+SILPPPSDLPKC
Sbjct  283  LHCHLEVHTTWGLKMVFFVENGRGPNQSILPPPSDLPKC  321



>ref|XP_011084946.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=555

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGV+TDDFP  P  P+NYTGTPP ++QT NGTKVYRL +NSTVQ+V+QGTSIIAPESH
Sbjct  397  NISGVYTDDFPANPPNPYNYTGTPPTSIQTNNGTKVYRLAYNSTVQLVLQGTSIIAPESH  456

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGFNFYVVGKGLGN+DP+NDPK FNL+DPVERNT+SVPTAGWTAIRFRADNPGVWF
Sbjct  457  PTHLHGFNFYVVGKGLGNYDPKNDPKNFNLVDPVERNTISVPTAGWTAIRFRADNPGVWF  516

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP+DLPKC
Sbjct  517  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPNDLPKC  555



>ref|XP_007009094.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY17904.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=554

 Score =   298 bits (762),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            ISGVFTDDFP KP IPFNYTGTPP+++QT NGT+VYRL +NSTVQ++IQG SIIAPESHP
Sbjct  397  ISGVFTDDFPAKPLIPFNYTGTPPSSLQTMNGTRVYRLAYNSTVQLIIQGNSIIAPESHP  456

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
            THLHGFNF+ VG+G+GNFDP+ DP KFNL+DPVERNT+SVPTAGWTAIRFRADNPGVWF 
Sbjct  457  THLHGFNFFAVGRGVGNFDPEKDPLKFNLVDPVERNTISVPTAGWTAIRFRADNPGVWFF  516

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAFLVENGKGPNES++PPPSDLP+C
Sbjct  517  HCHLEVHTTWGLKMAFLVENGKGPNESLIPPPSDLPQC  554



>ref|XP_010543748.1| PREDICTED: laccase-22-like [Tarenaya hassleriana]
Length=555

 Score =   295 bits (755),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 148/160 (93%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGT-PPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVFTDDFPGKP IPFNYT     ANM+T NGTK YRL +NSTVQ+VIQGTS+IAPES
Sbjct  396  NISGVFTDDFPGKPLIPFNYTANNSTANMRTMNGTKAYRLAYNSTVQLVIQGTSVIAPES  455

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HPTHLHGFNF+V+GKG+GNFDP NDPKKFNL+DPVERNTVSVPTAGWTAIRFRADNPGVW
Sbjct  456  HPTHLHGFNFFVIGKGVGNFDPLNDPKKFNLVDPVERNTVSVPTAGWTAIRFRADNPGVW  515

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F HCHLE+HT+WGLKM FLVENGKGPNE++LPPPSDLPKC
Sbjct  516  FFHCHLEVHTSWGLKMVFLVENGKGPNETLLPPPSDLPKC  555



>emb|CDP14064.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   294 bits (752),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            ISGV+T+DFPG P  P+NYTGTPP N+QT NGTKVY+L FNSTVQ+VIQG SI+APESHP
Sbjct  398  ISGVYTEDFPGNPPTPYNYTGTPPTNIQTTNGTKVYKLAFNSTVQVVIQGNSIVAPESHP  457

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
            THLHGFNF+VVGKGLGNF+P  DPKKFNL+DPVERNT+SVPT GWT IRFRADNPG+WFM
Sbjct  458  THLHGFNFFVVGKGLGNFNPNTDPKKFNLVDPVERNTISVPTGGWTVIRFRADNPGIWFM  517

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAFLVENG GPNESILPPP+DLPKC
Sbjct  518  HCHLEVHTTWGLKMAFLVENGNGPNESILPPPTDLPKC  555



>gb|KHG28836.1| Laccase-22 [Gossypium arboreum]
Length=574

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I+GVFTDDFP KP IPFNYTGTPP+ +QT NGTKVYRL +NSTVQ+VIQG +I+APESHP
Sbjct  417  INGVFTDDFPAKPAIPFNYTGTPPSGIQTMNGTKVYRLAYNSTVQLVIQGNTIVAPESHP  476

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
            THLHG NF+VVG+G+GNFDP  DP KFNL+DPVERNTVSVPTAGWTAIRFRADNPG+WF 
Sbjct  477  THLHGSNFFVVGRGVGNFDPDKDPLKFNLVDPVERNTVSVPTAGWTAIRFRADNPGIWFF  536

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAFLVENGKGPNESI PPPSDLPKC
Sbjct  537  HCHLEVHTTWGLKMAFLVENGKGPNESIEPPPSDLPKC  574



>gb|EPS61127.1| laccase 3, partial [Genlisea aurea]
Length=551

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N+SG+FT DFPG P IP+NYTGTPP NMQT NGTK+YRL +NSTV+IV QGTSIIAPESH
Sbjct  393  NMSGIFTTDFPGNPPIPYNYTGTPPRNMQTVNGTKLYRLAYNSTVEIVFQGTSIIAPESH  452

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGF+FYVVGKG+GN+DP+NDPKKFNL+DPVERNTVSVPT GWTAIRFRADNPG+WF
Sbjct  453  PTHLHGFDFYVVGKGVGNYDPKNDPKKFNLVDPVERNTVSVPTGGWTAIRFRADNPGIWF  512

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKMAFLVENG+GPN +I  PPSDLP+C
Sbjct  513  LHCHLEVHTTWGLKMAFLVENGEGPNATISAPPSDLPQC  551



>emb|CBI31539.3| unnamed protein product [Vitis vinifera]
Length=533

 Score =   288 bits (738),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFT DFPG P I FNYTGT P+NMQT NGT++YRL +NSTVQ+VIQGT++I+PESH
Sbjct  375  NIGGVFTVDFPGNPLIAFNYTGTQPSNMQTMNGTRLYRLAYNSTVQVVIQGTAMISPESH  434

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGF+FY VG+GLGNFDP NDPKKFNLIDP+ RNT+ VP+ GWTAIRFRADNPGVW 
Sbjct  435  PTHLHGFDFYAVGRGLGNFDPVNDPKKFNLIDPIARNTIGVPSGGWTAIRFRADNPGVWL  494

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKMAFLVENGKGPNES++PPPSDLPKC
Sbjct  495  LHCHLEVHTTWGLKMAFLVENGKGPNESLVPPPSDLPKC  533



>ref|XP_002265173.1| PREDICTED: laccase-4-like [Vitis vinifera]
Length=553

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFT DFPG P I FNYTGT P+NMQT NGT++YRL +NSTVQ+VIQGT++I+PESH
Sbjct  395  NIGGVFTVDFPGNPLIAFNYTGTQPSNMQTMNGTRLYRLAYNSTVQVVIQGTAMISPESH  454

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGF+FY VG+GLGNFDP NDPKKFNLIDP+ RNT+ VP+ GWTAIRFRADNPGVW 
Sbjct  455  PTHLHGFDFYAVGRGLGNFDPVNDPKKFNLIDPIARNTIGVPSGGWTAIRFRADNPGVWL  514

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKMAFLVENGKGPNES++PPPSDLPKC
Sbjct  515  LHCHLEVHTTWGLKMAFLVENGKGPNESLVPPPSDLPKC  553



>ref|XP_010067496.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW65638.1| hypothetical protein EUGRSUZ_G03028 [Eucalyptus grandis]
Length=561

 Score =   288 bits (737),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GV+TDDFPG P  PFNYTGTPP+NMQT NGT+VY+L +NSTVQ+V+QGTSIIAPE+HP
Sbjct  404  IKGVYTDDFPGNPPTPFNYTGTPPSNMQTTNGTRVYKLAYNSTVQVVLQGTSIIAPENHP  463

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
            THLHGFNF+ +GKGLGNFDP  DPK FNL+DPVERNT+ VPTAGWTAIRFRADNPGVWF+
Sbjct  464  THLHGFNFFGIGKGLGNFDPNKDPKNFNLVDPVERNTIGVPTAGWTAIRFRADNPGVWFL  523

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKM F+VE+G GPNES+LPPP+DLPKC
Sbjct  524  HCHLEVHTTWGLKMVFIVEDGDGPNESLLPPPADLPKC  561



>emb|CDP06511.1| unnamed protein product [Coffea canephora]
Length=561

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI+GVFT DFPG P  PFNYTGTPPAN+QT+NGTKVYRL +N+TVQ+V+Q T I+APE+H
Sbjct  403  NINGVFTTDFPGNPPSPFNYTGTPPANLQTKNGTKVYRLPYNATVQVVLQDTGIVAPENH  462

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNFDP+ DPKKFNL+DPVERNT+ VPT GW AIRFRADNPGVWF
Sbjct  463  PIHLHGFNFFAVGRGLGNFDPKTDPKKFNLVDPVERNTIGVPTGGWVAIRFRADNPGVWF  522

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKG NES+LPPPSDLPKC
Sbjct  523  MHCHLEVHTTWGLKMAFLVDNGKGTNESLLPPPSDLPKC  561



>ref|XP_009337309.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFPG P  P+NYTGT P NMQT+ GT++YRL +N+TVQ+V+QGT ++APE+H
Sbjct  400  NISGVFTDDFPGNPLNPYNYTGTQPTNMQTKKGTRLYRLAYNTTVQLVLQGTGMLAPETH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNFY VG+GLGNF+P+ DPK+FNL+DPVERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  460  PVHLHGFNFYEVGRGLGNFNPKTDPKRFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  558



>ref|XP_002316233.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
 gb|EEF02404.1| hypothetical protein POPTR_0010s20050g [Populus trichocarpa]
Length=555

 Score =   283 bits (723),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPA-NMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVFTDDFP KP I FNYTG   A N++T NGT+ YRL FNS VQ+V+QGT+IIAPES
Sbjct  396  NISGVFTDDFPAKPPISFNYTGNNTAMNLKTTNGTRAYRLAFNSAVQVVLQGTTIIAPES  455

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVGKG+GNFDP NDPKKFNL DPVERNTVSVPTAGW AIRF+ADNPGVW
Sbjct  456  HPFHLHGFNFFVVGKGIGNFDPDNDPKKFNLADPVERNTVSVPTAGWIAIRFKADNPGVW  515

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCHLE+HTTWGLKMAF+V+NGKGPNESILPPPSDLP C
Sbjct  516  FLHCHLEVHTTWGLKMAFVVDNGKGPNESILPPPSDLPTC  555



>emb|CAA74103.1| laccase [Populus trichocarpa]
Length=555

 Score =   282 bits (722),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPA-NMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVFTDDFP KP I FNYTG   A N++T NGT+ YRL FNS VQ+V+QGT+IIAPES
Sbjct  396  NISGVFTDDFPAKPPISFNYTGNNTAMNLKTTNGTRAYRLAFNSAVQVVLQGTTIIAPES  455

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVGKG+GNFDP NDPKKFNL DPVERNTVSVPTAGW AIRF+ADNPGVW
Sbjct  456  HPFHLHGFNFFVVGKGIGNFDPDNDPKKFNLADPVERNTVSVPTAGWIAIRFKADNPGVW  515

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCHLE+HTTWGLKMAF+V+NGKGPNESILPPPSDLP C
Sbjct  516  FLHCHLEVHTTWGLKMAFVVDNGKGPNESILPPPSDLPTC  555



>emb|CAC14719.1| laccase [Populus trichocarpa]
Length=555

 Score =   282 bits (722),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPA-NMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVFTDDFP KP I FNYTG   A N++T NGT+ YRL FNS VQ+V+QGT+IIAPES
Sbjct  396  NISGVFTDDFPAKPPISFNYTGNNTAMNLKTTNGTRAYRLAFNSAVQVVLQGTTIIAPES  455

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVGKG+GNFDP NDPKKFNL DPVERNTVSVPTAGW AIRF+ADNPGVW
Sbjct  456  HPFHLHGFNFFVVGKGIGNFDPDNDPKKFNLADPVERNTVSVPTAGWIAIRFKADNPGVW  515

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCHLE+HTTWGLKMAF+V+NGKGPNESILPPPSDLP C
Sbjct  516  FLHCHLEVHTTWGLKMAFVVDNGKGPNESILPPPSDLPTC  555



>ref|XP_011019227.1| PREDICTED: laccase-4-like, partial [Populus euphratica]
Length=315

 Score =   275 bits (702),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP KP   FNYTGTPP N+QT++GTKVYRL +NSTVQ+V+Q T II+PE+H
Sbjct  157  NISGVFTTDFPAKPPHVFNYTGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENH  216

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GN++P+ D KKFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  217  PIHLHGFNFFAVGRGVGNYNPKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  276

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGP ES+LPPPSDLPKC
Sbjct  277  MHCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPSDLPKC  315



>ref|XP_007220829.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
 gb|EMJ22028.1| hypothetical protein PRUPE_ppa027203mg [Prunus persica]
Length=558

 Score =   282 bits (721),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N  GVFT DFP  P IPFNYTG   ANMQT NGT++YRLG+NSTVQIV+QGT++IAPESH
Sbjct  400  NTKGVFTLDFPANPPIPFNYTGNSTANMQTTNGTRLYRLGYNSTVQIVLQGTAVIAPESH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGFNF+VVGKG+GNFDP+ DPK FNL+DPVERNT+SVPT GWTAIRFRADNPG+WF
Sbjct  460  PTHLHGFNFFVVGKGIGNFDPKKDPKTFNLVDPVERNTISVPTGGWTAIRFRADNPGIWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKM FLVENGKGPNE++ PPP+DLP C
Sbjct  520  LHCHLEVHTTWGLKMPFLVENGKGPNETLRPPPADLPTC  558



>ref|XP_009346884.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFPG P  P+NYTGT P NMQT+ GT++YRL +N+TVQ+V+QGT ++APE+H
Sbjct  400  NISGVFTDDFPGNPLNPYNYTGTQPTNMQTKKGTRLYRLAYNTTVQLVLQGTGMLAPETH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+P+ DPK+FNL+DPVERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  460  PVHLHGFNFFEVGRGLGNFNPKTDPKRFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  558



>ref|XP_009374280.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFPG P  P+NYTGT P N+QT+ GT++YRL +NSTVQ+V+QGT +IAPE+H
Sbjct  400  NISGVFTDDFPGNPLNPYNYTGTQPTNLQTRKGTRLYRLAYNSTVQLVLQGTGMIAPETH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+P+ DPKKFNL+DPVERNT+ VP+ GWTAIRF+ADNPG+WF
Sbjct  460  PVHLHGFNFFEVGRGLGNFNPKKDPKKFNLVDPVERNTIGVPSNGWTAIRFKADNPGIWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  558



>ref|XP_011036009.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=555

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPA-NMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVFTDDFP KP I FNYTG   A N++T NGT+ YRL FNS VQ+V+QGT+IIAPES
Sbjct  396  NISGVFTDDFPAKPPITFNYTGNNTAMNLKTTNGTRAYRLAFNSAVQVVLQGTTIIAPES  455

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVGKGLGNFDP NDPKKFNL+DPVERNTVSVPTAGW AIRF+ADNPGVW
Sbjct  456  HPFHLHGFNFFVVGKGLGNFDPDNDPKKFNLVDPVERNTVSVPTAGWIAIRFKADNPGVW  515

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCHLE+HTTWGLKMAF+V+NGKGPNESI PPPSDLP C
Sbjct  516  FLHCHLEVHTTWGLKMAFVVDNGKGPNESIPPPPSDLPSC  555



>emb|CAA74101.1| laccase [Populus trichocarpa]
Length=407

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP KP   FNYTGTPP N+QT +GTK YRL +NSTVQ+V+Q T II+PE+H
Sbjct  246  NISGVFTTDFPAKPPHVFNYTGTPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENH  305

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GN++P+ DPKKFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  306  PIHLHGFNFFAVGRGVGNYNPKTDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  365

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGPNES+LPPPSDLPKC
Sbjct  366  MHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  404



>emb|CAC14718.1| laccase [Populus trichocarpa]
Length=396

 Score =   276 bits (705),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP KP   FNYTGTPP N+QT +GTK YRL +NSTVQ+V+Q T II+PE+H
Sbjct  235  NISGVFTTDFPAKPPHVFNYTGTPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENH  294

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GN++P+ DPKKFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  295  PIHLHGFNFFAVGRGVGNYNPKTDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  354

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGPNES+LPPPSDLPKC
Sbjct  355  MHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  393



>ref|XP_008355354.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008355361.1| PREDICTED: laccase-4 [Malus domestica]
 ref|XP_008363414.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFPG P  P+NYTGT P N+QT+ GT++YRL +NSTVQ+V+Q T +IAPE+H
Sbjct  400  NISGVFTDDFPGNPLNPYNYTGTQPTNLQTRKGTRLYRLAYNSTVQLVLQDTGMIAPETH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+P  DPKKFNL+DPVERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  460  PVHLHGFNFFEVGRGLGNFNPMKDPKKFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  558



>gb|KDO69098.1| hypothetical protein CISIN_1g008799mg [Citrus sinensis]
Length=553

 Score =   280 bits (717),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            ISGVFTDDFP KP I FNYTG     +QT NGT++YRL +NSTVQ+V+QGT++IAPE+HP
Sbjct  396  ISGVFTDDFPAKPPIAFNYTGNYTGTLQTTNGTRLYRLAYNSTVQLVLQGTTVIAPENHP  455

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
            THLHGFNF+ VGKG GNFDP  DP+KFNL+DPVERNT+SVPTAGWTAIRFRADNPGVWF+
Sbjct  456  THLHGFNFFAVGKGSGNFDPNKDPQKFNLVDPVERNTISVPTAGWTAIRFRADNPGVWFL  515

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HT+WGLKMAF+V+NGKGPNES++PPPSDLP C
Sbjct  516  HCHLEVHTSWGLKMAFVVDNGKGPNESLIPPPSDLPTC  553



>ref|XP_006435668.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
 ref|XP_006486373.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR48908.1| hypothetical protein CICLE_v10031134mg [Citrus clementina]
Length=553

 Score =   280 bits (716),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            ISGVFTDDFP KP I FNYTG     +QT NGT++YRL +NSTVQ+V+QGT++IAPE+HP
Sbjct  396  ISGVFTDDFPAKPPIAFNYTGNYTGTLQTTNGTRLYRLAYNSTVQLVLQGTTVIAPENHP  455

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
            THLHGFNF+ VGKG GNFDP  DP+KFNL+DPVERNT+SVPTAGWTAIRFRADNPGVWF+
Sbjct  456  THLHGFNFFAVGKGSGNFDPNKDPQKFNLVDPVERNTISVPTAGWTAIRFRADNPGVWFL  515

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HT+WGLKMAF+V+NGKGPNES++PPPSDLP C
Sbjct  516  HCHLEVHTSWGLKMAFVVDNGKGPNESLIPPPSDLPTC  553



>ref|XP_008233715.1| PREDICTED: laccase-4-like [Prunus mume]
Length=558

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GV+T DFP  P IPFNYTG   ANMQT NGT++YRLG+NSTVQIV+QGT++IAPESH
Sbjct  400  NIKGVYTLDFPANPPIPFNYTGNTTANMQTTNGTRLYRLGYNSTVQIVLQGTAVIAPESH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGFNF+VVGKG+GNFDP  DPK FNL+DPVERNT+SVPT GWTAIRFRADNPG+WF
Sbjct  460  PTHLHGFNFFVVGKGIGNFDPTKDPKTFNLVDPVERNTISVPTGGWTAIRFRADNPGIWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKM FLVENGKG NE++ PPP+DLP C
Sbjct  520  LHCHLEVHTTWGLKMPFLVENGKGANETLRPPPADLPTC  558



>ref|XP_008220423.1| PREDICTED: laccase-4 [Prunus mume]
Length=558

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFPG P  P+NYTG  P NMQT  GT++YRL +NSTVQ+V+Q T +IAPE+H
Sbjct  400  NISGVFTDDFPGNPLNPYNYTGPQPTNMQTMKGTRLYRLAYNSTVQLVLQDTGMIAPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+P+ DPK+FNLIDPVERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  460  PVHLHGFNFFEVGRGLGNFNPKKDPKRFNLIDPVERNTIGVPSGGWTAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  558



>ref|XP_007207096.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
 gb|EMJ08295.1| hypothetical protein PRUPE_ppa022440mg [Prunus persica]
Length=558

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFPG P  P+NYTG  P NMQT  GT++YRL +NSTVQ+V+Q T +IAPE+H
Sbjct  400  NISGVFTDDFPGNPLNPYNYTGPQPTNMQTMKGTRLYRLAYNSTVQLVLQDTGMIAPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+P+ DPK+FNLIDPVERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  460  PVHLHGFNFFEVGRGLGNFNPKTDPKRFNLIDPVERNTIGVPSGGWTAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  558



>gb|ABK96121.1| unknown [Populus trichocarpa]
Length=276

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPA-NMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            +ISGVFTDDFP  P   FNYTG   A N+QT NGT+ YRL FNSTVQ+V+QGT+IIAPES
Sbjct  117  SISGVFTDDFPAMPPNSFNYTGNNTALNLQTINGTRTYRLAFNSTVQLVLQGTTIIAPES  176

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVGKG GNFD  NDPKKFNL DPVERNT+SVPTAGW AIRFRADNPGVW
Sbjct  177  HPFHLHGFNFFVVGKGFGNFDADNDPKKFNLADPVERNTISVPTAGWAAIRFRADNPGVW  236

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCHLE+HTTWGLKM F+V+NG+GP+ES+LPPPSDLP C
Sbjct  237  FLHCHLEVHTTWGLKMVFVVDNGEGPDESLLPPPSDLPNC  276



>ref|XP_002280416.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI16002.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            + GV+TDDFPG P I FNYTGT P N QT NGT++YRL +NSTVQ+V+Q T +IAPE HP
Sbjct  397  MKGVYTDDFPGNPPIAFNYTGTQPTNFQTMNGTRLYRLAYNSTVQLVLQDTGMIAPERHP  456

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+V+G+GLGN++P+ DPKKFNL+DPVERNTV VP+ GWTAIRFRADNPGVWFM
Sbjct  457  VHLHGFNFFVIGRGLGNYNPKKDPKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWFM  516

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  517  HCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  554



>gb|KHG18161.1| Laccase-4 -like protein [Gossypium arboreum]
Length=556

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNYTGTPP N+QT+NGTKV+RL +NSTVQ+V+Q T IIAPE+H
Sbjct  398  NISGVFTTDFPSTPPHVFNYTGTPPKNLQTRNGTKVFRLAYNSTVQLVLQDTGIIAPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VGKGLGN++P+ DP+KFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  458  PIHLHGFNFFAVGKGLGNYNPKTDPQKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGPN+S+LPPPSDLPKC
Sbjct  518  MHCHLEVHTTWGLKMAFLVDNGKGPNQSLLPPPSDLPKC  556



>gb|KDP44830.1| hypothetical protein JCGZ_01330 [Jatropha curcas]
Length=475

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFTDDFP  P  PFNYTG     + T+NGT++YRL FNSTVQ+V+QGT IIAPESH
Sbjct  317  NIRGVFTDDFPATPPNPFNYTGNYTGGLATKNGTRLYRLSFNSTVQVVLQGTGIIAPESH  376

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG NF+VVG+G+GNFDP NDPKKFNL+DPVERNT SVPT GW AIRFRADNPGVWF
Sbjct  377  PFHLHGSNFFVVGRGVGNFDPVNDPKKFNLVDPVERNTDSVPTGGWAAIRFRADNPGVWF  436

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HT+WGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  437  MHCHLEVHTSWGLKMAFVVDNGKGPNESLLPPPSDLPKC  475



>ref|XP_010044087.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86093.1| hypothetical protein EUGRSUZ_B02794 [Eucalyptus grandis]
Length=556

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFPG PR  FNYTG+PP+N++T +GTKV+RL +NSTVQ+V+Q T IIAPE+H
Sbjct  398  NISGVFTSDFPGNPRTTFNYTGSPPSNLRTTSGTKVFRLHYNSTVQLVLQDTGIIAPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VGKGLGN++P+ D K FNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  458  PIHLHGFNFFTVGKGLGNYNPKVDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLEIHTTWGLKMAFLV+NGKGPNES+LPPPSDLPKC
Sbjct  518  MHCHLEIHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  556



>ref|XP_008358974.1| PREDICTED: laccase-4-like [Malus domestica]
Length=557

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFTDDFPG P  P+NYTGT   NMQT+ GT++YRL +N+TVQ+V+QGT ++APE+H
Sbjct  399  NXSGVFTDDFPGNPLNPYNYTGTQQTNMQTKKGTRLYRLAYNTTVQLVLQGTGMLAPETH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+P  DPK+FNL+DPVERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  459  PVHLHGFNFFEVGRGLGNFNPNTDPKRFNLVDPVERNTIGVPSNGWTAIRFRADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  519  MHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  557



