BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25441_g6_i1 len=860 path=[4455:0-829 5285:830-859]

Length=860
                                                                      Score     E

ref|XP_009764218.1|  PREDICTED: probable pectinesterase/pectinest...    240   1e-71   
ref|XP_009628695.1|  PREDICTED: probable pectinesterase/pectinest...    232   2e-68   
ref|XP_011090455.1|  PREDICTED: probable pectinesterase/pectinest...    226   3e-66   
ref|XP_010098937.1|  putative pectinesterase/pectinesterase inhib...    219   2e-63   
ref|XP_002511680.1|  Pectinesterase-2 precursor, putative               216   1e-62   Ricinus communis
emb|CDO97715.1|  unnamed protein product                                214   1e-61   
gb|EYU31970.1|  hypothetical protein MIMGU_mgv1a025432mg                210   2e-60   
ref|XP_010692199.1|  PREDICTED: probable pectinesterase/pectinest...    207   1e-59   
ref|XP_010661658.1|  PREDICTED: probable pectinesterase/pectinest...    201   6e-57   
emb|CAN75818.1|  hypothetical protein VITISV_005130                     200   1e-56   Vitis vinifera
ref|XP_006347998.1|  PREDICTED: probable pectinesterase/pectinest...    198   8e-56   
ref|XP_004231159.2|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    193   7e-54   
ref|XP_004506985.1|  PREDICTED: probable pectinesterase/pectinest...    192   3e-53   
ref|XP_010058465.1|  PREDICTED: probable pectinesterase/pectinest...    192   3e-53   
gb|KEH29120.1|  pectinesterase/pectinesterase inhibitor                 191   5e-53   
ref|XP_010544635.1|  PREDICTED: probable pectinesterase/pectinest...    191   5e-53   
gb|KDP28779.1|  hypothetical protein JCGZ_14550                         189   2e-52   
ref|XP_007219055.1|  hypothetical protein PRUPE_ppa004770mg             188   7e-52   
ref|XP_008232608.1|  PREDICTED: probable pectinesterase/pectinest...    187   2e-51   
ref|XP_006402549.1|  hypothetical protein EUTSA_v10006472mg             186   9e-51   
ref|XP_010247589.1|  PREDICTED: probable pectinesterase/pectinest...    184   2e-50   
ref|XP_003521962.2|  PREDICTED: probable pectinesterase/pectinest...    184   2e-50   
gb|KHN35621.1|  Putative pectinesterase/pectinesterase inhibitor 36     183   3e-50   
emb|CAB82677.1|  pectinesterase-like protein                            183   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876579.1|  pectinesterase family protein                      180   7e-49   
emb|CDY41145.1|  BnaA09g38700D                                          180   8e-49   
ref|NP_191632.2|  putative pectinesterase/pectinesterase inhibito...    180   9e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAP04164.1|  putative pectinesterase                                 180   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006604099.1|  PREDICTED: probable pectinesterase/pectinest...    177   2e-48   
emb|CDX71786.1|  BnaC08g30880D                                          179   3e-48   
ref|XP_003553884.1|  PREDICTED: probable pectinesterase/pectinest...    177   6e-48   
ref|XP_009116752.1|  PREDICTED: probable pectinesterase/pectinest...    177   1e-47   
ref|XP_010941122.1|  PREDICTED: pectinesterase                          175   4e-47   
ref|XP_008794816.1|  PREDICTED: pectinesterase                          175   4e-47   
ref|XP_006292970.1|  hypothetical protein CARUB_v10019247mg             175   7e-47   
ref|XP_007134835.1|  hypothetical protein PHAVU_010G080300g             173   2e-46   
ref|XP_007052105.1|  Plant invertase/pectin methylesterase inhibi...    174   3e-46   
ref|XP_004168286.1|  PREDICTED: probable pectinesterase/pectinest...    169   5e-45   
ref|XP_004134349.1|  PREDICTED: probable pectinesterase/pectinest...    169   5e-45   
ref|XP_004308463.1|  PREDICTED: probable pectinesterase/pectinest...    156   2e-42   
ref|XP_008438191.1|  PREDICTED: probable pectinesterase/pectinest...    161   4e-42   
gb|KHN21590.1|  Putative pectinesterase/pectinesterase inhibitor 6      154   2e-39   
ref|XP_006580437.1|  PREDICTED: probable pectinesterase/pectinest...    154   2e-39   
ref|XP_010044212.1|  PREDICTED: pectinesterase                          154   5e-39   
ref|XP_010497220.1|  PREDICTED: probable pectinesterase/pectinest...    148   1e-38   
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             152   1e-38   
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    149   1e-37   
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      149   1e-37   
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     147   9e-37   
ref|XP_010469150.1|  PREDICTED: probable pectinesterase/pectinest...    146   2e-36   
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     146   2e-36   
ref|XP_004297462.1|  PREDICTED: probable pectinesterase/pectinest...    146   2e-36   
ref|XP_010413524.1|  PREDICTED: probable pectinesterase/pectinest...    145   4e-36   
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    144   8e-36   
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    144   9e-36   
ref|XP_011070723.1|  PREDICTED: LOW QUALITY PROTEIN: pectinesterase     144   1e-35   
gb|EYU33116.1|  hypothetical protein MIMGU_mgv1a022674mg                144   1e-35   
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    143   2e-35   
ref|XP_008438192.1|  PREDICTED: probable pectinesterase/pectinest...    142   3e-35   
gb|EYU24929.1|  hypothetical protein MIMGU_mgv1a025888mg                141   9e-35   
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         140   1e-34   
ref|XP_009625343.1|  PREDICTED: pectinesterase-like                     140   2e-34   
ref|XP_002314796.1|  pectin methylesterase 6 family protein             140   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_008389982.1|  PREDICTED: pectinesterase                          140   3e-34   
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 139   4e-34   
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               139   8e-34   Ricinus communis
ref|XP_009351519.1|  PREDICTED: pectinesterase-like                     138   9e-34   
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         138   1e-33   
gb|KHN16553.1|  Pectinesterase 2                                        137   1e-33   
ref|XP_010654104.1|  PREDICTED: pectinesterase                          138   1e-33   
gb|AER38244.1|  PME5                                                    137   2e-33   
gb|AFW03479.1|  pectin methylesterase 5                                 137   3e-33   
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   136   5e-33   
ref|XP_007052106.1|  Pectinesterase 2                                   136   5e-33   
ref|XP_009409661.1|  PREDICTED: pectinesterase-like                     136   6e-33   
ref|XP_010101978.1|  putative pectinesterase/pectinesterase inhib...    131   8e-33   
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     135   1e-32   
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               135   1e-32   Ricinus communis
ref|XP_009351517.1|  PREDICTED: pectinesterase-like                     135   1e-32   
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     135   1e-32   
gb|AFW03484.1|  pectin methylesterase 5                                 135   1e-32   
gb|KHG19575.1|  Uncharacterized protein F383_07269                      135   1e-32   
ref|XP_006646399.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    134   2e-32   
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        134   4e-32   
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   133   5e-32   
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     133   5e-32   
gb|KFK44409.1|  hypothetical protein AALP_AA1G253400                    133   6e-32   
ref|XP_006307093.1|  hypothetical protein CARUB_v10008680mg             133   7e-32   
ref|XP_008438193.1|  PREDICTED: pectinesterase 2                        133   8e-32   
emb|CDP00815.1|  unnamed protein product                                133   8e-32   
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   132   9e-32   
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    132   1e-31   Populus trichocarpa [western balsam poplar]
ref|XP_003630890.1|  Pectinesterase                                     132   2e-31   
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   132   2e-31   
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             131   2e-31   
ref|XP_004503381.1|  PREDICTED: probable pectinesterase/pectinest...    131   3e-31   
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     131   3e-31   
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   131   3e-31   
ref|XP_008367065.1|  PREDICTED: probable pectinesterase/pectinest...    128   4e-31   
emb|CAN77092.1|  hypothetical protein VITISV_026596                     130   4e-31   Vitis vinifera
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    130   5e-31   Populus trichocarpa [western balsam poplar]
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   130   5e-31   
ref|XP_009589961.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    130   6e-31   
ref|XP_009589755.1|  PREDICTED: pectinesterase-like                     130   8e-31   
ref|XP_003630895.1|  Pectinesterase                                     128   1e-30   
ref|XP_010460102.1|  PREDICTED: probable pectinesterase/pectinest...    129   1e-30   
ref|XP_009769268.1|  PREDICTED: pectinesterase-like                     129   2e-30   
ref|XP_010684811.1|  PREDICTED: pectinesterase-like                     129   2e-30   
ref|XP_006448208.1|  hypothetical protein CICLE_v10014888mg             129   2e-30   
ref|XP_006469215.1|  PREDICTED: probable pectinesterase/pectinest...    129   2e-30   
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   129   2e-30   
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    129   2e-30   
ref|XP_004150118.1|  PREDICTED: probable pectinesterase/pectinest...    129   3e-30   
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          128   3e-30   
emb|CBI23178.3|  unnamed protein product                                128   3e-30   
ref|XP_010552690.1|  PREDICTED: probable pectinesterase/pectinest...    128   3e-30   
emb|CDO99717.1|  unnamed protein product                                128   4e-30   
ref|XP_004133929.1|  PREDICTED: pectinesterase 2-like                   128   4e-30   
ref|XP_002266980.1|  PREDICTED: pectinesterase                          128   5e-30   Vitis vinifera
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        127   5e-30   Vitis vinifera
emb|CAN83663.1|  hypothetical protein VITISV_017689                     127   6e-30   Vitis vinifera
ref|XP_010259196.1|  PREDICTED: pectinesterase 2-like                   127   6e-30   
ref|XP_004167644.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    127   6e-30   
dbj|BAJ34238.1|  unnamed protein product                                127   6e-30   
ref|XP_006416115.1|  hypothetical protein EUTSA_v10007274mg             127   7e-30   
gb|KDP20786.1|  hypothetical protein JCGZ_21257                         127   7e-30   
ref|XP_010267745.1|  PREDICTED: pectinesterase                          127   7e-30   
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    127   8e-30   
ref|XP_011000694.1|  PREDICTED: pectinesterase                          127   1e-29   
ref|NP_173733.1|  probable pectinesterase/pectinesterase inhibitor 6    127   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010101471.1|  Pectinesterase/pectinesterase inhibitor            127   1e-29   
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   126   1e-29   
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        126   2e-29   
emb|CBI24286.3|  unnamed protein product                                125   2e-29   
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   125   3e-29   Vitis vinifera
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        125   3e-29   Vitis vinifera
ref|XP_010325628.1|  PREDICTED: pectinesterase 2                        125   3e-29   
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        125   3e-29   Vitis vinifera
sp|P83947.1|PME1_FICPW  RecName: Full=Pectinesterase/pectinestera...    125   3e-29   Ficus pumila var. awkeotsang [jelly fig]
emb|CBI24285.3|  unnamed protein product                                125   3e-29   
ref|XP_008221458.1|  PREDICTED: pectinesterase                          125   3e-29   
emb|CAN76835.1|  hypothetical protein VITISV_043176                     125   3e-29   Vitis vinifera
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             125   4e-29   
emb|CDO99718.1|  unnamed protein product                                125   4e-29   
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   125   5e-29   
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   124   5e-29   
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             124   5e-29   
emb|CDY04739.1|  BnaC05g18500D                                          124   6e-29   
ref|XP_002317208.1|  pectin methylesterase family protein               125   6e-29   Populus trichocarpa [western balsam poplar]
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        124   6e-29   
ref|XP_003622699.1|  Pectinesterase                                     125   7e-29   
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     124   7e-29   
ref|XP_010098938.1|  Pectinesterase 2                                   124   8e-29   
ref|XP_002890570.1|  predicted protein                                  124   8e-29   
ref|XP_006843574.1|  hypothetical protein AMTR_s00007p00101250          124   8e-29   
emb|CDO97716.1|  unnamed protein product                                124   9e-29   
ref|XP_004296684.1|  PREDICTED: probable pectinesterase/pectinest...    124   9e-29   
ref|XP_003564371.1|  PREDICTED: pectinesterase                          124   9e-29   
ref|XP_010477609.1|  PREDICTED: probable pectinesterase/pectinest...    124   1e-28   
ref|NP_001044480.1|  Os01g0788400                                       124   1e-28   Oryza sativa Japonica Group [Japonica rice]
gb|KEH29125.1|  pectinesterase/pectinesterase inhibitor                 123   1e-28   
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   123   1e-28   
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     123   2e-28   
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 123   2e-28   
ref|XP_007038413.1|  Pectinesterase                                     123   2e-28   
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   123   2e-28   
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   123   2e-28   
ref|XP_010498826.1|  PREDICTED: probable pectinesterase/pectinest...    123   2e-28   
emb|CDY21422.1|  BnaA09g30050D                                          123   2e-28   
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   123   2e-28   
ref|XP_006347887.1|  PREDICTED: pectinesterase 2-like                   122   3e-28   
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        122   3e-28   
ref|XP_008224789.1|  PREDICTED: pectinesterase                          123   3e-28   
ref|XP_006348082.1|  PREDICTED: pectinesterase/pectinesterase inh...    122   3e-28   
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        123   3e-28   
ref|XP_009771261.1|  PREDICTED: pectinesterase-like                     122   3e-28   
ref|XP_011016743.1|  PREDICTED: pectinesterase-like                     122   3e-28   
ref|XP_008367911.1|  PREDICTED: probable pectinesterase/pectinest...    121   3e-28   
ref|XP_008467117.1|  PREDICTED: pectinesterase                          122   4e-28   
ref|XP_010101474.1|  Pectinesterase/pectinesterase inhibitor            122   4e-28   
gb|EAY76103.1|  hypothetical protein OsI_04029                          122   4e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_009339900.1|  PREDICTED: probable pectinesterase/pectinest...    123   5e-28   
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     122   5e-28   
gb|KEH21378.1|  pectinesterase                                          121   5e-28   
ref|XP_007045218.1|  Plant invertase/pectin methylesterase inhibi...    122   5e-28   
ref|XP_011030843.1|  PREDICTED: pectinesterase-like                     122   5e-28   
ref|XP_011016647.1|  PREDICTED: pectinesterase-like                     122   6e-28   
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     122   6e-28   
emb|CAN78759.1|  hypothetical protein VITISV_000562                     121   7e-28   Vitis vinifera
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     122   8e-28   
ref|XP_011095339.1|  PREDICTED: pectinesterase 2.1-like                 121   9e-28   
ref|XP_004492228.1|  PREDICTED: pectinesterase 2.1-like                 121   9e-28   
ref|XP_002522859.1|  Pectinesterase-2 precursor, putative               121   1e-27   Ricinus communis
ref|XP_007213952.1|  hypothetical protein PRUPE_ppa003697mg             121   1e-27   
gb|AAC14742.1|  pectin methylesterase                                   121   1e-27   Pisum sativum [garden pea]
gb|KDP42887.1|  hypothetical protein JCGZ_23829                         121   1e-27   
ref|XP_006307176.1|  hypothetical protein CARUB_v10008769mg             120   2e-27   
ref|XP_009115554.1|  PREDICTED: probable pectinesterase/pectinest...    120   2e-27   
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   120   2e-27   
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     120   2e-27   
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     120   2e-27   
ref|XP_010458561.1|  PREDICTED: pectinesterase/pectinesterase inh...    120   2e-27   
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     120   3e-27   
ref|XP_010932734.1|  PREDICTED: pectinesterase-like                     120   3e-27   
ref|XP_010058468.1|  PREDICTED: pectinesterase 2-like                   121   3e-27   
ref|XP_002518523.1|  Pectinesterase precursor, putative                 120   3e-27   Ricinus communis
ref|XP_004293266.1|  PREDICTED: pectinesterase/pectinesterase inh...    120   3e-27   
dbj|BAC67661.1|  pectin methylesterase                                  120   4e-27   Pisum sativum [garden pea]
ref|XP_010271283.1|  PREDICTED: pectinesterase                          119   4e-27   
ref|XP_010493017.1|  PREDICTED: pectinesterase/pectinesterase inh...    120   4e-27   
ref|XP_004492227.1|  PREDICTED: pectinesterase/pectinesterase inh...    120   4e-27   
ref|XP_010088582.1|  Pectinesterase/pectinesterase inhibitor            120   4e-27   
emb|CAA47810.1|  pectinesterase                                         120   4e-27   Pisum sativum [garden pea]
gb|KDP34079.1|  hypothetical protein JCGZ_07650                         120   4e-27   
ref|XP_010692197.1|  PREDICTED: pectinesterase 2                        119   4e-27   
gb|EYU31969.1|  hypothetical protein MIMGU_mgv1a005025mg                119   5e-27   
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...    119   6e-27   
ref|XP_009402517.1|  PREDICTED: pectinesterase-like                     119   6e-27   
ref|XP_010476087.1|  PREDICTED: pectinesterase/pectinesterase inh...    119   6e-27   
gb|ACJ85768.1|  unknown                                                 119   6e-27   Medicago truncatula
ref|XP_002456465.1|  hypothetical protein SORBIDRAFT_03g036790          119   6e-27   Sorghum bicolor [broomcorn]
gb|KDO64577.1|  hypothetical protein CISIN_1g047288mg                   119   7e-27   
ref|XP_007025998.1|  Pectinesterase/pectinesterase inhibitor, put...    119   7e-27   
gb|AFC98398.1|  pectin methylesterase                                   119   7e-27   
ref|XP_011017534.1|  PREDICTED: probable pectinesterase/pectinest...    117   7e-27   
ref|XP_009397166.1|  PREDICTED: pectinesterase-like                     119   8e-27   
ref|XP_010058445.1|  PREDICTED: pectinesterase 2-like                   117   1e-26   
ref|XP_009622987.1|  PREDICTED: pectinesterase 2.1-like                 116   1e-26   
ref|XP_010069353.1|  PREDICTED: pectinesterase-like                     118   2e-26   
emb|CDY34642.1|  BnaC08g42010D                                          117   2e-26   
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    117   2e-26   
ref|XP_010069351.1|  PREDICTED: pectinesterase-like                     118   2e-26   
ref|XP_009118185.1|  PREDICTED: pectinesterase/pectinesterase inh...    118   2e-26   
ref|XP_002301275.2|  hypothetical protein POPTR_0002s14660g             116   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_004168287.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    115   2e-26   
ref|XP_002527752.1|  Pectinesterase-2 precursor, putative               118   2e-26   Ricinus communis
gb|KCW73025.1|  hypothetical protein EUGRSUZ_E01468                     117   3e-26   
ref|XP_006377839.1|  hypothetical protein POPTR_0011s13830g             117   3e-26   
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     117   3e-26   
dbj|BAC67662.1|  pectin methylesterase                                  117   3e-26   Pisum sativum [garden pea]
gb|KCW73024.1|  hypothetical protein EUGRSUZ_E01466                     117   4e-26   
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   117   4e-26   
dbj|BAK05307.1|  predicted protein                                      117   4e-26   
ref|XP_010257625.1|  PREDICTED: pectinesterase 2-like                   117   4e-26   
ref|NP_001275775.1|  pectinesterase 2 precursor                         116   4e-26   
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   116   4e-26   