>ref|XP_010104682.1| hypothetical protein L484_022065 [Morus notabilis]
 gb|EXC01488.1| hypothetical protein L484_022065 [Morus notabilis]
Length=556

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFPGKP +PFNYTGT P+N  T  GT++YRL +NSTVQ+V+Q T +I PE+H
Sbjct  398  NISGVFTDDFPGKPPVPFNYTGTQPSNFATTQGTRLYRLAYNSTVQLVLQDTGMITPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVGKGLGNF P  DPK FNL+DPVERNT+ VP+ GWTAIRF+ADNPGVWF
Sbjct  458  PIHLHGFNFFVVGKGLGNFHPNKDPKNFNLVDPVERNTIGVPSGGWTAIRFKADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNE++LPPP+DLPKC
Sbjct  518  MHCHLEVHTTWGLKMAFVVDNGKGPNETLLPPPTDLPKC  556



>ref|XP_010256659.1| PREDICTED: laccase-4 [Nelumbo nucifera]
Length=554

 Score =   276 bits (706),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFP  P I FNYTGT PAN+QT NGTK+YRL +N TVQ+V+Q T +IAPE+H
Sbjct  396  NISGVFTDDFPANPPISFNYTGTQPANLQTMNGTKLYRLRYNDTVQLVLQDTGMIAPENH  455

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGN++P+ DP KFNL+DP+ERNT+ VP+ GWT IRFRADNPGVWF
Sbjct  456  PVHLHGFNFFAVGRGLGNYNPKTDPAKFNLVDPIERNTIGVPSGGWTVIRFRADNPGVWF  515

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  516  MHCHLEVHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  554



>ref|XP_002322961.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
 gb|EEF04722.2| hypothetical protein POPTR_0016s11950g [Populus trichocarpa]
Length=557

 Score =   275 bits (704),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP KP   FNYTGTPP N+QT +GTK YRL +NSTVQ+V+Q T II+PE+H
Sbjct  399  NISGVFTTDFPAKPPHVFNYTGTPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GN++P+ DPKKFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  459  PIHLHGFNFFAVGRGVGNYNPKTDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGPNES+LPPPSDLPKC
Sbjct  519  MHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  557



>ref|XP_004308920.1| PREDICTED: laccase-22-like [Fragaria vesca subsp. vesca]
Length=556

 Score =   275 bits (702),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GV+T DFP KP  PF+YTGTPP N+Q  NGTK+YRLG+NSTVQIV+Q  +II PESH
Sbjct  398  NIKGVYTLDFPPKPPNPFDYTGTPPVNVQAANGTKLYRLGYNSTVQIVLQDIAIILPESH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGFNF+VVG GLGNFDP  D K FNL+DPVERNTVSVPT GWTAIRFRADNPG+WF
Sbjct  458  PTHLHGFNFFVVGTGLGNFDPDKDTKTFNLVDPVERNTVSVPTGGWTAIRFRADNPGIWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKMAFLV+NG+GPNES+ PPPSDLP C
Sbjct  518  LHCHLEVHTTWGLKMAFLVDNGEGPNESLTPPPSDLPAC  556



>ref|XP_002308208.2| laccase family protein [Populus trichocarpa]
 gb|EEE91731.2| laccase family protein [Populus trichocarpa]
Length=558

 Score =   275 bits (702),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP KP   FNYTGTPP N+QT++GTKVYRL +NSTVQ+V+Q T II+PE+H
Sbjct  400  NISGVFTTDFPAKPPHVFNYTGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GN++P+ D KKFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  460  PIHLHGFNFFAVGRGVGNYNPKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGP ES+LPPPSDLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPSDLPKC  558



>ref|XP_002308209.2| laccase family protein [Populus trichocarpa]
 gb|EEE91732.2| laccase family protein [Populus trichocarpa]
Length=559

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP KP   FNYTGTPP N+QT++GTKVYRL +NSTVQ+V+Q T II+PE+H
Sbjct  401  NISGVFTTDFPAKPPHVFNYTGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GN++P+ D KKFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  461  PIHLHGFNFFAVGRGVGNYNPKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGP ES+LPPPSDLPKC
Sbjct  521  MHCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPSDLPKC  559



>ref|XP_010262771.1| PREDICTED: laccase-4-like [Nelumbo nucifera]
Length=555

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFP  P I +NYTGT PAN+QT NGTKVYRL +N TVQ+V+Q T +IAPE+H
Sbjct  397  NISGVFTDDFPANPPIAYNYTGTQPANLQTINGTKVYRLRYNDTVQVVLQDTGMIAPENH  456

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGN++P+ DP KFNL+DP+ERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  457  PIHLHGFNFFAVGRGLGNYNPKKDPAKFNLVDPIERNTIGVPSGGWTAIRFRADNPGVWF  516

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKG N+S+LPPPSDLPKC
Sbjct  517  MHCHLEVHTTWGLKMAFVVDNGKGTNQSLLPPPSDLPKC  555



>ref|XP_006387495.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
 gb|ERP46409.1| hypothetical protein POPTR_0958s00200g [Populus trichocarpa]
Length=559

 Score =   275 bits (702),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP KP   FNYTGTPP N+QT++GTKVYRL +NSTVQ+V+Q T II+PE+H
Sbjct  401  NISGVFTTDFPAKPPHVFNYTGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GN++P+ D KKFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  461  PIHLHGFNFFAVGRGVGNYNPKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGP ES+LPPPSDLPKC
Sbjct  521  MHCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPSDLPKC  559



>ref|XP_004294236.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVFTDDFPG P +P+NYTG   P NMQT  GT++YRL +NSTVQ+V+Q T +IAPE+
Sbjct  402  NISGVFTDDFPGNPLMPYNYTGAQQPTNMQTMKGTRLYRLAYNSTVQLVLQDTGMIAPEN  461

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+ VG+GLGNF+ + DPK FNLIDPVERNTV VP+ GWTAIRFRADNPGVW
Sbjct  462  HPVHLHGFNFFEVGRGLGNFNSKTDPKIFNLIDPVERNTVGVPSGGWTAIRFRADNPGVW  521

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  522  FMHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  561



>ref|XP_010044090.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044092.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 ref|XP_010044093.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86096.1| hypothetical protein EUGRSUZ_B02797 [Eucalyptus grandis]
 gb|KCW86097.1| hypothetical protein EUGRSUZ_B02798 [Eucalyptus grandis]
 gb|KCW86098.1| hypothetical protein EUGRSUZ_B02799 [Eucalyptus grandis]
Length=556

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFPG P   FNYTG+PP N++T +GTKVYRL +NSTVQ+V+Q T IIAPE+H
Sbjct  398  NISGVFTSDFPGNPPTTFNYTGSPPTNLRTTSGTKVYRLRYNSTVQLVLQDTGIIAPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VGKGLGN++P+ D K FNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  458  PIHLHGFNFFAVGKGLGNYNPKVDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLEIHTTWGLKMAFLV+NGKGPNES+LPPPSDLPKC
Sbjct  518  MHCHLEIHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  556



>emb|CDY08537.1| BnaA05g27730D [Brassica napus]
Length=530

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/160 (80%), Positives = 142/160 (89%), Gaps = 4/160 (3%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTG----TPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            GVFTDDFPG+P  PF+YTG     P +N+QT+NGT+VYRL FN+TVQIVIQGTS+IAPES
Sbjct  371  GVFTDDFPGRPLTPFDYTGGNNSIPLSNLQTKNGTQVYRLEFNATVQIVIQGTSVIAPES  430

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HPTHLHG NF+VVGKGLGNFDP  DPKKFNL+DPVERNTVSVPTAGWTAIRF ADNPGVW
Sbjct  431  HPTHLHGSNFFVVGKGLGNFDPLMDPKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVW  490

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F HCHLE+HT+WGLKMAFLVE+GK  NE + PPPSDLPKC
Sbjct  491  FFHCHLEVHTSWGLKMAFLVEDGKDSNEKLPPPPSDLPKC  530



>ref|XP_011003662.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=557

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP KP   FNYTGTPP N+QT +GTK YRL +NSTVQ+V+Q T II+PE+H
Sbjct  399  NISGVFTTDFPAKPPHVFNYTGTPPTNLQTTSGTKAYRLPYNSTVQLVMQDTGIISPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG G+GN++P+ DPKKFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  459  PIHLHGFNFFAVGGGVGNYNPKTDPKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGPNES+LPPPSDLPKC
Sbjct  519  MHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  557



>gb|KDO37344.1| hypothetical protein CISIN_1g009854mg [Citrus sinensis]
Length=524

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GVFTDDFPG P + +N+TGT PAN QT NGT++YRL +NSTVQ+V+Q T +IAPE+HP
Sbjct  367  IGGVFTDDFPGNPPVTYNFTGTQPANFQTNNGTRIYRLPYNSTVQLVLQDTGMIAPENHP  426

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+ VG+GLGNF+ + DPKKFNL+DPVERNT+ VP+ GWTAIRFRADNPGVWFM
Sbjct  427  LHLHGFNFFEVGRGLGNFNSKKDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFM  486

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  487  HCHLEVHTTWGLKMAFIVDNGKGPNESLLPPPSDLPKC  524



>emb|CDY01010.1| BnaC05g41900D [Brassica napus]
Length=559

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/160 (81%), Positives = 143/160 (89%), Gaps = 4/160 (3%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTG----TPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            GVFTDDFPG+P  PF+YTG     P +N+QT+NGT+VYRL FN+TVQIVIQGTS+IAPES
Sbjct  400  GVFTDDFPGRPLTPFDYTGGNKSIPLSNLQTKNGTQVYRLEFNATVQIVIQGTSVIAPES  459

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HPTHLHG NF+VVGKGLGNFDP  DPKKFNL+DPVERNTVSVPTAGWTAIRF ADNPGVW
Sbjct  460  HPTHLHGSNFFVVGKGLGNFDPLMDPKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVW  519

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F HCHLE+HT+WGLKMAFLVE+GKG NE + PPPSDLPKC
Sbjct  520  FFHCHLEVHTSWGLKMAFLVEDGKGSNEKLPPPPSDLPKC  559



>ref|XP_011019150.1| PREDICTED: laccase-4 isoform X1 [Populus euphratica]
Length=559

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP KP   FNY+GTPP N+QT++GTKVYRL +NSTVQ+V+Q T II+PE+H
Sbjct  401  NISGVFTTDFPAKPPHVFNYSGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GN++P+ D KKFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  461  PIHLHGFNFFAVGRGVGNYNPKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGP ES+LPPPSDLPKC
Sbjct  521  MHCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPSDLPKC  559



>ref|XP_011019151.1| PREDICTED: laccase-4 isoform X2 [Populus euphratica]
Length=558

 Score =   273 bits (699),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP KP   FNY+GTPP N+QT++GTKVYRL +NSTVQ+V+Q T II+PE+H
Sbjct  400  NISGVFTTDFPAKPPHVFNYSGTPPTNLQTKSGTKVYRLSYNSTVQLVMQDTGIISPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GN++P+ D KKFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  460  PIHLHGFNFFAVGRGVGNYNPKTDTKKFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGP ES+LPPPSDLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPSDLPKC  558



>ref|XP_007026782.1| Laccase/Diphenol oxidase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY07284.1| Laccase/Diphenol oxidase family protein isoform 2 [Theobroma 
cacao]
Length=490

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNY+GTPP N+QT NGTKV+RL +NSTVQ+V+Q T IIAPE+H
Sbjct  332  NISGVFTTDFPANPPNVFNYSGTPPTNLQTTNGTKVFRLAYNSTVQLVLQDTGIIAPENH  391

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGN++P+ DP+ FNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  392  PIHLHGFNFFAVGRGLGNYNPKTDPQNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  451

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKMAFLV+NGKGPN+S+LPPPSDLPKC
Sbjct  452  LHCHLEVHTTWGLKMAFLVDNGKGPNQSLLPPPSDLPKC  490



>emb|CAA74102.1| laccase [Populus trichocarpa]
Length=437

 Score =   270 bits (689),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPA-NMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            +ISGVFTDDFP  P   FNYTG   A N+QT NGT+ YRL FNSTVQ+V+QGT+IIAPES
Sbjct  278  SISGVFTDDFPAMPPNSFNYTGNNTALNLQTINGTRTYRLAFNSTVQLVLQGTTIIAPES  337

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVGKG GNFD  NDPKKFNL DPVERNT+SVPTAGW AIRFRADNPGVW
Sbjct  338  HPFHLHGFNFFVVGKGFGNFDADNDPKKFNLADPVERNTISVPTAGWAAIRFRADNPGVW  397

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCHLE+HTTWGLKM F+V+NG+GP+ES+LPPPSDLP C
Sbjct  398  FLHCHLEVHTTWGLKMVFVVDNGEGPDESLLPPPSDLPNC  437



>ref|XP_006425016.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
 ref|XP_006488481.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR38256.1| hypothetical protein CICLE_v10028117mg [Citrus clementina]
Length=557

 Score =   273 bits (698),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GVFTDDFPG P + +N+TGT PAN QT NGT++YRL +NSTVQ+V+Q T +IAPE+HP
Sbjct  400  IGGVFTDDFPGNPPVTYNFTGTQPANFQTNNGTRIYRLPYNSTVQLVLQDTGMIAPENHP  459

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+ VG+GLGNF+ + DPKKFNL+DPVERNT+ VP+ GWTAIRFRADNPGVWFM
Sbjct  460  LHLHGFNFFEVGRGLGNFNSKKDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFM  519

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  520  HCHLEVHTTWGLKMAFIVDNGKGPNESLLPPPSDLPKC  557



>ref|XP_002322962.2| laccase family protein [Populus trichocarpa]
 gb|EEF04723.2| laccase family protein [Populus trichocarpa]
Length=564

 Score =   273 bits (697),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP KP   FNYTGTPP N+QT +GTKVYRL +NSTV++V+Q T II+PE+H
Sbjct  406  NISGVFTTDFPSKPPHVFNYTGTPPTNLQTTSGTKVYRLRYNSTVELVMQDTGIISPENH  465

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GN++P+ DPKKFNL+DPVERNT+ VP+ GW AIRFR DNPGVWF
Sbjct  466  PIHLHGFNFFGVGRGVGNYNPKTDPKKFNLVDPVERNTIGVPSGGWVAIRFRVDNPGVWF  525

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGPNES+LPPPSDLPKC
Sbjct  526  MHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  564



>ref|XP_010104683.1| hypothetical protein L484_022066 [Morus notabilis]
 gb|EXC01489.1| hypothetical protein L484_022066 [Morus notabilis]
Length=556

 Score =   272 bits (696),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFPGKP +PFNYTGT P+N  T  GT++YRL + STVQ+V+Q T +I PE+H
Sbjct  398  NISGVFTDDFPGKPPVPFNYTGTQPSNFATTQGTRLYRLAYKSTVQLVLQDTGMITPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVGKGLGNF+P  D K FNL+DPVERNT+ VP+ GWTAIRF+ADNPGVWF
Sbjct  458  PIHLHGFNFFVVGKGLGNFNPNKDQKNFNLVDPVERNTIGVPSGGWTAIRFKADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPP DLPKC
Sbjct  518  MHCHLEVHTTWGLKMAFVVDNGKGPNESLLPPPIDLPKC  556



>ref|XP_011039810.1| PREDICTED: laccase-4-like [Populus euphratica]
Length=556

 Score =   272 bits (696),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPA-NMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            +ISGVFTDDFP  P   FNYTG   A N+QT NGT++YRL FNSTVQ+V+QGT+IIAPES
Sbjct  397  SISGVFTDDFPAMPPNSFNYTGNNTALNLQTNNGTRIYRLAFNSTVQLVLQGTTIIAPES  456

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVGKG GNFD  NDPKKFNL DPVERNT+SVPTAGW AIRFRADNPGVW
Sbjct  457  HPFHLHGFNFFVVGKGFGNFDADNDPKKFNLADPVERNTISVPTAGWAAIRFRADNPGVW  516

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCHLE+HTTWGLKM F+V+NG+GP+ES+LPPPSDLP C
Sbjct  517  FLHCHLEVHTTWGLKMVFVVDNGEGPDESLLPPPSDLPNC  556



>ref|XP_003539958.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN07789.1| Laccase-4 [Glycine soja]
Length=556

 Score =   272 bits (695),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GVFTDDFPG P + +N+TGT P+N++T  GT+VYRL +NSTVQ+V+Q T +I PE+HP
Sbjct  399  IKGVFTDDFPGNPPVVYNFTGTQPSNLKTMKGTRVYRLAYNSTVQLVLQDTGMITPENHP  458

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+VVG+G GNF+P  DPKKFNL+DPVERNTV VP  GWTAIRFRADNPGVWFM
Sbjct  459  IHLHGFNFFVVGRGQGNFNPTKDPKKFNLVDPVERNTVGVPAGGWTAIRFRADNPGVWFM  518

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLEIHTTWGLKMAF+V+NGKGPNES+LPPP+DLPKC
Sbjct  519  HCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPTDLPKC  556



>gb|KHG11130.1| Laccase-4 -like protein [Gossypium arboreum]
Length=503

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNY+GTPP N++T  GTKV+RL +NSTVQ+V+Q T IIAPE+H
Sbjct  345  NISGVFTTDFPANPPHKFNYSGTPPTNLKTMTGTKVFRLAYNSTVQLVLQDTGIIAPENH  404

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VGKGLGN++P+ DP+ FNL+DPVERNT+ VP  GW AIRFRADNPGVWF
Sbjct  405  PIHLHGFNFFSVGKGLGNYNPKTDPQNFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWF  464

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+S++PPPSDLPKC
Sbjct  465  MHCHLEVHTTWGLKMAFLVENGKGPNQSLVPPPSDLPKC  503



>ref|XP_011032153.1| PREDICTED: laccase-4-like isoform X1 [Populus euphratica]
Length=523

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFP  P  PFNYTGT P N QT NGTK+YRL +N+TVQ+V+Q T ++ PE+H
Sbjct  365  NISGVFTDDFPANPPTPFNYTGTQPTNFQTVNGTKLYRLAYNNTVQLVLQDTGMLTPENH  424

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GNFDP  DPKKFNL+DPVERNT+ VP  GWTAIRF ADNPGVWF
Sbjct  425  PIHLHGFNFFEVGRGVGNFDPNKDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWF  484

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPP DLPKC
Sbjct  485  MHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPPDLPKC  523



>ref|XP_010041000.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW44721.1| hypothetical protein EUGRSUZ_L01734 [Eucalyptus grandis]
Length=556

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFPG PR  FNYTG+PP+N++T +GTKV+RL +NSTVQ+V+Q T IIAPE+H
Sbjct  398  NISGVFTSDFPGNPRTTFNYTGSPPSNLRTTSGTKVFRLHYNSTVQLVLQDTGIIAPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VGKGLGN++P+ D K FNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  458  PIHLHGFNFFTVGKGLGNYNPKVDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLEIHTTWGLKMAFLV+NGKGPNES+ PPP+DLPKC
Sbjct  518  MHCHLEIHTTWGLKMAFLVDNGKGPNESLPPPPNDLPKC  556



>ref|XP_006429309.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
 ref|XP_006480970.1| PREDICTED: laccase-4-like [Citrus sinensis]
 gb|ESR42549.1| hypothetical protein CICLE_v10011400mg [Citrus clementina]
Length=555

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFPG P   +N+TGTP  N+QT NGTK YRL +NSTVQ+++Q T IIAPE+H
Sbjct  398  NISGVFTTDFPGNPPHTYNFTGTP-KNLQTSNGTKAYRLAYNSTVQLILQDTGIIAPENH  456

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VGKGLGNF+P+ DPKKFNL+DPVERNT+ VP+ GW AIRF ADNPGVWF
Sbjct  457  PVHLHGFNFFAVGKGLGNFNPKKDPKKFNLVDPVERNTIGVPSGGWVAIRFSADNPGVWF  516

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGPNES+LPPPSDLPKC
Sbjct  517  MHCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  555



>ref|XP_007026781.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY07283.1| Laccase/Diphenol oxidase family protein isoform 1 [Theobroma 
cacao]
Length=556

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNY+GTPP N+QT NGTKV+RL +NSTVQ+V+Q T IIAPE+H
Sbjct  398  NISGVFTTDFPANPPNVFNYSGTPPTNLQTTNGTKVFRLAYNSTVQLVLQDTGIIAPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGN++P+ DP+ FNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  458  PIHLHGFNFFAVGRGLGNYNPKTDPQNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKMAFLV+NGKGPN+S+LPPPSDLPKC
Sbjct  518  LHCHLEVHTTWGLKMAFLVDNGKGPNQSLLPPPSDLPKC  556



>ref|XP_011035200.1| PREDICTED: laccase-4 [Populus euphratica]
Length=556

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFTDDFPG P  PFNYTGT P N QT NGTK+YRL +NSTVQ+V+Q T ++ PE+H
Sbjct  398  NIKGVFTDDFPGNPPTPFNYTGTQPTNFQTVNGTKLYRLAYNSTVQLVLQDTGMLTPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GNF+P+ DPKKFNL+DPVERNT+ VP  GWTAIRF ADNPGVWF
Sbjct  458  PIHLHGFNFFEVGRGIGNFNPKRDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPP DLPKC
Sbjct  518  MHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPPDLPKC  556



>ref|XP_011032154.1| PREDICTED: laccase-4-like isoform X2 [Populus euphratica]
Length=556

 Score =   271 bits (694),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFP  P  PFNYTGT P N QT NGTK+YRL +N+TVQ+V+Q T ++ PE+H
Sbjct  398  NISGVFTDDFPANPPTPFNYTGTQPTNFQTVNGTKLYRLAYNNTVQLVLQDTGMLTPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GNFDP  DPKKFNL+DPVERNT+ VP  GWTAIRF ADNPGVWF
Sbjct  458  PIHLHGFNFFEVGRGVGNFDPNKDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPP DLPKC
Sbjct  518  MHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPPDLPKC  556



>ref|XP_010044089.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86095.1| hypothetical protein EUGRSUZ_B02796 [Eucalyptus grandis]
Length=556

 Score =   271 bits (692),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFT DFPG P   FNYTG+PP+N++T +GTKVYRL +NSTVQ+V+Q T IIAPE+H
Sbjct  398  NKSGVFTSDFPGNPPTIFNYTGSPPSNLRTTSGTKVYRLRYNSTVQLVLQDTGIIAPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ +GKGLGN++P+ D K FNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  458  PIHLHGFNFFAIGKGLGNYNPKVDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLEIHTTWGLKMAFLV+NGKGPNES+LPPPSDLPKC
Sbjct  518  MHCHLEIHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  556



>ref|XP_007142229.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
 gb|ESW14223.1| hypothetical protein PHAVU_008G263100g [Phaseolus vulgaris]
Length=555

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVFTDDFP KP + +++TGT  PAN++T  GT+VYRL +NSTVQ+V+Q T +I PE+
Sbjct  396  NISGVFTDDFPRKPSVVYDFTGTQQPANLRTNRGTRVYRLAYNSTVQLVLQDTGMITPEN  455

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVG+G GNF+P+ D KKFNL+DPVERNTV VP+ GWTAIRFRADNPGVW
Sbjct  456  HPVHLHGFNFFVVGRGQGNFNPKRDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVW  515

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLEIHTTWGLKMAFLV+NGKGPNESILPPP DLPKC
Sbjct  516  FMHCHLEIHTTWGLKMAFLVDNGKGPNESILPPPIDLPKC  555



>ref|XP_011077581.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=557

 Score =   270 bits (691),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFT DFPG P   FNYTG+PPAN+ T NGTK+YRL +N+TVQ+V+Q T IIAPE+H
Sbjct  399  NIKGVFTTDFPGNPPFAFNYTGSPPANLGTTNGTKLYRLPYNATVQVVLQDTGIIAPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+GLGNF+P+ DPK FNL+DPVERNT+ VP+ GW AIRF ADNPGVWF
Sbjct  459  PIHLHGFNFFVVGRGLGNFNPKTDPKTFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGPNE +LPPP DLPKC
Sbjct  519  MHCHLEVHTTWGLKMAFLVDNGKGPNEVLLPPPKDLPKC  557



>ref|XP_002520425.1| laccase, putative [Ricinus communis]
 gb|EEF41838.1| laccase, putative [Ricinus communis]
Length=556

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFP  P + +NYTGT P N QT  GT++YRL +NSTVQ+V+Q T +I PE+H
Sbjct  398  NISGVFTDDFPSNPPVSYNYTGTQPTNFQTTTGTRLYRLAYNSTVQLVLQDTGMITPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GNF+P+ DPK FNL+DPVERNT  VP+ GWTAIRFRADNPGVWF
Sbjct  458  PIHLHGFNFFQVGRGVGNFNPKKDPKNFNLVDPVERNTAGVPSGGWTAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  518  MHCHLEVHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  556



>ref|XP_010494695.1| PREDICTED: laccase-22-like [Camelina sativa]
Length=554

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 140/157 (89%), Gaps = 1/157 (1%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPT  577
             GVFTDDFPGKP  PFNYTG   +N++T+NGTKVYRL FN+TVQ++IQGTS+IAPESHPT
Sbjct  399  EGVFTDDFPGKPSTPFNYTGGL-SNLRTENGTKVYRLEFNATVQVIIQGTSVIAPESHPT  457

Query  576  HLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMH  397
            HLHG NF+V+GKGLGNFDP  DPKKFNL+DPVERNTVSVPTAGWTAIRF ADNPGVWF H
Sbjct  458  HLHGSNFFVIGKGLGNFDPLKDPKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVWFFH  517

Query  396  CHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            CHLE+HT+WGLKMAFLVE+G G NE + PPPSDLP C
Sbjct  518  CHLEVHTSWGLKMAFLVEDGNGSNEKLPPPPSDLPIC  554



>ref|XP_008775059.1| PREDICTED: laccase-22-like [Phoenix dactylifera]
Length=554

 Score =   270 bits (690),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVF DDFPGKP I FNYTG  P NMQT +GT+VYRL FNSTVQ+V+Q T IIAPE+H
Sbjct  396  NISGVFADDFPGKPPIAFNYTGGGPKNMQTMSGTRVYRLAFNSTVQLVLQDTGIIAPENH  455

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGN++P   P KFNL+DPVERNT+ VP+ GWTAIRF+ADNPGVWF
Sbjct  456  PIHLHGFNFFAVGRGLGNYNPNTSPSKFNLVDPVERNTIGVPSGGWTAIRFQADNPGVWF  515

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NG+GPNES++PPP+DLP C
Sbjct  516  MHCHLEVHTTWGLKMAFVVDNGEGPNESLIPPPNDLPPC  554



>ref|XP_004490574.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=570

 Score =   270 bits (691),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFP KP   +++TG  P+N++T  GT+VYRL +NSTVQ+V+Q T +IAPE+H
Sbjct  412  NISGVFTDDFPEKPPRVYDFTGKQPSNLRTNKGTRVYRLAYNSTVQLVLQDTGMIAPENH  471

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVGKG GNF+ + DPKKFNL+DPVERNTV VP+ GWTAIRFRADNPGVWF
Sbjct  472  PIHLHGFNFFVVGKGKGNFNSKKDPKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWF  531

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  532  MHCHLEVHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  570



>ref|XP_003544873.2| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN40048.1| Laccase-4 [Glycine soja]
Length=557

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 143/160 (89%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVFTDDFPGKP + +++TGT  P N++T  GT+VYRL +NSTVQ+V+Q T +I PE+
Sbjct  398  NISGVFTDDFPGKPPVVYDFTGTQQPTNLRTNRGTRVYRLAYNSTVQLVLQDTGMITPEN  457

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVG+G GNF+P+ D KKFNL+DPVERNTV VP+ GWTAIRFRADNPGVW
Sbjct  458  HPIHLHGFNFFVVGRGQGNFNPKKDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVW  517

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLEIHTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  518  FMHCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  557



>gb|AES99522.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=529

 Score =   269 bits (688),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 143/160 (89%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGT-PPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NI GVFTDDFP KP + F+YTGT  PAN+ T NGTKVYRL FNS+VQIV+QGT++IAPE+
Sbjct  370  NIKGVFTDDFPSKPPMVFDYTGTDQPANLHTDNGTKVYRLNFNSSVQIVLQGTAMIAPEN  429

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVG+GLGNFDP+ DP +FNL+DP+ERNT+SVP  GW AIRFRADNPGVW
Sbjct  430  HPFHLHGFNFFVVGQGLGNFDPEKDPLRFNLVDPIERNTLSVPNNGWIAIRFRADNPGVW  489

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCHLE+HTTWGLKMAF+V+NG+GP+ESILPPP DLP C
Sbjct  490  FLHCHLEVHTTWGLKMAFIVDNGRGPSESILPPPKDLPIC  529



>ref|XP_002311202.1| laccase family protein [Populus trichocarpa]
 gb|EEE88569.1| laccase family protein [Populus trichocarpa]
Length=556

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPA-NMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            +ISGVFTDDFP  P   FNYTG   A N+QT NGT+ YRL FNSTVQ+V+QGT+IIAPES
Sbjct  397  SISGVFTDDFPAMPPNSFNYTGNNTALNLQTINGTRTYRLAFNSTVQLVLQGTTIIAPES  456

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVGKG GNFD  NDPKKFNL DPVERNT+SVPTAGW AIRFRADNPGVW
Sbjct  457  HPFHLHGFNFFVVGKGFGNFDADNDPKKFNLADPVERNTISVPTAGWAAIRFRADNPGVW  516

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCHLE+HTTWGLKM F+V+NG+GP+ES+LPPPSDLP C
Sbjct  517  FLHCHLEVHTTWGLKMVFVVDNGEGPDESLLPPPSDLPNC  556



>ref|XP_007146741.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
 gb|ESW18735.1| hypothetical protein PHAVU_006G065800g [Phaseolus vulgaris]
Length=556

 Score =   270 bits (690),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GVFTDDFPG P + +N+TGT P+N+ T NGT++YRL +NSTVQ+V+Q T ++ PE+HP
Sbjct  399  IKGVFTDDFPGNPPVFYNFTGTQPSNLNTVNGTRLYRLAYNSTVQLVLQDTGMLTPENHP  458

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+VVG+G GNF+P  DPKKFNL+DPVERNTV VP  GWTAIRFRADNPGVWFM
Sbjct  459  IHLHGFNFFVVGRGQGNFNPTKDPKKFNLVDPVERNTVGVPAGGWTAIRFRADNPGVWFM  518

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLEIHTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  519  HCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  556



>ref|XP_006300062.1| hypothetical protein CARUB_v10016290mg [Capsella rubella]
 gb|EOA32960.1| hypothetical protein CARUB_v10016290mg [Capsella rubella]
Length=548

 Score =   270 bits (689),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPT  577
             GVFTDDFPG+P  PFNYTG    N++T+ GTKVYRL FNSTVQ++IQGTS+IAPESHPT
Sbjct  393  EGVFTDDFPGRPLTPFNYTGGL-NNLRTKKGTKVYRLEFNSTVQVIIQGTSVIAPESHPT  451

Query  576  HLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMH  397
            HLHG NF+VVGKGLGNFDP  DPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF H
Sbjct  452  HLHGSNFFVVGKGLGNFDPLEDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFFH  511

Query  396  CHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            CHLE+HT+WGLKMAFLVE+GK  NE + PPPSDLP C
Sbjct  512  CHLEVHTSWGLKMAFLVEDGKSSNEKLPPPPSDLPIC  548



>ref|XP_002299828.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
 gb|EEE84633.2| hypothetical protein POPTR_0001s25580g [Populus trichocarpa]
Length=557

 Score =   270 bits (689),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFTDDFPG P  PFNYTGT P N QT NGTK+YRL +NSTVQ+V+Q T ++ PE+H
Sbjct  399  NIKGVFTDDFPGNPPTPFNYTGTQPKNFQTVNGTKLYRLAYNSTVQLVLQDTGMLTPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GNF+P+ DPKKFNL DPVERNT+ VP  GWTAIRF ADNPGVWF
Sbjct  459  PVHLHGFNFFEVGRGIGNFNPKRDPKKFNLADPVERNTIGVPAGGWTAIRFIADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPP DLPKC
Sbjct  519  MHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPPDLPKC  557



>ref|XP_010044088.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW86094.1| hypothetical protein EUGRSUZ_B02795 [Eucalyptus grandis]
Length=556

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFT DFPG P   FNYTG+PP+N++T +GTKVYRL +NSTVQ+V+Q T IIAPE+H
Sbjct  398  NKSGVFTSDFPGNPPTIFNYTGSPPSNLRTTSGTKVYRLRYNSTVQLVLQDTGIIAPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ +GKGLGN++P+ D K FNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  458  PIHLHGFNFFAIGKGLGNYNPKVDQKNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLEIHTTWGLKMAFLV+NGKGP+ES+LPPPSDLPKC
Sbjct  518  MHCHLEIHTTWGLKMAFLVDNGKGPSESLLPPPSDLPKC  556



>ref|XP_002314124.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
 gb|EEE88079.1| hypothetical protein POPTR_0009s04720g [Populus trichocarpa]
Length=556

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFP  P  PFNYTGT P N QT  GTK+YRL +N+TVQ+V+Q T ++ PE+H
Sbjct  398  NISGVFTDDFPANPPTPFNYTGTQPTNFQTVKGTKLYRLAYNNTVQLVLQDTGMLTPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GNFDP  DPKKFNL+DPVERNT+ VP  GWTAIRF ADNPGVWF
Sbjct  458  PVHLHGFNFFEVGRGVGNFDPNKDPKKFNLVDPVERNTIGVPAGGWTAIRFIADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPP DLPKC
Sbjct  518  MHCHLEVHTTWGLKMAFVVDNGKGPNESVLPPPPDLPKC  556



>ref|XP_008449180.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=556

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI+GVFT DFP  P   FNYTG+ P+N+QT  GTK+Y+L FNSTV++V+Q T IIA E+H
Sbjct  398  NINGVFTTDFPANPPHVFNYTGSGPSNLQTTRGTKLYKLKFNSTVELVLQDTGIIAAENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G+GN+D +NDPK FNL+DPVERNTV VP+ GWTAIRFRADNPGVWF
Sbjct  458  PIHLHGFNFFVVGRGIGNYDAKNDPKSFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPNESI+PPP DLPKC
Sbjct  518  MHCHLEVHTTWGLKMAFLVENGKGPNESIIPPPKDLPKC  556



>ref|XP_009146739.1| PREDICTED: laccase-22-like [Brassica rapa]
Length=560

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 142/160 (89%), Gaps = 4/160 (3%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTG----TPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            GVFT+DFPG+P  PF+YTG     P +N+QT+NGT+VYRL FN+TVQIVIQGTS+IAPES
Sbjct  401  GVFTNDFPGRPLTPFDYTGGNNSIPLSNLQTKNGTQVYRLEFNATVQIVIQGTSVIAPES  460

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HPTHLHG NF+VVGKGLGNFDP  DPKKFNL+DPVERNTVSVPTAGWTAIRF ADNPGVW
Sbjct  461  HPTHLHGSNFFVVGKGLGNFDPLMDPKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVW  520

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F HCHLE+HT+WGLKMAFLVE+GK  NE + PPPSDLPKC
Sbjct  521  FFHCHLEVHTSWGLKMAFLVEDGKYSNEKLPPPPSDLPKC  560



>ref|XP_009799024.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=557

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GVFT DFP  P   FNYTGT PAN+ T NGTKVYRL +N TVQ+V+Q T IIAPE+HP
Sbjct  400  IKGVFTTDFPANPPFAFNYTGTGPANLATTNGTKVYRLRYNDTVQLVLQDTGIIAPENHP  459

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNFY+VGKG+GNF+P+ DPK FNL+DPVERNTV VP  GW AIRFRADNPGVWFM
Sbjct  460  IHLHGFNFYLVGKGIGNFNPKTDPKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFM  519

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLEIHTTWGLKMA+LV+NGKGPNES+LPPP DLPKC
Sbjct  520  HCHLEIHTTWGLKMAWLVDNGKGPNESLLPPPKDLPKC  557



>ref|XP_011094977.1| PREDICTED: laccase-4-like [Sesamum indicum]
Length=558

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GVFT DFP  P   FNYTGTPPAN+ T  GTKVY+L +NSTVQ+V+Q T IIAPE+HP
Sbjct  401  IKGVFTTDFPANPPFAFNYTGTPPANLATTTGTKVYKLPYNSTVQVVLQDTGIIAPENHP  460

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+ VG+GLGNF+P+ DPK FNLIDPVERNT+ VP+ GW AIRF ADNPGVWFM
Sbjct  461  VHLHGFNFFAVGRGLGNFNPKTDPKNFNLIDPVERNTIGVPSGGWVAIRFLADNPGVWFM  520

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAFLVENG GPNESILPPP DLPKC
Sbjct  521  HCHLEVHTTWGLKMAFLVENGNGPNESILPPPKDLPKC  558



>ref|XP_009416212.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=562

 Score =   269 bits (687),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFTDDFPG+P I FNYTG+ P+NMQT NGT++YRL FN++VQ+V+Q T +I PESH
Sbjct  404  NTSGVFTDDFPGQPPIAFNYTGSGPSNMQTMNGTRLYRLSFNASVQLVLQDTGVIGPESH  463

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG+NF+VVG+G+GN+DP+  P KFNL+DPVERNT+ VPT GWTAIRFRADNPGVWF
Sbjct  464  PIHLHGYNFFVVGRGVGNYDPKTSPSKFNLVDPVERNTIGVPTGGWTAIRFRADNPGVWF  523

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCH E+HT+WGLKMAF+V++GKG NES+LPPPSD P C
Sbjct  524  LHCHFEVHTSWGLKMAFVVDDGKGTNESLLPPPSDFPAC  562



>ref|XP_008457399.1| PREDICTED: laccase-4 [Cucumis melo]
Length=562

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFTDDFP  P I ++YTG  P+NMQT  GT++YRL +NSTVQ+V+Q T++IAPE+H
Sbjct  404  NIDGVFTDDFPANPPIRYDYTGKQPSNMQTTKGTRLYRLAYNSTVQLVLQDTAMIAPENH  463

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG GLGNF+ + DP+KFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  464  PVHLHGFNFFVVGSGLGNFNHKKDPEKFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWF  523

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NG+GP ES+LPPPSDLPKC
Sbjct  524  MHCHLEVHTTWGLKMAFVVDNGRGPEESLLPPPSDLPKC  562



>ref|XP_010685615.1| PREDICTED: laccase-4 [Beta vulgaris subsp. vulgaris]
Length=560

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N+SGVFT DFP KP IPFNYTG    N+ T  GTKVYRL +N+TVQ+V+Q T++IAPE+H
Sbjct  402  NLSGVFTADFPSKPVIPFNYTGNQVTNLGTTTGTKVYRLPYNATVQLVLQDTAMIAPENH  461

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+GLGN++P+ DPKKFNL+DPVERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  462  PFHLHGFNFFVVGRGLGNYNPKEDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWF  521

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLEIHTTWGLKMAFLV+NGKG NES+LPPP+D PKC
Sbjct  522  LHCHLEIHTTWGLKMAFLVDNGKGLNESLLPPPTDFPKC  560



>ref|XP_002530417.1| laccase, putative [Ricinus communis]
 gb|EEF31987.1| laccase, putative [Ricinus communis]
Length=554

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFP  P  PFNYTG       T NGT++YRL FNSTVQ+V+QGT I+APESH
Sbjct  396  NISGVFTDDFPANPPTPFNYTGNYTGGFATSNGTRLYRLAFNSTVQVVLQGTGILAPESH  455

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ +G+G+GN+DP NDPKKFNL+DPVERNT SVPT GW AIRFRADNPGVWF
Sbjct  456  PFHLHGFNFFAIGRGVGNYDPVNDPKKFNLVDPVERNTNSVPTGGWVAIRFRADNPGVWF  515

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HT+WGLKMAF+V+NG+GPN+SI+PPP DLPKC
Sbjct  516  LHCHLEVHTSWGLKMAFVVDNGEGPNDSIIPPPKDLPKC  554



>ref|XP_003551299.1| PREDICTED: laccase-4-like [Glycine max]
Length=556

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GVFTDDFPG P + +N+TGT P+N++T  GT+VYRL +NSTVQ+V+Q T +I PE+HP
Sbjct  399  IKGVFTDDFPGNPPVVYNFTGTQPSNLRTMKGTRVYRLAYNSTVQLVLQDTGMITPENHP  458

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+VVG+G  NF+P  DPKKFNL+DPVERNTV VP  GWTAIRFR DNPGVWFM
Sbjct  459  IHLHGFNFFVVGRGQRNFNPTKDPKKFNLVDPVERNTVGVPAGGWTAIRFRTDNPGVWFM  518

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLEIHTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  519  HCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  556



>gb|KHN06247.1| Laccase-4 [Glycine soja]
Length=556

 Score =   268 bits (685),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GVFTDDFPG P + +N+TGT P+N++T  GT+VYRL +NSTVQ+V+Q T +I PE+HP
Sbjct  399  IKGVFTDDFPGNPPVVYNFTGTQPSNLRTMKGTRVYRLAYNSTVQLVLQDTGMITPENHP  458

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+VVG+G  NF+P  DPKKFNL+DPVERNTV VP  GWTAIRFR DNPGVWFM
Sbjct  459  IHLHGFNFFVVGRGQRNFNPTKDPKKFNLVDPVERNTVGVPAGGWTAIRFRTDNPGVWFM  518

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLEIHTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  519  HCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  556



>ref|XP_003518300.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN46170.1| Laccase-4 [Glycine soja]
Length=557

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVF DDFPGKP + +++TGT  P N++T  GT+VYRL +NSTVQ+V+Q T +I PE+
Sbjct  398  NISGVFIDDFPGKPPVVYDFTGTQQPTNLRTNRGTRVYRLAYNSTVQLVLQDTGMITPEN  457

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVG+G GNF+P+ D KKFNL+DPVERNTV VP+ GWTAIRFRADNPGVW
Sbjct  458  HPLHLHGFNFFVVGRGQGNFNPKKDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVW  517

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLEIHTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  518  FMHCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  557



>ref|XP_008239590.1| PREDICTED: laccase-4-like [Prunus mume]
Length=559

 Score =   268 bits (685),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 141/161 (88%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPAN--MQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NISGVFT DFPG P   FN++G PPAN  M T NGTK+YRL +NSTVQ+V+Q T  IAPE
Sbjct  399  NISGVFTTDFPGNPPNTFNFSGGPPANASMATTNGTKLYRLAYNSTVQLVLQDTGTIAPE  458

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNFY VG+G+GN++P+ DPKKFNL+DPVERNTV VP+ GW AIRF+ADNPGV
Sbjct  459  NHPVHLHGFNFYSVGRGVGNYNPKKDPKKFNLVDPVERNTVGVPSGGWAAIRFQADNPGV  518

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WF+HCHLE+HTTWGLKMAFLV+NGKGPNESILPPPSDLPKC
Sbjct  519  WFLHCHLEVHTTWGLKMAFLVDNGKGPNESILPPPSDLPKC  559



>gb|AES98533.2| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=558

 Score =   268 bits (684),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISG+FTDDFP KP I +++TG   P+N +T  GT+VYRL +NSTVQ+++Q T +IAPE+
Sbjct  399  NISGIFTDDFPRKPEIVYDFTGNKQPSNFRTNKGTRVYRLAYNSTVQLILQDTGMIAPEN  458

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVGKG GNF+P+ D KKFNL+DPVERNTV VP+ GWTAIRFRADNPGVW
Sbjct  459  HPIHLHGFNFFVVGKGQGNFNPKKDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVW  518

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLEIHTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  519  FMHCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  558



>ref|XP_002278638.1| PREDICTED: laccase-4 [Vitis vinifera]
 emb|CBI30423.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   268 bits (684),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 141/159 (89%), Gaps = 1/159 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGV+T DFP  P + FNYTG+P AN+QT NGTKVYR+ +NSTVQ+V+Q T IIA E+H
Sbjct  399  NISGVYTTDFPANPPVAFNYTGSP-ANLQTTNGTKVYRVPYNSTVQVVLQDTGIIATENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VGKGLGN++P+ DP+ FNLIDPVERNT+ VP+ GWTAIRF ADNPGVWF
Sbjct  458  PVHLHGFNFFAVGKGLGNYNPKTDPQNFNLIDPVERNTIGVPSGGWTAIRFLADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGPN+SI+PPPSDLPKC
Sbjct  518  MHCHLEVHTTWGLKMAFLVDNGKGPNQSIIPPPSDLPKC  556



>ref|XP_003615575.1| Laccase 1a [Medicago truncatula]
Length=593

 Score =   268 bits (686),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISG+FTDDFP KP I +++TG   P+N +T  GT+VYRL +NSTVQ+++Q T +IAPE+
Sbjct  434  NISGIFTDDFPRKPEIVYDFTGNKQPSNFRTNKGTRVYRLAYNSTVQLILQDTGMIAPEN  493

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVGKG GNF+P+ D KKFNL+DPVERNTV VP+ GWTAIRFRADNPGVW
Sbjct  494  HPIHLHGFNFFVVGKGQGNFNPKKDTKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVW  553

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLEIHTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  554  FMHCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  593



>gb|AAC49538.1| diphenol oxidase, partial [Nicotiana tabacum]
Length=409

 Score =   263 bits (672),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I+GVFT DFP  P   FNYTGTPP N+ T NGTKVYRL +N+TVQ+V+Q T IIAPE+HP
Sbjct  252  INGVFTTDFPANPPFVFNYTGTPPTNLATTNGTKVYRLPYNATVQLVLQDTGIIAPENHP  311

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF++VGKGLGNF+ + DPK FNLIDPVERNT+ VP+ GW AIR+ ADNPGVWFM
Sbjct  312  IHLHGFNFFLVGKGLGNFNSKTDPKNFNLIDPVERNTIGVPSGGWVAIRWLADNPGVWFM  371

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAFLV+NGKGP ES+LPPP DLPKC
Sbjct  372  HCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPKDLPKC  409



>ref|XP_003616564.1| Laccase [Medicago truncatula]
Length=675

 Score =   270 bits (691),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 143/160 (89%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGT-PPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NI GVFTDDFP KP + F+YTGT  PAN+ T NGTKVYRL FNS+VQIV+QGT++IAPE+
Sbjct  516  NIKGVFTDDFPSKPPMVFDYTGTDQPANLHTDNGTKVYRLNFNSSVQIVLQGTAMIAPEN  575

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVG+GLGNFDP+ DP +FNL+DP+ERNT+SVP  GW AIRFRADNPGVW
Sbjct  576  HPFHLHGFNFFVVGQGLGNFDPEKDPLRFNLVDPIERNTLSVPNNGWIAIRFRADNPGVW  635

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCHLE+HTTWGLKMAF+V+NG+GP+ESILPPP DLP C
Sbjct  636  FLHCHLEVHTTWGLKMAFIVDNGRGPSESILPPPKDLPIC  675



>ref|XP_003544123.1| PREDICTED: laccase-4-like [Glycine max]
Length=554

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFTDDFP  P I FNYTGT PAN+QT NGT++YRL FNSTVQI++QGT++IAPE+H
Sbjct  396  NIKGVFTDDFPSFPPIAFNYTGTQPANIQTNNGTRLYRLDFNSTVQIILQGTAMIAPENH  455

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG+NF+VVG+GLGNFDP+ DP  FNL+DPVERNT+ VP  GW AIRFRA+NPGVWF
Sbjct  456  PFHLHGYNFFVVGQGLGNFDPEKDPLSFNLVDPVERNTIGVPNGGWAAIRFRANNPGVWF  515

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKMAF+V+NG GP+ES LPPP DLP C
Sbjct  516  LHCHLEVHTTWGLKMAFIVDNGNGPHESSLPPPKDLPMC  554



>ref|XP_004150626.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004169234.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=517

 Score =   266 bits (680),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFTDDFP  P I ++YTG  P+N+QT  GT++YRL +NSTVQ+V+Q T++IAPE+H
Sbjct  359  NIDGVFTDDFPANPPIRYDYTGKQPSNLQTTKGTRLYRLAYNSTVQLVLQDTAMIAPENH  418

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG GLGNF+ + DP+KFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  419  PVHLHGFNFFVVGSGLGNFNHKKDPEKFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWF  478

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V NG+GP ES+LPPPSDLPKC
Sbjct  479  MHCHLEVHTTWGLKMAFVVNNGRGPEESLLPPPSDLPKC  517