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             116   4e-26   
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     116   5e-26   
gb|AAX93021.1|  hypothetical protein LOC_Os11g07090                     116   5e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ17589.1|  hypothetical protein OsJ_33128                          116   5e-26   Oryza sativa Japonica Group [Japonica rice]
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 116   5e-26   
gb|AFK35109.1|  unknown                                                 117   5e-26   
ref|XP_003521947.1|  PREDICTED: pectinesterase 2-like                   116   5e-26   
ref|XP_003521940.1|  PREDICTED: pectinesterase 2-like                   116   5e-26   
ref|XP_003622688.1|  Pectinesterase                                     116   6e-26   
gb|KHN35617.1|  Pectinesterase 2                                        116   6e-26   
ref|XP_007204488.1|  hypothetical protein PRUPE_ppa019698mg             116   6e-26   
ref|XP_010058471.1|  PREDICTED: pectinesterase 2-like                   116   6e-26   
gb|KHN30453.1|  Pectinesterase 2.2                                      115   7e-26   
gb|KHG01688.1|  Uncharacterized protein F383_22979                      115   7e-26   
ref|XP_007134831.1|  hypothetical protein PHAVU_010G079900g             115   7e-26   
emb|CAD29733.1|  pectin methylesterase                                  116   8e-26   Sesbania rostrata
ref|XP_010541676.1|  PREDICTED: probable pectinesterase/pectinest...    115   8e-26   
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   115   8e-26   
ref|XP_007157172.1|  hypothetical protein PHAVU_002G048700g             116   8e-26   
ref|XP_008372811.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    114   8e-26   
ref|XP_008391160.1|  PREDICTED: pectinesterase-like                     116   9e-26   
ref|XP_008386148.1|  PREDICTED: pectinesterase-like                     116   9e-26   
gb|KDP33980.1|  hypothetical protein JCGZ_07551                         116   9e-26   
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   115   1e-25   
ref|XP_006573891.1|  PREDICTED: pectinesterase/pectinesterase inh...    115   1e-25   
ref|XP_008242331.1|  PREDICTED: pectinesterase-like                     115   1e-25   
gb|AFK44272.1|  unknown                                                 115   1e-25   
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             115   1e-25   
gb|KHG13344.1|  Uncharacterized protein F383_18528                      115   1e-25   
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    115   1e-25   Citrus sinensis [apfelsine]
ref|XP_003517028.1|  PREDICTED: pectinesterase 2-like                   115   1e-25   
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    115   2e-25   
ref|XP_003632058.1|  PREDICTED: probable pectinesterase/pectinest...    115   2e-25   
ref|XP_009768199.1|  PREDICTED: pectinesterase 2.1-like                 115   2e-25   
gb|AHC69829.1|  pectin methylesterase PME2.1                            115   2e-25   
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    114   2e-25   
ref|XP_002889876.1|  At1g11580/T23J18_33                                115   2e-25   
gb|KHN47892.1|  Pectinesterase 2                                        114   2e-25   
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        114   2e-25   
ref|XP_004307817.1|  PREDICTED: pectinesterase 2-like                   114   2e-25   
ref|XP_010058469.1|  PREDICTED: pectinesterase 2-like                   115   3e-25   
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             114   3e-25   
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   114   3e-25   
ref|XP_009594446.1|  PREDICTED: probable pectinesterase/pectinest...    114   3e-25   
ref|XP_010919483.1|  PREDICTED: pectinesterase 2-like                   114   3e-25   
ref|XP_006344844.1|  PREDICTED: probable pectinesterase/pectinest...    114   3e-25   
emb|CDP20872.1|  unnamed protein product                                114   3e-25   
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   114   3e-25   
emb|CDP20891.1|  unnamed protein product                                114   3e-25   
gb|KFK28346.1|  hypothetical protein AALP_AA8G504200                    114   4e-25   
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         114   4e-25   
ref|XP_009762316.1|  PREDICTED: probable pectinesterase/pectinest...    113   5e-25   
sp|P83948.1|PME3_CITSI  RecName: Full=Pectinesterase 3; Short=PE ...    114   5e-25   
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               112   6e-25   
ref|XP_002318285.1|  putative pectin methylesterase family protein      113   6e-25   
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...    113   6e-25   
ref|XP_006838619.1|  hypothetical protein AMTR_s00002p00230630          113   7e-25   
emb|CAA96435.1|  pectin methylesterase                                  111   7e-25   
gb|EMS59431.1|  Putative pectinesterase/pectinesterase inhibitor 28     114   7e-25   
gb|EAY80111.1|  hypothetical protein OsI_35283                          113   8e-25   
gb|EPS70211.1|  pectinesterase                                          110   8e-25   
ref|XP_004488157.1|  PREDICTED: probable pectinesterase/pectinest...    113   9e-25   
ref|XP_009781154.1|  PREDICTED: pectinesterase-like                     112   9e-25   
ref|XP_007138600.1|  hypothetical protein PHAVU_009G222500g             113   9e-25   
gb|KHN45039.1|  Pectinesterase/pectinesterase inhibitor PPE8B           112   1e-24   
ref|XP_003534983.1|  PREDICTED: pectinesterase/pectinesterase inh...    112   1e-24   
emb|CAA96434.1|  pectin methylesterase                                  110   1e-24   
ref|XP_008228106.1|  PREDICTED: pectinesterase 3                        113   1e-24   
ref|XP_007157169.1|  hypothetical protein PHAVU_002G048400g             113   1e-24   
ref|XP_010526019.1|  PREDICTED: putative pectinesterase/pectinest...    113   1e-24   
ref|XP_006360082.1|  PREDICTED: pectinesterase 3-like                   112   1e-24   
emb|CDP05792.1|  unnamed protein product                                112   1e-24   
ref|XP_003546531.1|  PREDICTED: probable pectinesterase/pectinest...    112   1e-24   
gb|KCW73023.1|  hypothetical protein EUGRSUZ_E01465                     110   1e-24   
ref|XP_003542387.1|  PREDICTED: pectinesterase/pectinesterase inh...    112   1e-24   
gb|AFI23414.1|  pectin methylesterase                                   113   1e-24   
gb|KHN10485.1|  Putative pectinesterase/pectinesterase inhibitor 12     112   2e-24   
ref|XP_007138598.1|  hypothetical protein PHAVU_009G2224000g            111   2e-24   
ref|XP_010029513.1|  PREDICTED: pectinesterase 3-like                   112   2e-24   
ref|XP_006417343.1|  hypothetical protein EUTSA_v10007263mg             112   2e-24   
gb|KHN47891.1|  Pectinesterase 2                                        112   2e-24   
ref|XP_006293870.1|  hypothetical protein CARUB_v10022851mg             112   2e-24   
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     112   2e-24   
ref|XP_008222686.1|  PREDICTED: probable pectinesterase/pectinest...    112   2e-24   
dbj|BAA89480.1|  pectin methylesterase                                  112   2e-24   
ref|XP_002324181.2|  pectinesterase family protein                      112   2e-24   
ref|XP_010672022.1|  PREDICTED: pectinesterase-like                     112   2e-24   
ref|XP_006828588.1|  hypothetical protein AMTR_s00129p00047530          112   2e-24   
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    112   2e-24   
ref|NP_172624.1|  methylesterase PCR A                                  112   2e-24   
gb|AFK41384.1|  unknown                                                 110   2e-24   
gb|AAK59760.1|  At1g11580/T23J18_33                                     112   3e-24   
emb|CDO97788.1|  unnamed protein product                                112   3e-24   
ref|XP_011046152.1|  PREDICTED: pectinesterase-like                     112   3e-24   
ref|XP_002515781.1|  Pectinesterase-3 precursor, putative               112   3e-24   
ref|XP_006851559.1|  hypothetical protein AMTR_s00040p00188020          112   4e-24   
gb|AGJ83739.1|  pectinesterase/pectinesterase inhibitor PPE8B-lik...    110   4e-24   
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   111   4e-24   
ref|XP_009775925.1|  PREDICTED: pectinesterase-like                     111   4e-24   
gb|EPS61512.1|  pectinesterase                                          110   4e-24   
ref|XP_006587077.1|  PREDICTED: probable pectinesterase/pectinest...    111   4e-24   
ref|XP_008388938.1|  PREDICTED: putative pectinesterase/pectinest...    111   5e-24   
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   110   5e-24   
ref|XP_009413991.1|  PREDICTED: pectinesterase-like                     111   5e-24   
ref|XP_002311918.1|  pectinesterase family protein                      111   5e-24   
ref|XP_010033654.1|  PREDICTED: pectinesterase 3-like                   111   5e-24   
ref|XP_006360083.1|  PREDICTED: pectinesterase 2.1-like                 111   6e-24   
ref|XP_010057974.1|  PREDICTED: pectinesterase-like                     111   6e-24   
ref|XP_009142324.1|  PREDICTED: probable pectinesterase/pectinest...    110   6e-24   
ref|XP_010067062.1|  PREDICTED: probable pectinesterase/pectinest...    111   6e-24   
ref|XP_002322401.1|  putative pectin methylesterase family protein      110   6e-24   
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     110   6e-24   
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     110   6e-24   
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   110   6e-24   
ref|XP_009116570.1|  PREDICTED: probable pectinesterase/pectinest...    110   7e-24   
ref|XP_007133558.1|  hypothetical protein PHAVU_011G1890000g            109   7e-24   
ref|XP_010472673.1|  PREDICTED: probable pectinesterase/pectinest...    110   8e-24   
ref|XP_002880019.1|  pectinesterase family protein                      110   8e-24   
ref|XP_001758305.1|  predicted protein                                  110   8e-24   
gb|AFK36090.1|  unknown                                                 109   8e-24   
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   110   8e-24   
ref|XP_006289025.1|  hypothetical protein CARUB_v10002406mg             109   9e-24   
ref|XP_008391336.1|  PREDICTED: probable pectinesterase/pectinest...    109   9e-24   
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       110   9e-24   
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             110   9e-24   
gb|AAF23891.1|  pectin methyl esterase                                  110   9e-24   
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     110   9e-24   
ref|XP_009142158.1|  PREDICTED: probable pectinesterase/pectinest...    110   1e-23   
emb|CDM84519.1|  unnamed protein product                                109   1e-23   
emb|CAA64217.1|  pectinmethylesterase                                   108   1e-23   
ref|XP_002872964.1|  predicted protein                                  109   1e-23   
ref|XP_010049304.1|  PREDICTED: pectinesterase/pectinesterase inh...    110   1e-23   
emb|CDY27388.1|  BnaC04g50170D                                          109   1e-23   
ref|XP_004134752.1|  PREDICTED: pectinesterase/pectinesterase inh...    110   1e-23   
ref|XP_006408782.1|  hypothetical protein EUTSA_v10001934mg             110   1e-23   
ref|NP_001274785.1|  pectin methyl esterase                             110   1e-23   
ref|XP_011015792.1|  PREDICTED: LOW QUALITY PROTEIN: putative pec...    110   1e-23   
emb|CDY65609.1|  BnaCnng47940D                                          109   1e-23   
ref|XP_009414355.1|  PREDICTED: putative pectinesterase/pectinest...    110   1e-23   
ref|XP_007222370.1|  hypothetical protein PRUPE_ppa003433mg             110   1e-23   
ref|XP_008439965.1|  PREDICTED: pectinesterase                          110   1e-23   
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   110   1e-23   
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    108   1e-23   
ref|XP_004231287.2|  PREDICTED: probable pectinesterase/pectinest...    109   1e-23   
ref|XP_004155595.1|  PREDICTED: pectinesterase/pectinesterase inh...    110   1e-23   
gb|KDP33981.1|  hypothetical protein JCGZ_07552                         110   1e-23   
ref|XP_002878961.1|  pectinesterase family protein                      109   2e-23   
ref|XP_002298185.1|  hypothetical protein POPTR_0001s21650g             109   2e-23   
ref|XP_003526361.1|  PREDICTED: putative pectinesterase/pectinest...    109   2e-23   
gb|KHN26433.1|  Putative pectinesterase/pectinesterase inhibitor 24     109   2e-23   
ref|XP_003535331.2|  PREDICTED: probable pectinesterase/pectinest...    109   2e-23   
ref|XP_010107092.1|  Pectinesterase/pectinesterase inhibitor PPE8B      111   2e-23   
ref|XP_004308461.1|  PREDICTED: probable pectinesterase/pectinest...    106   2e-23   
ref|XP_003591169.1|  Pectinesterase                                     109   2e-23   
ref|XP_010103929.1|  putative pectinesterase/pectinesterase inhib...    109   2e-23   
gb|KDP25318.1|  hypothetical protein JCGZ_20474                         108   3e-23   
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   108   3e-23   
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   108   3e-23   
ref|XP_003595381.1|  hypothetical protein MTR_2g044810                  108   3e-23   
ref|XP_010417436.1|  PREDICTED: probable pectinesterase/pectinest...    108   3e-23   
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   108   3e-23   
ref|XP_007215024.1|  hypothetical protein PRUPE_ppa003307mg             109   3e-23   
ref|XP_010429665.1|  PREDICTED: probable pectinesterase/pectinest...    108   3e-23   
emb|CDX74715.1|  BnaA05g04610D                                          107   3e-23   
ref|NP_181833.1|  putative pectinesterase/ pectinerase inhibitor 16     108   3e-23   
emb|CDP08022.1|  unnamed protein product                                108   3e-23   
ref|XP_002516193.1|  Pectinesterase-1 precursor, putative               109   3e-23   
ref|XP_009612569.1|  PREDICTED: probable pectinesterase/pectinest...    108   3e-23   
emb|CDY18944.1|  BnaC04g04060D                                          107   3e-23   
ref|XP_009766961.1|  PREDICTED: probable pectinesterase/pectinest...    108   4e-23   
ref|XP_004514850.1|  PREDICTED: pectinesterase 2-like                   108   4e-23   
ref|XP_010524121.1|  PREDICTED: probable pectinesterase/pectinest...    108   4e-23   
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     108   4e-23   
gb|EPS62329.1|  pectinesterase                                          108   4e-23   
ref|XP_010932336.1|  PREDICTED: pectinesterase-like                     108   4e-23   
ref|XP_010552499.1|  PREDICTED: probable pectinesterase/pectinest...    108   4e-23   
ref|NP_566038.1|  putative pectinesterase/pectinesterase inhibito...    108   4e-23   
gb|KFK43434.1|  hypothetical protein AALP_AA1G125000                    108   4e-23   
ref|XP_010067063.1|  PREDICTED: probable pectinesterase/pectinest...    108   4e-23   
ref|XP_010321856.1|  PREDICTED: pectinesterase                          108   4e-23   
ref|XP_008460558.1|  PREDICTED: putative pectinesterase/pectinest...    108   4e-23   
ref|XP_003595386.1|  Pectinesterase                                     108   4e-23   
ref|XP_002882002.1|  predicted protein                                  108   4e-23   
gb|ABK94644.1|  unknown                                                 106   5e-23   
gb|KFK32509.1|  hypothetical protein AALP_AA6G251800                    108   5e-23   
emb|CBI36882.3|  unnamed protein product                                108   5e-23   
ref|XP_010559221.1|  PREDICTED: probable pectinesterase/pectinest...    107   5e-23   
gb|EMT24232.1|  Putative pectinesterase/pectinesterase inhibitor 13     108   5e-23   
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     107   5e-23   
ref|XP_007011069.1|  Root hair specific 12                              108   5e-23   
ref|XP_006659464.1|  PREDICTED: probable pectinesterase/pectinest...    108   6e-23   
ref|XP_008392665.1|  PREDICTED: pectinesterase-like                     108   6e-23   
ref|XP_006367330.1|  PREDICTED: probable pectinesterase/pectinest...    108   6e-23   
ref|XP_009782456.1|  PREDICTED: pectinesterase-like                     107   6e-23   
ref|XP_003622696.1|  Pectinesterase                                     108   6e-23   
ref|XP_009143104.1|  PREDICTED: probable pectinesterase/pectinest...    107   7e-23   
ref|XP_011010925.1|  PREDICTED: pectinesterase-like isoform X2          107   7e-23   
ref|XP_009369731.1|  PREDICTED: putative pectinesterase/pectinest...    108   7e-23   
ref|XP_010261669.1|  PREDICTED: probable pectinesterase/pectinest...    108   7e-23   
ref|XP_008337790.1|  PREDICTED: pectinesterase/pectinesterase inh...    107   8e-23   
emb|CBI22967.3|  unnamed protein product                                109   8e-23   
ref|XP_010273802.1|  PREDICTED: pectinesterase/pectinesterase inh...    107   8e-23   
ref|XP_004287680.1|  PREDICTED: probable pectinesterase/pectinest...    107   8e-23   
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     107   9e-23   
ref|XP_009348912.1|  PREDICTED: pectinesterase-like                     107   9e-23   
emb|CDX83392.1|  BnaA03g21140D                                          106   9e-23   
ref|XP_009364480.1|  PREDICTED: pectinesterase                          107   9e-23   
ref|XP_010260187.1|  PREDICTED: probable pectinesterase/pectinest...    107   9e-23   
emb|CDX95641.1|  BnaC03g25220D                                          106   9e-23   
ref|XP_003578154.1|  PREDICTED: pectinesterase-like                     108   1e-22   
ref|XP_011010924.1|  PREDICTED: pectinesterase-like isoform X1          107   1e-22   
ref|NP_180212.1|  Probable pectinesterase/pectinesterase inhibito...    107   1e-22   
ref|XP_002273396.2|  PREDICTED: probable pectinesterase/pectinest...    107   1e-22   
ref|XP_009799791.1|  PREDICTED: probable pectinesterase/pectinest...    107   1e-22   
ref|XP_009599026.1|  PREDICTED: pectinesterase-like                     107   1e-22   
ref|XP_010933723.1|  PREDICTED: pectinesterase-like                     107   1e-22   
dbj|BAK05856.1|  predicted protein                                      107   1e-22   
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    107   1e-22   
ref|XP_011010930.1|  PREDICTED: pectinesterase-like                     106   1e-22   
ref|XP_010277646.1|  PREDICTED: pectinesterase 2-like                   106   1e-22   
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     107   2e-22   
ref|XP_004231483.1|  PREDICTED: probable pectinesterase/pectinest...    107   2e-22   
ref|XP_004142361.1|  PREDICTED: putative pectinesterase/pectinest...    107   2e-22   
ref|XP_004494573.1|  PREDICTED: putative pectinesterase/pectinest...    106   2e-22   
emb|CBI27756.3|  unnamed protein product                                106   2e-22   
gb|KDO73741.1|  hypothetical protein CISIN_1g009418mg                   106   2e-22   
ref|XP_003608136.1|  Pectinesterase                                     106   2e-22   
ref|XP_010999998.1|  PREDICTED: probable pectinesterase/pectinest...    107   2e-22   
ref|XP_002982529.1|  hypothetical protein SELMODRAFT_116557             105   2e-22   
ref|XP_006490218.1|  PREDICTED: probable pectinesterase/pectinest...    106   2e-22   
emb|CDY12333.1|  BnaA06g20110D                                          106   2e-22   
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   105   2e-22   
ref|XP_002277473.1|  PREDICTED: pectinesterase                          107   2e-22   
ref|NP_001275859.1|  pectinesterase 1 precursor                         107   2e-22   
emb|CDY53657.1|  BnaC04g52910D                                          106   2e-22   
emb|CDP19933.1|  unnamed protein product                                106   2e-22   
ref|XP_006474559.1|  PREDICTED: probable pectinesterase/pectinest...    106   2e-22   
gb|KDO73740.1|  hypothetical protein CISIN_1g009418mg                   106   2e-22   
gb|KHN10316.1|  Putative pectinesterase/pectinesterase inhibitor 24     106   2e-22   
ref|XP_003541560.1|  PREDICTED: putative pectinesterase/pectinest...    106   2e-22   
ref|XP_002509939.1|  enzyme inhibitor, putative                         105   2e-22   
ref|XP_008450601.1|  PREDICTED: putative pectinesterase/pectinest...    105   2e-22   
gb|KDO73738.1|  hypothetical protein CISIN_1g009418mg                   106   2e-22   
ref|XP_006393237.1|  hypothetical protein EUTSA_v10011371mg             106   2e-22   
ref|XP_010426712.1|  PREDICTED: putative pectinesterase/pectinest...    105   2e-22   
ref|XP_002322399.1|  putative pectin methylesterase family protein      105   2e-22   
ref|XP_010520512.1|  PREDICTED: probable pectinesterase/pectinest...    106   3e-22   
emb|CDP19930.1|  unnamed protein product                                106   3e-22   
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    105   3e-22   
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...    105   3e-22   
ref|XP_008450600.1|  PREDICTED: putative pectinesterase/pectinest...    106   3e-22   
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...    105   3e-22   
gb|AGR44473.1|  pectin methylesterase 4                                 104   3e-22   
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg             106   3e-22   