>ref|XP_004246339.1| PREDICTED: laccase-4 [Solanum lycopersicum]
Length=561

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 138/159 (87%), Gaps = 1/159 (1%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGT-PPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            I GVFT DFPG P + +NYT T PPANM T +GTKVY+L +N TVQ+V+Q T IIAPE+H
Sbjct  403  IKGVFTADFPGNPPVVYNYTSTTPPANMGTTSGTKVYKLSYNDTVQLVLQDTGIIAPENH  462

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNFY VGKGLGN++P+ DPK FNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  463  PIHLHGFNFYQVGKGLGNYNPKVDPKNFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWF  522

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLEIHTTWGLKMAFLVENGKGPNES+LPPP DLPKC
Sbjct  523  MHCHLEIHTTWGLKMAFLVENGKGPNESLLPPPKDLPKC  561



>ref|XP_010464832.1| PREDICTED: laccase-22-like [Camelina sativa]
Length=554

 Score =   267 bits (682),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPT  577
             GVFTDDFPG+P  PFNYTG   +N+QT+NGTKVYRL FN+TVQ++IQGTS+IAPESHPT
Sbjct  399  EGVFTDDFPGRPSTPFNYTGGL-SNLQTKNGTKVYRLQFNATVQVIIQGTSVIAPESHPT  457

Query  576  HLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMH  397
            HLHG NF+V+GKGLGNFDP  DPKKFNL+DPVERNTVSVPTAGWTAIRF ADNPGVWF H
Sbjct  458  HLHGSNFFVIGKGLGNFDPIKDPKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVWFFH  517

Query  396  CHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            CHLE+HT+WGLKMAFLVE+G   NE + PPPSDLP C
Sbjct  518  CHLEVHTSWGLKMAFLVEDGNDSNEKLPPPPSDLPIC  554



>gb|KHN20872.1| Laccase-4 [Glycine soja]
Length=562

 Score =   267 bits (683),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFTDDFP  P I FNYTGT PAN+QT NGT++YRL FNSTVQI++QGT++IAPE+H
Sbjct  404  NIKGVFTDDFPSFPPIAFNYTGTQPANIQTNNGTRLYRLDFNSTVQIILQGTAMIAPENH  463

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG+NF+VVG+GLGNFDP+ DP  FNL+DPVERNT+ VP  GW AIRFRA+NPGVWF
Sbjct  464  PFHLHGYNFFVVGQGLGNFDPEKDPLSFNLVDPVERNTIGVPNGGWAAIRFRANNPGVWF  523

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKMAF+V+NG GP+ES LPPP DLP C
Sbjct  524  LHCHLEVHTTWGLKMAFIVDNGNGPHESSLPPPKDLPMC  562



>ref|XP_009786393.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=556

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GV+T DFP  P I FNYTG PP N+ T +GTKVYRL +N+TVQ+V+Q T IIAPE+HP
Sbjct  399  IKGVYTTDFPQNPPIKFNYTGKPPVNLATTSGTKVYRLPYNATVQLVLQDTGIIAPENHP  458

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+ VGKGLGNF+P+ DPK FNL+DPVERNT+ VP  GW AIRFRADNPGVWFM
Sbjct  459  IHLHGFNFFAVGKGLGNFNPKTDPKNFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFM  518

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAFLV+NGKGPNES+LPPP DLPKC
Sbjct  519  HCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  556



>ref|XP_007016183.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
 gb|EOY33802.1| Laccase/Diphenol oxidase family protein [Theobroma cacao]
Length=557

 Score =   267 bits (682),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFPG P +PFNYT T   N QT+ GTK+YRL +NSTVQ+V+Q T +I PE+H
Sbjct  399  NISGVFTTDFPGNPPVPFNYTSTQLTNFQTKQGTKLYRLAYNSTVQLVLQDTGMITPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+P+ D KKFNL+DPVERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  459  PLHLHGFNFFEVGRGLGNFNPKKDTKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NG GPNE++LPPPSDLPKC
Sbjct  519  MHCHLEVHTTWGLKMAFVVDNGNGPNETLLPPPSDLPKC  557



>ref|XP_009350996.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=558

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 138/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N+ GV+T DFP  P IPFNYTGT PAN+QT NGT++YRL +NSTVQIV+QGT+IIAPESH
Sbjct  400  NVKGVYTLDFPANPPIPFNYTGTSPANLQTTNGTRLYRLEYNSTVQIVLQGTAIIAPESH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGFNF+VVGKGLGNFDP+ DP+KFNL+DPVERNTVSVPTAGWTAIRFRA+NPG+WF
Sbjct  460  PTHLHGFNFFVVGKGLGNFDPKKDPEKFNLVDPVERNTVSVPTAGWTAIRFRANNPGIWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNES  319
            +HCHLE+HT+WGLKMAFLVENG+G NES
Sbjct  520  LHCHLEVHTSWGLKMAFLVENGEGQNES  547



>gb|KHG17519.1| Laccase-4 -like protein [Gossypium arboreum]
Length=503

 Score =   265 bits (678),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFPG P  PFNYT T   N  T+ GT++YRL +N TVQ+V+Q T +I PE+H
Sbjct  345  NISGVFTSDFPGNPPAPFNYTSTQVTNFATKQGTRLYRLAYNDTVQLVLQDTGMITPENH  404

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+P+ DPKKFNL+DPVERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  405  PLHLHGFNFFEVGRGLGNFNPKEDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWF  464

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSD PKC
Sbjct  465  MHCHLEVHTTWGLKMAFVVDNGKGPNESLLPPPSDFPKC  503



>gb|EYU41858.1| hypothetical protein MIMGU_mgv1a003895mg [Erythranthe guttata]
Length=557

 Score =   267 bits (682),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFT DFPG P   FNYTG PPAN+ T  GTKVYRL +N+TVQ+V+Q T IIAPE+H
Sbjct  399  NIKGVFTSDFPGNPPHAFNYTGAPPANLSTTTGTKVYRLPYNATVQVVLQDTGIIAPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGN++P+ DP  FNL+DPVERNT+ VP+ GW AIRF ADNPGVWF
Sbjct  459  PVHLHGFNFFAVGRGLGNYNPKTDPNNFNLVDPVERNTIGVPSGGWVAIRFLADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGPN+SILPPP DLPKC
Sbjct  519  MHCHLEVHTTWGLKMAFLVDNGKGPNQSILPPPKDLPKC  557



>ref|XP_010486777.1| PREDICTED: laccase-22-like isoform X1 [Camelina sativa]
Length=554

 Score =   266 bits (681),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPT  577
             GVFTDDFPGKP  PFNYTG   +N++T+NGTKVYRL FN+TVQ++IQGTS+IAPESHPT
Sbjct  399  EGVFTDDFPGKPSTPFNYTGGL-SNLRTENGTKVYRLEFNATVQVIIQGTSVIAPESHPT  457

Query  576  HLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMH  397
            HLHG NF+V+GKGLGNFDP  D KKFNL+DPVERNTVSVPTAGWTAIRF ADNPGVWF H
Sbjct  458  HLHGSNFFVIGKGLGNFDPLKDTKKFNLVDPVERNTVSVPTAGWTAIRFIADNPGVWFFH  517

Query  396  CHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            CHLE+HT+WGLKMAFLVE+G G NE + PPPSDLP C
Sbjct  518  CHLEVHTSWGLKMAFLVEDGNGSNEKLPPPPSDLPIC  554



>ref|XP_009624727.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GVFT DFP  P   FNYTGT P N+ T NGTKVYRL +N TVQ+V+Q T IIAPE+HP
Sbjct  400  IKGVFTTDFPANPPFAFNYTGTGPTNLATMNGTKVYRLRYNDTVQLVLQDTGIIAPENHP  459

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF++VGKG+GNF+P+ DPK FNL+DPVERNTV VP  GW AIRFRADNPGVWFM
Sbjct  460  IHLHGFNFFLVGKGIGNFNPKTDPKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFM  519

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLEIHTTWGLKMA+LV+NGKGPNES+LPPP DLPKC
Sbjct  520  HCHLEIHTTWGLKMAWLVDNGKGPNESLLPPPKDLPKC  557



>gb|KGN65788.1| hypothetical protein Csa_1G528530 [Cucumis sativus]
Length=562

 Score =   266 bits (680),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFTDDFP  P I ++YTG  P+N+QT  GT++YRL +NSTVQ+V+Q T++IAPE+H
Sbjct  404  NIDGVFTDDFPANPPIRYDYTGKQPSNLQTTKGTRLYRLAYNSTVQLVLQDTAMIAPENH  463

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG GLGNF+ + DP+KFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  464  PVHLHGFNFFVVGSGLGNFNHKKDPEKFNLVDPVERNTVGVPSGGWVAIRFRADNPGVWF  523

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V NG+GP ES+LPPPSDLPKC
Sbjct  524  MHCHLEVHTTWGLKMAFVVNNGRGPEESLLPPPSDLPKC  562



>ref|XP_008392913.1| PREDICTED: laccase-4-like [Malus domestica]
Length=558

 Score =   266 bits (679),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 137/148 (93%), Gaps = 0/148 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N+ GV+T DFP  P IPFNYTGT PAN+QT NGT++YRL +NSTVQIV+QGT+IIAPESH
Sbjct  400  NVKGVYTLDFPANPPIPFNYTGTSPANLQTTNGTRLYRLEYNSTVQIVLQGTAIIAPESH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGFNF+VVGKGLGNFDP+ DP KFNL+DPVERNTVSVPTAGWTAIRFRA+NPG+WF
Sbjct  460  PTHLHGFNFFVVGKGLGNFDPKKDPGKFNLVDPVERNTVSVPTAGWTAIRFRANNPGIWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNES  319
            +HCHLE+HT+WGLKMAFLVENG+G NES
Sbjct  520  LHCHLEVHTSWGLKMAFLVENGEGQNES  547



>gb|KDP24484.1| hypothetical protein JCGZ_25048 [Jatropha curcas]
Length=486

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI+GVFT DFP  P   FN+TG  PAN+QT+NGT+VY+L +N TVQ+V+Q T IIAPE+H
Sbjct  328  NINGVFTTDFPANPPHVFNFTGKGPANLQTKNGTRVYKLKYNETVQLVMQDTGIIAPENH  387

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+G+++P+ DP+ FNL+DP ERNT+ VPT GW AIRFRADNPGVWF
Sbjct  388  PVHLHGFNFFAVGRGIGSYNPKTDPQNFNLVDPPERNTIGVPTGGWVAIRFRADNPGVWF  447

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPNES+LPPPSDLPKC
Sbjct  448  MHCHLEVHTTWGLKMAFLVENGKGPNESLLPPPSDLPKC  486



>ref|XP_010486778.1| PREDICTED: laccase-22-like isoform X2 [Camelina sativa]
Length=565

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 140/167 (84%), Gaps = 10/167 (6%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTPPA----------NMQTQNGTKVYRLGFNSTVQIVIQGT  607
             GVFTDDFPGKP  PFNYTG  P+          N++T+NGTKVYRL FN+TVQ++IQGT
Sbjct  399  EGVFTDDFPGKPSTPFNYTGGKPSTPFNYTGGLSNLRTENGTKVYRLEFNATVQVIIQGT  458

Query  606  SIIAPESHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFR  427
            S+IAPESHPTHLHG NF+V+GKGLGNFDP  D KKFNL+DPVERNTVSVPTAGWTAIRF 
Sbjct  459  SVIAPESHPTHLHGSNFFVIGKGLGNFDPLKDTKKFNLVDPVERNTVSVPTAGWTAIRFI  518

Query  426  ADNPGVWFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            ADNPGVWF HCHLE+HT+WGLKMAFLVE+G G NE + PPPSDLP C
Sbjct  519  ADNPGVWFFHCHLEVHTSWGLKMAFLVEDGNGSNEKLPPPPSDLPIC  565



>ref|XP_007205010.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
 gb|EMJ06209.1| hypothetical protein PRUPE_ppa003646mg [Prunus persica]
Length=559

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 140/161 (87%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPAN--MQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NISGVFT DFPG P   FN++G P AN  M T NGTK+YRL +NSTVQ+V+Q T  IAPE
Sbjct  399  NISGVFTTDFPGNPPNTFNFSGGPSANASMATTNGTKLYRLAYNSTVQLVLQDTGTIAPE  458

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHG+NFY VG+G+GN++P+ DPKKFNL+DPVERNTV VP+ GW AIRF+ADNPGV
Sbjct  459  NHPVHLHGYNFYAVGRGVGNYNPKKDPKKFNLVDPVERNTVGVPSGGWAAIRFQADNPGV  518

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WF+HCHLE+HTTWGLKMAFLV+NGKGPNESILPPPSDLPKC
Sbjct  519  WFLHCHLEVHTTWGLKMAFLVDNGKGPNESILPPPSDLPKC  559



>ref|XP_004147923.1| PREDICTED: laccase-4-like [Cucumis sativus]
 ref|XP_004165325.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN54357.1| hypothetical protein Csa_4G308480 [Cucumis sativus]
Length=556

 Score =   265 bits (678),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI+GVFT DFP  P   FNYTG+ P+N+QT  GTK+Y+L FNSTV++V+Q T I+  E+H
Sbjct  398  NINGVFTTDFPANPPHVFNYTGSGPSNLQTTRGTKLYKLKFNSTVELVLQDTGILTAENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G+GN+D +NDPK FNL+DPVERNTV VP+ GWTAIRFRADNPGVWF
Sbjct  458  PIHLHGFNFFVVGRGIGNYDAKNDPKSFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SI+PPP DLPKC
Sbjct  518  MHCHLEVHTTWGLKMAFLVENGKGPNQSIIPPPKDLPKC  556



>gb|KCW52562.1| hypothetical protein EUGRSUZ_J01941, partial [Eucalyptus grandis]
Length=524

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
             ++GVFTDDFP KP I FNYTG  P N+ T  GT++YRL +NSTVQ+V+Q T ++APE+H
Sbjct  366  KMTGVFTDDFPAKPMIRFNYTGAQPVNLNTMTGTRLYRLRYNSTVQLVLQDTGMVAPENH  425

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GNFDP  DP+KFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  426  PIHLHGFNFFAVGRGIGNFDPITDPRKFNLVDPVERNTIGVPSGGWAAIRFRADNPGVWF  485

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V++G+GP++S+LPPPSDLPKC
Sbjct  486  MHCHLEVHTTWGLKMAFVVDDGEGPDQSLLPPPSDLPKC  524



>ref|XP_004249084.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=556

 Score =   265 bits (677),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GV+T DFP  P   FNYTGTPP N+ T +GTKVYRL +N+TVQ+V+Q T II+PE+HP
Sbjct  399  IKGVYTTDFPQNPPFKFNYTGTPPTNLATMSGTKVYRLPYNATVQLVLQDTGIISPENHP  458

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+ VGKG+GNF+P+ DP  FNLIDPVERNT+ VP+ GW AIRFRADNPGVWFM
Sbjct  459  IHLHGFNFFAVGKGIGNFNPKKDPNNFNLIDPVERNTIGVPSGGWVAIRFRADNPGVWFM  518

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLEIHTTWGLKMAFLV+NGKGPNES+LPPP DLPKC
Sbjct  519  HCHLEIHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  556



>gb|KHG22893.1| Laccase-4 -like protein [Gossypium arboreum]
Length=486

 Score =   263 bits (672),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI+GVF  +FPG+P +PFNYT     N+ T+  TK+YRLG+N TVQ+V+Q T +I PE+H
Sbjct  328  NINGVFATNFPGRPPVPFNYTSIQLTNLGTKQATKLYRLGYNDTVQLVLQDTGMITPENH  387

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GNFDP+ DPK FNL+DPVERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  388  PIHLHGFNFFEVGRGVGNFDPKKDPKNFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWF  447

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  448  MHCHLEVHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  486



>ref|XP_010033027.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
Length=553

 Score =   265 bits (676),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
             ++GVFTDDFP KP I FNYTG  P N+ T  GT++YRL +NSTVQ+V+Q T ++APE+H
Sbjct  395  KMTGVFTDDFPAKPMIRFNYTGAQPVNLNTMTGTRLYRLRYNSTVQLVLQDTGMVAPENH  454

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GNFDP  DP+KFNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  455  PIHLHGFNFFAVGRGIGNFDPITDPRKFNLVDPVERNTIGVPSGGWAAIRFRADNPGVWF  514

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V++G+GP++S+LPPPSDLPKC
Sbjct  515  MHCHLEVHTTWGLKMAFVVDDGEGPDQSLLPPPSDLPKC  553



>ref|XP_009593041.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=556

 Score =   265 bits (676),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GV+T DFP  P   FNYTGTPPAN+ T +GTKVYRL +N+TVQ+V+Q T II+PE+HP
Sbjct  399  IKGVYTTDFPQNPPFKFNYTGTPPANLSTMSGTKVYRLPYNATVQLVLQDTGIISPENHP  458

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+ VGKGLGNF+ + DPK FNL+DPVERNT+ VP  GW AIRFRADNPGVWFM
Sbjct  459  IHLHGFNFFAVGKGLGNFNSKIDPKNFNLVDPVERNTIGVPAGGWVAIRFRADNPGVWFM  518

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAFLV+NGKGPNES+LPPP DLPKC
Sbjct  519  HCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  556



>gb|AAC49536.1| diphenol oxidase [Nicotiana tabacum]
Length=557

 Score =   265 bits (676),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 134/157 (85%), Gaps = 0/157 (0%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPT  577
             GVFT DFP  P   FNYTGT P N+ T NGTKVYRL +N TVQ+V+Q T IIAPE+HP 
Sbjct  401  KGVFTTDFPANPPFAFNYTGTGPTNLATMNGTKVYRLRYNDTVQLVLQDTGIIAPENHPI  460

Query  576  HLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMH  397
            HLHGFNF++VGKG+GNF+P+ DPK FNL+DPVERNTV VP  GW AIRFRADNPGVWFMH
Sbjct  461  HLHGFNFFLVGKGIGNFNPKTDPKNFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWFMH  520

Query  396  CHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            CHLEIHTTWGLKMA+LV+NGKGPNES+LPPP DLPKC
Sbjct  521  CHLEIHTTWGLKMAWLVDNGKGPNESLLPPPKDLPKC  557



>ref|XP_009384856.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=558

 Score =   265 bits (676),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N+SGVFT+DFPG+P I FNYTG+ P N QT NGT++YRL +N++VQ+V+Q T II PESH
Sbjct  400  NMSGVFTNDFPGQPLIAFNYTGSGPNNTQTMNGTRLYRLPYNASVQLVLQDTGIIGPESH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG+NF+VVG+G+GN+DP   P KFNL+DP+ERNT++VP AGWTAIRFRADNPGVWF
Sbjct  460  PIHLHGYNFFVVGRGVGNYDPATSPSKFNLVDPIERNTMAVPAAGWTAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCH E+HTTWGLKMAF+VE+GKGPNES+ PPP DLP C
Sbjct  520  LHCHFEVHTTWGLKMAFVVEDGKGPNESLQPPPKDLPAC  558



>ref|XP_010553253.1| PREDICTED: laccase-4 [Tarenaya hassleriana]
Length=559

 Score =   264 bits (674),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   +NYTG+PPAN+ T+ GT++Y+L +N+TV++V+Q T II+PE+H
Sbjct  401  NISGVFTTDFPKNPPHVYNYTGSPPANLATEKGTRLYKLPYNATVEVVLQDTGIISPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GNF+P+ DPK FNL DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  461  PVHLHGFNFFQVGRGIGNFNPKKDPKSFNLDDPVERNTIGVPSGGWVAIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPNES+LPPP+DLPKC
Sbjct  521  MHCHLEVHTTWGLKMAFLVENGKGPNESVLPPPNDLPKC  559



>ref|XP_004500229.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=556

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVF++DFPG P I +N+TGT P N  T  GT++Y+L +NSTVQ+V+Q T +I PE+H
Sbjct  398  NIKGVFSEDFPGNPPIVYNFTGTQPTNFGTTKGTRLYKLAYNSTVQLVLQDTGMITPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G GN++P+ D KKFNL+DPVERNT+ VP  GWTAIRFRADNPGVWF
Sbjct  458  PIHLHGFNFFVVGRGQGNYNPRKDAKKFNLVDPVERNTIGVPAGGWTAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLEIHTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  518  MHCHLEIHTTWGLKMAFVVDNGKGPNESVLPPPSDLPKC  556



>ref|XP_002533894.1| laccase, putative [Ricinus communis]
 gb|EEF28494.1| laccase, putative [Ricinus communis]
Length=556

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            ISGVFT DFP KP   FN+TG+ P N+ T   TKVYRL +N TVQ+V+Q T +IAPESHP
Sbjct  399  ISGVFTTDFPSKPPHVFNFTGSGPKNLNTVRATKVYRLKYNDTVQLVMQDTGVIAPESHP  458

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+VVG+GLGN++P  DP+ FNL+DP ERNT+ VPT GW AIRFRADNPGVWFM
Sbjct  459  IHLHGFNFFVVGRGLGNYNPNTDPQNFNLVDPAERNTIGVPTGGWAAIRFRADNPGVWFM  518

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAFLV+NGKGPNES+LPPPSDLPKC
Sbjct  519  HCHLEVHTTWGLKMAFLVDNGKGPNESLLPPPSDLPKC  556



>ref|XP_010037723.1| PREDICTED: laccase-4-like [Eucalyptus grandis]
 gb|KCW49475.1| hypothetical protein EUGRSUZ_K02996 [Eucalyptus grandis]
Length=562

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQ--TQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NISGVFT DFPG P   +NYT TPP N    T NGTKVYRL +N+TVQ+V+Q T IIAPE
Sbjct  402  NISGVFTTDFPGNPPTTYNYTATPPQNASVPTMNGTKVYRLPYNATVQLVLQDTGIIAPE  461

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VGKG+GN+DP+ DPKKFNL+DPVERNT+ +P+ GW AIRF ADNPGV
Sbjct  462  THPIHLHGFNFFGVGKGVGNYDPKKDPKKFNLVDPVERNTIGIPSGGWIAIRFTADNPGV  521

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WF+HCHLE+HTTWGLKMAFLV+NGKGP E++LPPPSDLPKC
Sbjct  522  WFLHCHLEVHTTWGLKMAFLVDNGKGPKETLLPPPSDLPKC  562



>ref|XP_010676357.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=561

 Score =   263 bits (672),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 141/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGT-PPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVFTDDFP KP  PFN+TG     N+ T  GTKVYRL +N+TVQ+V+Q T+IIAPE+
Sbjct  402  NISGVFTDDFPAKPPTPFNFTGNNQVTNVGTTKGTKVYRLPYNATVQLVLQDTAIIAPEN  461

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVGKG+GNF+P+NDPKKFNL+DPVERNT+ VP+ GW AIRFRADNPGVW
Sbjct  462  HPFHLHGFNFFVVGKGVGNFNPKNDPKKFNLVDPVERNTIGVPSGGWAAIRFRADNPGVW  521

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F HCHLEIHTTWGLKMAFLV++GKGP+ES+LPPP+D PKC
Sbjct  522  FFHCHLEIHTTWGLKMAFLVDDGKGPSESLLPPPNDFPKC  561



>ref|XP_007141799.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
 gb|ESW13793.1| hypothetical protein PHAVU_008G226700g [Phaseolus vulgaris]
Length=553

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N+ GVFTDDFP  P I FNYTGT PAN+QT NGT++YRL FNSTVQI++QGT++IAPE+H
Sbjct  395  NVKGVFTDDFPAHPPIVFNYTGTQPANIQTNNGTRLYRLNFNSTVQIILQGTAMIAPENH  454

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG+NF+VVG+G GNFDP+ DP  FNL+DPVERNT+ VP  GW AIRFRA+NPGVWF
Sbjct  455  PFHLHGYNFFVVGQGSGNFDPEKDPLGFNLVDPVERNTIGVPNGGWVAIRFRANNPGVWF  514

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKMAF+V+NG  P+ES  PPP+DLPKC
Sbjct  515  LHCHLEVHTTWGLKMAFIVDNGNSPHESSFPPPNDLPKC  553



>gb|KFK44563.1| hypothetical protein AALP_AA1G273400 [Arabis alpina]
Length=556

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N++GV+T DFPGKPR  +++TG PP+N+ T   TK+Y+L +NSTVQ+V+Q T  +APE+H
Sbjct  398  NLTGVYTTDFPGKPRRFYDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENH  457

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G+GN++ + D KKFNL+DPVERNTV VP+ GWTAIRFRADNPGVWF
Sbjct  458  PIHLHGFNFFVVGFGIGNYNSKKDSKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWF  517