>ref|XP_009764218.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Nicotiana sylvestris]
Length=491

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 184/256 (72%), Gaps = 12/256 (5%)
 Frame = +2

Query  110  LTASNQDL-LAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEE  286
            +  SNQDL   I+  RS VL A++W+Q L  L +  R+   N A     +C  LY D E 
Sbjct  22   VVTSNQDLDEVIQRTRSGVLNAMKWAQGLKTLDKADRDGSTNFAGI---ECVKLYEDTEP  78

Query  287  RLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALA  460
            RLA+L  D + Y HDDAVTWLSAA++SHRSCLDGL EKGL+     A +NLTL LK AL 
Sbjct  79   RLAQLVSDEKYYSHDDAVTWLSAALASHRSCLDGLEEKGLIFKSEEA-RNLTLLLKDALF  137

Query  461  RFSQK-RNVK--TTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAV  631
             + Q+ R+ +   TRK    +P S++G GLL SW++A+SKA++VVAQDGSGNYK+INEAV
Sbjct  138  HYGQRLRSSRRANTRKGARPRPISNEGRGLLVSWNAATSKADLVVAQDGSGNYKTINEAV  197

Query  632  SALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTT  811
            +ALSRM      R +VYVK+GVY E VEIERG+KN+M VGDG+D+TI+TGN+NV+DG+TT
Sbjct  198  AALSRMTR--PERTIVYVKSGVYRENVEIERGLKNLMFVGDGIDKTIVTGNKNVRDGATT  255

Query  812  FGSATFRVSGDGFWAR  859
              SATF VS DGFWAR
Sbjct  256  LSSATFGVSADGFWAR  271



>ref|XP_009628695.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Nicotiana tomentosiformis]
Length=490

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 143/257 (56%), Positives = 182/257 (71%), Gaps = 10/257 (4%)
 Frame = +2

Query  104  NALTASNQDL-LAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADA  280
            N +  SNQD+  A++  RS VL  ++W++ L  L +  R+ G+    A + +C  LY D 
Sbjct  21   NNVVTSNQDIDNAVQRTRSAVLNVMKWARGLKRLDKADRD-GSTINFAGI-ECVKLYEDT  78

Query  281  EERLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQA  454
            E RLA+L    + Y HDDAVTWLSAA++SHRSCLDGL EKGLV     A +NLTL LK A
Sbjct  79   EPRLAQLVSGEKYYSHDDAVTWLSAALASHRSCLDGLEEKGLVFKSEEA-RNLTLLLKDA  137

Query  455  LARFSQKRNVKTT--RKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEA  628
            L  + Q RN   T  RK    +P S++G GLL SW++A+SKA+IV+AQDGSGNYK+INEA
Sbjct  138  LFNYGQLRNNGRTKARKGAQPRPISNEGRGLLASWNAATSKADIVIAQDGSGNYKTINEA  197

Query  629  VSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGST  808
            V+ALSR+      R +VYVK+GVY E VEI R +KN+M VGDG+D+TI+TGN+NVQDG+T
Sbjct  198  VAALSRITR--PERTIVYVKSGVYRENVEIGRELKNLMFVGDGIDKTIVTGNKNVQDGAT  255

Query  809  TFGSATFRVSGDGFWAR  859
            T GSATF VS D FWAR
Sbjct  256  TLGSATFGVSADEFWAR  272



>ref|XP_011090455.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Sesamum indicum]
Length=484

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 129/253 (51%), Positives = 175/253 (69%), Gaps = 9/253 (4%)
 Frame = +2

Query  110  LTASNQDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEER  289
              +  ++L  +  AR  +L A+  ++    L  PS+ESG    A  V DC  LY + E R
Sbjct  18   FVSCGRELEVVEMAREGMLHAVARARGFRTLDGPSQESGFPDGA--VGDCVKLYEEVEPR  75

Query  290  LARL---DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALA  460
            LARL   + ++  +DDA+TWLSAA++SH +CLDGL EKG +   R A +NLT  +++ALA
Sbjct  76   LARLVSGERKRCSNDDAMTWLSAALASHGTCLDGLGEKGWLFEARQA-RNLTWVIREALA  134

Query  461  RFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSAL  640
             +  +RN +  RK +      S  G  L +W++A+SKA+IVVAQDGSGNY++INEAV+AL
Sbjct  135  VYRGRRNPRGKRKALTGN---SGQGINLATWNAATSKADIVVAQDGSGNYRTINEAVAAL  191

Query  641  SRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGS  820
             R+G     R VVYVK+GVY E+VEI R +KNVM VGDG+D+T++TG++NVQDG+TTF S
Sbjct  192  GRLGGNRPERAVVYVKSGVYKEKVEIGRDLKNVMFVGDGIDKTVVTGSQNVQDGATTFNS  251

Query  821  ATFRVSGDGFWAR  859
            ATF VSGDGFWAR
Sbjct  252  ATFGVSGDGFWAR  264



>ref|XP_010098937.1| putative pectinesterase/pectinesterase inhibitor 36 [Morus notabilis]
 gb|EXB76239.1| putative pectinesterase/pectinesterase inhibitor 36 [Morus notabilis]
Length=529

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 133/247 (54%), Positives = 175/247 (71%), Gaps = 8/247 (3%)
 Frame = +2

Query  140  IRTARSNVLRALEWSQ-SLHELHEPSRESGnnaaaaaVSDCATLYADAEERLARL---DI  307
            ++ A++ +L+A  W Q S  ELH   RES +N    A+ DC  LYA++E RL+RL     
Sbjct  86   VQHAQAKLLQAKNWVQYSSMELHGLDRES-SNNVGLALRDCNKLYAESEPRLSRLVSGAT  144

Query  308  EKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-ASQNLTLSLKQALARFSQKRNV  484
             +Y  DDA+TWL A +++HRSCL+GL EKG V    H A+QNLT SL +ALA +S+ ++ 
Sbjct  145  SRYTVDDALTWLGAVLANHRSCLEGLAEKGFVEAQSHLAAQNLTTSLGEALALYSKMKST  204

Query  485  KTTRKVVH--KKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNG  658
               +  V   +K   +  GGLL SW+ A+SKA+ VVA+DGSG +++INEAV+AL+RMG G
Sbjct  205  SKEKIQVSEAQKTGPNTNGGLLASWNPATSKADFVVAKDGSGTHRTINEAVAALARMGRG  264

Query  659  GEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVS  838
               R ++YVKAGVYNE+VEI R +KNVM VGDGM RTI+TG+RNV DG+TT  SATF VS
Sbjct  265  RGQRTIIYVKAGVYNEKVEIGRKLKNVMFVGDGMGRTIVTGSRNVPDGATTISSATFGVS  324

Query  839  GDGFWAR  859
            GDGFWAR
Sbjct  325  GDGFWAR  331



>ref|XP_002511680.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50349.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=472

 Score =   216 bits (549),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 174/247 (70%), Gaps = 6/247 (2%)
 Frame = +2

Query  125  QDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLARL-  301
            Q+L  I+TA++  L+  +W QS   L     +  +      +SDC  LY+++E RL++L 
Sbjct  10   QELETIQTAQTQTLQVRKWLQS--SLGGGLNQGFSYNFGVPLSDCIKLYSESEFRLSQLL  67

Query  302  -DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQKR  478
               + Y H DA TWLS  +++H++CLDGL+EKG + +    + NLT SL ++LA +S+ R
Sbjct  68   ASEKNYTHHDARTWLSGVLANHKTCLDGLSEKGFLENDHEMAHNLTFSLSKSLALYSRGR  127

Query  479  NVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNG  658
              +T  + V ++P  +  GG+L SW+  +S+A+ VVA+DGSG +++IN+A++ALSR+G  
Sbjct  128  --RTINRGVPRRPIHNYNGGILTSWNPTTSQADFVVARDGSGTHRTINDALAALSRLGTR  185

Query  659  GEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVS  838
               RV++YVKAGVYNE+VEI+  IK+VM VGDG+D+TIITG+RNV DGS+TF SATF VS
Sbjct  186  RTQRVIIYVKAGVYNEKVEIDHHIKDVMFVGDGIDKTIITGSRNVPDGSSTFSSATFGVS  245

Query  839  GDGFWAR  859
            GDGFWAR
Sbjct  246  GDGFWAR  252



>emb|CDO97715.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 176/253 (70%), Gaps = 9/253 (4%)
 Frame = +2

Query  116  ASNQDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLA  295
            +  Q+L A+R AR  +L+A+ W+QSL   H+   + G+     A++DC  LY ++E  LA
Sbjct  52   SCEQELEAVRAARFGILQAVNWAQSLRRYHD-HLDHGSRFGDIAIADCLKLYEESEPLLA  110

Query  296  RLDI--EKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFS  469
             L++  + Y   DAVTWLSAA++SHRSCLDGL EKGL S    A+QNLTL L  ALA   
Sbjct  111  WLELSSKNYSQADAVTWLSAALASHRSCLDGLEEKGL-SFDTQAAQNLTLLLHAALASVK  169

Query  470  QKRNVKTTRKVVHKKPsssdgggl---ldswssassKANIVVAQDGSGNYKSINEAVSAL  640
             + N    R + H K +S         L SWS A+SKA+IVVAQDGSGN+++I EAV+AL
Sbjct  170  LQGNFG--RPLTHGKLASQSTDQYWGLLASWSPATSKADIVVAQDGSGNFETIKEAVAAL  227

Query  641  SRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGS  820
             RMG+   GR VVYVK+G+Y+E+VEI R ++NVM VGDG+D+TI+TGN+NV DG++T  S
Sbjct  228  GRMGHNRPGRAVVYVKSGLYHEKVEIPRNLENVMFVGDGIDKTIVTGNQNVVDGASTLSS  287

Query  821  ATFRVSGDGFWAR  859
            ATF +SG+GFWAR
Sbjct  288  ATFGISGNGFWAR  300



>gb|EYU31970.1| hypothetical protein MIMGU_mgv1a025432mg [Erythranthe guttata]
Length=483

 Score =   210 bits (535),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 130/250 (52%), Positives = 171/250 (68%), Gaps = 12/250 (5%)
 Frame = +2

Query  131  LLAIRTARSNVLRALEWSQS--LHELHEPSRESGnnaaaaaVSDCATLYADAEERLARLD  304
            L  +  AR  +L+++ W++      L  P  E G +  A  +SDC  LY +AE RL RL 
Sbjct  30   LEVVEAAREAMLQSMAWAEGEGFKTLVGPGHEPGFSGGA--LSDCVKLYGEAEPRLRRLV  87

Query  305  I----EKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQ  472
                  ++ HDDAVTWLSAA +SH +CLDGL EKG+    R A  NLT  ++++LA ++ 
Sbjct  88   SGERGYEFSHDDAVTWLSAAFASHTTCLDGLEEKGMSFEARRA-HNLTSVIRESLAVYAA  146

Query  473  KRNVKTTRKVVHKKPsssdggglldsw-ssassKANIVVAQDGSGNYKSINEAVSALSRM  649
            K N +  RKVV K+P S +  G + +  ++A+SKA+ VVAQDGSGNYK+INEAV+ALS+ 
Sbjct  147  KDNRRGRRKVVRKRPGSDNVVGGILASWNAANSKADFVVAQDGSGNYKTINEAVAALSQS  206

Query  650  GNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATF  829
                  RVVVYVK+GVY E+VEI RG+ N+M VGDG+D+TI+TGN NVQDG+TT  SATF
Sbjct  207  VR--NERVVVYVKSGVYREKVEIGRGLNNIMFVGDGIDKTIVTGNANVQDGATTLNSATF  264

Query  830  RVSGDGFWAR  859
             VSGDGFWAR
Sbjct  265  GVSGDGFWAR  274



>ref|XP_010692199.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Beta vulgaris subsp. vulgaris]
Length=432

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 147/211 (70%), Gaps = 8/211 (4%)
 Frame = +2

Query  248  VSDCATLYADAEERLARLDIEK---YDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH  418
            + DCA LY  AE RLARL +EK   Y H+DA+ WLS A++SH +CLDGL E+G+      
Sbjct  3    IVDCAKLYDQAEARLARL-VEKNGEYSHEDALAWLSGAITSHMTCLDGLKERGVDEQVHP  61

Query  419  ASQNLTLSLKQALARFSQKRNV--KTTRKVVHKKPsssdggglldsw-ssassKANIVVA  589
             SQNLT+ L +ALA  ++K     KT  K V  +P   +      +  + A+S+A+IVVA
Sbjct  62   MSQNLTIVLNEALALHAKKHTFGSKTKSKGVEGRPRRGNHFRGQLASWNPATSRADIVVA  121

Query  590  QDGSGNYKSINEAVSALSRM-GNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDR  766
            +DGSGNY++I EAV AL R+ G G E RV+V+VKAGVY+ERVEI R +KNVM VGDGM +
Sbjct  122  RDGSGNYRTIKEAVDALGRIKGRGNERRVIVHVKAGVYDERVEIPRNLKNVMFVGDGMGK  181

Query  767  TIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            T++TG RNV DG TT  SATFRV GDGFWAR
Sbjct  182  TVVTGRRNVIDGGTTVNSATFRVFGDGFWAR  212



>ref|XP_010661658.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Vitis vinifera]
 emb|CBI38889.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 122/251 (49%), Positives = 168/251 (67%), Gaps = 7/251 (3%)
 Frame = +2

Query  116  ASNQDLLAIRTARSNVLRALEWSQSLHELHEPSR-ESGnnaaaaaVSDCATLYADAEERL  292
            A N++L A+RTAR  +L+   W++    LH  +  +SG    A  + DC  LY ++E RL
Sbjct  19   ACNEELKAVRTARFGLLQGGRWARGSLRLHGLNLVDSGYVGEA--LGDCVKLYEESESRL  76