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPPSDLPKC
Sbjct  518  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  556



>ref|XP_006363052.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=561

 Score =   263 bits (671),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 136/159 (86%), Gaps = 1/159 (1%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGT-PPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            I GVFT DFPG P   +NYT T PPANM T +GTKVY+L +N TVQ+V+Q T IIAPE+H
Sbjct  403  IKGVFTADFPGNPPFVYNYTNTTPPANMGTTSGTKVYKLSYNDTVQLVLQDTGIIAPENH  462

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNFY VGKGLGN++P+ DPK FNL+DPVERNTV VP+ GW AIRFR DNPGVWF
Sbjct  463  PIHLHGFNFYQVGKGLGNYNPKVDPKNFNLVDPVERNTVGVPSGGWVAIRFRTDNPGVWF  522

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLEIHTTWGLKMAFLV+NGKGPNES+LPPP DLPKC
Sbjct  523  MHCHLEIHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  561



>ref|XP_006602641.1| PREDICTED: laccase-4-like isoform X1 [Glycine max]
Length=560

 Score =   262 bits (670),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANM-QTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NI GVFT DFPG P   +NYT TPPA   QT NGTK YRL FNSTVQ+V+Q T +IAPES
Sbjct  401  NIKGVFTTDFPGNPSHVYNYTATPPAAAWQTTNGTKAYRLAFNSTVQVVLQDTGVIAPES  460

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVG G+GN+DP+ D   FNL DPVERNT+ VPT GW A RFRADNPGVW
Sbjct  461  HPVHLHGFNFFVVGSGVGNYDPKTDQNNFNLADPVERNTIGVPTGGWVAFRFRADNPGVW  520

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCH E+HTTWGLKMAFLV+NGKGPNES+LPPP DLPKC
Sbjct  521  FLHCHFEVHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  560



>ref|XP_006349470.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=556

 Score =   262 bits (669),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GV+T DFP  P   FNYTGTPP N+ T +GTKVY L +N+TVQ+V+Q T II+PE+HP
Sbjct  399  IKGVYTTDFPQNPPFKFNYTGTPPTNLATMSGTKVYLLPYNATVQLVLQDTGIISPENHP  458

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+ VGKG+GNF+P+ DP  FNLIDPVERNT+ VP+ GW AIRFRADNPGVWFM
Sbjct  459  IHLHGFNFFAVGKGIGNFNPKTDPNNFNLIDPVERNTIGVPSGGWVAIRFRADNPGVWFM  518

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLEIHTTWGLKMAFLV+NGKGPNES+LPPP DLPKC
Sbjct  519  HCHLEIHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  556



>ref|XP_008388134.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score =   262 bits (670),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 139/161 (86%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPAN--MQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            N SGVFT DFPG P   FNY+G PPAN  + T NGTK+YRL +NSTVQ+V+Q T  IAPE
Sbjct  399  NKSGVFTTDFPGNPPTAFNYSGGPPANASLATTNGTKLYRLAYNSTVQLVLQDTGTIAPE  458

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+G+GN++P+ DPKKFNL+DPVERNT ++P+ GWTAIRF ADNPGV
Sbjct  459  NHPIHLHGFNFFCVGRGVGNYNPKTDPKKFNLVDPVERNTANIPSGGWTAIRFVADNPGV  518

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAFLV+NGKGPN+S+LPPP DLPKC
Sbjct  519  WFMHCHLEVHTTWGLKMAFLVDNGKGPNQSLLPPPKDLPKC  559



>gb|KHN04832.1| Laccase-4 [Glycine soja]
Length=524

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFT DFP  P   FNY+G  PAN+ T+ GTKVYRL FN+TVQ+V+Q T IIAPE+H
Sbjct  366  NIKGVFTTDFPANPPHVFNYSGPGPANLNTETGTKVYRLPFNATVQVVLQDTGIIAPENH  425

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G+GNF+P+ DPK FNL+DPVERNT+ VP  GWTA RFRADNPGVWF
Sbjct  426  PVHLHGFNFFVVGRGVGNFNPKIDPKNFNLVDPVERNTIGVPAGGWTAFRFRADNPGVWF  485

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGP +S++PPP DLPKC
Sbjct  486  MHCHLEVHTTWGLKMAFLVDNGKGPKQSVIPPPKDLPKC  524



>gb|EPS65618.1| hypothetical protein M569_09159, partial [Genlisea aurea]
Length=539

 Score =   261 bits (668),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 131/158 (83%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I+GVFT DFPGKP  PFNYTG    NM T  GTKVY+L +NSTVQ+V+QGT IIAPESHP
Sbjct  382  IAGVFTADFPGKPLNPFNYTGAYKGNMATVTGTKVYKLAYNSTVQVVLQGTGIIAPESHP  441

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+ VG G GNF+P  DP +FNL+DPVERNTV+VP  GW AIRFRADNPGVWFM
Sbjct  442  FHLHGFNFFAVGSGKGNFNPNLDPARFNLVDPVERNTVAVPNGGWVAIRFRADNPGVWFM  501

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKM FLVENG GPN+S+ PPP DLP C
Sbjct  502  HCHLEVHTTWGLKMVFLVENGNGPNQSVQPPPKDLPTC  539



>ref|XP_003516941.1| PREDICTED: laccase-4-like [Glycine max]
Length=557

 Score =   262 bits (669),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFT DFP  P   FNY+G  PAN+ T+ GTKVYRL FN+TVQ+V+Q T IIAPE+H
Sbjct  399  NIKGVFTTDFPANPPHVFNYSGPGPANLNTETGTKVYRLPFNATVQVVLQDTGIIAPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G+GNF+P+ DPK FNL+DPVERNT+ VP  GWTA RFRADNPGVWF
Sbjct  459  PVHLHGFNFFVVGRGVGNFNPKIDPKNFNLVDPVERNTIGVPAGGWTAFRFRADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGP +S++PPP DLPKC
Sbjct  519  MHCHLEVHTTWGLKMAFLVDNGKGPKQSVIPPPKDLPKC  557



>gb|KHN24301.1| Laccase-4 [Glycine soja]
Length=522

 Score =   261 bits (666),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANM-QTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NI GVFT DFPG P   +NYT TPPA   QT NGTK YRL FNSTVQ+V+Q T +IAPES
Sbjct  363  NIKGVFTTDFPGNPSHVYNYTATPPAAAWQTTNGTKAYRLAFNSTVQVVLQDTGVIAPES  422

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVG G+GN+DP+ D   FNL DPVERNT+ VPT GW A RFRADNPGVW
Sbjct  423  HPVHLHGFNFFVVGSGVGNYDPKTDQNNFNLADPVERNTIGVPTGGWVAFRFRADNPGVW  482

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCH E+HTTWGLKMAFLV+NGKGPNES+LPPP DLPKC
Sbjct  483  FLHCHFEVHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  522



>gb|ACN39933.1| unknown [Picea sitchensis]
Length=559

 Score =   261 bits (668),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI+GVFT DFP +P  PFNYTG PP N  T  GT++ R+ FNSTVQ+V+QGTS++A E H
Sbjct  401  NITGVFTTDFPDRPPTPFNYTGAPPQNPMTSKGTRLTRIPFNSTVQLVLQGTSVLAMEKH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF++VG+G GN++P  DP KFNL+DP ERNTV VPT GWTAIRFRADNPGVWF
Sbjct  461  PLHLHGFNFFIVGRGFGNYNPNKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+VENG GPN+SILPPP DLPKC
Sbjct  521  MHCHLEVHTTWGLKMAFVVENGDGPNQSILPPPKDLPKC  559



>ref|XP_010529771.1| PREDICTED: laccase-4-like [Tarenaya hassleriana]
Length=559

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N++GVFT DFP  P   FNYTG PPAN+ T  GT++Y+L +N+TV++V+Q T +I+PE+H
Sbjct  401  NVNGVFTTDFPKNPPHVFNYTGAPPANLATDKGTRLYKLPYNATVELVLQDTVVISPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+P  DPK+FNL DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  461  PLHLHGFNFFQVGRGLGNFNPNKDPKRFNLDDPVERNTIGVPSGGWVAIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPNESILPPP DLPKC
Sbjct  521  MHCHLEVHTTWGLKMAFLVENGKGPNESILPPPKDLPKC  559



>gb|KEH34185.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=556

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I GVFTDDFPG P + +N+TG+   N+ T  GT++YRL +NSTVQ+V+Q T ++ PE+HP
Sbjct  399  IKGVFTDDFPGNPPVVYNFTGSQVTNLATTKGTRLYRLAYNSTVQLVLQDTGMLTPENHP  458

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+VVG+G GNFD + D KKFNL+DPVERNTV VP  GWTAIRF+ADNPGVWFM
Sbjct  459  IHLHGFNFFVVGRGQGNFDSKKDVKKFNLVDPVERNTVGVPAGGWTAIRFKADNPGVWFM  518

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLEIHTTWGLKMAF+V+NGKGPNES+LPPPSDLPKC
Sbjct  519  HCHLEIHTTWGLKMAFVVDNGKGPNESLLPPPSDLPKC  556



>gb|EYU26646.1| hypothetical protein MIMGU_mgv1a003805mg [Erythranthe guttata]
Length=563

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPP-ANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NI GVFT DFPG P + FNYTG PP +N  T+NGTK+YR+ +N+T+Q+V+Q T IIAPE+
Sbjct  404  NIKGVFTTDFPGNPPVSFNYTGGPPPSNFGTRNGTKLYRVPYNTTIQVVLQDTGIIAPEN  463

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVG+GLGNF+ + DPK+FNL+DPVERNT+ VP+ GW AIRF ADNPGVW
Sbjct  464  HPIHLHGFNFFVVGRGLGNFNSKTDPKQFNLVDPVERNTIGVPSGGWVAIRFLADNPGVW  523

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HTTWGLKMAFLV+NGK PNES+LPPP DLPKC
Sbjct  524  FMHCHLEVHTTWGLKMAFLVDNGKSPNESVLPPPKDLPKC  563



>ref|XP_009358852.1| PREDICTED: laccase-4-like [Pyrus x bretschneideri]
Length=559

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 140/161 (87%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPAN--MQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            N SGVFT DFPG P + FNY+G PPAN  + T NGT++YRL +NSTVQ+V+Q T  IAPE
Sbjct  399  NKSGVFTTDFPGNPPMAFNYSGGPPANSSLATTNGTRLYRLAYNSTVQLVLQDTGTIAPE  458

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHG+NF+ VG+G+GN++P+ DPKKFNL+DPVERNT +VP+ GWTAIRF ADNPGV
Sbjct  459  NHPIHLHGYNFFSVGRGVGNYNPKTDPKKFNLVDPVERNTANVPSGGWTAIRFIADNPGV  518

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAFLV+NGKGPN+S+LPPP DLPKC
Sbjct  519  WFMHCHLEVHTTWGLKMAFLVDNGKGPNQSLLPPPKDLPKC  559



>ref|XP_010452014.1| PREDICTED: laccase-10 isoform X1 [Camelina sativa]
 ref|XP_010452015.1| PREDICTED: laccase-10 isoform X2 [Camelina sativa]
Length=559

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N++GV+T DFPGKPR  F++TG PP+N+ T   TK+Y+L +NSTVQ+V+Q T  +APE+H
Sbjct  401  NLTGVYTTDFPGKPRRFFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G GN++ + D KKFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  461  PIHLHGFNFFVVGLGTGNYNSKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPPSDLPKC
Sbjct  521  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  559



>gb|AAK37830.1|AF132126_1 laccase [Pinus taeda]
Length=577

 Score =   261 bits (667),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP KP  PFNYTGTPP N+ T  GT++ RL FNSTVQ+V+Q TS++  E+H
Sbjct  419  NISGVFTADFPDKPPTPFNYTGTPPKNLITSKGTRLSRLPFNSTVQLVLQDTSVLTVENH  478

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF++VG+G GN+DP  DP  FNL+DP ERNTV VPT GWT IRFRADNPGVWF
Sbjct  479  PIHLHGFNFFIVGRGFGNYDPNTDPASFNLVDPPERNTVGVPTGGWTVIRFRADNPGVWF  538

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENG GP++S+LPPPSD PKC
Sbjct  539  MHCHLEVHTTWGLKMAFLVENGDGPDQSMLPPPSDFPKC  577



>ref|XP_009593274.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=554

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I+GVFT DFP  P   FNYTGTPP N+ T  GTKVYRL +N+TVQ+V+Q T IIAPE+HP
Sbjct  397  INGVFTTDFPANPPFVFNYTGTPPTNLATTKGTKVYRLPYNATVQLVLQDTGIIAPENHP  456

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF++VGKGLGNF+ + DPK FNLIDPVERNT+ VP+ GW AIR+ ADNPGVWFM
Sbjct  457  IHLHGFNFFLVGKGLGNFNSKTDPKNFNLIDPVERNTIGVPSGGWVAIRWLADNPGVWFM  516

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAFLV+NGKGP ES+LPPP DLPKC
Sbjct  517  HCHLEVHTTWGLKMAFLVDNGKGPKESLLPPPKDLPKC  554



>ref|XP_002873023.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49282.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=559

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N++G++T DFPGKPR  F++TG PP+N+ T   TK+Y+L +NSTVQ+V+Q T  +APE+H
Sbjct  401  NLTGIYTTDFPGKPRRFFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G GN++ + D KKFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  461  PIHLHGFNFFVVGLGTGNYNSKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPPSDLPKC
Sbjct  521  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  559



>ref|XP_010101806.1| hypothetical protein L484_023595 [Morus notabilis]
 gb|EXB89943.1| hypothetical protein L484_023595 [Morus notabilis]
Length=558

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPTH  574
            GVFT DFP  P   FNY+GTPPA++ T NGTK+YR+ +N TVQ+V+Q T IIAPE+HP H
Sbjct  403  GVFTTDFPANPPNVFNYSGTPPASLATTNGTKLYRIKYNETVQLVLQDTGIIAPENHPVH  462

Query  573  LHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMHC  394
            LHGFNF+VVG+G GN++P+ D K FNL+DPVERNTV VP+ GWTAIRF ADNPGVWFMHC
Sbjct  463  LHGFNFFVVGRGTGNYNPKKDQKSFNLVDPVERNTVGVPSGGWTAIRFLADNPGVWFMHC  522

Query  393  HLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HLE+HTTWGLKMAFLV+NGKGPNES++PPPSDLPKC
Sbjct  523  HLEVHTTWGLKMAFLVDNGKGPNESLIPPPSDLPKC  558



>ref|XP_009787551.1| PREDICTED: laccase-4-like [Nicotiana sylvestris]
Length=554

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            I+GVFT DFP  P   FNYTGT P N+ T  GTKVYRL +N+TVQ+V+Q T IIAPE+HP
Sbjct  397  INGVFTTDFPANPPFVFNYTGTSPTNLATTKGTKVYRLPYNATVQLVLQDTGIIAPENHP  456

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF++VGKGLGNF+ + DPK FNLIDPVERNT+ VP+ GW AIR+RADNPGVWFM
Sbjct  457  IHLHGFNFFLVGKGLGNFNSKTDPKNFNLIDPVERNTIGVPSGGWVAIRWRADNPGVWFM  516

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HTTWGLKMAFLV+NGKG NES+LPPP DLPKC
Sbjct  517  HCHLEVHTTWGLKMAFLVDNGKGSNESLLPPPKDLPKC  554



>ref|XP_004490949.1| PREDICTED: laccase-4-like [Cicer arietinum]
Length=554

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGT-PPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NI GVFTDDFP  P + F+YTG   P N+ T+NGT+VYRL FNS+V+IV+QGT++IAPE+
Sbjct  395  NIKGVFTDDFPANPPLVFDYTGADQPDNLHTENGTRVYRLNFNSSVEIVLQGTAMIAPEN  454

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHG+NF+VVG+GLGNFD   DP +FNL+DPVERNT+SVP AGW AIRFRADNPGVW
Sbjct  455  HPFHLHGYNFFVVGQGLGNFDHDKDPLRFNLVDPVERNTLSVPNAGWIAIRFRADNPGVW  514

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCHLE+HTTWGLKMAF+V+NG+GPNES LPPP+DLP C
Sbjct  515  FLHCHLEVHTTWGLKMAFIVDNGRGPNESKLPPPNDLPMC  554



>ref|XP_008442464.1| PREDICTED: LOW QUALITY PROTEIN: laccase-4-like [Cucumis melo]
Length=559

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 136/157 (87%), Gaps = 0/157 (0%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPT  577
             GVFT DFP KP   FNY+G  P N+QT   TK+Y+L +NSTV++V+Q T IIAPE+HP 
Sbjct  403  KGVFTTDFPXKPPHKFNYSGPGPKNLQTTTATKLYKLQYNSTVELVLQDTGIIAPENHPI  462

Query  576  HLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMH  397
            HLHGFNF+ VG+G+GNF+P+ DPKKFNL+DPVERNT+ VP+ GWTAIRFRADNPGVWFMH
Sbjct  463  HLHGFNFFEVGRGIGNFNPKTDPKKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMH  522

Query  396  CHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            CHLEIHTTWGLKMAFLVENGKGPN+S+LPPP DLPKC
Sbjct  523  CHLEIHTTWGLKMAFLVENGKGPNQSLLPPPRDLPKC  559



>ref|XP_003522150.1| PREDICTED: laccase-4-like [Glycine max]
 gb|KHN02155.1| Laccase-4 [Glycine soja]
Length=557

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFT DFP  P   FNY+G  PAN+ T+ GTKVYR+ FN+TVQ+V+Q T IIAPE+H
Sbjct  399  NIKGVFTTDFPANPPHLFNYSGPGPANLNTETGTKVYRVPFNATVQVVLQDTGIIAPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G+GNF+P+ DPK FNL+DPVERNT+ VP  GWTA RFRADNPGVWF
Sbjct  459  PVHLHGFNFFVVGRGVGNFNPKIDPKNFNLVDPVERNTIGVPAGGWTAFRFRADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGP +S++PPP DLPKC
Sbjct  519  MHCHLEVHTTWGLKMAFLVDNGKGPKQSVIPPPKDLPKC  557



>ref|XP_010543228.1| PREDICTED: laccase-10 [Tarenaya hassleriana]
Length=558

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N+SGV+T DFPGKP   F++TG PP+N+ T   TKVY+L +NS VQ+V+Q T +I+PESH
Sbjct  400  NLSGVYTTDFPGKPHHAFDFTGKPPSNLATMKATKVYKLPYNSRVQVVLQDTGVISPESH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG+NF+VVG+G GN++ ++D KKFNL+DPVERNTVSVP+ GW AIRFRADNPGVWF
Sbjct  460  PIHLHGYNFFVVGRGSGNYNAKSDAKKFNLVDPVERNTVSVPSGGWVAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HT+WGLKMAFLVE+G GPN+SILPPPSDLPKC
Sbjct  520  LHCHLEVHTSWGLKMAFLVEDGNGPNQSILPPPSDLPKC  558



>ref|XP_004163861.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=559

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPTH  574
            GVFT DFPG P   FNY+G  P N+QT + TK+Y+L +NSTV++V+Q T IIAPE+HP H
Sbjct  404  GVFTTDFPGNPPHKFNYSGPGPKNLQTTSATKLYKLQYNSTVELVLQDTGIIAPENHPIH  463

Query  573  LHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMHC  394
            LHGFNF+ VG+G+GNF+P+ DP KFNL+DPVERNT+ VP+ GWTAIRFRADNPGVWFMHC
Sbjct  464  LHGFNFFEVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHC  523

Query  393  HLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HLEIHTTWGLKMAFLVENGKGPN+S+LPPP+DLPKC
Sbjct  524  HLEIHTTWGLKMAFLVENGKGPNQSLLPPPTDLPKC  559



>ref|XP_009789474.1| PREDICTED: laccase-4-like isoform X2 [Nicotiana sylvestris]
Length=524

 Score =   258 bits (660),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFTDDFPG P   F+YTG PP N++T  GT++YRL +NS VQ+++Q T +++PE+H
Sbjct  366  NKSGVFTDDFPGNPAYTFDYTGIPPENLRTMEGTRLYRLAYNSNVQVIMQDTGLLSPENH  425

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G GNFDP+ DPKKFNL+DPVERNT++ P+ GW AIRFRA+NPG+WF
Sbjct  426  PMHLHGFNFFVVGRGRGNFDPEEDPKKFNLVDPVERNTINAPSGGWVAIRFRANNPGIWF  485

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKMAF+V+NG GP ES+LPPP DLP C
Sbjct  486  LHCHLEVHTTWGLKMAFVVDNGNGPEESLLPPPKDLPTC  524



>ref|XP_004137913.1| PREDICTED: laccase-4-like [Cucumis sativus]
 gb|KGN58791.1| hypothetical protein Csa_3G732490 [Cucumis sativus]
Length=559

 Score =   259 bits (663),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPTH  574
            GVFT DFPG P   FNY+G  P N+QT + TK+Y+L +NSTV++V+Q T IIAPE+HP H
Sbjct  404  GVFTTDFPGNPPHKFNYSGPGPKNLQTISATKLYKLQYNSTVELVLQDTGIIAPENHPIH  463

Query  573  LHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMHC  394
            LHGFNF+ VG+G+GNF+P+ DP KFNL+DPVERNT+ VP+ GWTAIRFRADNPGVWFMHC
Sbjct  464  LHGFNFFEVGRGIGNFNPKTDPTKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWFMHC  523

Query  393  HLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HLEIHTTWGLKMAFLVENGKGPN+S+LPPP+DLPKC
Sbjct  524  HLEIHTTWGLKMAFLVENGKGPNQSLLPPPTDLPKC  559



>gb|KDP46534.1| hypothetical protein JCGZ_08506 [Jatropha curcas]
Length=563

 Score =   259 bits (663),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFPG P + FNYTGT P+N+QT NGT++YRL +NSTVQIV+Q T +IAPE+H
Sbjct  405  NISGVFTDDFPGNPPVQFNYTGTQPSNVQTNNGTRLYRLAYNSTVQIVLQDTGMIAPENH  464

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+G+GNF+P+ DPKKFNL+DPVERNTV VP+ GWTAIRFRADNPGVWF
Sbjct  465  PIHLHGFNFFEVGRGVGNFNPKKDPKKFNLVDPVERNTVGVPSGGWTAIRFRADNPGVWF  524

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NGKGPNE +LPPP DLPKC
Sbjct  525  MHCHLEVHTTWGLKMAFVVDNGKGPNECLLPPPPDLPKC  563



>ref|XP_010490598.1| PREDICTED: laccase-10-like isoform X1 [Camelina sativa]
 ref|XP_010490599.1| PREDICTED: laccase-10-like isoform X2 [Camelina sativa]
Length=558

 Score =   259 bits (662),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N++GV+T DFPGKPR  F++TG PP+N+ T   TK+Y+L +NSTVQ+V+Q T  +APE+H
Sbjct  400  NLTGVYTTDFPGKPRRFFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G GN+  + D KKFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  460  PIHLHGFNFFVVGLGTGNYISKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPPSDLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  558



>ref|XP_010423919.1| PREDICTED: laccase-10-like [Camelina sativa]
Length=558

 Score =   259 bits (662),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N++GV+T DFPGKPR  F++ G PP+N+ T   TK+Y+L +NSTVQ+V+Q T  +APE+H
Sbjct  400  NLTGVYTTDFPGKPRRFFDFNGKPPSNLSTMKATKLYKLPYNSTVQVVLQDTGNVAPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G GN++ + D KKFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  460  PIHLHGFNFFVVGLGTGNYNSKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPPSDLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  558



>ref|XP_009407561.1| PREDICTED: laccase-22-like [Musa acuminata subsp. malaccensis]
Length=559

 Score =   259 bits (661),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFTDDFPG+P I FNYTG+ P N+QT +GT++YR+ +N++VQ+V+Q T II PE+H
Sbjct  401  NASGVFTDDFPGQPPIAFNYTGSGPRNLQTMSGTRLYRVPYNASVQLVLQDTGIIGPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG+NF+VVG+G+GN+DP++ P  FNL+DP+ERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  461  PIHLHGYNFFVVGRGVGNYDPKSSPSNFNLVDPIERNTIGVPSGGWTAIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCH E+HTTWGLKMAF+V++G+GPN+S+LPPP+DLP C
Sbjct  521  LHCHFEVHTTWGLKMAFVVDDGEGPNQSLLPPPNDLPSC  559