Query  293  ARL-DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFS  469
             RL   E  + DDA TWLS+A++SHR+CLDGL  KG+       ++N+T+ L +ALA ++
Sbjct  77   TRLLSGETRNCDDARTWLSSALASHRTCLDGLEGKGMAEA--PMARNVTVWLSEALALYA  134

Query  470  QKRNVKT-TRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSR  646
            + +   T   K V      S    +L  WS  +SKA+IVVA+DGSGN+ +INEAV+AL+R
Sbjct  135  KYKEPDTDAEKEVQPTLKPSQNEVMLAEWSPKTSKADIVVAKDGSGNHMTINEAVAALTR  194

Query  647  MGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSAT  826
            M +    RVVVYVK+G+YNE+VEI + + NVM VGDG+D+TIIT +RNV DG+TT  SAT
Sbjct  195  MVHKRTRRVVVYVKSGIYNEKVEIGKNLNNVMFVGDGVDKTIITADRNVHDGATTPSSAT  254

Query  827  FRVSGDGFWAR  859
            F VSGDGFWA+
Sbjct  255  FGVSGDGFWAK  265



>emb|CAN75818.1| hypothetical protein VITISV_005130 [Vitis vinifera]
Length=485

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 121/251 (48%), Positives = 167/251 (67%), Gaps = 7/251 (3%)
 Frame = +2

Query  116  ASNQDLLAIRTARSNVLRALEWSQSLHELHEPSR-ESGnnaaaaaVSDCATLYADAEERL  292
            A N++L A+ TAR  +L+   W++    LH  +  +SG    A  + DC  LY ++E RL
Sbjct  19   ACNEELXAVXTARXGLLQGGRWARXSLRLHGLNLVDSGYVGEA--LGDCVKLYEESESRL  76

Query  293  AR-LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFS  469
             R L  E  + DDA TWLS+A++SHR+CLDGL  KG+       ++N+T+ L +ALA ++
Sbjct  77   TRXLSGETRNCDDARTWLSSALASHRTCLDGLEGKGMAE--APMARNVTVWLSEALALYA  134

Query  470  QKRNVKT-TRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSR  646
            + +   T   K V      S    +L  WS  +SKA+IVVA+DGSGN+ +INEAV+AL+R
Sbjct  135  KYKEPDTDAEKEVQPTLKPSQNEVMLAEWSPKTSKADIVVAKDGSGNHMTINEAVAALTR  194

Query  647  MGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSAT  826
            M +    RVVVYVK+G+YNE+VEI + + NVM VGDG+D+TIIT +RNV DG+TT  SAT
Sbjct  195  MVHKXTRRVVVYVKSGIYNEKVEIGKNLNNVMFVGDGVDKTIITADRNVHDGATTPSSAT  254

Query  827  FRVSGDGFWAR  859
            F VSGDGFWA+
Sbjct  255  FGVSGDGFWAK  265



>ref|XP_006347998.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Solanum tuberosum]
Length=495

 Score =   198 bits (504),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 164/254 (65%), Gaps = 16/254 (6%)
 Frame = +2

Query  125  QDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLARLD  304
            QDL+ I      VL A++W++   +    ++E+       + ++C  LY + E RLARL 
Sbjct  29   QDLI-INNKVVRVLSAMKWAKGTLKGQLLNKEA----EDQSYNECVKLYEETEPRLARLV  83

Query  305  I-------EKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSH--GRHASQNLTLSLKQAL  457
            +         Y HDDA+TWLSAA++SHRSCLDGL EKGL +       +QNLTL LK AL
Sbjct  84   VFGGDHHKYNYSHDDALTWLSAALASHRSCLDGLKEKGLATFISRNEEAQNLTLLLKDAL  143

Query  458  ARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSA  637
              + Q   +  T   +    S+ +  GLL SW++A+SK +IVVA DGSGNYK+IN+AV+A
Sbjct  144  FHYRQLTTLSRTGAQLIPMNSNEEDKGLLASWNAATSKPDIVVALDGSGNYKTINDAVAA  203

Query  638  LSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFG  817
            LS M      R VVYVK+G Y E VEI RG+ N+M VGDG+D+TI+TG +NV DG++T G
Sbjct  204  LSSMTR--PERTVVYVKSGTYRENVEIGRGLNNLMFVGDGIDKTIVTGYKNVPDGASTLG  261

Query  818  SATFRVSGDGFWAR  859
            SATF VS DGFWAR
Sbjct  262  SATFGVSADGFWAR  275



>ref|XP_004231159.2| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 36 [Solanum lycopersicum]
Length=502

 Score =   193 bits (491),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 167/262 (64%), Gaps = 24/262 (9%)
 Frame = +2

Query  119  SNQDLLAIRTARSNVLRALEWSQ-SLHELHEPSRESGnnaaaaaVSDCATLYADAEERLA  295
            SNQD+L I      VL A++W++ +L      S+E+       + ++C  LY + E RLA
Sbjct  30   SNQDVL-INNKVVRVLSAMKWAKGTLKGQLLLSKEA----EDQSYNECVKLYEETEPRLA  84

Query  296  RL-----DIEKYD--HDDAVTWLSAAMSSHRSCLDGLNEKGLVSH---GRHASQNLTLSL  445
            RL     D  KY+  HDDA+TWLSAA++SHRSCLDGL EK L +        +QNLTL L
Sbjct  85   RLVVFGGDNHKYNYSHDDAITWLSAALASHRSCLDGLKEKSLATFIVSRNEETQNLTLLL  144

Query  446  KQALARFSQKRNVKTTRKVVHKK--Psssdggglldsws--sassKANIVVAQDGSGNYK  613
            K AL  + Q      TR V  ++  P SS+  G     S  +A+SK +IVVA DGSGNYK
Sbjct  145  KDALFHYRQLST--HTRTVTGEQLIPISSNKEGKGLLASWNAATSKPDIVVALDGSGNYK  202

Query  614  SINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNV  793
            +IN+AV+ALS M      R VVYVK+G Y E VEI +G+ N+M VGDG+D+TI+TG++NV
Sbjct  203  TINDAVAALSSMTR--SERTVVYVKSGTYRENVEIGKGLDNLMFVGDGIDKTIVTGSKNV  260

Query  794  QDGSTTFGSATFRVSGDGFWAR  859
             DG+TT  SATF VS DGFWAR
Sbjct  261  PDGATTLNSATFGVSADGFWAR  282



>ref|XP_004506985.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Cicer arietinum]
Length=489

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/251 (46%), Positives = 162/251 (65%), Gaps = 11/251 (4%)
 Frame = +2

Query  125  QDLLAIRTARSNVLRALEWSQSLHELH--EPSRESGnnaaaaaVSDCATLYADAEERLAR  298
            Q++  ++ A++ V  A+ W  +   LH  E    S N ++  A+ DCA LY ++E RL+ 
Sbjct  24   QEMEVLQMAQTQVSEAMSWVDNSMRLHGLESMSISSNISSVLALRDCAKLYEESEFRLSH  83

Query  299  LDIEK---YDHDDAVTWLSAAMSSHRSCLDGLNEKGLVS-HGRHASQNLTLSLKQALARF  466
            + + K   Y +DDA+TW+SA M++HR+CLDGL EKG    H     +N++  L QAL  +
Sbjct  84   M-VSKNSSYTNDDALTWVSAVMTNHRTCLDGLKEKGYFQGHQFFLGRNMSRLLGQALVLY  142

Query  467  SQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSR  646
            S+ +     +++   +    +  GLL+SW  A++ A+  VA DGSG Y++I EAV ALS 
Sbjct  143  SKNKVKAPPQRITTSE----ENDGLLESWDLANNNAHFTVAHDGSGTYRTIKEAVDALSS  198

Query  647  MGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSAT  826
            MG+   GR ++YVKAGVYNE+VEI   + NVM VGDG+D+TI+TGNRNV  G TT  SAT
Sbjct  199  MGHNRPGRAIIYVKAGVYNEKVEIGNKLHNVMFVGDGIDKTIVTGNRNVPHGYTTLNSAT  258

Query  827  FRVSGDGFWAR  859
            F VSGDGFWAR
Sbjct  259  FDVSGDGFWAR  269



>ref|XP_010058465.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Eucalyptus grandis]
Length=507

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 119/268 (44%), Positives = 164/268 (61%), Gaps = 31/268 (12%)
 Frame = +2

Query  113  TASNQDLLAIRTARSNVLRA--------LEWSQSLHELHEPSRESGnnaaaaaVSDCATL  268
            T+S Q+  A+R A+S V +A        +   Q++ +  E S  S     + A+SDC+ L
Sbjct  32   TSSTQEHKALRAAKSMVSQAKILVDHKFMSLDQNIDK--EISNNSNVMRHSLALSDCSKL  89

Query  269  YADAEERLAR-LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQ------  427
            Y ++E RL + LD E +  +D  TWLS  +++HR+CLDGL E+G      HAS       
Sbjct  90   YRNSESRLMQSLDREDHTVEDTQTWLSGVLANHRTCLDGLREEG------HASLDGLSGG  143

Query  428  ---NLTLSLKQALARFSQKRNV-KTTRKVVHKKPsssdggglldswssassKANIVVAQD  595
               NLT SL+ ALA + ++ +V + T       P+         + S    KA+ VVA+D
Sbjct  144  LMVNLTRSLRHALALYGRETSVGRGTSPRFGTDPNGELLASWSAATS----KADFVVAKD  199

Query  596  GSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTII  775
            GSG Y  I +A++AL+RMG     RVV+YVK+GVY E+VEI RG+KNVM VGDGMDRT++
Sbjct  200  GSGTYTMIKDAIAALARMGESRPERVVIYVKSGVYKEKVEIGRGMKNVMFVGDGMDRTVV  259

Query  776  TGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TG++NV DGSTT  SATF +SGDGFWAR
Sbjct  260  TGSKNVPDGSTTLASATFAISGDGFWAR  287



>gb|KEH29120.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=489

 Score =   191 bits (485),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/249 (46%), Positives = 163/249 (65%), Gaps = 6/249 (2%)
 Frame = +2

Query  125  QDLLAIRTARSNVLRALEWSQSLHELH--EPSRESGnnaaaaaVSDCATLYADAEERLAR  298
            Q++  ++ A++ V +A+ W  +  +LH  E    S N  +  A+ DCA LY ++E  L  
Sbjct  23   QEMEVLQMAKTQVSQAINWVDNSMKLHGLESMSISLNQTSVLALRDCAKLYEESEFMLNN  82

Query  299  LDIEK--YDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQ  472
            + +EK  Y  +DA+ W+SA M++H++CLDGL EKG V   +   +NLT  L Q L  +S 
Sbjct  83   MMVEKSSYTKEDAIIWVSAMMTNHKTCLDGLEEKGYVQANQVLDRNLTSLLGQTLVLYSN  142

Query  473  KRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMG  652
              N    ++   +     +  GLLDSWS A+ +A+  VAQDGSG++++I EAV AL+ MG
Sbjct  143  --NKIKVKEQPQRSTILEENDGLLDSWSLANHRADFTVAQDGSGSHRTIKEAVDALASMG  200

Query  653  NGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFR  832
            +    R V++VKAGVY+E+VEIE+ + NVM VGDG+D+TI+TGNRNV  GSTT  SA+F 
Sbjct  201  HNRPSRAVIHVKAGVYHEKVEIEKKLHNVMFVGDGIDKTIVTGNRNVVHGSTTLNSASFD  260

Query  833  VSGDGFWAR  859
            VSGDGFWAR
Sbjct  261  VSGDGFWAR  269



>ref|XP_010544635.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Tarenaya hassleriana]
Length=486

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 112/253 (44%), Positives = 166/253 (66%), Gaps = 6/253 (2%)
 Frame = +2

Query  107  ALTASNQDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEE  286
            A   S  +L  + TAR+ V  +  W  S   +          +  +A+ +C  LY ++E 
Sbjct  18   ATAVSAGELEMLETARAAVAESRAWVGS--RVETEGFTGHIYSNGSAIIECEKLYEESEI  75

Query  287  RLARL-DI-EKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALA  460
            RL+ L D+ E +  DDA+TWL   + +HR+CL+GL +KGL         N+TL + ++LA
Sbjct  76   RLSTLIDVHENFTVDDAITWLGGVLVNHRTCLEGLEQKGLAQKAL-VYNNVTLIVSKSLA  134

Query  461  RFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSAL  640
             + + R     ++  H+    +  GG+L SW+   SKA+ VVA+DGSG ++SINEA++A+
Sbjct  135  LYRKGRKNHVNKRP-HEAGRPNQSGGMLVSWNPTRSKADFVVAKDGSGGHRSINEALTAV  193

Query  641  SRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGS  820
            SRMG    GRV++Y+K+GVYNE+++I+R +KN+MLVGDG+DRTI+TG+ NV DG+TT+GS
Sbjct  194  SRMGPRRSGRVIIYIKSGVYNEKIDIDRKMKNIMLVGDGIDRTIVTGSSNVPDGATTYGS  253

Query  821  ATFRVSGDGFWAR  859
            ATF VSGDGFWAR
Sbjct  254  ATFGVSGDGFWAR  266



>gb|KDP28779.1| hypothetical protein JCGZ_14550 [Jatropha curcas]
Length=472

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 173/251 (69%), Gaps = 14/251 (6%)
 Frame = +2

Query  125  QDLLAIRTARSNVLRALEW-SQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLARL  301
            Q L AI+ A++ + +   W +Q+L       ++  +N  +   +DC  LY+++E RL++L
Sbjct  10   QGLEAIQMAQNQIAQVRNWATQTL-------QDDDSNHVSVPFNDCVKLYSESEFRLSQL  62

Query  302  DI-EKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQ--  472
               E Y  DD  TWLS  +++H++CL+GLNEKG +   +  ++NLT  L +ALA + +  
Sbjct  63   LASENYTRDDTRTWLSGVLANHKTCLNGLNEKGFL-QTQPITRNLTFWLNEALAFYRKGR  121

Query  473  -KRNVKTTRKV-VHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSR  646
             KRNV +   V +  +P ++ GGG+L SW  A+SKA+  VA+DGSG +++IN+AV+AL+R
Sbjct  122  GKRNVSSIEGVPLPGRPINNHGGGILTSWDPATSKADFTVARDGSGTHRTINDAVAALNR  181

Query  647  MGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSAT  826
            M  G   R++++VKAGVYNE+VEIE+   +VMLVGDG+ +TIITG+RNV+DG +T  SAT
Sbjct  182  MVKGRSQRIIIHVKAGVYNEKVEIEKHHHDVMLVGDGIGKTIITGSRNVRDGDSTLSSAT  241

Query  827  FRVSGDGFWAR  859
            F VSGDGFWAR
Sbjct  242  FGVSGDGFWAR  252



>ref|XP_007219055.1| hypothetical protein PRUPE_ppa004770mg [Prunus persica]
 gb|EMJ20254.1| hypothetical protein PRUPE_ppa004770mg [Prunus persica]
Length=492

 Score =   188 bits (477),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 115/245 (47%), Positives = 156/245 (64%), Gaps = 4/245 (2%)
 Frame = +2

Query  137  AIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLARL--DIE  310
             I+ A   VL+A  W QS  +LHE   +  +N    A+ DCA LY ++  RL  L  + E
Sbjct  28   PIQVALDRVLQATNWVQSSIKLHELGSDDTSNDGGVALRDCAQLYDESAARLMVLLSNNE  87

Query  311  KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH--ASQNLTLSLKQALARFSQKRNV  484
             Y  DDA TWLS  +++ R+CLDGL+EKG      H   ++NLT+ L +ALA + +  + 
Sbjct  88   SYSGDDARTWLSGLLANQRTCLDGLDEKGFNKTDEHRVVAENLTMVLGEALAFYGKGMHE  147

Query  485  KTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGE  664
                    ++P      GLL SWS  +S+A+ VVA+DGSG +++INEAV+AL RMG+   
Sbjct  148  GRRVPPREQEPKPKQNEGLLVSWSLGTSRADFVVAKDGSGTHRTINEAVAALVRMGHRRP  207

Query  665  GRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGD  844
             RV++YVK GVY E+VE+ R I NVMLVG G+D+TIITG+ + + G TT  SATF VSGD
Sbjct  208  PRVIIYVKPGVYQEKVELHRNIVNVMLVGAGIDKTIITGSHSYRGGLTTRNSATFGVSGD  267

Query  845  GFWAR  859
            GFWAR
Sbjct  268  GFWAR  272



>ref|XP_008232608.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Prunus mume]
Length=490

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 114/245 (47%), Positives = 158/245 (64%), Gaps = 6/245 (2%)
 Frame = +2

Query  137  AIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLARL--DIE  310
             I+ A   VL+A +W QS  +LHE   +  +N +  A+ DCA LY ++  RL  L  + E
Sbjct  28   PIQLALDRVLQATDWVQSSIKLHELGSDDISNDSDVALRDCAQLYDESAARLMVLLSNNE  87

Query  311  KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH--ASQNLTLSLKQALARFSQKRNV  484
             Y  DD  TWLS  +++ R+CLDGL+EKG      H   ++NLT+ L +ALA + +  + 
Sbjct  88   SYSGDDVRTWLSGVLANQRTCLDGLDEKGFNKTDEHRVVAENLTMVLCEALAFYGKGMHE  147

Query  485  KTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGE  664
            +   +   +KP      GLL SWS  +S+A+ VVA+DGSG +++INEAV+AL RMG+   
Sbjct  148  EVPPR--EQKPKPKQNEGLLVSWSPGTSRADFVVAKDGSGTHRAINEAVAALVRMGHRRP  205