>ref|XP_009789473.1| PREDICTED: laccase-4-like isoform X1 [Nicotiana sylvestris]
Length=557

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFTDDFPG P   F+YTG PP N++T  GT++YRL +NS VQ+++Q T +++PE+H
Sbjct  399  NKSGVFTDDFPGNPAYTFDYTGIPPENLRTMEGTRLYRLAYNSNVQVIMQDTGLLSPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G GNFDP+ DPKKFNL+DPVERNT++ P+ GW AIRFRA+NPG+WF
Sbjct  459  PMHLHGFNFFVVGRGRGNFDPEEDPKKFNLVDPVERNTINAPSGGWVAIRFRANNPGIWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKMAF+V+NG GP ES+LPPP DLP C
Sbjct  519  LHCHLEVHTTWGLKMAFVVDNGNGPEESLLPPPKDLPTC  557



>ref|XP_006398646.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
 gb|ESQ40099.1| hypothetical protein EUTSA_v10015593mg [Eutrema salsugineum]
Length=558

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N++G++T DFP KPR  F++TG PP+N+ T   TK+Y+L +NSTVQ+V+Q T  +APE+H
Sbjct  400  NLTGIYTTDFPAKPRRFFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G GN++ + D KKFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  460  PIHLHGFNFFVVGLGSGNYNSKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPPSDLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  558



>ref|XP_006350822.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=559

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFTDDFPG P+  F+YTG PP N++T  GTK+YRL +NS VQI++Q T +++PE+H
Sbjct  401  NKSGVFTDDFPGNPQNAFDYTGVPPENLRTMEGTKLYRLEYNSNVQIILQDTGLLSPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G GNF+P+ D KKFNL+DPVERNT++ P+ GW AIRFRA+NPGVWF
Sbjct  461  PMHLHGFNFFVVGRGKGNFNPKEDSKKFNLVDPVERNTINAPSGGWVAIRFRANNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
             HCHLE+HTTWGLKMAF+V NG GPNES+LPPP DLPKC
Sbjct  521  FHCHLEVHTTWGLKMAFVVNNGNGPNESLLPPPKDLPKC  559



>emb|CDY70510.1| BnaAnng33960D, partial [Brassica napus]
Length=194

 Score =   246 bits (628),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTG--TPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NIS VFTDDFP KP  P+NYT       N  T  GTK+YRL +N+TVQI++Q T+II  E
Sbjct  34   NISHVFTDDFPAKPSNPYNYTAPVDQSVNAATMTGTKLYRLPYNATVQIILQNTAIILSE  93

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+GLGNF+P+ DPK+FNL+DPVERNTV VP  GWTAIRF ADNPGV
Sbjct  94   NHPFHLHGFNFFEVGRGLGNFNPEKDPKRFNLVDPVERNTVGVPAGGWTAIRFIADNPGV  153

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLEIHTTWGLKMAF+V+NG GP++S+LPPP+DLPKC
Sbjct  154  WFMHCHLEIHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  194



>ref|XP_007134763.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
 gb|ESW06757.1| hypothetical protein PHAVU_010G0738000g, partial [Phaseolus vulgaris]
Length=527

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFT DFP  P   FNY+G  PAN+ T+ GTKVY+L FN+TVQ+V+Q T IIAPE+H
Sbjct  369  NIKGVFTTDFPANPPHVFNYSGPGPANLNTETGTKVYKLPFNATVQVVLQDTGIIAPENH  428

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G+GN++P  DPK FNL+DPVERNTV VP  GW AIRFRADNPGVWF
Sbjct  429  PVHLHGFNFFVVGRGIGNYNPNTDPKNFNLVDPVERNTVGVPAGGWAAIRFRADNPGVWF  488

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKG  +S++ PP DLPKC
Sbjct  489  MHCHLEVHTTWGLKMAFLVENGKGSKQSVIAPPKDLPKC  527



>gb|AFN53658.1| hypothetical protein [Linum usitatissimum]
Length=480

 Score =   255 bits (652),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/157 (74%), Positives = 132/157 (84%), Gaps = 1/157 (1%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPT  577
            GVFTDDFP  P  PFNYTG+P P N+ T NGT+VYRL FN TVQ+V+Q   +I PE+HP 
Sbjct  324  GVFTDDFPANPLEPFNYTGSPLPGNLATTNGTRVYRLKFNDTVQLVLQNIGLITPENHPI  383

Query  576  HLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMH  397
            HLHGFNF+ VG+G+GNFD + DP +FNL DPVERNTV VP  GWTAIRFRADNPGVWFMH
Sbjct  384  HLHGFNFFEVGRGVGNFDAKKDPMRFNLHDPVERNTVGVPAGGWTAIRFRADNPGVWFMH  443

Query  396  CHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            CHLE+HTTWGLKMA++V+NGKGPNESILPPP DLP C
Sbjct  444  CHLEVHTTWGLKMAWVVDNGKGPNESILPPPHDLPNC  480



>ref|XP_006338994.1| PREDICTED: laccase-4-like [Solanum tuberosum]
Length=557

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGT-PPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            I  VFT DFPG P   FNYT T PP ++ T NGTK+YRL +N+TVQ+V+Q T IIAPE+H
Sbjct  399  IKNVFTMDFPGNPPFVFNYTSTVPPPSLATMNGTKLYRLRYNATVQLVLQDTGIIAPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VGKGLGNF+P+ D K FNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  459  PIHLHGFNFFAVGKGLGNFNPKTDTKNFNLMDPVERNTIGVPSGGWVAIRFRADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLEIHTTWGLKMAFLV+NGKGPNES+LPPP DLPKC
Sbjct  519  MHCHLEIHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  557



>emb|CDY48114.1| BnaC02g03710D [Brassica napus]
Length=559

 Score =   256 bits (655),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N++G++T DFP KP   F++TG PP+N+ T   TK+Y+L +NSTVQ+V+Q T  +APE+H
Sbjct  401  NLTGIYTTDFPAKPHHVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G GN++ + D KKFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  461  PIHLHGFNFFVVGIGSGNYNSKKDAKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPPSDLPKC
Sbjct  521  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  559



>emb|CDY55905.1| BnaAnng13970D [Brassica napus]
Length=563

 Score =   256 bits (655),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N++G++T DFP KP   F++TG PP+N+ T   TK+Y+L +NSTVQ+V+Q T  +APE+H
Sbjct  405  NLTGIYTTDFPAKPHHVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENH  464

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G GN++ + D KKFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  465  PIHLHGFNFFVVGIGSGNYNSKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWF  524

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPPSDLPKC
Sbjct  525  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  563



>ref|XP_009125430.1| PREDICTED: laccase-10 [Brassica rapa]
Length=559

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N++G++T DFP KP   F++TG PP+N+ T   TK+Y+L +NSTVQ+V+Q T  +APE+H
Sbjct  401  NLTGIYTTDFPAKPHHVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G GN++ + D KKFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  461  PIHLHGFNFFVVGIGSGNYNSKKDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPPSDLPKC
Sbjct  521  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPSDLPKC  559



>ref|XP_004249583.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=557

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 135/159 (85%), Gaps = 1/159 (1%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGT-PPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            I  VFT DFPG P   FNYT T PP ++ T NGTK+YRL +++TVQ+V+Q T IIAPE+H
Sbjct  399  IKNVFTTDFPGNPPFIFNYTSTLPPPSLATTNGTKLYRLRYDATVQLVLQDTGIIAPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VGKGLGNF+P+ D K FNLIDPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  459  PIHLHGFNFFAVGKGLGNFNPKIDTKNFNLIDPVERNTIGVPSGGWVAIRFRADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLEIHTTWGLKMAFLV+NGKGPNES+LPPP DLPKC
Sbjct  519  MHCHLEIHTTWGLKMAFLVDNGKGPNESLLPPPKDLPKC  557



>gb|KFK36706.1| hypothetical protein AALP_AA4G158700 [Arabis alpina]
Length=560

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +IAPE+H
Sbjct  402  NISGVFTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENH  461

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+P+ DP  FNL+DPVERNTV VP+ GW  IRFRADNPGVWF
Sbjct  462  PVHLHGFNFFEVGRGLGNFNPKKDPNNFNLVDPVERNTVGVPSGGWVVIRFRADNPGVWF  521

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP DLPKC
Sbjct  522  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  560



>ref|XP_008377498.1| PREDICTED: laccase-4-like [Malus domestica]
Length=559

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPAN--MQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            N SGVFT DFPG P   FN++G  PAN  + T  GTK+YRL +NSTVQ+V+Q T  IAPE
Sbjct  399  NKSGVFTTDFPGNPPTAFNFSGGLPANASLATTRGTKLYRLAYNSTVQLVLQDTGTIAPE  458

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+G+GN++P+ DPKKFNL+DPVERNT +VPT GW AIRF ADNPGV
Sbjct  459  NHPVHLHGFNFFSVGRGIGNYNPKTDPKKFNLVDPVERNTANVPTGGWVAIRFIADNPGV  518

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAFLV+NGKGPN+S+LPPP DLPKC
Sbjct  519  WFMHCHLEVHTTWGLKMAFLVDNGKGPNQSLLPPPKDLPKC  559



>emb|CAB69847.1| laccase-like protein [Arabidopsis thaliana]
Length=553

 Score =   255 bits (652),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N++G++T DFP KPR  F++TG PP+N+ T   TK+Y+L +NSTVQ+V+Q T  +APE+H
Sbjct  395  NLTGIYTTDFPAKPRRVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENH  454

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G GN++ + D  KFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  455  PIHLHGFNFFVVGLGTGNYNSKKDSNKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWF  514

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SI PPPSDLPKC
Sbjct  515  MHCHLEVHTTWGLKMAFLVENGKGPNQSIRPPPSDLPKC  553



>ref|XP_006411009.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
 gb|ESQ52462.1| hypothetical protein EUTSA_v10016460mg [Eutrema salsugineum]
Length=557

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +IAPE+H
Sbjct  399  NISGVFTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG+NF+ VG+GLGNFDP+ DP  FNL+DPVERNTV VP+ GW  IRFRADNPGVWF
Sbjct  459  PIHLHGYNFFEVGRGLGNFDPKKDPNNFNLVDPVERNTVGVPSGGWVVIRFRADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP D PKC
Sbjct  519  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDFPKC  557



>ref|NP_195739.2| laccase 10 [Arabidopsis thaliana]
 sp|Q6ID18.1|LAC10_ARATH RecName: Full=Laccase-10; AltName: Full=Benzenediol:oxygen oxidoreductase 
10; AltName: Full=Diphenol oxidase 10; AltName: 
Full=Urishiol oxidase 10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAT41838.1| At5g01190 [Arabidopsis thaliana]
 gb|AED90308.1| laccase 10 [Arabidopsis thaliana]
Length=558

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N++G++T DFP KPR  F++TG PP+N+ T   TK+Y+L +NSTVQ+V+Q T  +APE+H
Sbjct  400  NLTGIYTTDFPAKPRRVFDFTGKPPSNLATMKATKLYKLPYNSTVQVVLQDTGNVAPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G GN++ + D  KFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  460  PIHLHGFNFFVVGLGTGNYNSKKDSNKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SI PPPSDLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVENGKGPNQSIRPPPSDLPKC  558



>ref|XP_010535416.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535417.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535418.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
 ref|XP_010535419.1| PREDICTED: laccase-16 [Tarenaya hassleriana]
Length=568

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N+ GVFTDDFP +P  P+NYTGT PAN  T  GT++YRL +N+ V+IV+Q T +I PE+H
Sbjct  410  NLPGVFTDDFPARPSHPYNYTGTQPANPATMKGTRLYRLPYNARVEIVLQDTGMITPENH  469

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+ + DPKKFNL+DPVERNTV VP  GW AIRF ADNPGVWF
Sbjct  470  PIHLHGFNFFEVGRGLGNFNQKKDPKKFNLVDPVERNTVGVPAGGWVAIRFTADNPGVWF  529

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLEIHTTWGLKMAF+V+NG GPN S+LPPP+DLPKC
Sbjct  530  MHCHLEIHTTWGLKMAFVVDNGDGPNHSLLPPPADLPKC  568



>sp|Q0IQU1.2|LAC22_ORYSJ RecName: Full=Laccase-22; AltName: Full=Benzenediol:oxygen oxidoreductase 
22; AltName: Full=Diphenol oxidase 22; AltName: 
Full=Urishiol oxidase 22; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAX95423.1| laccase (EC 1.10.3.2) precursor - common tobacco [Oryza sativa 
Japonica Group]
 gb|ABA95532.1| Multicopper oxidase family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ19339.1| hypothetical protein OsJ_34890 [Oryza sativa Japonica Group]
Length=564

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFT+DFP  P   FNYTG+ P N+QT NGT+VYRL +N++VQ+V+Q T II+PESH
Sbjct  406  NIPGVFTEDFPATPLHKFNYTGSGPKNLQTMNGTRVYRLPYNASVQVVLQDTGIISPESH  465

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVGKG+GN++P+  P  FNLIDP+ERNT+ VPT GWTAIRFR+DNPGVWF
Sbjct  466  PIHLHGFNFFVVGKGVGNYNPRTSPSTFNLIDPIERNTIGVPTGGWTAIRFRSDNPGVWF  525

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCH E+HT+WGLKMAF+V+NGK P+E+++PPP DLP+C
Sbjct  526  MHCHFEVHTSWGLKMAFVVDNGKRPSETLIPPPKDLPQC  564



>ref|XP_006287399.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
 gb|EOA20297.1| hypothetical protein CARUB_v10000605mg [Capsella rubella]
Length=558

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N +GV+T DFPG+PR  F++TG PP+N+ T   TK+Y+L +N+TVQ+V+Q T  +APE+H
Sbjct  400  NQTGVYTTDFPGRPRRVFDFTGKPPSNLATMKATKLYKLPYNATVQVVLQDTGNVAPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G GN++ + D KKFNL+DPVERNTV VP+ GW AIRFRADNPGVWF
Sbjct  460  PIHLHGFNFFVVGLGSGNYNSKRDSKKFNLVDPVERNTVGVPSGGWAAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGPN+SILPPP+DLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVDNGKGPNQSILPPPNDLPKC  558



>gb|AAK37829.1|AF132125_1 laccase [Pinus taeda]
Length=555

 Score =   254 bits (650),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNYTGTPP N+Q+ NGT++ R+ FNSTVQ+V+Q TS +  E+H
Sbjct  397  NISGVFTTDFPDNPPATFNYTGTPPKNLQSSNGTRLSRIPFNSTVQLVLQDTSALTVENH  456

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF++VG+G GN++P+ DP KFNL+DP ERNTV VPT GWT IRFRADNPGVWF
Sbjct  457  PVHLHGFNFFIVGRGFGNYNPKKDPAKFNLVDPPERNTVGVPTGGWTVIRFRADNPGVWF  516

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENG GP +SILPP  DLP+C
Sbjct  517  MHCHLEVHTTWGLKMAFLVENGHGPEQSILPPGKDLPQC  555



>emb|CDX91428.1| BnaC04g07220D [Brassica napus]
Length=558

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +IAPE+H
Sbjct  400  NISGVFTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+ + DP  FNL+DPVERNT+ VP+ GW  IRFRADNPGVWF
Sbjct  460  PIHLHGFNFFEVGRGLGNFNAKKDPSNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP DLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>ref|XP_009370205.1| PREDICTED: laccase-4 [Pyrus x bretschneideri]
Length=559

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 136/161 (84%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPAN--MQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            N SGVFT DFPG P   FN++G  PAN  + T +GTK+YRL +NSTVQ+V+Q T  IAPE
Sbjct  399  NKSGVFTTDFPGNPPTAFNFSGGLPANASLATTSGTKLYRLAYNSTVQLVLQDTGTIAPE  458

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+G+GN++ + DPKKFNL+DPVERNT +VPT GW AIRF ADNPGV
Sbjct  459  NHPVHLHGFNFFSVGRGIGNYNSKTDPKKFNLVDPVERNTANVPTGGWVAIRFIADNPGV  518

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAFLV+NGKGPN+S+LPPP DLPKC
Sbjct  519  WFMHCHLEVHTTWGLKMAFLVDNGKGPNQSLLPPPKDLPKC  559



>emb|CDX74915.1| BnaA05g06610D [Brassica napus]
Length=558

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +IAPE+H
Sbjct  400  NISGVFTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+ + DP  FNL+DPVERNT+ VP+ GW  IRFRADNPGVWF
Sbjct  460  PIHLHGFNFFEVGRGLGNFNAKKDPSNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP DLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>ref|XP_009143427.1| PREDICTED: laccase-4 [Brassica rapa]
Length=561

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +IAPE+H
Sbjct  403  NISGVFTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENH  462

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+ + DP  FNL+DPVERNT+ VP+ GW  IRFRADNPGVWF
Sbjct  463  PIHLHGFNFFEVGRGLGNFNAKKDPSNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWF  522

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP DLPKC
Sbjct  523  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  561



>ref|XP_007140382.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
 gb|ESW12376.1| hypothetical protein PHAVU_008G107100g [Phaseolus vulgaris]
Length=560

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            N  GVFT DFPG P   +NYT TP  A+ QT NGTKVYRL FNSTVQ+V+Q T +IA ES
Sbjct  401  NTQGVFTTDFPGNPPQVYNYTATPRAASSQTTNGTKVYRLAFNSTVQVVLQDTGVIALES  460

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVG G+GN+DP+ D   FNL+DPVERNT+ VPT GW A+RFRADNPGVW
Sbjct  461  HPIHLHGFNFFVVGSGVGNYDPKTDGSNFNLVDPVERNTIGVPTGGWIALRFRADNPGVW  520

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F+HCH E+HTTWGLKMAFLV+NGKGPNES++ PP+DLPKC
Sbjct  521  FLHCHFEVHTTWGLKMAFLVDNGKGPNESLIAPPNDLPKC  560



>ref|XP_007140300.1| hypothetical protein PHAVU_008G1006001g, partial [Phaseolus vulgaris]
 gb|ESW12294.1| hypothetical protein PHAVU_008G1006001g, partial [Phaseolus vulgaris]
Length=226

 Score =   243 bits (620),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPT  577
            +GV+T DFP KP +PFNYTGTPP N    NGTKV  L FN++V++V+Q TSI+  ESHP 
Sbjct  70   NGVYTTDFPTKPLVPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPL  129

Query  576  HLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMH  397
            HLHGFNF+VVG+G GN+DP  DP KFN++DPVERNTV VP+ GW AIRF ADNPGVWFMH
Sbjct  130  HLHGFNFFVVGQGFGNYDPNKDPAKFNVVDPVERNTVGVPSGGWVAIRFLADNPGVWFMH  189

Query  396  CHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            CHLE+HTTWGLKMA+LV +GK PN+ + PPP+DLPKC
Sbjct  190  CHLEVHTTWGLKMAWLVLDGKLPNQKLFPPPADLPKC  226



>emb|CDX93330.1| BnaC04g45660D [Brassica napus]
Length=560

 Score =   253 bits (646),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T IIAPE+H
Sbjct  402  NISGVFTPDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGIIAPENH  461

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG+NF+ VG+GLGNF+P+ DP  FNL+DPVERNT+ VP+ GW  IRFRADNPGVWF
Sbjct  462  PIHLHGYNFFEVGRGLGNFNPKKDPNNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWF  521

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP D PKC
Sbjct  522  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDFPKC  560



>ref|XP_008785423.1| PREDICTED: laccase-22 [Phoenix dactylifera]
Length=554

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N+SGVFTDDFPGKP I FNYTG+ P N+ T  GT+VYRL FNSTVQ+V+Q T IIAPE+H
Sbjct  396  NVSGVFTDDFPGKPPIAFNYTGSGPRNLGTMTGTRVYRLPFNSTVQLVLQDTGIIAPENH  455

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGN++P+  P KFNL+DPVERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  456  PIHLHGFNFFAVGRGLGNYNPKRSPSKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWF  515

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNES  319
            MHCHLE+HTTWGLKMAF+V+NGKGPNES
Sbjct  516  MHCHLEVHTTWGLKMAFVVDNGKGPNES  543



>ref|XP_009589148.1| PREDICTED: laccase-4-like [Nicotiana tomentosiformis]
Length=557

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFTDDFPG P   F+YTG PP N++T  GT++YRL +NS VQ+++Q T +++PE+H
Sbjct  399  NKSGVFTDDFPGNPAYTFDYTGIPPENLRTMEGTRLYRLAYNSNVQLIMQDTGLLSPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G GNFDP+ DP KFNL+DPVERNT++ P+ GW AIRF A+NPG+WF
Sbjct  459  PMHLHGFNFFVVGRGRGNFDPKEDPNKFNLVDPVERNTINAPSGGWVAIRFTANNPGIWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGLKMAF+V+NG GP ES+LPPP DLP C
Sbjct  519  LHCHLEVHTTWGLKMAFVVDNGNGPEESLLPPPIDLPTC  557



>ref|XP_003604619.1| Laccase 1a [Medicago truncatula]
 gb|AES86816.1| laccase/diphenol oxidase family protein [Medicago truncatula]
Length=557

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI  VFT DFP  P   +N+TG  P N+ T +GTK+Y+L FN TVQ+V+Q T IIAPESH
Sbjct  399  NIKNVFTADFPPNPPHIYNFTGAGPKNLNTTSGTKLYKLSFNDTVQLVMQDTGIIAPESH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G+GN+D +ND KKFNL+DPVERNTV VP  GW AIRFRADNPGVWF
Sbjct  459  PVHLHGFNFFVVGRGVGNYDSKNDSKKFNLVDPVERNTVGVPAGGWVAIRFRADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLV+NGKGP +S++ PP DLPKC
Sbjct  519  MHCHLEVHTTWGLKMAFLVDNGKGPKQSVIAPPKDLPKC  557



>ref|NP_565881.1| laccase-4 [Arabidopsis thaliana]
 sp|O80434.2|LAC4_ARATH RecName: Full=Laccase-4; AltName: Full=Benzenediol:oxygen oxidoreductase 
4; AltName: Full=Diphenol oxidase 4; AltName: Full=Protein 
IRREGULAR XYLEM 12; AltName: Full=Urishiol oxidase 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96573.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL36080.1| At2g38080/T8P21 [Arabidopsis thaliana]
 gb|AAL38363.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAC27158.2| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AAM47955.1| putative diphenol oxidase [Arabidopsis thaliana]
 gb|AEC09487.1| laccase-4 [Arabidopsis thaliana]
Length=558

 Score =   252 bits (644),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +IAPE+H
Sbjct  400  NTSGVFTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+   DPK FNL+DPVERNT+ VP+ GW  IRFRADNPGVWF
Sbjct  460  PVHLHGFNFFEVGRGLGNFNSTKDPKNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP DLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>ref|XP_006663136.1| PREDICTED: laccase-22-like [Oryza brachyantha]
Length=566

 Score =   253 bits (645),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFT DFP  P   FNYTG+ P N+QT NGT+VYRL +N++VQ+V+Q T II+PESH
Sbjct  408  NIPGVFTQDFPATPLHKFNYTGSGPKNLQTMNGTRVYRLPYNASVQVVLQDTGIISPESH  467

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G+GN++P+  P  FNLIDP+ERNTV VPT GWTAIRFRADNPGVWF
Sbjct  468  PIHLHGFNFFVVGRGVGNYNPKTSPSTFNLIDPIERNTVGVPTGGWTAIRFRADNPGVWF  527

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCH E+HT+WGLKM F+V+NGK P+E+++PPP DLP C
Sbjct  528  MHCHFEVHTSWGLKMVFVVDNGKRPSETLIPPPKDLPHC  566



>ref|XP_010690098.1| PREDICTED: laccase-4-like [Beta vulgaris subsp. vulgaris]
Length=565

 Score =   252 bits (643),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYT-GTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVFTDDFP KP   F+YT       + T NGTKVYRL +N+TVQ+V+Q TSIIAPES
Sbjct  406  NISGVFTDDFPSKPPTNFDYTIANYTGGLATMNGTKVYRLSYNATVQVVLQDTSIIAPES  465

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHG NF+VVG G GN++   D K FNL+DPVERNT+ VPT GWTAIRFRADNPGVW
Sbjct  466  HPLHLHGTNFFVVGMGTGNYNATKDFKNFNLVDPVERNTIDVPTGGWTAIRFRADNPGVW  525

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HT+WGLKMAFL+ENG GPN+SI+PPP DLPKC
Sbjct  526  FMHCHLEVHTSWGLKMAFLIENGDGPNKSIMPPPKDLPKC  565