Query  665  GRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGD  844
             RV++YVK GVY E+VE+ R I NVMLVG G+D+TI+TG+ +   G TT  SATF VSGD
Sbjct  206  PRVIIYVKPGVYQEKVELHRNIVNVMLVGAGIDKTIVTGSLSYGGGLTTRNSATFGVSGD  265

Query  845  GFWAR  859
            GFWAR
Sbjct  266  GFWAR  270



>ref|XP_006402549.1| hypothetical protein EUTSA_v10006472mg [Eutrema salsugineum]
 gb|ESQ44002.1| hypothetical protein EUTSA_v10006472mg [Eutrema salsugineum]
Length=519

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 118/281 (42%), Positives = 168/281 (60%), Gaps = 31/281 (11%)
 Frame = +2

Query  104  NALTASN-QDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADA  280
            N   ASN  +L  + TAR+ V+ A      L    E + E  +    + +SDC  LY ++
Sbjct  21   NVAAASNTSELYLLETARAAVVEART-RVGLMATVEATNEVASGYYYSGLSDCEKLYDES  79

Query  281  EERLARLDI--EKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQA  454
            E RL++L +  E +  +D  TWLS  +++H +CLDGL++     H      N+T  L+QA
Sbjct  80   EARLSKLVVAHENFTVEDVRTWLSGVLANHHTCLDGLDQS-RQGHKPLVHNNVTFVLRQA  138

Query  455  LARFSQKR-------------NVKTTR-------------KVVHKKPsssdggglldsws  556
            LA + + +             N + TR             +  H     +  GG+L SW+
Sbjct  139  LAFYKKSKGHIKKRMHGPATPNHRPTRPHHGPTIAHHGSARPYHGPARPNQSGGMLVSWN  198

Query  557  sassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKN  736
               S+A+ VVA+DGS  ++S+N+A++A+SRMG     RVV+Y+KAGVYNE++EI+R +KN
Sbjct  199  PIRSRADFVVAKDGSATHRSVNQALAAVSRMGKSRSHRVVIYIKAGVYNEKIEIDREMKN  258

Query  737  VMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +MLVGDGMDRTIIT +RNV DGSTT+GSATF VSGDGFWAR
Sbjct  259  IMLVGDGMDRTIITNSRNVPDGSTTYGSATFGVSGDGFWAR  299



>ref|XP_010247589.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Nelumbo nucifera]
Length=515

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 112/246 (46%), Positives = 156/246 (63%), Gaps = 18/246 (7%)
 Frame = +2

Query  137  AIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLARLDIEKY  316
            A+R A S +++A +W+     L   S +     +  A+SDC  LY D   RL RL + ++
Sbjct  63   AVRMASSKLMQARDWALGSSRLQ--SLDHQMACSEIALSDCVNLYEDTNYRLQRLFL-RH  119

Query  317  DHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQK-----RN  481
             HDDA TWLS A++SHR+CL+GL E  +      A QNLT  L + LA ++Q      R 
Sbjct  120  RHDDARTWLSGALTSHRTCLEGLRE--MSCSVPQALQNLTTILSKTLALYAQPSSENDRE  177

Query  482  VKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGG  661
              + +  V++         LL SW ++ S+A+ VV++DGS +Y++IN  V+ L + G   
Sbjct  178  PSSLQSEVNQP--------LLVSWDASISRADFVVSKDGSNSYRTINSVVAVLEKGGGNR  229

Query  662  EGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSG  841
              RVV+YVKAGVYNE VEI+R ++NVM +GDG+D+TIITGNR+V DGS+T  SATF VSG
Sbjct  230  GKRVVIYVKAGVYNENVEIKRNMENVMFIGDGIDKTIITGNRSVHDGSSTISSATFGVSG  289

Query  842  DGFWAR  859
            DGFWAR
Sbjct  290  DGFWAR  295



>ref|XP_003521962.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Glycine max]
Length=490

 Score =   184 bits (467),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 145/206 (70%), Gaps = 4/206 (2%)
 Frame = +2

Query  248  VSDCATLYADAEERLARLDIEK--YDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA  421
            +SDCA LY ++E RL+ +  ++  Y  +DA+TW+SA M++HR+CLDGL EKG +   +  
Sbjct  67   LSDCAKLYEESESRLSHMMAQESYYAKEDALTWMSAVMTNHRTCLDGLKEKGYI-EAQVL  125

Query  422  SQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGS  601
             +NLT+ LKQAL  +S K N    +       S SD  G+L+SWS +S K +  VAQDGS
Sbjct  126  DRNLTMLLKQALVVYS-KNNKGKGKGPPEGTISKSDYAGILESWSESSYKPDFTVAQDGS  184

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            G + +I  AV+AL+ MG+    R V++VK+GVY+E+VEI + + NVMLVGDG+D+TI+TG
Sbjct  185  GTHGTIQAAVNALAAMGHNRPARAVIHVKSGVYHEKVEIGQKLHNVMLVGDGIDKTIVTG  244

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            NRNV  GSTT  SATF VSGDGFWAR
Sbjct  245  NRNVVQGSTTLNSATFDVSGDGFWAR  270



>gb|KHN35621.1| Putative pectinesterase/pectinesterase inhibitor 36 [Glycine 
soja]
Length=490

 Score =   183 bits (465),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 145/206 (70%), Gaps = 4/206 (2%)
 Frame = +2

Query  248  VSDCATLYADAEERLARLDIEK--YDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA  421
            +SDCA LY ++E RL+ +  ++  Y  +DA+TW+SA M++HR+CLDGL EKG +   +  
Sbjct  67   LSDCAKLYEESESRLSHMMSQESYYAKEDALTWMSAVMTNHRTCLDGLKEKGYI-EAQVL  125

Query  422  SQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGS  601
             +NLT+ LKQAL  +S K N    +       S SD  G+L+SWS +S K +  VAQDGS
Sbjct  126  DRNLTMLLKQALVVYS-KNNKGKGKGPPEGTISKSDYAGILESWSESSYKPDFTVAQDGS  184

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            G + +I  AV+AL+ MG+    R V++VK+GVY+E+VEI + + NVMLVGDG+D+TI+TG
Sbjct  185  GTHGTIQAAVNALAAMGHNRPARAVIHVKSGVYHEKVEIGQKLHNVMLVGDGIDKTIVTG  244

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            NRNV  GSTT  SATF VSGDGFWAR
Sbjct  245  NRNVVQGSTTLNSATFDVSGDGFWAR  270



>emb|CAB82677.1| pectinesterase-like protein [Arabidopsis thaliana]
Length=496

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 116/269 (43%), Positives = 168/269 (62%), Gaps = 21/269 (8%)
 Frame = +2

Query  110  LTASNQ-DLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEE  286
            +TASN  +L  +  AR+ V+ A     S+  + E + E   +     +S+C  LY ++E 
Sbjct  23   ITASNTAELDVLEMARTAVVEAKTSFGSM-AVTEATSEVAGSYYKLGLSECEKLYDESEA  81

Query  287  RLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALA  460
            RL++L  D E +  +D  TWLS  +++H +CLDGL ++    H      N+T  L +ALA
Sbjct  82   RLSKLVVDHENFTVEDVRTWLSGVLANHHTCLDGLIQQ-RQGHKPLVHSNVTFVLHEALA  140

Query  461  RFSQKR----------NVKTTR------KVVHKKPsssdggglldswssassKANIVVAQ  592
             + + R            + TR      +  H     +  GG+L SW+  SS+A+ VVA+
Sbjct  141  FYKKSRARQGHGPTRPKHRPTRPNHGPGRSHHGPSRPNQNGGMLVSWNPTSSRADFVVAR  200

Query  593  DGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTI  772
            DGS  +++IN+A++A+SRMG     RV++Y+KAGVYNE++EI+R +KN+MLVGDGMDRTI
Sbjct  201  DGSATHRTINQALAAVSRMGKSRLNRVIIYIKAGVYNEKIEIDRHMKNIMLVGDGMDRTI  260

Query  773  ITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +T NRNV DGSTT+GSATF VSGDGFWAR
Sbjct  261  VTNNRNVPDGSTTYGSATFGVSGDGFWAR  289



>ref|XP_002876579.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52838.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   180 bits (457),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 116/279 (42%), Positives = 170/279 (61%), Gaps = 30/279 (11%)
 Frame = +2

Query  110  LTASNQ-DLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEE  286
            +TASN  +L  +  AR+ V+ A     S+  +   S  + ++     +S+C  LY  +E 
Sbjct  23   VTASNTAELDVLEMARTAVVEARASFGSVAVVEATSEVATSSYYNLGLSECEKLYDVSEA  82

Query  287  RLARLDI--EKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALA  460
            RL++L +  E +  +D  TWLS  +++H +CLDGL ++    H      N+T  L +ALA
Sbjct  83   RLSKLVVAHENFTVEDVRTWLSGVLANHHTCLDGLVQQ-RQGHKPLVHSNVTFVLHEALA  141

Query  461  RFSQKR-NVKTTR-------------------------KVVHKKPsssdggglldswssa  562
             + + R ++K T                          +  H+    +  GG+L SW+  
Sbjct  142  FYKKSRGHMKKTLHGPARENHGPERPKHGPTRSNHGPGRPNHEPSRPNQSGGMLVSWNPT  201

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVM  742
            SS+A+ VVAQDGSG +++IN+A++A+SRMG     RV++Y+KAGVYNE+V+I+R +KN+M
Sbjct  202  SSRADFVVAQDGSGTHRTINQALAAVSRMGKSRLNRVIIYIKAGVYNEKVDIDRHMKNIM  261

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            LVGDGMDRTI+T NRNV DGSTT+GSATF VSGDGFWAR
Sbjct  262  LVGDGMDRTIVTNNRNVPDGSTTYGSATFGVSGDGFWAR  300



>emb|CDY41145.1| BnaA09g38700D [Brassica napus]
Length=521

 Score =   180 bits (457),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 116/286 (41%), Positives = 170/286 (59%), Gaps = 42/286 (15%)
 Frame = +2

Query  107  ALTASNQDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEE  286
            A++ +  +L  +  AR++V+ A     S+  + E + E   +  +  +SDC  LY ++E 
Sbjct  23   AISFNTSELDVLERARASVVEARTRFGSMATV-EATNEVARSYYSLGLSDCEKLYDESEA  81

Query  287  RLARLDI--EKYDHDDAVTWLSAAMSSHRSCLDGLNE-----KGLVSHGRHASQNLTLSL  445
            RL+ L +  E +  +D  TWLS  +++H +CLDGL++     K LV        N+T+ L
Sbjct  82   RLSNLVVAHENFTVEDVRTWLSGVLANHHTCLDGLDQSRQGDKPLVH------SNITVVL  135

Query  446  KQALARFSQKR--------NVKTTR--------------------KVVHKKPsssdgggl  541
             +ALA + + R        N   TR                    +  H     +  GG+
Sbjct  136  GEALAFYKKTRGHLKKRRPNHAPTRQHHATTRPHHGPTRPNHGPARPYHGPARPNQSGGM  195

Query  542  ldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIE  721
            L SW+   S+A+ VVA+DGS  ++SI+EA++A+SRMG     RV++Y+KAGVYNE++EI+
Sbjct  196  LVSWNPTGSRADFVVAKDGSATHRSISEALAAVSRMGKSRTNRVIIYIKAGVYNEKIEID  255

Query  722  RGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            R +KN+MLVGDGMDRTIIT NRNV DGS+T+GSATF VSGDGFWAR
Sbjct  256  RHMKNIMLVGDGMDRTIITNNRNVPDGSSTYGSATFGVSGDGFWAR  301



>ref|NP_191632.2| putative pectinesterase/pectinesterase inhibitor 36 [Arabidopsis 
thaliana]
 sp|Q84R10.2|PME36_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
36; Includes: RecName: Full=Pectinesterase inhibitor 36; AltName: 
Full=Pectin methylesterase inhibitor 36; Includes: RecName: 
Full=Pectinesterase 36; Short=PE 36; AltName: Full=Pectin 
methylesterase 36; Short=AtPME36; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE80101.1| putative pectinesterase/pectinesterase inhibitor 36 [Arabidopsis 
thaliana]
Length=519

 Score =   180 bits (457),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 166/279 (59%), Gaps = 31/279 (11%)
 Frame = +2

Query  110  LTASNQ-DLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEE  286
            +TASN  +L  +  AR+ V+ A     S+  + E + E   +     +S+C  LY ++E 
Sbjct  23   ITASNTAELDVLEMARTAVVEAKTSFGSM-AVTEATSEVAGSYYKLGLSECEKLYDESEA  81

Query  287  RLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALA  460
            RL++L  D E +  +D  TWLS  +++H +CLDGL ++    H      N+T  L +ALA
Sbjct  82   RLSKLVVDHENFTVEDVRTWLSGVLANHHTCLDGLIQQ-RQGHKPLVHSNVTFVLHEALA  140

Query  461  RFSQKRNVKTTR--------------------------KVVHKKPsssdggglldswssa  562
             + + R     R                          +  H     +  GG+L SW+  
Sbjct  141  FYKKSRGHMKKRLHGPARQGHGPTRPKHRPTRPNHGPGRSHHGPSRPNQNGGMLVSWNPT  200

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVM  742
            SS+A+ VVA+DGS  +++IN+A++A+SRMG     RV++Y+KAGVYNE++EI+R +KN+M
Sbjct  201  SSRADFVVARDGSATHRTINQALAAVSRMGKSRLNRVIIYIKAGVYNEKIEIDRHMKNIM  260

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            LVGDGMDRTI+T NRNV DGSTT+GSATF VSGDGFWAR
Sbjct  261  LVGDGMDRTIVTNNRNVPDGSTTYGSATFGVSGDGFWAR  299



>gb|AAP04164.1| putative pectinesterase [Arabidopsis thaliana]
 dbj|BAF00482.1| pectinesterase like protein [Arabidopsis thaliana]
Length=519

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 115/279 (41%), Positives = 166/279 (59%), Gaps = 31/279 (11%)
 Frame = +2

Query  110  LTASNQ-DLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEE  286
            +TASN  +L  +  AR+ V+ A     S+  + E + E   +     +S+C  LY ++E 
Sbjct  23   ITASNTAELDVLEMARTAVVEAKTSFGSM-AVTEATSEVAGSYYKLGLSECEKLYDESEA  81

Query  287  RLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALA  460
            RL++L  D E +  +D  TWLS  +++H +CLDGL ++    H      N+T  L +ALA
Sbjct  82   RLSKLVVDHENFTVEDVRTWLSGVLANHHTCLDGLIQQ-RQGHKPLVHSNVTFVLHEALA  140

Query  461  RFSQKRNVKTTR--------------------------KVVHKKPsssdggglldswssa  562
             + + R     R                          +  H     +  GG+L SW+  
Sbjct  141  FYKKSRGHMKKRLHGPARQGHGPTRPKHRPTRPNHGPGRSHHGPSRPNQNGGMLVSWNPT  200

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVM  742
            SS+A+ VVA+DGS  +++IN+A++A+SRMG     RV++Y+KAGVYNE++EI+R +KN+M
Sbjct  201  SSRADFVVARDGSATHRTINQALAAVSRMGKSRLNRVIIYIKAGVYNEKIEIDRHMKNIM  260

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            LVGDGMDRTI+T NRNV DGSTT+GSATF VSGDGFWAR
Sbjct  261  LVGDGMDRTIVTNNRNVPDGSTTYGSATFGVSGDGFWAR  299



>ref|XP_006604099.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
isoform X2 [Glycine max]
Length=436

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 156/250 (62%), Gaps = 10/250 (4%)
 Frame = +2

Query  116  ASNQDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLA  295
             S++++ A++  +  V +A  W      LH        +    A+ DC  LY ++E RL+
Sbjct  7    CSSKEMKALKMVQIQVSQARSWVDGYVRLH-----GLLDKKYVALEDCVKLYGESESRLS  61

Query  296  RL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFS  469
             +  D+  Y   DA+TW+S+ M+SH++CLD L  KG     +   +N+T+ L++AL  ++
Sbjct  62   HMLTDMNVYTTHDALTWISSVMTSHKTCLDELKAKGFPEPPQELDKNMTMMLREALVSYA  121

Query  470  QKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRM  649
            + R  KT   +  ++      GGLL SWSS +S A+  VAQDGSG +K+I EA+ AL+ M
Sbjct  122  KNRG-KTKEPL--QETLLESNGGLLASWSSGTSNADFTVAQDGSGTHKTIIEAIDALAAM  178

Query  650  GNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATF  829
             +    R V+YVK+GVYNE+V+I   +KNVM VGDG+D+TI+TGN+NV  G +T  SATF
Sbjct  179  DSSRPSRPVIYVKSGVYNEKVDIGINLKNVMFVGDGIDQTIVTGNKNVIQGYSTISSATF  238

Query  830  RVSGDGFWAR  859
             VSGDGFWAR
Sbjct  239  DVSGDGFWAR  248



>emb|CDX71786.1| BnaC08g30880D [Brassica napus]
Length=522

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 168/287 (59%), Gaps = 43/287 (15%)
 Frame = +2

Query  107  ALTASNQDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEE  286
            A++ +  +L  +  AR++V+ A     S+  + E + E   +  +  +SDC  LY ++E 
Sbjct  23   AISFNTSELDVLERARASVVEARTRFGSMATV-EATNEVARSYYSLGLSDCEKLYDESEA  81

Query  287  RLARLDI--EKYDHDDAVTWLSAAMSSHRSCLDGLNE-----KGLVSHGRHASQNLTLSL  445
            RL  L +  E +  +D  TWLS  +++H +CLDGL++     K LV        N+T+ L
Sbjct  82   RLLNLVVAHENFTVEDVRTWLSGVLANHHTCLDGLDQSRQGDKPLVH------SNITVVL  135