>ref|XP_002879726.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55985.1| IRX12/LAC4 [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score =   251 bits (641),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +I+PE+H
Sbjct  399  NTSGVFTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVISPENH  458

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+   DPK FNLIDPVERNT+ VP+ GW  IRFRADNPGVWF
Sbjct  459  PVHLHGFNFFEVGRGLGNFNSTKDPKNFNLIDPVERNTIGVPSGGWVVIRFRADNPGVWF  518

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP DLPKC
Sbjct  519  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  557



>emb|CDY18406.1| BnaA04g21810D [Brassica napus]
Length=559

 Score =   251 bits (641),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +IAPE+H
Sbjct  401  NISGVFTPDFPKIPPHVFNYSGGSLTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG+NF+ VG+GLGNF+P+ DP  FNL+DPVERNT+ VP+ GW  IRFRADNPGVWF
Sbjct  461  PIHLHGYNFFEVGRGLGNFNPKKDPNNFNLVDPVERNTIGVPSGGWVVIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP D PKC
Sbjct  521  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDFPKC  559



>ref|XP_006293932.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
 gb|EOA26830.1| hypothetical protein CARUB_v10022927mg [Capsella rubella]
Length=558

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +I+PE+H
Sbjct  400  NKSGVFTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVISPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+ + DP  FNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  460  PLHLHGFNFFQVGRGLGNFNSKTDPNNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP DLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>emb|CBI30530.3| unnamed protein product [Vitis vinifera]
Length=261

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPTH  574
            GV+T DFP  P   FNYTGTPP+N+   +GTKV  L FN+ V++V+Q TSII  ESHP H
Sbjct  106  GVYTTDFPANPTFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPLH  165

Query  573  LHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMHC  394
            LHGFNFYVVG+G GNFDP+ DP  FNL+DP+ERNTV VP+ GW AIRFRADNPGVWFMHC
Sbjct  166  LHGFNFYVVGQGFGNFDPKKDPANFNLVDPIERNTVGVPSGGWVAIRFRADNPGVWFMHC  225

Query  393  HLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HLE+HT+WGLKMA++V +GK PN+ + PPPSDLPKC
Sbjct  226  HLEVHTSWGLKMAWVVTDGKRPNQKLPPPPSDLPKC  261



>ref|XP_004302643.1| PREDICTED: laccase-4-like [Fragaria vesca subsp. vesca]
Length=561

 Score =   250 bits (639),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 133/158 (84%), Gaps = 2/158 (1%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPAN--MQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            GVFT DFP  P   FN++G  PAN  + T NGTKVYRL +NSTVQ+V+Q T IIAPE+HP
Sbjct  404  GVFTTDFPANPPNAFNFSGGLPANSSLATTNGTKVYRLAYNSTVQLVLQDTGIIAPENHP  463

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+ +G+GLGN++P+ DPK FNL+DPVERNT+ VP+ GW AIRF ADNPGVWFM
Sbjct  464  VHLHGFNFFAIGRGLGNYNPKTDPKNFNLVDPVERNTIGVPSGGWVAIRFIADNPGVWFM  523

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HT+WGLKMAFLV+NGKGPN+S+LPPP DLP C
Sbjct  524  HCHLEVHTSWGLKMAFLVDNGKGPNQSLLPPPKDLPTC  561



>ref|XP_010509229.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +I+PE+H
Sbjct  400  NKSGVFTTDFPKNPPHVFNYSGGSVKNMATETGTRLYKLPYNATVQLVLQDTGVISPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+   DP  FNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  460  PLHLHGFNFFQVGRGLGNFNSTKDPNNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP DLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>ref|XP_009120399.1| PREDICTED: laccase-16 [Brassica rapa]
Length=565

 Score =   250 bits (638),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTG--TPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NIS VFTDDFP KP  PFNYT       N  T  GTK+YRL +N+TVQI++Q T++I  E
Sbjct  405  NISHVFTDDFPAKPSNPFNYTAPVDQSVNAATMTGTKLYRLPYNATVQIILQNTAMILSE  464

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+GLGNF+P+ DPK+FNL+DPVERNTV VP  GWTAIRF ADNPGV
Sbjct  465  NHPFHLHGFNFFEVGRGLGNFNPEKDPKRFNLVDPVERNTVGVPAGGWTAIRFIADNPGV  524

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLEIHTTWGLKMAF+V+NG GP++S+LPPP+DLPKC
Sbjct  525  WFMHCHLEIHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  565



>gb|KDP29119.1| hypothetical protein JCGZ_16508 [Jatropha curcas]
Length=349

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 132/158 (84%), Gaps = 1/158 (1%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHP  580
            SGVF  +FP +P  PFNYTG P  AN+ T +GT++ +L FNST+++V+Q T++++ ESHP
Sbjct  192  SGVFKTNFPDRPPTPFNYTGAPLTANLATSSGTRLSKLAFNSTIELVLQDTNLLSVESHP  251

Query  579  THLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFM  400
             HLHGFNF+VVG G+GNFDP  DP KFNL+DP ERNTV VPT GWTAIRFRADNPGVWFM
Sbjct  252  FHLHGFNFFVVGNGIGNFDPAKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVWFM  311

Query  399  HCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HCHLE+HT WGLKMAF+VENGK P++SILPPP DLP C
Sbjct  312  HCHLELHTMWGLKMAFVVENGKLPDQSILPPPKDLPPC  349



>ref|XP_010098906.1| hypothetical protein L484_006544 [Morus notabilis]
 gb|EXB76109.1| hypothetical protein L484_006544 [Morus notabilis]
Length=545

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 132/159 (83%), Gaps = 9/159 (6%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI  VFTDDFPG P   FNYTG  PAN+QT NGT++YRL +NS+VQ+V+QGTS+IAPE+H
Sbjct  396  NIGAVFTDDFPGNPPFRFNYTGPSPANIQTTNGTRLYRLAYNSSVQVVLQGTSVIAPENH  455

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            PTHLHGFNFYVVG GLGNFDP  DPKKFNL+DPVERNT+ VPTAGW AIRFRADNP    
Sbjct  456  PTHLHGFNFYVVGMGLGNFDPVEDPKKFNLVDPVERNTLGVPTAGWAAIRFRADNP----  511

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
                 E+HTTWGLKMAFLVENG GPNES+ PPP DLPKC
Sbjct  512  -----EVHTTWGLKMAFLVENGFGPNESLPPPPRDLPKC  545



>ref|XP_010923124.1| PREDICTED: laccase-22 [Elaeis guineensis]
Length=554

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 131/148 (89%), Gaps = 0/148 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFPGKP I FNY+G+ P+N+ T  GT+VYRL FNSTVQ+V+Q T IIAPE+H
Sbjct  396  NISGVFTADFPGKPPIAFNYSGSGPSNLGTMTGTRVYRLPFNSTVQLVLQDTGIIAPENH  455

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGN++P+  P KFNL+DPVERNT+ VP+ GWTAIRFRADNPGVWF
Sbjct  456  PIHLHGFNFFAVGRGLGNYNPKTSPSKFNLVDPVERNTIGVPSGGWTAIRFRADNPGVWF  515

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNES  319
            MHCHLE+HTTWGLKMAF+V+NGKGPNES
Sbjct  516  MHCHLEVHTTWGLKMAFVVDNGKGPNES  543



>ref|XP_010505418.1| PREDICTED: laccase-4 [Camelina sativa]
Length=558

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +I+PE+H
Sbjct  400  NKSGVFTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVISPENH  459

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ +G+GLGNF+   DP  FNL+DPVERNT+ VP+ GW AIRFRADNPGVWF
Sbjct  460  PLHLHGFNFFQIGRGLGNFNSTKDPNNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWF  519

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP DLPKC
Sbjct  520  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>ref|XP_004241179.1| PREDICTED: laccase-4-like [Solanum lycopersicum]
Length=560

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 136/160 (85%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            N SGVFTDDFPG P+  F+YTG PP N++T  GTK+YRL +NS VQI++Q T +++PE+H
Sbjct  401  NKSGVFTDDFPGNPQNVFDYTGVPPENLRTIEGTKLYRLEYNSNVQIILQDTGLLSPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPT-AGWTAIRFRADNPGVW  406
            P HLHGFNF+VVG+G GNF+P+ D KKFNL+DPVERNT++ P+  GW AIRFRA+NPGVW
Sbjct  461  PMHLHGFNFFVVGRGKGNFNPKEDFKKFNLVDPVERNTINAPSGGGWVAIRFRANNPGVW  520

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            F HCHLE+HTTWGLKMAF+V NG GPNES+LPPP D+PKC
Sbjct  521  FFHCHLEVHTTWGLKMAFVVNNGNGPNESLLPPPEDIPKC  560



>ref|XP_004980096.1| PREDICTED: laccase-22-like [Setaria italica]
Length=589

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFTDDFP  P   FNYTG+ P N+QT  GT+VYRL +N++VQ+V+Q T II+PESH
Sbjct  431  NIPGVFTDDFPATPPHKFNYTGSGPKNLQTMKGTRVYRLPYNASVQVVLQDTGIISPESH  490

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG G+GN++P+  P  FNLIDP+ERNT+ VPT GW AIRFRADNPGVWF
Sbjct  491  PIHLHGFNFFVVGNGVGNYNPKTSPSTFNLIDPIERNTIGVPTGGWAAIRFRADNPGVWF  550

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCH E+HT+WGLKM F+V+NGK P+E+++PPP DLP+C
Sbjct  551  MHCHFEVHTSWGLKMVFVVDNGKRPDETLIPPPKDLPQC  589



>ref|XP_006282033.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
 gb|EOA14931.1| hypothetical protein CARUB_v10028274mg [Capsella rubella]
Length=530

 Score =   248 bits (633),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 135/161 (84%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPP--ANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NISGVFTDDFP KP  P++YT       N  T  GTK+YRL +N+TVQ+V+Q T++I P+
Sbjct  370  NISGVFTDDFPAKPANPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQVVLQNTAMIVPD  429

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+GLGNF+P+ DPK FNL+DPVERNTV VP  GWTAIRF ADNPGV
Sbjct  430  NHPFHLHGFNFFEVGRGLGNFNPEKDPKMFNLVDPVERNTVGVPAGGWTAIRFIADNPGV  489

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAF+V+NG GP++S+LPPP+DLPKC
Sbjct  490  WFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  530



>emb|CDX80325.1| BnaC09g34170D [Brassica napus]
Length=570

 Score =   249 bits (636),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTG--TPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NIS VFTDDFP KP  P+NYT       N  T  GTK+YRL +N+TVQI++Q T++I  E
Sbjct  410  NISHVFTDDFPAKPSNPYNYTAPVDQSVNAATMTGTKLYRLPYNATVQIILQNTAMILSE  469

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+GLGNF+P+ DPK+FNL+DPVERNTV VP  GWTAIRF ADNPGV
Sbjct  470  NHPFHLHGFNFFEVGRGLGNFNPEKDPKRFNLVDPVERNTVGVPAGGWTAIRFIADNPGV  529

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLEIHTTWGLKMAF+V+NG GP++S+LPPP+DLPKC
Sbjct  530  WFMHCHLEIHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  570



>ref|XP_009141718.1| PREDICTED: laccase-4-like [Brassica rapa]
Length=559

 Score =   248 bits (634),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +IAPE+H
Sbjct  401  NISGVFTPDFPKIPPHVFNYSGGSLTNMATETGTRLYKLPYNATVQLVLQDTGVIAPENH  460

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG+NF+ VG+GLGNF+P+ DP  F L+DPVERNT+ VP+ GW  IRFRADNPGVWF
Sbjct  461  PIHLHGYNFFEVGRGLGNFNPKKDPNNFYLVDPVERNTIGVPSGGWVVIRFRADNPGVWF  520

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAFLVENGKGPN+SILPPP D PKC
Sbjct  521  MHCHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDFPKC  559



>ref|XP_010517091.1| PREDICTED: laccase-4-like [Camelina sativa]
Length=558

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPT  577
            SGVFT DFP  P   FNY+G    NM T+ GT++Y+L +N+TVQ+V+Q T +I+PE+HP 
Sbjct  402  SGVFTTDFPKNPPHVFNYSGGSVTNMATETGTRLYKLPYNATVQLVLQDTGVISPENHPL  461

Query  576  HLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMH  397
            HLHGFNF+ VG+GLGNF+   DP  FNL+DPVERNT+ VP+ GW AIRFRADNPGVWFMH
Sbjct  462  HLHGFNFFQVGRGLGNFNSTKDPNNFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMH  521

Query  396  CHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            CHLE+HTTWGLKMAFLVENGKGPN+SILPPP DLPKC
Sbjct  522  CHLEVHTTWGLKMAFLVENGKGPNQSILPPPKDLPKC  558



>ref|XP_010483503.1| PREDICTED: laccase-16-like isoform X3 [Camelina sativa]
Length=567

 Score =   248 bits (634),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFP KP  P++YT     N  T  GTK+YRL +N+TVQIV+Q T++I  ++H
Sbjct  409  NISGVFTDDFPAKPLNPYDYTAPLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSDNH  468

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGNF+P+ DPK FNL+DPVERNTV VP  GWTAIRF ADNPGVWF
Sbjct  469  PFHLHGFNFFEVGRGLGNFNPEKDPKIFNLVDPVERNTVGVPAGGWTAIRFIADNPGVWF  528

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+V+NG GP++S+LPPP+DLP+C
Sbjct  529  MHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPRC  567



>ref|XP_011080855.1| PREDICTED: laccase-4 [Sesamum indicum]
Length=554

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFTDDFPG P  P++YT     NM T  GT++YR+ +N++VQ+V+QGT +I PE+H
Sbjct  396  NIPGVFTDDFPGDPPTPYDYTARRVVNMGTTTGTRLYRVRYNASVQVVLQGTGMIFPENH  455

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VGKGLGNFD + D + FNL DPVERNT+ VP+ GW AIRF ADNPGVWF
Sbjct  456  PIHLHGFNFFAVGKGLGNFDSEKDTRSFNLDDPVERNTIVVPSGGWVAIRFIADNPGVWF  515

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HT+WGLKMAF+VENGKGPN+S+LPPP+DLPKC
Sbjct  516  LHCHLEVHTSWGLKMAFIVENGKGPNQSLLPPPNDLPKC  554



>ref|NP_200699.1| laccase 16 [Arabidopsis thaliana]
 gb|AED97116.1| laccase 16 [Arabidopsis thaliana]
Length=523

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPP--ANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NISGVFTDDFP KP  P++YT       N  T  GTK+YRL +N+TVQIV+Q T++I  +
Sbjct  363  NISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSD  422

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+GLGNF+P+ DPK FNL+DPVERNTV VP  GWTAIRF ADNPGV
Sbjct  423  NHPFHLHGFNFFEVGRGLGNFNPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGV  482

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAF+V+NG GP++S+LPPP+DLPKC
Sbjct  483  WFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  523



>gb|EMT07841.1| Laccase-4 [Aegilops tauschii]
Length=368

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPT  577
            SGV++ +FP  P+ PFNYTGTPP N    NGT++  L +   V++V+QGTSI+  ESHP 
Sbjct  212  SGVYSSNFPAVPQSPFNYTGTPPNNTNVSNGTRLVVLSYGDAVELVMQGTSILGAESHPF  271

Query  576  HLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMH  397
            HLHGFNF+VVG+G GNFDP  DP K+NL+DPVERNTV VP AGW AIRFRADNPGVWFMH
Sbjct  272  HLHGFNFFVVGQGFGNFDPAKDPAKYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMH  331

Query  396  CHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            CHLE+H +WGLKMA++V++G  PN+ +LPPPSDLPKC
Sbjct  332  CHLEVHVSWGLKMAWVVQDGSLPNQKLLPPPSDLPKC  368



>dbj|BAN10308.1| laccase [Chamaecyparis obtusa]
Length=555

 Score =   247 bits (631),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 128/159 (81%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFT DFP  P  PFNYTGTPP N+ T  GT+   L +NSTVQ+V+Q TSI+  ++H
Sbjct  397  NISGVFTKDFPDNPPTPFNYTGTPPKNLFTSKGTRATSLTYNSTVQLVLQDTSILTVDNH  456

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF++VG G GN++ + DP  FNL+DP ERNTV VPT GWTAIRFRADNPGVWF
Sbjct  457  PVHLHGFNFFIVGTGFGNYNSKTDPANFNLVDPAERNTVGVPTGGWTAIRFRADNPGVWF  516

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HTTWGLKMAF+VENG G  +S+LPPP DLP C
Sbjct  517  MHCHLEVHTTWGLKMAFVVENGNGAEQSVLPPPPDLPAC  555



>gb|ABE66261.1| laccase/diphenol oxidase [Arabidopsis thaliana]
Length=530

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTG--TPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NISGVFTDDFP KP  P++YT       N  T  GTK+YRL +N+TVQIV+Q T++I  +
Sbjct  370  NISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSD  429

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+GLGNF+P+ DPK FNL+DPVERNTV VP  GWTAIRF ADNPGV
Sbjct  430  NHPFHLHGFNFFEVGRGLGNFNPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGV  489

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAF+V+NG GP++S+LPPP+DLPKC
Sbjct  490  WFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  530



>gb|ABK28766.1| unknown [Arabidopsis thaliana]
Length=531

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPP--ANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NISGVFTDDFP KP  P++YT       N  T  GTK+YRL +N+TVQIV+Q T++I  +
Sbjct  370  NISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSD  429

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+GLGNF+P+ DPK FNL+DPVERNTV VP  GWTAIRF ADNPGV
Sbjct  430  NHPFHLHGFNFFEVGRGLGNFNPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGV  489

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAF+V+NG GP++S+LPPP+DLPKC
Sbjct  490  WFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  530



>dbj|BAJ98144.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=564

 Score =   246 bits (629),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            +I GVFT+DFP  P   FNYTG+ P N+QT NGT+VYRL +N++VQ+++Q T II+ ESH
Sbjct  406  SIPGVFTEDFPATPPHKFNYTGSGPNNLQTMNGTRVYRLPYNASVQVLLQDTGIISTESH  465

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G+GN++P++ P  FNLIDPVERNT+ VPT GWTAIRFRADNPGVWF
Sbjct  466  PIHLHGFNFFVVGRGIGNYNPKSSPFTFNLIDPVERNTIGVPTGGWTAIRFRADNPGVWF  525

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCH E+HT+WGLKM F+V+NGK P+E+++PPP DLP+C
Sbjct  526  MHCHFEVHTSWGLKMVFVVDNGKRPSETLIPPPKDLPQC  564



>sp|Q1PDH6.2|LAC16_ARATH RecName: Full=Laccase-16; AltName: Full=Benzenediol:oxygen oxidoreductase 
16; AltName: Full=Diphenol oxidase 16; AltName: 
Full=Urishiol oxidase 16; Flags: Precursor [Arabidopsis thaliana]
Length=566

 Score =   246 bits (629),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPP--ANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NISGVFTDDFP KP  P++YT       N  T  GTK+YRL +N+TVQIV+Q T++I  +
Sbjct  406  NISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSD  465

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+GLGNF+P+ DPK FNL+DPVERNTV VP  GWTAIRF ADNPGV
Sbjct  466  NHPFHLHGFNFFEVGRGLGNFNPEKDPKAFNLVDPVERNTVGVPAGGWTAIRFIADNPGV  525

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAF+V+NG GP++S+LPPP+DLPKC
Sbjct  526  WFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  566



>ref|XP_008449246.1| PREDICTED: laccase-11 [Cucumis melo]
Length=563

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NI GVFT DFP +P +PFNYTG P  AN+ T  GT++ +L FNSTV++V+Q T+++  ES
Sbjct  404  NIPGVFTADFPDRPAVPFNYTGVPLTANLATTLGTRLSKLAFNSTVELVLQDTNMLTVES  463

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHG+NF+VVG G+GNFDP+NDP K+NLIDP ERNTV VPT GW AIRFRADNPGVW
Sbjct  464  HPFHLHGYNFFVVGTGIGNFDPKNDPLKYNLIDPPERNTVGVPTGGWAAIRFRADNPGVW  523

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HT WGLKMAF+VENGK   ESILPPP+DLP C
Sbjct  524  FMHCHLELHTMWGLKMAFVVENGKSAEESILPPPADLPPC  563



>ref|XP_003558760.1| PREDICTED: laccase-22 [Brachypodium distachyon]
Length=561

 Score =   246 bits (629),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 106/159 (67%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFT+DFP  P   FNYTG+ P N++T NGT+VYRL +N++VQ+++Q T II+ ESH
Sbjct  403  NIPGVFTEDFPATPPHKFNYTGSGPKNLRTMNGTRVYRLPYNASVQVILQDTGIISTESH  462

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G+GN+ P+  P  FNLIDP+ERNT+ VPT GWTAIRFRADNPGVWF
Sbjct  463  PIHLHGFNFFVVGRGIGNYSPKTSPSTFNLIDPIERNTIGVPTGGWTAIRFRADNPGVWF  522

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCH E+HT+WGLKM F+VENGK P+E+++PPP DL +C
Sbjct  523  MHCHFEVHTSWGLKMVFVVENGKRPSETLIPPPKDLLQC  561



>ref|XP_004159811.1| PREDICTED: laccase-4-like [Cucumis sativus]
Length=355

 Score =   240 bits (613),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI GVFTDDFP  P   ++YTG PP N QT NGTKVYRL FNSTVQ+V+Q T++IAPESH
Sbjct  197  NIPGVFTDDFPANPPFVYDYTGKPPTNNQTSNGTKVYRLRFNSTVQLVLQDTAVIAPESH  256

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFN ++VG GLGNFDP  D K FNL+DPVERNT  VP  GW AIRFRADNPGVWF
Sbjct  257  PIHLHGFNVFIVGTGLGNFDPIEDWKGFNLVDPVERNTFGVPNGGWIAIRFRADNPGVWF  316

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGL+MAFLVENG+GPNES+ PPPSDLP+C
Sbjct  317  LHCHLEVHTTWGLRMAFLVENGEGPNESLPPPPSDLPQC  355



>ref|XP_003632636.1| PREDICTED: laccase-11 [Vitis vinifera]
 emb|CBI32739.3| unnamed protein product [Vitis vinifera]
Length=562

 Score =   245 bits (625),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 131/160 (82%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NI GVF  DFP +P  PFNYTG P  AN+ T  GT++ +L FNST+++V+Q T+++  ES
Sbjct  403  NIKGVFRTDFPDRPLAPFNYTGAPLTANLGTSLGTRLSKLAFNSTIELVLQDTNLLTVES  462

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHG+NF+VVG G+GNFDP+ DP KFNLIDP ERNTV VPT GWTAIRFRADNPGVW
Sbjct  463  HPFHLHGYNFFVVGNGIGNFDPKKDPAKFNLIDPPERNTVGVPTGGWTAIRFRADNPGVW  522

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HT WGLKMAF+VENGK P ES+LPPP DLP C
Sbjct  523  FMHCHLELHTMWGLKMAFVVENGKSPEESVLPPPKDLPPC  562



>gb|EPS60103.1| laccase 1a, partial [Genlisea aurea]
Length=546

 Score =   244 bits (624),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPTH  574
            GVFT DFPG P   F+YTG  P N+ T NGTK+YRL +N TVQIVIQ T +I  E+HP H
Sbjct  391  GVFTTDFPGNPPSSFDYTGRSPRNLATTNGTKLYRLKYNDTVQIVIQDTGMIMAENHPVH  450

Query  573  LHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMHC  394
            LHGFNF+ VGKGLGNF+   DPK+FNL+DPVERNT+ VP+ GW AIRFRADNPGVWFMHC
Sbjct  451  LHGFNFFGVGKGLGNFNSTADPKRFNLVDPVERNTIGVPSGGWVAIRFRADNPGVWFMHC  510

Query  393  HLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HLE+HTTWGLKMAFLV++G  P +++LPPP DLP C
Sbjct  511  HLEVHTTWGLKMAFLVDDGTSPEQTLLPPPKDLPTC  546



>gb|KDO50695.1| hypothetical protein CISIN_1g036540mg [Citrus sinensis]
Length=562

 Score =   245 bits (625),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVF  DFP +P +PFNYTG P  AN+ T  GT++ ++ FNST+++V+Q T+++  ES
Sbjct  403  NISGVFRTDFPDRPPVPFNYTGAPLTANLGTSLGTRLSKVAFNSTIELVLQDTNLLTVES  462