Query  446  KQALARFSQKR--------NVKTTR---------------------KVVHKKPsssdggg  538
             +ALA + + R        N   TR                     +  H     +  GG
Sbjct  136  GEALAFYKKTRGRLKKRRPNHTPTRQHHAPTRPHHGPTRPNHNGPARPYHGPVRPNQSGG  195

Query  539  lldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEI  718
            +L SW    S+A+ VVA+DGS  ++SI+EA++A+SRMG     RV++Y+KAGVYNE++EI
Sbjct  196  MLVSWDPTGSRADFVVAKDGSATHRSISEALAAVSRMGKSRTNRVIIYIKAGVYNEKIEI  255

Query  719  ERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +R +KN+MLVGDGMDRTIIT NRNV DGSTT+GSATF VSGDGFW+R
Sbjct  256  DRHMKNIMLVGDGMDRTIITNNRNVPDGSTTYGSATFGVSGDGFWSR  302



>ref|XP_003553884.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
isoform X1 [Glycine max]
 gb|KHN00029.1| Putative pectinesterase/pectinesterase inhibitor 36 [Glycine 
soja]
Length=468

 Score =   177 bits (448),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 106/250 (42%), Positives = 156/250 (62%), Gaps = 10/250 (4%)
 Frame = +2

Query  116  ASNQDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLA  295
             S++++ A++  +  V +A  W      LH        +    A+ DC  LY ++E RL+
Sbjct  7    CSSKEMKALKMVQIQVSQARSWVDGYVRLH-----GLLDKKYVALEDCVKLYGESESRLS  61

Query  296  RL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFS  469
             +  D+  Y   DA+TW+S+ M+SH++CLD L  KG     +   +N+T+ L++AL  ++
Sbjct  62   HMLTDMNVYTTHDALTWISSVMTSHKTCLDELKAKGFPEPPQELDKNMTMMLREALVSYA  121

Query  470  QKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRM  649
            + R  KT   +  ++      GGLL SWSS +S A+  VAQDGSG +K+I EA+ AL+ M
Sbjct  122  KNRG-KTKEPL--QETLLESNGGLLASWSSGTSNADFTVAQDGSGTHKTIIEAIDALAAM  178

Query  650  GNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATF  829
             +    R V+YVK+GVYNE+V+I   +KNVM VGDG+D+TI+TGN+NV  G +T  SATF
Sbjct  179  DSSRPSRPVIYVKSGVYNEKVDIGINLKNVMFVGDGIDQTIVTGNKNVIQGYSTISSATF  238

Query  830  RVSGDGFWAR  859
             VSGDGFWAR
Sbjct  239  DVSGDGFWAR  248



>ref|XP_009116752.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Brassica rapa]
Length=521

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 115/286 (40%), Positives = 169/286 (59%), Gaps = 42/286 (15%)
 Frame = +2

Query  107  ALTASNQDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEE  286
            A++ +  +L  +  AR++V+ A     S+  + E + E   +  +  +SDC  LY ++E 
Sbjct  23   AISFNTSELDVLERARASVVEARTRFGSMATV-EATNEVARSYYSLGLSDCEKLYDESEA  81

Query  287  RLARLDI--EKYDHDDAVTWLSAAMSSHRSCLDGLNE-----KGLVSHGRHASQNLTLSL  445
            RL+ L +  E +  +D  TWLS  +++H +CLDGL++     K LV        N+T+ L
Sbjct  82   RLSNLVVAHENFTVEDVRTWLSGVLANHHTCLDGLDQSRQGDKPLVH------SNITVVL  135

Query  446  KQALARFSQKR--------NVKTTR--------------------KVVHKKPsssdgggl  541
             +ALA + + R        N   TR                    +  H     +  GG+
Sbjct  136  GEALAFYKKTRGHLKKRRPNHAPTRQHHATTRPHHGPTRPNHGPARPYHGPARPNQSGGM  195

Query  542  ldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIE  721
            L SW+   S+A+ VVA+DGS  ++SI+EA++A+SRMG     R ++Y+KAGVYNE++EI+
Sbjct  196  LVSWNPTGSRADFVVAKDGSATHRSISEALAAVSRMGKSRTNRGIIYIKAGVYNEKIEID  255

Query  722  RGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            R +KN+MLVGDGMDRTIIT NRNV DGS+T+GSATF VSGDGFWAR
Sbjct  256  RHMKNIMLVGDGMDRTIITNNRNVPDGSSTYGSATFGVSGDGFWAR  301



>ref|XP_010941122.1| PREDICTED: pectinesterase [Elaeis guineensis]
Length=493

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 160/247 (65%), Gaps = 18/247 (7%)
 Frame = +2

Query  137  AIRTARSNVLRALEW-SQSLH----ELHEPSRESGnnaaaaaVSDCATLYADAEERLARL  301
            A++ AR  ++ A+EW S S++     LHE  +         A+SDCA LY D EE L RL
Sbjct  39   AVQKARDALVSAIEWVSASIYLERDGLHETQK-------GMALSDCARLYEDGEETLRRL  91

Query  302  DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQKRN  481
                Y+  DA TWLSAAM++H +C++GL +  + +     ++N+   L++ALA  +   +
Sbjct  92   -TGDYELVDAHTWLSAAMTAHSTCVEGLRQVNVPAPA--LARNVRALLRKALAWHAPPAD  148

Query  482  VKTTRKVVHK-KPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNG  658
            +K   +  H    ++ D  GLL SW S+  +A++VVAQDGSGNYK+I+EAV+AL +    
Sbjct  149  LKDDEQPNHWWNVTALDDAGLLVSWDSSKQRADMVVAQDGSGNYKTISEAVAALQQQRR-  207

Query  659  GEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVS  838
             E RVV+YVK GVY E V+I R +KNVM VGDG+D T+ITG+RNV DG TTF SATF V+
Sbjct  208  -ESRVVIYVKRGVYKEYVDIGRKLKNVMFVGDGIDNTVITGDRNVPDGYTTFSSATFGVT  266

Query  839  GDGFWAR  859
            GD FWAR
Sbjct  267  GDNFWAR  273



>ref|XP_008794816.1| PREDICTED: pectinesterase [Phoenix dactylifera]
Length=480

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 105/206 (51%), Positives = 143/206 (69%), Gaps = 5/206 (2%)
 Frame = +2

Query  248  VSDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQ  427
            +SDCA LY D++E L RL  E Y+  DA+TWLSAAM++H +C+ GL +  + +    +++
Sbjct  58   LSDCARLYEDSKEALRRLTGE-YELADALTWLSAAMTAHSTCMGGLRQ--MNASASASAR  114

Query  428  NLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGN  607
            N+   L++ALA  +    +K  +       ++ D  GLL SW ++  +A++VVAQDGSGN
Sbjct  115  NVRALLRKALALHAPPAGLKDGQISHWWNATALDDAGLLVSWDASKQRADMVVAQDGSGN  174

Query  608  YKSINEAVSALSRMGNGG--EGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            YK+INEAV+AL +       E RVV+YVK+GVY E VEI R +KNVMLVGDG+D TI+TG
Sbjct  175  YKTINEAVAALQQQQQQQQRESRVVIYVKSGVYEEYVEIGRKLKNVMLVGDGIDSTIVTG  234

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            N NV+DG TTF SATF V+GD FWAR
Sbjct  235  NHNVRDGYTTFSSATFGVTGDNFWAR  260



>ref|XP_006292970.1| hypothetical protein CARUB_v10019247mg [Capsella rubella]
 gb|EOA25868.1| hypothetical protein CARUB_v10019247mg [Capsella rubella]
Length=527

 Score =   175 bits (444),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 108/284 (38%), Positives = 163/284 (57%), Gaps = 36/284 (13%)
 Frame = +2

Query  113  TASNQDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERL  292
            T++  +L  ++ A++ V+ A     S+  +   S  + +      +S+C  LY + E RL
Sbjct  25   TSNTAELDVLKMAQTAVVEARTSFGSIAVVEATSEVATSRYHNLVLSECEKLYGEGEARL  84

Query  293  ARLDI--EKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARF  466
            ++L +  E +  +D  TWLS  +++H +CLDGL ++    H      N+TL L++ALA +
Sbjct  85   SKLVVAHENFTVEDVRTWLSGVLANHHTCLDGLAQE-RQGHKPLVHSNVTLVLREALAFY  143

Query  467  SQKRNVKTTR---------------------------------KVVHKKPsssdggglld  547
             + R     R                                 +  H     +  GG+L 
Sbjct  144  KKSRGHIKKRLHGPARPNHRPEGQKHGPRRPKHGPTRPNHGPERQSHGPSRPNQSGGMLV  203

Query  548  swssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERG  727
            SW+   S+A+ VVAQDGS  +++IN+A++A+S MG     RV++Y+KAGVYNE+++I+R 
Sbjct  204  SWNPTRSRADFVVAQDGSATHRTINQALAAISGMGKSRSNRVIIYIKAGVYNEKIDIDRH  263

Query  728  IKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +KN+MLVGDGMDRTI+T NRNV DGSTT+GSATF VSGDGFWAR
Sbjct  264  MKNIMLVGDGMDRTIVTNNRNVPDGSTTYGSATFGVSGDGFWAR  307



>ref|XP_007134835.1| hypothetical protein PHAVU_010G080300g [Phaseolus vulgaris]
 gb|ESW06829.1| hypothetical protein PHAVU_010G080300g [Phaseolus vulgaris]
Length=486

 Score =   173 bits (439),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/204 (49%), Positives = 141/204 (69%), Gaps = 9/204 (4%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEK--YDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQ  427
            DCA LY ++E RL+ +  +   Y  +DA+TW+SA M++HR+CLDGL EKG V   +    
Sbjct  70   DCAKLYEESECRLSHMMSQNSSYTKEDALTWISALMTNHRTCLDGLQEKGYV-QAQILDT  128

Query  428  NLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGN  607
            NLT+SLKQAL  +S+ + +    K    + + S   G+L+SWS AS + +  VAQDGSG 
Sbjct  129  NLTMSLKQALILYSKNKGIA---KGPPPQGTISKASGILESWSEASYEPDFTVAQDGSGT  185

Query  608  YKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNR  787
            +++I  AV+A+   G+    RV+++VK+G+Y E+V+I + + NVMLVGDG+D+TI+T NR
Sbjct  186  HRTIQAAVNAI---GHDRPARVIIHVKSGIYTEKVQIGQKLHNVMLVGDGIDKTIVTANR  242

Query  788  NVQDGSTTFGSATFRVSGDGFWAR  859
            NV  GSTT  SATF VSGDGFWAR
Sbjct  243  NVAQGSTTMNSATFDVSGDGFWAR  266



>ref|XP_007052105.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOX96262.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=594

 Score =   174 bits (441),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 118/180 (66%), Gaps = 29/180 (16%)
 Frame = +2

Query  323  DDAVTWLSAAMSSHRSCLDGLNEKGLVSHGR-HASQNLTLSLKQALARFSQKRNVKTTRK  499
            DDA TWLS   ++HR+CL+GL E+G+V      A QNLT  L +ALA + +   +K    
Sbjct  223  DDARTWLSGVPANHRTCLEGLGERGVVIQDHADAHQNLTTLLSEALALYGKHVVIK----  278

Query  500  VVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVV  679
                                    A+ VVA DGSG +K+INEAV+A++RMGN    RV++
Sbjct  279  ------------------------ADFVVATDGSGTHKTINEAVAAVARMGNRRPQRVII  314

Query  680  YVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            YVK+GVY+E V+I+R +KNV LVGDGMD+TI+TG+RNV DG+T  GSATF VSGDGFWAR
Sbjct  315  YVKSGVYSENVDIDRNVKNVWLVGDGMDKTIVTGSRNVPDGATILGSATFGVSGDGFWAR  374



>ref|XP_004168286.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Cucumis sativus]
 gb|KGN56615.1| hypothetical protein Csa_3G126790 [Cucumis sativus]
Length=487

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 149/223 (67%), Gaps = 13/223 (6%)
 Frame = +2

Query  215  RESGnnaaaaaVSDCATLYADAEERLARLDI--EKYDHDDAVTWLSAAMSSHRSCLDGLN  388
            R+ G+    AA+ DCATLY +AE RLA + +   KY  +D   W+SAAM++HRSCLDGL 
Sbjct  50   RQFGDWNLQAALRDCATLYEEAEWRLAGMLVGENKYRAEDGRMWVSAAMANHRSCLDGLE  109

Query  389  EKGLVSHGRHASQNLTLSLKQALARFS-----QKRNVKTTRKVVHKKPsssdggglldsw  553
            E   V+       NLT+ L  AL  +      +KRN    RK + K+    + G  L +W
Sbjct  110  EVHDVAA--VDGNNLTVMLTGALHLYDKIAAVEKRN---GRKRLGKRKWRENRGTNLATW  164

Query  554  ssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGR-VVVYVKAGVYNERVEIERGI  730
            + A+SKAN VVA+DGSG +++IN AV+AL+R G    G  +V+YVKAGVY E VEI   +
Sbjct  165  NPATSKANYVVAKDGSGTHRTINRAVAALARSGRTRRGGRIVIYVKAGVYRENVEIGIQL  224

Query  731  KNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            KNVMLVGDG+D+TI+TG+RNV DG+TT+ SATF VSGDGFW R
Sbjct  225  KNVMLVGDGIDKTIVTGSRNVPDGATTYNSATFGVSGDGFWVR  267



>ref|XP_004134349.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Cucumis sativus]
Length=490

 Score =   169 bits (429),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 149/223 (67%), Gaps = 13/223 (6%)
 Frame = +2

Query  215  RESGnnaaaaaVSDCATLYADAEERLARLDI--EKYDHDDAVTWLSAAMSSHRSCLDGLN  388
            R+ G+    AA+ DCATLY +AE RLA + +   KY  +D   W+SAAM++HRSCLDGL 
Sbjct  53   RQFGDWNLQAALRDCATLYEEAEWRLAGMLVGENKYRAEDGRMWVSAAMANHRSCLDGLE  112

Query  389  EKGLVSHGRHASQNLTLSLKQALARFS-----QKRNVKTTRKVVHKKPsssdggglldsw  553
            E   V+       NLT+ L  AL  +      +KRN    RK + K+    + G  L +W
Sbjct  113  EVHDVAA--VDGNNLTVMLTGALHLYDKIAAVEKRN---GRKRLGKRKWRENRGTNLATW  167

Query  554  ssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGR-VVVYVKAGVYNERVEIERGI  730
            + A+SKAN VVA+DGSG +++IN AV+AL+R G    G  +V+YVKAGVY E VEI   +
Sbjct  168  NPATSKANYVVAKDGSGTHRTINRAVAALARSGRTRRGGRIVIYVKAGVYRENVEIGIQL  227

Query  731  KNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            KNVMLVGDG+D+TI+TG+RNV DG+TT+ SATF VSGDGFW R
Sbjct  228  KNVMLVGDGIDKTIVTGSRNVPDGATTYNSATFGVSGDGFWVR  270



>ref|XP_004308463.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Fragaria vesca subsp. vesca]
Length=216

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 140/222 (63%), Gaps = 19/222 (9%)
 Frame = +2

Query  191  LHELHEPSRESGnnaaaaaVSDCATLYADAEERLARLDIEK--YDHDDAVTWLSAAMSSH  364
            LH L   S ES       A+ DC  LY ++  RL  L   +  Y  +DA TWLS  +++H
Sbjct  4    LHVL--ASSESDPPGCDVALMDCERLYDESVPRLTELISGEGNYTGEDAWTWLSGVLANH  61

Query  365  RSCLDGLNEKGLVSHG------RHASQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsss  526
            RSC  GL EKG+V +       R  +QNLT+ L +ALA +         +KV+H++ S++
Sbjct  62   RSCWAGLEEKGVVKNTSAAQQYRAVAQNLTVVLGEALALYG--------KKVLHRQNSNA  113

Query  527  dggglldsw-ssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYN  703
               G L +  + A S+A+ VVA+DGSG + +IN AV+AL+RMG+    R ++YVK+GVYN
Sbjct  114  KPNGGLLASWNPARSRADFVVAKDGSGTHTTINHAVAALARMGDKRPPRAIIYVKSGVYN  173

Query  704  ERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATF  829
            E+VEI   +KNVMLVGDGMDRT+I G+R+V DG TT  SATF
Sbjct  174  EKVEIGGHMKNVMLVGDGMDRTVIIGSRSVVDGDTTLTSATF  215



>ref|XP_008438191.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
isoform X1 [Cucumis melo]
Length=490

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 139/211 (66%), Gaps = 13/211 (6%)
 Frame = +2

Query  254  DCATLYADAEERLARLDI---EKYDHDDAVTWLSAAMSSHRSCLDGLNE---KGLVSHGR  415
            DCA LY +AE RLA + +   + Y  +D   W+SAAM++HRSCLDGL E    G    G 
Sbjct  64   DCAKLYEEAEWRLAGMLVGGEKYYSAEDGRMWVSAAMANHRSCLDGLEEVDADGAAVGG-  122

Query  416  HASQNLTLSLKQALARFSQKRNV--KTTRKVVHKKPsssdggglldswssassKANIVVA  589
                NLT+ L  AL  + +   V  +   K + K+    + G  L +W+ A+SKA+ VVA
Sbjct  123  ---HNLTVMLTGALHLYDKIAAVEKRNGWKRLEKRKWRENRGINLATWNPATSKADYVVA  179

Query  590  QDGSGNYKSINEAVSAL-SRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDR  766
            +DGSG + +IN AV+AL S     G GR+V+YVKAGVY E VEI   +KNVMLVGDG+D+
Sbjct  180  KDGSGTHTTINRAVAALASTGRRRGGGRIVIYVKAGVYRENVEIGIQLKNVMLVGDGIDK  239

Query  767  TIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TI+TG+RNV DG+TT+ SATF VSGDGFWAR
Sbjct  240  TIVTGSRNVPDGATTYNSATFGVSGDGFWAR  270