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHG+NF+VVG G+GNFDP+ DP KFNL+DP ERNTV VPT GWTAIRFRADNPGVW
Sbjct  463  HPFHLHGYNFFVVGSGIGNFDPKKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVW  522

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HT WGLKMAF+VENGK P++SI+PPP DLP C
Sbjct  523  FMHCHLELHTMWGLKMAFVVENGKSPDQSIVPPPKDLPPC  562



>ref|XP_002519529.1| laccase, putative [Ricinus communis]
 gb|EEF42943.1| laccase, putative [Ricinus communis]
Length=559

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVF  DFP +P +PFNYTG P  AN+ T +GT++ ++ FNS +++V+Q T+++  ES
Sbjct  400  NISGVFRTDFPDRPPVPFNYTGAPLTANIATSSGTRLSKVAFNSAIELVLQDTNLLTVES  459

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVG G+GNFDP  DP KFNL+DP ERNTV VPT GWTAIRFRADNPGVW
Sbjct  460  HPFHLHGFNFFVVGSGIGNFDPAKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVW  519

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HT WGLKMAF+VENGK P +S+LPPP DLP C
Sbjct  520  FMHCHLELHTMWGLKMAFVVENGKLPEQSVLPPPKDLPSC  559



>ref|XP_007140298.1| hypothetical protein PHAVU_008G100400g [Phaseolus vulgaris]
 gb|ESW12292.1| hypothetical protein PHAVU_008G100400g [Phaseolus vulgaris]
Length=625

 Score =   246 bits (628),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPTH  574
            GV+T DFP KP +PFNYTGTPP N    NGTKV  L FN++V++V+Q TSI+  ESHP H
Sbjct  470  GVYTTDFPTKPLVPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPLH  529

Query  573  LHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMHC  394
            LHGFNF+VVG+G GN+DP  DP KFNL+DPVERNTV VP+ GW AIRF ADNPGVWFMHC
Sbjct  530  LHGFNFFVVGQGFGNYDPNKDPAKFNLVDPVERNTVGVPSGGWVAIRFLADNPGVWFMHC  589

Query  393  HLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HLE+HT+WGLKMA++V +GK PN+ +LPPP DLPKC
Sbjct  590  HLEVHTSWGLKMAWIVLDGKLPNQKLLPPPEDLPKC  625



>ref|XP_008441433.1| PREDICTED: laccase-4-like [Cucumis melo]
Length=553

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NI G+FTDDFP  P   +NYTG PPAN QT NGTK+YRL FNSTVQ+V+Q T++IAPESH
Sbjct  395  NIPGIFTDDFPANPPFVYNYTGKPPANNQTSNGTKIYRLRFNSTVQLVLQDTAVIAPESH  454

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFN ++VG GLGNFDP  + K FNL+DPVERNT  VP  GWTAIRFRADNPGVWF
Sbjct  455  PIHLHGFNVFIVGTGLGNFDPIENSKGFNLVDPVERNTFGVPNGGWTAIRFRADNPGVWF  514

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            +HCHLE+HTTWGL+MAFLVENG+GPNES+ PPPSDLPKC
Sbjct  515  LHCHLEVHTTWGLRMAFLVENGEGPNESLPPPPSDLPKC  553



>ref|XP_006428774.1| hypothetical protein CICLE_v10013446mg [Citrus clementina]
 ref|XP_006481839.1| PREDICTED: laccase-11-like [Citrus sinensis]
 gb|ESR42014.1| hypothetical protein CICLE_v10013446mg [Citrus clementina]
Length=562

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVF  DFP +P +PFNYTG P  AN+ T  GT++ ++ FNST+++V+Q T+++  ES
Sbjct  403  NISGVFRTDFPDRPPVPFNYTGAPLTANLGTSLGTRLSKVAFNSTIELVLQDTNLLTVES  462

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHG+NF+VVG G+GNFDP+ DP KFNL+DP ERNTV VPT GWTAIRFRADNPGVW
Sbjct  463  HPFHLHGYNFFVVGSGIGNFDPKKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVW  522

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HT WGLKMAF+VENGK P++SI+PPP DLP C
Sbjct  523  FMHCHLELHTMWGLKMAFVVENGKSPDQSIVPPPKDLPPC  562



>ref|XP_004143251.1| PREDICTED: laccase-11-like [Cucumis sativus]
 ref|XP_004170658.1| PREDICTED: laccase-11-like [Cucumis sativus]
 gb|KGN48155.1| hypothetical protein Csa_6G445190 [Cucumis sativus]
Length=563

 Score =   244 bits (623),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 132/159 (83%), Gaps = 1/159 (1%)
 Frame = -1

Query  759  ISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            I GVFT DFP +P +PFNYTG P  AN+ T  GT++ +L FNSTV++V+Q T+++  ESH
Sbjct  405  IPGVFTADFPDRPAVPFNYTGVPLTANLATTLGTRLSKLAFNSTVELVLQDTNMLTVESH  464

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHG+NF+VVG G+GNFDP+NDP K+NLIDP ERNTV VPT GW AIRFRADNPGVWF
Sbjct  465  PFHLHGYNFFVVGTGIGNFDPKNDPLKYNLIDPPERNTVGVPTGGWAAIRFRADNPGVWF  524

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCHLE+HT WGLKMAF+VENGK   ESILPPP+DLP C
Sbjct  525  MHCHLELHTMWGLKMAFVVENGKSAEESILPPPADLPPC  563



>ref|XP_010454388.1| PREDICTED: laccase-16 [Camelina sativa]
Length=540

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 133/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPP--ANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NISGVFTDDFP KP  P++YT       N  T  GT++YRL +N+TVQIV+Q T++I  +
Sbjct  380  NISGVFTDDFPAKPSNPYDYTAPVKLGVNAATMKGTRLYRLPYNATVQIVLQNTAMILSD  439

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+GLGNF+P+ DPK FNL+DPVERNTV VP  GWTAIRF ADNPGV
Sbjct  440  NHPFHLHGFNFFEVGRGLGNFNPEKDPKMFNLVDPVERNTVGVPAGGWTAIRFIADNPGV  499

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAF+V+NG GP++S+LPPP DLPKC
Sbjct  500  WFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPVDLPKC  540



>gb|KDO48719.1| hypothetical protein CISIN_1g0085922mg, partial [Citrus sinensis]
Length=384

 Score =   239 bits (610),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPTH  574
            GV+T DFP  P   FNYTGTPP+N+   +GTKV  L FN++V++V+Q TSII  ESHP H
Sbjct  229  GVYTTDFPANPPFKFNYTGTPPSNIMVSSGTKVVVLPFNASVEVVMQDTSIIVAESHPLH  288

Query  573  LHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMHC  394
            LHGFNF+VV +G GNFDP  DP KFNL+DP ERNTV VP+ GW AIRF ADNPGVWFMHC
Sbjct  289  LHGFNFFVVAQGFGNFDPNKDPAKFNLVDPAERNTVGVPSGGWVAIRFLADNPGVWFMHC  348

Query  393  HLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HLE+HT+WGLKMA++V +GKGP + + PPPSDLPKC
Sbjct  349  HLEVHTSWGLKMAWIVNDGKGPKQKLPPPPSDLPKC  384



>ref|XP_008811561.1| PREDICTED: laccase-11-like [Phoenix dactylifera]
Length=541

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NI GVF  DFP KP   FNYTG P  AN+ T  GT++ R+ +NSTV++V+Q T+++A ES
Sbjct  382  NIKGVFRPDFPDKPAAAFNYTGAPLTANLGTSLGTRLSRIPYNSTVELVLQDTNLLAAES  441

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHG NF+VVG+G+GNFDP+ +P KFNL+DP ERNTV VPT GWTAIRFRADNPGVW
Sbjct  442  HPFHLHGSNFFVVGRGIGNFDPEKEPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVW  501

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HTTWGLKMAF+VENG GP ESILPPP DLP C
Sbjct  502  FMHCHLELHTTWGLKMAFVVENGNGPEESILPPPKDLPPC  541



>ref|XP_010924287.1| PREDICTED: laccase-11-like [Elaeis guineensis]
Length=559

 Score =   244 bits (622),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NI GVF  DFP KP   FNYTG P  AN+ T  GT++ R+ +NSTV++V+Q T+++APES
Sbjct  400  NIKGVFRLDFPDKPATTFNYTGAPLTANLGTSLGTRLSRIPYNSTVELVLQDTNLLAPES  459

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHG+NF+VVG+G+GNFDP+ DP K+NL+DP ERNTV VPT GWTAIRFRADNPGVW
Sbjct  460  HPFHLHGYNFFVVGRGIGNFDPKKDPAKYNLVDPPERNTVGVPTGGWTAIRFRADNPGVW  519

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HTTWGLKMAF+VENG G  +SILPPP DLP C
Sbjct  520  FMHCHLELHTTWGLKMAFVVENGNGTEQSILPPPKDLPPC  559



>ref|XP_010483501.1| PREDICTED: laccase-16-like isoform X1 [Camelina sativa]
 ref|XP_010483502.1| PREDICTED: laccase-16-like isoform X2 [Camelina sativa]
Length=569

 Score =   244 bits (623),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 134/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPP--ANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NISGVFTDDFP KP  P++YT       N  T  GTK+YRL +N+TVQIV+Q T++I  +
Sbjct  409  NISGVFTDDFPAKPLNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSD  468

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+GLGNF+P+ DPK FNL+DPVERNTV VP  GWTAIRF ADNPGV
Sbjct  469  NHPFHLHGFNFFEVGRGLGNFNPEKDPKIFNLVDPVERNTVGVPAGGWTAIRFIADNPGV  528

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAF+V+NG GP++S+LPPP+DLP+C
Sbjct  529  WFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPRC  569



>ref|XP_010907627.1| PREDICTED: laccase-22-like [Elaeis guineensis]
Length=554

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 128/148 (86%), Gaps = 0/148 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            NISGVFTDDFPGKP I FNYTG+ P N+ T  GT+VYRL FNS+VQ+V+Q T IIAPE+H
Sbjct  396  NISGVFTDDFPGKPPIDFNYTGSGPKNLGTMTGTRVYRLPFNSSVQVVLQDTGIIAPENH  455

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+ VG+GLGN++P   P KFNL+DPVERNT+ VP+ GWTAIRF ADNPGVWF
Sbjct  456  PLHLHGFNFFAVGRGLGNYNPNTSPYKFNLVDPVERNTIGVPSGGWTAIRFSADNPGVWF  515

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNES  319
            MHCHLE+HTTWGLKMAF+V+NG GP+ES
Sbjct  516  MHCHLEVHTTWGLKMAFVVDNGIGPDES  543



>ref|XP_010107530.1| hypothetical protein L484_024383 [Morus notabilis]
 gb|EXC16212.1| hypothetical protein L484_024383 [Morus notabilis]
Length=559

 Score =   243 bits (621),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            N+S VF  DFP +P +PFNYTG P  AN+ T+ GT++ ++ +NS+V++V+Q T+++  ES
Sbjct  400  NLSAVFAMDFPDRPPVPFNYTGAPLAANLGTKLGTRLSKVAYNSSVELVLQDTNLLTVES  459

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHGFNF+VVG G+GNFDP  DP KFNL+DP ERNTV VPT GWTAIRFRADNPGVW
Sbjct  460  HPFHLHGFNFFVVGSGIGNFDPAKDPAKFNLVDPPERNTVGVPTGGWTAIRFRADNPGVW  519

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HT WGLKMAF+VENGK P+ESILPPP DLP C
Sbjct  520  FMHCHLELHTMWGLKMAFVVENGKSPSESILPPPKDLPPC  559



>gb|EMT26873.1| Laccase-22 [Aegilops tauschii]
Length=563

 Score =   244 bits (622),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESH  583
            +I GVFT+DFP  P   FNYTG+ P N+QT  GT+V+RL +N++VQ+++Q T II+ ESH
Sbjct  405  SIPGVFTEDFPATPPHKFNYTGSGPKNLQTMKGTRVHRLPYNASVQVILQDTGIISTESH  464

Query  582  PTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWF  403
            P HLHGFNF+VVG+G+GN++P+  P  FNLIDPVERNT+ VPT GWTAIRFRADNPGVWF
Sbjct  465  PIHLHGFNFFVVGRGVGNYNPKASPSTFNLIDPVERNTIGVPTGGWTAIRFRADNPGVWF  524

Query  402  MHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            MHCH E+HT+WGLKM F+V+NGK P+E+++PPP DLP+C
Sbjct  525  MHCHFEVHTSWGLKMVFVVDNGKRPSETLIPPPKDLPQC  563



>ref|XP_002866298.1| hypothetical protein ARALYDRAFT_496014 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42557.1| hypothetical protein ARALYDRAFT_496014 [Arabidopsis lyrata subsp. 
lyrata]
Length=523

 Score =   243 bits (619),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 133/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPP--ANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NISGVFTDDFP  P  P++YT       N  T  GTK+YRL +N+TVQIV+Q T++I  +
Sbjct  363  NISGVFTDDFPANPSNPYDYTAPVKIGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSD  422

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+G+GNF+P+ DPK FNL+DPVERNTV VP  GWTAIRF ADNPGV
Sbjct  423  NHPFHLHGFNFFEVGRGMGNFNPEKDPKMFNLVDPVERNTVGVPAGGWTAIRFIADNPGV  482

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAF+V+NG GP++++LPPP+DLPKC
Sbjct  483  WFMHCHLELHTTWGLKMAFVVDNGHGPDQALLPPPADLPKC  523



>ref|NP_001147942.1| L-ascorbate oxidase precursor [Zea mays]
 gb|ACG29196.1| L-ascorbate oxidase precursor [Zea mays]
Length=582

 Score =   244 bits (622),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPTH  574
            GV++ +FP  P +PFNYTGTPP N    NGTK+  L + ++V++V+QGTSI+  ESHP H
Sbjct  427  GVYSSNFPAAPLVPFNYTGTPPNNTNVSNGTKLVVLPYGTSVELVMQGTSILGAESHPLH  486

Query  573  LHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMHC  394
            LHGFNF+VVG+G GNFDP  DP K+NL+DPVERNTV VP AGW AIRFRADNPGVWFMHC
Sbjct  487  LHGFNFFVVGQGFGNFDPAKDPAKYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMHC  546

Query  393  HLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HLE+H +WGLKMA+LV +G  PNE +LPPPSDLPKC
Sbjct  547  HLEVHVSWGLKMAWLVLDGDRPNEKLLPPPSDLPKC  582



>ref|XP_002458747.1| hypothetical protein SORBIDRAFT_03g039530 [Sorghum bicolor]
 gb|EES03867.1| hypothetical protein SORBIDRAFT_03g039530 [Sorghum bicolor]
Length=579

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPTH  574
            GV++ +FP  P +PFNYTGTPP N    NGTK+  L + ++V++V+QGTSI+  ESHP H
Sbjct  424  GVYSSNFPAAPLVPFNYTGTPPNNTNVANGTKLVVLPYGASVELVLQGTSILGAESHPLH  483

Query  573  LHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMHC  394
            LHGFNF+VVG+G GNFDP  DP K+NL+DPVERNTV VP AGW AIRFRADNPGVWFMHC
Sbjct  484  LHGFNFFVVGQGFGNFDPAKDPAKYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMHC  543

Query  393  HLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HLE+H +WGLKMA+LV +G  PNE +LPPPSDLP+C
Sbjct  544  HLEVHVSWGLKMAWLVLDGDRPNEKLLPPPSDLPRC  579



>ref|XP_010443638.1| PREDICTED: laccase-16-like [Camelina sativa]
Length=568

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 133/161 (83%), Gaps = 2/161 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTPP--ANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPE  589
            NISGVFTDDFP KP  P++YT       N  T  GTK+YRL +N+TVQIV+Q T++I  +
Sbjct  408  NISGVFTDDFPAKPLNPYDYTAPVKLGVNAATMKGTKLYRLPYNATVQIVLQNTAMILSD  467

Query  588  SHPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGV  409
            +HP HLHGFNF+ VG+GLGNF+ + DPK FNL+DPVERNTV VP  GWTAIRF ADNPGV
Sbjct  468  NHPFHLHGFNFFEVGRGLGNFNSEKDPKMFNLVDPVERNTVGVPAGGWTAIRFIADNPGV  527

Query  408  WFMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            WFMHCHLE+HTTWGLKMAF+V+NG GP++S+LPPP+DLPKC
Sbjct  528  WFMHCHLELHTTWGLKMAFVVDNGHGPDQSLLPPPADLPKC  568



>gb|KHG01609.1| Laccase-11 -like protein [Gossypium arboreum]
Length=562

 Score =   243 bits (619),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 133/160 (83%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVF  DFP KP  PFNYTG P  AN+ T +GT++ ++ FNSTV++V+Q T+++  ES
Sbjct  403  NISGVFRTDFPDKPPKPFNYTGAPLTANLGTAHGTRLSKIAFNSTVELVLQDTNLLTVES  462

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHG+NF+VVG G+GNFDP  DP K+NL+DPVERNTV VPT GWTAIRFRADNPGVW
Sbjct  463  HPFHLHGYNFFVVGTGIGNFDPVKDPAKYNLVDPVERNTVGVPTGGWTAIRFRADNPGVW  522

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HT WGLKMAF VE+GKG ++SILPPP DLP C
Sbjct  523  FMHCHLELHTGWGLKMAFEVEDGKGADQSILPPPKDLPPC  562



>ref|XP_010654256.1| PREDICTED: laccase-17-like isoform X2 [Vitis vinifera]
Length=573

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPTH  574
            GV+T DFP  P   FNYTGTPP+N+   +GTKV  L FN+ V++V+Q TSII  ESHP H
Sbjct  418  GVYTTDFPANPTFKFNYTGTPPSNILVNSGTKVVVLPFNTRVELVLQDTSIIGAESHPLH  477

Query  573  LHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMHC  394
            LHGFNFYVVG+G GNFDP+ DP  FNL+DP+ERNTV VP+ GW AIRFRADNPGVWFMHC
Sbjct  478  LHGFNFYVVGQGFGNFDPKKDPANFNLVDPIERNTVGVPSGGWVAIRFRADNPGVWFMHC  537

Query  393  HLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HLE+HT+WGLKMA++V +GK PN+ + PPPSDLPKC
Sbjct  538  HLEVHTSWGLKMAWVVTDGKRPNQKLPPPPSDLPKC  573



>gb|ACN34362.1| unknown [Zea mays]
 tpg|DAA56880.1| TPA: putative laccase family protein [Zea mays]
Length=582

 Score =   243 bits (619),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPTH  574
            GV++ +FP  P +PFNYTGTPP N    NGTK+  L + ++V++V+QGTSI+  ESHP H
Sbjct  427  GVYSSNFPAAPLVPFNYTGTPPNNTNVSNGTKLVVLPYGTSVELVMQGTSILGAESHPLH  486

Query  573  LHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMHC  394
            LHGFNF+VVG+G GNFDP  DP K+NL+DPVERNTV VP AGW AIRFRADNPGVWFMHC
Sbjct  487  LHGFNFFVVGQGFGNFDPAKDPAKYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMHC  546

Query  393  HLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HLE+H +WGLKMA+LV +G+ PNE +LPPPSDLP C
Sbjct  547  HLEVHVSWGLKMAWLVLDGERPNEKLLPPPSDLPTC  582



>ref|XP_008246065.1| PREDICTED: laccase-11-like, partial [Prunus mume]
Length=349

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 129/160 (81%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            N+ GVF  DFP +P+  FNYTG P  AN+ T  GT++ ++ FNSTV++V+Q T+++  ES
Sbjct  190  NLKGVFKTDFPDRPQTSFNYTGAPLTANLGTSTGTRLSKIAFNSTVELVLQDTNLLTVES  249

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHG+NF+VVG G+GNFDP  DP K+NL+DPVERNTV VPT GWTAIRFRADNPGVW
Sbjct  250  HPFHLHGYNFFVVGTGIGNFDPAKDPAKYNLVDPVERNTVGVPTGGWTAIRFRADNPGVW  309

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HT WGLK AF+VE+G G + S+LPPP DLP C
Sbjct  310  FMHCHLELHTGWGLKTAFVVEDGPGSDHSVLPPPKDLPPC  349



>gb|KHN16225.1| Laccase-17, partial [Glycine soja]
Length=540

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPT  577
            +GV+T DFP KP IPFNYTGTPP N    NGTKV  L FN++V++V+Q TSI+  ESHP 
Sbjct  384  NGVYTADFPAKPLIPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPL  443

Query  576  HLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMH  397
            HLHGFNF+ VG+G GNFDP  DP  FNL+DP+ERNTV VP+ GW AIRF ADNPGVWFMH
Sbjct  444  HLHGFNFFAVGQGFGNFDPNKDPANFNLLDPIERNTVGVPSGGWVAIRFLADNPGVWFMH  503

Query  396  CHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            CHLE+HT+WGLKMA++V +GK PN+ + PPP+DLPKC
Sbjct  504  CHLEVHTSWGLKMAWVVLDGKLPNQKLFPPPADLPKC  540



>dbj|BAF01776.1| laccase (diphenol oxidase)-like protein [Arabidopsis thaliana]
Length=339

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 128/160 (80%), Gaps = 1/160 (1%)
 Frame = -1

Query  762  NISGVFTDDFPGKPRIPFNYTGTP-PANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPES  586
            NISGVF  DFP +P   FNYTG P  AN+ T  GT++ R+ FN+T+++V+Q T+++  ES
Sbjct  180  NISGVFRTDFPDRPPKAFNYTGVPLTANLGTSTGTRLSRVKFNTTIELVLQDTNLLTVES  239

Query  585  HPTHLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVW  406
            HP HLHG+NF+VVG G+GNFDP+ DP KFNL+DP ERNTV VPT GW AIRFRADNPGVW
Sbjct  240  HPFHLHGYNFFVVGTGVGNFDPKKDPAKFNLVDPPERNTVGVPTGGWAAIRFRADNPGVW  299

Query  405  FMHCHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            FMHCHLE+HT WGLKMAF+VENG+ P  S+LPPP D P C
Sbjct  300  FMHCHLEVHTMWGLKMAFVVENGETPELSVLPPPKDYPSC  339



>emb|CDM84967.1| unnamed protein product [Triticum aestivum]
 emb|CDM85765.1| unnamed protein product [Triticum aestivum]
Length=571

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = -1

Query  753  GVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPTH  574
            GV++ +FP  P+ PFNYTGTPP N    NGT++  L +   V++V+QGTSI+  ESHP H
Sbjct  416  GVYSSNFPAVPKSPFNYTGTPPNNTNVSNGTRLVVLSYGDAVELVMQGTSILGAESHPFH  475

Query  573  LHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMHC  394
            LHGFNF+VVG+G GNFDP  DP K+NL+DPVERNTV VP AGW AIRFRADNPGVWFMHC
Sbjct  476  LHGFNFFVVGQGFGNFDPVKDPAKYNLVDPVERNTVGVPAAGWVAIRFRADNPGVWFMHC  535

Query  393  HLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            HLE+H +WGLKMA++V++G  PN+ +LPPPSDLPKC
Sbjct  536  HLEVHVSWGLKMAWVVQDGSLPNQKLLPPPSDLPKC  571



>gb|KHN16226.1| Laccase-17 [Glycine soja]
Length=578

 Score =   242 bits (617),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -1

Query  756  SGVFTDDFPGKPRIPFNYTGTPPANMQTQNGTKVYRLGFNSTVQIVIQGTSIIAPESHPT  577
            +GV+T DFP KP IPFNYTGTPP N    NGTKV  L FN++V++V+Q TSI+  ESHP 
Sbjct  422  NGVYTADFPAKPLIPFNYTGTPPNNTMVSNGTKVVVLPFNTSVELVMQDTSILGAESHPL  481

Query  576  HLHGFNFYVVGKGLGNFDPQNDPKKFNLIDPVERNTVSVPTAGWTAIRFRADNPGVWFMH  397
            HLHGFNF+ VG+G GNFDP  DP  FNL+DP+ERNTV VP+ GW AIRF ADNPGVWFMH
Sbjct  482  HLHGFNFFAVGQGFGNFDPNKDPANFNLLDPIERNTVGVPSGGWVAIRFLADNPGVWFMH  541

Query  396  CHLEIHTTWGLKMAFLVENGKGPNESILPPPSDLPKC  286
            CHLE+HT+WGLKMA++V +GK PN+ + PPP+DLPKC
Sbjct  542  CHLEVHTSWGLKMAWVVLDGKLPNQKLFPPPADLPKC  578



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1346324970506