>gb|KHN21590.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=527

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 130/215 (60%), Gaps = 16/215 (7%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-----  418
            DC  LY +   +L R  +   + +D +TW SA++++H++C +G  +  L SH  +     
Sbjct  97   DCLELYENTLYQLKR-SMNSNNLNDRLTWQSASIANHQTCQNGFTDFNLPSHLNYFPSML  155

Query  419  ------ASQNLTLSLKQALARFSQKRNVKTT--RKVVHKKPsssdggglldswssassKA  574
                   S +L++S    L  FS   + K +  R+++                   +SKA
Sbjct  156  SNFSELLSNSLSISKAMTLTSFSSSPSTKQSGGRRLLSDGFPYWLSRSDRRLLQETASKA  215

Query  575  NIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGD  754
            ++VVAQDGSGNYK+I+E V+A S  G  G+GRVVV+VKAGVY E ++I+R +KN+M+VGD
Sbjct  216  DVVVAQDGSGNYKTISEGVNAAS--GLSGKGRVVVHVKAGVYKENIDIKRTVKNLMIVGD  273

Query  755  GMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GM  TI+TGN N QDGSTTF SATF V GDGF AR
Sbjct  274  GMGATIVTGNLNAQDGSTTFRSATFAVDGDGFIAR  308



>ref|XP_006580437.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
isoform X1 [Glycine max]
Length=527

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 130/215 (60%), Gaps = 16/215 (7%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-----  418
            DC  LY +   +L R  +   + +D +TW SA++++H++C +G  +  L SH  +     
Sbjct  97   DCLELYENTLYQLKR-SMNSNNLNDRLTWQSASIANHQTCQNGFTDFNLPSHLNYFPSML  155

Query  419  ------ASQNLTLSLKQALARFSQKRNVKTT--RKVVHKKPsssdggglldswssassKA  574
                   S +L++S    L  FS   + K +  R+++                   +SKA
Sbjct  156  SNFSELLSNSLSISKAMTLTSFSSSPSTKQSGGRRLLSDGFPYWLSRSDRRLLQETASKA  215

Query  575  NIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGD  754
            ++VVAQDGSGNYK+I+E V+A S  G  G+GRVVV+VKAGVY E ++I+R +KN+M+VGD
Sbjct  216  DVVVAQDGSGNYKTISEGVNAAS--GLSGKGRVVVHVKAGVYKENIDIKRTVKNLMIVGD  273

Query  755  GMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GM  TI+TGN N QDGSTTF SATF V GDGF AR
Sbjct  274  GMGATIVTGNLNAQDGSTTFRSATFAVDGDGFIAR  308



>ref|XP_010044212.1| PREDICTED: pectinesterase [Eucalyptus grandis]
Length=552

 Score =   154 bits (388),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 114/260 (44%), Positives = 155/260 (60%), Gaps = 26/260 (10%)
 Frame = +2

Query  134  LAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLARLDIEK  313
            +A++ A S  LRA E   S+    +PS  S +     A SDC  LY D+   L R  +  
Sbjct  81   VALKVAMSEALRAHELVSSM----DPS--SFDERTRLAWSDCIELYEDSVRLLNR-SVSS  133

Query  314  YDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSH-----------GRHASQNLTL----SLK  448
                D+ TWLSAA+++HR+C +G NE  L SH            +  S +L +    S  
Sbjct  134  KKPSDSQTWLSAAITNHRTCQNGFNEFNLASHLESFPLMLSNFSKLLSNSLAINKVSSSS  193

Query  449  QALARFSQKRNVKTTRKV-VHKK-Ps-ssdggglldswssassKANIVVAQDGSGNYKSI  619
             + AR S  + V+  R +  H+K PS  S     L   + A +KA++VVA+DGSGNYK+I
Sbjct  194  YSPARVSFSKQVRGRRLLGDHEKFPSWVSASDRKLLQTARAPAKADLVVAKDGSGNYKTI  253

Query  620  NEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQD  799
            +EAV+A S     G  R V+YVKAGVY+E VE++R +KN+M+VGDG+D TI+TG++N QD
Sbjct  254  SEAVAA-SSSKRSGSSRFVIYVKAGVYSENVEVKRSMKNLMIVGDGIDATIVTGDKNAQD  312

Query  800  GSTTFGSATFRVSGDGFWAR  859
            GSTTF SATF V GDGF AR
Sbjct  313  GSTTFRSATFAVMGDGFIAR  332



>ref|XP_010497220.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36, 
partial [Camelina sativa]
Length=296

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLV  748
            +A+ VVAQDGS  Y++IN+A++A+S MG     RV++Y+KAGVYNE++EI+R +KN+MLV
Sbjct  68   RADFVVAQDGSATYRTINQALAAVSSMGKSRTNRVIIYIKAGVYNEKIEIDRHMKNIMLV  127

Query  749  GDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GDGMDRTI+T NRNV DGSTT+GSATF VSGDGFWAR
Sbjct  128  GDGMDRTIVTNNRNVPDGSTTYGSATFGVSGDGFWAR  164



>ref|XP_007160398.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
 gb|ESW32392.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
Length=517

 Score =   152 bits (384),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 129/213 (61%), Gaps = 15/213 (7%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNL  433
            DC  LY D   +L R  +   + +D +TW SA++++H++C +G  E  L SH  H    L
Sbjct  90   DCLELYEDTLYQLKR-SLNSNNLNDRLTWQSASIANHQTCQNGFTEFNLPSHLNHFPSML  148

Query  434  T-----------LSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANI  580
            T           LS   +LA  S  +     R+++     S             +SKA++
Sbjct  149  TNFSKLLSNSLSLSKAMSLASLSSTKQ-NGGRRLLSDGFPSWMSHSDRKLLQETASKADV  207

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVAQDGSGNYK+I+E V+A S++   G+GRVVV+VKAGVY E ++I+R +KN+M++GDGM
Sbjct  208  VVAQDGSGNYKTISEGVAAASKLS--GKGRVVVHVKAGVYKESIDIKRTVKNLMIIGDGM  265

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
              TI+TG+ N QDGSTTF SATF VSGD F AR
Sbjct  266  GATIVTGSNNAQDGSTTFRSATFAVSGDNFIAR  298



>ref|XP_006580436.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=521

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 127/214 (59%), Gaps = 15/214 (7%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNL  433
            DC  LY D   +L R  +     +D +TW SA++++H++C +G  E  L SH  +    L
Sbjct  92   DCLELYEDTLYQLKR-SMNSNKLNDRLTWQSASIANHQTCQNGFTEFNLPSHLNYFPSML  150

Query  434  T---------LSLKQALARFSQKRNVKTT---RKVVHKKPsssdggglldswssassKAN  577
            +         LS+ + +       + K +   R ++                   + KA+
Sbjct  151  SNFSKLLSNSLSISKTMMMTLTTSSTKQSGGRRLLLSDGFPYWLSHSDRRLLQETTPKAD  210

Query  578  IVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDG  757
            +VVAQDGSGNYK+I+E V+A +++   G+GRVVV+VKAGVY + ++I+R +KN+M++GDG
Sbjct  211  VVVAQDGSGNYKTISEGVAAAAKLS--GKGRVVVHVKAGVYKDSIDIKRTVKNLMIIGDG  268

Query  758  MDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            M  TI+TGN N QDGSTTF SATF VSGDGF AR
Sbjct  269  MGATIVTGNLNAQDGSTTFRSATFAVSGDGFIAR  302



>gb|KHN21591.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=521

 Score =   149 bits (377),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 127/214 (59%), Gaps = 15/214 (7%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNL  433
            DC  LY D   +L R  +     +D +TW SA++++H++C +G  E  L SH  +    L
Sbjct  92   DCLELYEDTLYQLKR-SMNSNKLNDRLTWQSASIANHQTCQNGFTEFNLPSHLNYFPSML  150

Query  434  T---------LSLKQALARFSQKRNVKTT---RKVVHKKPsssdggglldswssassKAN  577
            +         LS+ + +       + K +   R ++                   + KA+
Sbjct  151  SNFSKLLSNSLSISKTMMMTLTTSSTKQSGGRRLLLSDGFPYWLSHSDRRLLQETTPKAD  210

Query  578  IVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDG  757
            +VVAQDGSGNYK+I+E V+A +++   G+GRVVV+VKAGVY + ++I+R +KN+M++GDG
Sbjct  211  VVVAQDGSGNYKTISEGVAAAAKLS--GKGRVVVHVKAGVYKDSIDIKRTVKNLMIIGDG  268

Query  758  MDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            M  TI+TGN N QDGSTTF SATF VSGDGF AR
Sbjct  269  MGATIVTGNLNAQDGSTTFRSATFAVSGDGFIAR  302



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   147 bits (371),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 93/233 (40%), Positives = 136/233 (58%), Gaps = 16/233 (7%)
 Frame = +2

Query  182  SQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSS  361
            + +L  L EP++ +         +DC  L+ D    L R        +DA TWLSAAM++
Sbjct  79   AMNLAPLDEPAKAAW--------ADCLELFEDTIGHLNRSLGHSSSAEDAQTWLSAAMAN  130

Query  362  HRSCLDGLNEKG---LVSHGRHASQNLTLSLKQALA---RFSQKRNVKTTRKVVHKKPs-  520
             ++C +G  E G   L +     + N++ SL  +LA      + +     R +    P  
Sbjct  131  QQTCKNGFAELGTSFLFTSSLFMANNISESLSNSLAVNNAMPRGKAPGNRRLLSQGFPGW  190

Query  521  ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVY  700
                   L   SS++ KAN+VVA+DGSG+YK+I+EAV+A +++   G  R V+ VK+G+Y
Sbjct  191  VKAADRKLLQSSSSTIKANLVVAKDGSGDYKTISEAVAASAKL-RSGTSRFVILVKSGIY  249

Query  701  NERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            NE V I   +KN+M++GDGMD T++TG++NVQDGSTTF SATF VSG GF AR
Sbjct  250  NENVVITNSMKNIMMIGDGMDATVVTGSKNVQDGSTTFRSATFAVSGGGFIAR  302



>ref|XP_010469150.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Camelina sativa]
Length=533

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/97 (67%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +2

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLV  748
            +A+ VVAQDGS  +++IN+A++A+S MG     RV++Y+KAGVYNE++EI+R +KN+MLV
Sbjct  217  RADFVVAQDGSATHRTINQALAAVSSMGKSRSNRVIIYIKAGVYNEKIEIDRHMKNIMLV  276

Query  749  GDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GDGMDRTI+T NRNV DGSTT+GSATF VSGDGFWAR
Sbjct  277  GDGMDRTIVTNNRNVPDGSTTYGSATFGVSGDGFWAR  313


 Score = 55.8 bits (133),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 67/126 (53%), Gaps = 5/126 (4%)
 Frame = +2

Query  110  LTASN-QDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEE  286
            +TASN  +L  +  AR+ V+ A     S+  +      SG+   A  +S+C  LY + E 
Sbjct  23   VTASNIAELDVLEMARTAVVEARTRFGSMAVVESEVATSGHYYLA--LSECEKLYDEGEA  80

Query  287  RLARLDI--EKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALA  460
            RL++L +  E +  +D  TWLS  +++H +CLDGL ++           N+T  L++ALA
Sbjct  81   RLSKLVVAHENFTVEDIRTWLSGVLANHNTCLDGLVQERQGHDKPLVHSNVTFVLREALA  140

Query  461  RFSQKR  478
             + + R
Sbjct  141  FYKKSR  146



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/207 (43%), Positives = 127/207 (61%), Gaps = 9/207 (4%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKG---LVSHGRHAS  424
            DC  L  D   +L R  +    +DDA TWLSAAM++ ++C +G  E G           S
Sbjct  93   DCLELCEDTIGKLNR-SMSSSSYDDAQTWLSAAMANQQTCRNGFIELGSSFPFGSSPFTS  151

Query  425  QNLTLSLKQALARFSQKRNVKT--TRKVVHKKPsssdggglldswssassKANIVVAQDG  598
             N++ SL  +LA        K+   R+++     +           S++  A++VVA+DG
Sbjct  152  YNISESLSNSLAINKATTAAKSGGNRRLLSGGFPNWLSAADRKLLHSSTINADLVVAKDG  211

Query  599  SGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIIT  778
            SGNYK+I+EA++A ++  NG   R V++VKAGVYNE V+    +KN+M+VGDGM+ T++T
Sbjct  212  SGNYKTISEAIAAATKQSNG-RSRFVIHVKAGVYNENVQTP--MKNLMIVGDGMNATVVT  268

Query  779  GNRNVQDGSTTFGSATFRVSGDGFWAR  859
            G+RNVQDGSTTF SATF V+GDGF AR
Sbjct  269  GSRNVQDGSTTFRSATFAVTGDGFIAR  295



>ref|XP_004297462.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Fragaria vesca subsp. vesca]
Length=548

 Score =   146 bits (368),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/232 (42%), Positives = 132/232 (57%), Gaps = 31/232 (13%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLV-SHGRHA---  421
            DC  LY D  ++L R  +   +  DA+TWLSA++++ ++C +G N+  +  SH + +   
Sbjct  98   DCLELYEDTIDKLNR-SMSSNNALDAITWLSASIANQQTCQNGFNDLNIPNSHLQSSFPN  156

Query  422  ----SQNLTLSLKQALA--------------------RFS-QKRNVKTTRKVVHKKPsss  526
                S +L + L  +LA                     FS Q R  +   K     P+  
Sbjct  157  FYKLSTDLPMLLSNSLAIHKESSTSSSSSSSTSSSAMHFSKQVRGRRLLLKSDAIFPAWV  216

Query  527  dggglldswssassK-ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYN  703
                     SSA  K A+IVVAQDGSGNYK+I EAV+A  +    G  RVV+YVKAGVY 
Sbjct  217  SASDRKLLQSSAGPKSADIVVAQDGSGNYKTITEAVAAAKKSSGSGTKRVVIYVKAGVYK  276

Query  704  ERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            E VE+++ +K +M VGDGMD TI+TGN+N QDGSTTF SATF VSG+GF A+
Sbjct  277  ENVEVKKTMKKLMFVGDGMDATIVTGNKNAQDGSTTFRSATFGVSGEGFIAQ  328



>ref|XP_010413524.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Camelina sativa]
Length=533

 Score =   145 bits (366),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 83/97 (86%), Gaps = 0/97 (0%)
 Frame = +2

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLV  748
            +A+ VVAQDGS  +++IN+A++A+S MG     RV++Y+KAGVYNE++EI+R +KN+MLV
Sbjct  217  RADFVVAQDGSATHRTINQALAAVSSMGKSRSNRVIIYIKAGVYNEKIEIDRHMKNIMLV  276

Query  749  GDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GDGMDRTI+T NRN  DGSTT+GSATF VSGDGFWAR
Sbjct  277  GDGMDRTIVTNNRNFPDGSTTYGSATFGVSGDGFWAR  313


 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 70/132 (53%), Gaps = 17/132 (13%)
 Frame = +2

Query  110  LTASNQ-DLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEE  286
            +TASN  +   +  AR+ V+ A    +S+  +      SG+   A  +S+C  LY + E 
Sbjct  23   VTASNTAEFDVLEMARAAVVEARTLFRSMAVVESEVATSGHYYLA--LSECEKLYDEGEA  80

Query  287  RLARLDI--EKYDHDDAVTWLSAAMSSHRSCLDGL------NEKGLVSHGRHASQNLTLS  442
            RL++L +  E +  +D  TWLS  +++H +CLDGL      ++K LV        N+T  
Sbjct  81   RLSKLVVAHENFTVEDIRTWLSGVLANHNTCLDGLVQERQGHDKPLV------HSNVTFV  134

Query  443  LKQALARFSQKR  478
            L++ALA + + R
Sbjct  135  LREALAFYKKSR  146



>ref|XP_010101977.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90901.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=514

 Score =   144 bits (363),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 126/216 (58%), Gaps = 15/216 (7%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQ-  427
            DC  LY D  + L R ++    +  D  TWLSA++++  +C +G  +  + SH       
Sbjct  80   DCLELYKDTVDLLNRSVNSNNKNPLDTHTWLSASLANQHTCRNGFTDFQIPSHYDSFPSM  139

Query  428  --NLTLSLKQALA---------RFSQKRNVKTTRKVVHKKPs-ssdggglldswssassK  571
              N +  L  +LA           S  + V++ R +    P   S     L     A++K
Sbjct  140  LSNFSKLLSNSLAINKATIPSTATSFSKQVRSRRLLSDGFPEWVSAADRKLLQSGGAAAK  199

Query  572  ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVG  751
            A+IVVAQDGSG +K+I+EAV A   +G GG  R+VVYVKAGVY E VEI+  IKN+M VG
Sbjct  200  ADIVVAQDGSGGFKTISEAVEAAKNLG-GGSKRIVVYVKAGVYKENVEIKNDIKNLMFVG  258

Query  752  DGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            DG+D TI+TGNRN  DGSTTF SATF VSGDGF A+
Sbjct  259  DGIDATIVTGNRNNVDGSTTFQSATFGVSGDGFIAQ  294



>ref|XP_003530788.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=526

 Score =   144 bits (363),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 89/215 (41%), Positives = 124/215 (58%), Gaps = 16/215 (7%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNL  433
            DC  LY +   +L R  +   + +D +TW SA++++H++C +G  +  L SH  +    L
Sbjct  96   DCLELYENTLYQLKR-SMNSNNLNDRMTWQSASIANHQTCQNGFTDFNLPSHLNYFPSML  154

Query  434  TLSLK-----------QALARFSQKRNVKTT--RKVVHKKPsssdggglldswssassKA  574
            +                 L   S     K +  RK++                   +SKA
Sbjct  155  SNLSGLLSNSLSISKAMTLRSLSSSPTTKQSGGRKLLSDGFPYWLSRSDRKLLQETASKA  214

Query  575  NIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGD  754
            ++VVAQDGSGNYK+I+E V+A SR+   G+GRVVV+VKAGVY E ++I+R +KN+M+VGD
Sbjct  215  DVVVAQDGSGNYKTISEGVAAASRLS--GKGRVVVHVKAGVYKENIDIKRTVKNLMIVGD  272

Query  755  GMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GM  TI+TGN N  DGSTTF SATF V GDGF AR
Sbjct  273  GMGATIVTGNHNAIDGSTTFRSATFAVDGDGFIAR  307



>ref|XP_011070723.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase [Sesamum indicum]
Length=511

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 136/214 (64%), Gaps = 15/214 (7%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQN  430
            +DC  LY D  ++L R         DA TWLSAA+++ ++C  G  +  L S  +  S N
Sbjct  83   ADCLELYEDTIDQLNRSSGRGTGAVDAQTWLSAAIANEKTCKTGFLDMKLFSQLK--SFN  140

Query  431  LTLS-------LKQALARFSQKRNVKTTRKVVHKK--P--sssdggglldswssassKAN  577
            L LS       L+ +LA   +  NV+  R +  ++  P   S+    +L   S  S KA+
Sbjct  141  LMLSDDDFPKFLRNSLA-IIKAMNVRERRLLSDERNFPDWVSAGNRKILVETSGGSIKAD  199

Query  578  IVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDG  757
            IVVA+DGSG+Y++I++A++A ++  NG + R V+YVK GVY E VE+++ +KN+M VGDG
Sbjct  200  IVVAEDGSGDYRTISDALAAAAKQRNGTK-RFVIYVKRGVYKENVEVKKSMKNLMFVGDG  258

Query  758  MDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +D TI+TG++NVQDGSTTF SATF +SGDGF AR
Sbjct  259  IDATIVTGSKNVQDGSTTFRSATFAISGDGFIAR  292



>gb|EYU33116.1| hypothetical protein MIMGU_mgv1a022674mg [Erythranthe guttata]
Length=521

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 124/213 (58%), Gaps = 18/213 (8%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNL  433
            DC  LY D   +L R        +DA TWLS+++++ ++C +G  +  L       S + 
Sbjct  100  DCLDLYEDTIYQLNRSIFGS--KNDAQTWLSSSIANEQACRNGFLDFNLSFSMMLMSDDF  157

Query  434  TLSLKQALA-----------RFSQKRNVKTTRKVVHKKPsssdggglldswssassKANI  580
            +  L  +LA              QKRN    R+++                  +S+K +I
Sbjct  158  SKYLSNSLAINKATASASSYTTKQKRN----RRLLSTVDFPEWVSHGDRRLLQSSTKGDI  213

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVAQDGSGNYK+INEA++A  +  +G   R V+YVK GVY E VE++R +KN+M +GDG+
Sbjct  214  VVAQDGSGNYKTINEALAAAEKQRSGTR-RFVIYVKKGVYKENVEVKRSMKNLMFIGDGI  272

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            D T++TG++NVQDGSTTF SATF V+GDGF AR
Sbjct  273  DSTVVTGSKNVQDGSTTFRSATFAVTGDGFIAR  305



>ref|XP_010101979.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90903.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=463

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 95/216 (44%), Positives = 126/216 (58%), Gaps = 15/216 (7%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQ-  427
            DC  LY D  + L R ++    +  D  TWLSA++++  +C +G  +  + SH       
Sbjct  29   DCLELYKDTVDLLNRSVNSNNKNPLDTHTWLSASLANQHTCRNGFTDFQIPSHYDSFPSM  88

Query  428  --NLTLSLKQALA---------RFSQKRNVKTTRKVVHKKPs-ssdggglldswssassK  571
              N +  L  +LA           S  + V++ R +    P   S     L     A++K
Sbjct  89   LSNFSKLLSNSLAINKATIPSTATSFSKQVRSRRLLSDGFPEWVSTADRKLLQSGGAAAK  148

Query  572  ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVG  751
            A+IVVAQDGSG +K+I+EAV A   +G GG  R+VVYVKAGVYNE VEI+  IKN+M VG
Sbjct  149  ADIVVAQDGSGGFKTISEAVEAAKNLG-GGSKRIVVYVKAGVYNENVEIKNDIKNLMFVG  207

Query  752  DGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            DG+D TI+TGNRN  DGSTTF SATF VSGD F A+
Sbjct  208  DGIDATIVTGNRNNVDGSTTFQSATFGVSGDRFIAQ  243



>ref|XP_008438192.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
isoform X2 [Cucumis melo]
Length=443

 Score =   142 bits (358),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 132/206 (64%), Gaps = 13/206 (6%)
 Frame = +2

Query  248  VSDCATLYADAEERLARLDI---EKYDHDDAVTWLSAAMSSHRSCLDGLNE---KGLVSH  409
            + DCA LY +AE RLA + +   + Y  +D   W+SAAM++HRSCLDGL E    G    
Sbjct  62   LRDCAKLYEEAEWRLAGMLVGGEKYYSAEDGRMWVSAAMANHRSCLDGLEEVDADGAAVG  121

Query  410  GRHASQNLTLSLKQALARFSQKRNVKTTR--KVVHKKPsssdggglldswssassKANIV  583
            G     NLT+ L  AL  + +   V+     K + K+    + G  L +W+ A+SKA+ V
Sbjct  122  G----HNLTVMLTGALHLYDKIAAVEKRNGWKRLEKRKWRENRGINLATWNPATSKADYV  177

Query  584  VAQDGSGNYKSINEAVSAL-SRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VA+DGSG + +IN AV+AL S     G GR+V+YVKAGVY E VEI   +KNVMLVGDG+
Sbjct  178  VAKDGSGTHTTINRAVAALASTGRRRGGGRIVIYVKAGVYRENVEIGIQLKNVMLVGDGI  237

Query  761  DRTIITGNRNVQDGSTTFGSATFRVS  838
            D+TI+TG+RNV DG+TT+ SATF + 
Sbjct  238  DKTIVTGSRNVPDGATTYNSATFELP  263



>gb|EYU24929.1| hypothetical protein MIMGU_mgv1a025888mg, partial [Erythranthe 
guttata]
Length=486

 Score =   141 bits (355),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 124/217 (57%), Gaps = 22/217 (10%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNL  433
            DC  LY D   +L R        +DA TWLS+++++ ++C +G  +  L       S + 
Sbjct  61   DCLDLYEDTIYQLNRSIFGS--KNDAQTWLSSSIANEQACRNGFLDFNLSFPTMLTSDDF  118

Query  434  TLSLKQALA---------------RFSQKRNVKTTRKVVHKKPsssdggglldswssass  568
            +  L  +LA                  QKRN    R+++                  +S+
Sbjct  119  SKYLSNSLAINKATASASASASSYATKQKRN----RRLLSTVDFPEWVSHGDRRLLQSST  174

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLV  748
            K +IVVAQDGSGN+K+INEA++A  +  +G   R V+YVK GVY E VE++R +KN+M +
Sbjct  175  KGDIVVAQDGSGNFKTINEALAAAEKQRSGTR-RFVIYVKKGVYKENVEVKRSMKNLMFI  233

Query  749  GDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GDG+D T++TG++NVQDGSTTF SATF V+GDGF AR
Sbjct  234  GDGIDATVVTGSKNVQDGSTTFRSATFAVTGDGFIAR  270



>gb|KDP38089.1| hypothetical protein JCGZ_04732 [Jatropha curcas]
Length=543

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 94/228 (41%), Positives = 127/228 (56%), Gaps = 26/228 (11%)
 Frame = +2

Query  251  SDCATLYADAEERLAR-LDIEKYDHDDAV---TWLSAAMSSHRSCLDGLNEKGLVSHGRH  418
            +DC  LY D  + L R L +   ++++ V   TWLSAA ++ ++C +G  E  L S+   
Sbjct  97   ADCVELYEDTIDHLNRSLFVSSSNNNNPVDSQTWLSAANTNLQTCQNGFTEFNLTSNYLE  156

Query  419  AS------QNLTLSLKQALA------RFSQKRNVKTT---------RKVVHKKPsssdgg  535
            +        N +  L  +LA        S   N KT          RK++H         
Sbjct  157  SLLLPDMLSNFSKLLSNSLAINKENYYISPLYNSKTVHPGSSGGGGRKLLHDDEFPWWVS  216

Query  536  glldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVE  715
                    +S +A+IVVAQDGSGNYK+I EAV+A S     G  R V+YVK GVY E VE
Sbjct  217  VTDRKLLQSSPEADIVVAQDGSGNYKTIGEAVAA-SATRRSGNKRFVIYVKKGVYKEYVE  275

Query  716  IERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            I+  + N+ML+GDG+D TI+TGN+N QDGSTTF SATF VSG+GF A+
Sbjct  276  IKNSMNNLMLIGDGIDATIVTGNKNNQDGSTTFRSATFAVSGEGFIAK  323



>ref|XP_009625343.1| PREDICTED: pectinesterase-like, partial [Nicotiana tomentosiformis]
Length=504

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 89/220 (40%), Positives = 123/220 (56%), Gaps = 18/220 (8%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHAS--  424
            +DC  LY D   +L +        +D  TWLSAAM++H++CL+G ++  L SH    S  
Sbjct  72   ADCLKLYEDTFYQLNKSINNSGKTNDVQTWLSAAMANHQTCLNGFHDFQLSSHLEKFSSV  131

Query  425  -----QNL--TLSLKQALARFSQKRNVKTTRK--------VVHKKPsssdggglldswss  559
                 +NL  +L++ +A A  S   +     K        V   +               
Sbjct  132  LNDFSENLCNSLAINKATAIPSASLSTNPQLKGRRLLRGGVAWSEAGFLTSPDKKPLQQG  191

Query  560  assKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNV  739
               KA+IVVAQDGSGNY +I+EA++A++ M NG  GR V+YVK G Y E VEIE  + N+
Sbjct  192  TPIKADIVVAQDGSGNYHTISEALAAVNSMRNG-TGRFVIYVKRGNYTEYVEIENTMNNL  250

Query  740  MLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            M +GDG+D TII+GNR+   G +TFGSATF VSG GF A+
Sbjct  251  MFIGDGIDATIISGNRSNGTGYSTFGSATFGVSGGGFIAK  290



>ref|XP_002314796.1| pectin methylesterase 6 family protein [Populus trichocarpa]
 gb|EEF00967.1| pectin methylesterase 6 family protein [Populus trichocarpa]
Length=531

 Score =   140 bits (353),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 93/219 (42%), Positives = 132/219 (60%), Gaps = 18/219 (8%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNL  433
            DC  LY D  + + R  +   +  D+ TWLSAA+++ R+C +G  +  +VS+       L
Sbjct  94   DCLKLYEDTVDHVNR-SMSSNNLADSQTWLSAAIANQRTCENGFIDFNIVSYLESLPNML  152

Query  434  ---------TLSLKQALAR-----FSQKRNVKTTRKVVHKKPs--ssdggglldswssas  565
                     TLSL +A+          K++    R +V   PS   +    LL S   A+
Sbjct  153  RNFTKLLSNTLSLNKAIISSTPILLDTKQDGGRRRLLVDGFPSWVPASDRKLLQSNGRAA  212

Query  566  sKANIVVAQDGSGNYKSINEAVSALSRMGNGGEG-RVVVYVKAGVYNERVEIERGIKNVM  742
             KA+IVVAQDGSG+YK+I+EAV+A +++ +G +  R V+YVK GVY E VEI++ +KN+M
Sbjct  213  PKADIVVAQDGSGDYKTISEAVAASAKLRSGTKSKRFVIYVKGGVYKENVEIKKSMKNLM  272

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             VGDG+D T+IT N+N QDG+TTF SAT  VSG GF AR
Sbjct  273  FVGDGIDATVITSNKNTQDGTTTFRSATVGVSGKGFIAR  311



>ref|XP_008389982.1| PREDICTED: pectinesterase [Malus domestica]
 ref|XP_008367067.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=537

 Score =   140 bits (352),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/224 (39%), Positives = 130/224 (58%), Gaps = 21/224 (9%)
 Frame = +2

Query  248  VSDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVS-HGRHAS  424
             +DC  LY D  ++L R  I   +  DA TWLSA++++ ++C +G  +  + S H +   
Sbjct  95   CNDCLELYEDTVDKLNR-SIGSSNXFDANTWLSASLANLKTCQNGFVDFNISSSHLQSFP  153

Query  425  QNLTLS--LKQALARFSQKRNVKTTRKVVHKKPss-----------------sdggglld  547
              +TLS  L + L+       V T    +H                      S     L 
Sbjct  154  NYVTLSSNLSKMLSNSLSVHKVSTFPSALHFSKQVRGRRRTLLSDDGFPEWVSAADRRLL  213

Query  548  swssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERG  727
               S+  KA+++VAQDGSGNYKSI+EAV++  ++ +G   R V++VKAGVY E VEI++ 
Sbjct  214  QSGSSGPKADMIVAQDGSGNYKSISEAVNSAHKLRSGATKRFVIHVKAGVYRENVEIKKT  273

Query  728  IKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +KN+M +GDG+D TI+TGN+N QDGSTT+ SATF V+G+GF A+
Sbjct  274  MKNIMFIGDGIDATIVTGNKNSQDGSTTYRSATFGVTGEGFIAQ  317



>gb|KEH21379.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=541

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 130/233 (56%), Gaps = 45/233 (19%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-----  418
            DC  LY D   +L R  I   + +D +TW SA++++H++C +G  +  L SH  +     
Sbjct  103  DCLELYEDTIYQLKR-SINSNNLNDKLTWQSASITNHQTCQNGFIDFNLPSHLNYFPSML  161

Query  419  ------------ASQNLTLSLKQALARFSQKRN--------------VKTTRKVVHKKPs  520
                         S  LT S   + +  S K+N                + RK++   P 
Sbjct  162  SNFTKLLSNSLSISNTLTSSQSSSSSSSSTKQNGGRRLLSDGFPYWLSGSDRKLLQATPG  221

Query  521  ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVY  700
            S  G            +A+IVVAQDGSGNYK+I+E V+A +++   G+GRVV+++KAG+Y
Sbjct  222  SGIGP-----------RADIVVAQDGSGNYKTISEGVAAAAKLS--GKGRVVIHLKAGIY  268

Query  701  NERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             E V+I++ +KN+M+ GDGMD TI+TGN N  DGSTTF SATF V GDGF A+
Sbjct  269  KENVDIKKTVKNLMIFGDGMDSTIVTGNHNAIDGSTTFRSATFGVMGDGFIAK  321



>ref|XP_002527782.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF34592.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=529

 Score =   139 bits (349),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 92/216 (43%), Positives = 132/216 (61%), Gaps = 17/216 (8%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQ--  427
            DC  LY D  + L R  +      D+ TWLSAA+++ ++C +G  +  L S+  H     
Sbjct  97   DCMELYEDTVDHLNR-SLSSTIPIDSQTWLSAAIANQQTCQNGFIDLNL-SYDDHLESMP  154

Query  428  ----NLTLSLKQALA--RFSQKRNVKTT--RKVV----HKKPsssdggglldswssassK  571
                NL++ L  +LA  + S   N K    R+++         S+    LL S S  + K
Sbjct  155  IMLSNLSMLLSNSLAVNKVSVPHNTKQVNGRRLLIFDGFPSWVSATDRRLLQSSSGVAPK  214

Query  572  ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVG  751
            A+IVVAQDGSGNYK+I EAV+A  +  +G + R+V+YVK G+Y E +EI++ +KN+M VG
Sbjct  215  ADIVVAQDGSGNYKTITEAVAAAVKQRSGSK-RLVIYVKKGIYKENIEIKKSMKNLMFVG  273

Query  752  DGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            DG+D TI+TG++N +DGSTTF SATF VSG GF A+
Sbjct  274  DGIDATIVTGSKNAKDGSTTFRSATFAVSGQGFIAK  309



>ref|XP_009351519.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=537

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 137/251 (55%), Gaps = 21/251 (8%)
 Frame = +2

Query  167  RALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLARLDIEKYDHDDAVTWLS  346
            +A+E  Q +  L+  S +  +  A  A +DC  LY D  ++L R  I   +  D  TWLS
Sbjct  68   QAIEAHQLVLSLNSNSLDGDHTRAKGAWNDCLELYEDTVDKLNR-SIGSTNALDVNTWLS  126

Query  347  AAMSSHRSCLDGLNEKGLVS-HGRHASQNLTLSLKQALARFSQK--RNVKTTRKVVHKKP  517
            A++++ ++C +G     + S H +     +TLS   +    +      V T+   +H   
Sbjct  127  ASLTNQQTCQNGFTNLNIPSSHLQSFPNYVTLSTNLSKLLSNSLSIHKVSTSSSALHFSK  186

Query  518  s-----------------ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSR  646
                               S     L    S+   A++VVAQDGSGNYKSI+EAV A  +
Sbjct  187  QIRGRRRLLLSDDGFPGWVSAADRKLLQSISSGPNADMVVAQDGSGNYKSISEAVDAAYK  246

Query  647  MGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSAT  826
            +  G   R V++VKAGVY E +EI++ +KN+M +GDG+D TI+TGN+NVQDGSTT+ SAT
Sbjct  247  LQGGASKRFVIHVKAGVYRENIEIKKTMKNIMFIGDGIDATIVTGNKNVQDGSTTYRSAT  306

Query  827  FRVSGDGFWAR  859
            F  +GDGF A+
Sbjct  307  FGATGDGFIAQ  317



>gb|KDP28780.1| hypothetical protein JCGZ_14551 [Jatropha curcas]
Length=514

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 120/211 (57%), Gaps = 19/211 (9%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKG-------LVSH  409
            +DC  LY      L +    K    DA TWLS A+++  +C  G  E G       L+S+
Sbjct  96   ADCLELYEYTVLWLNQTTTSKCSKYDAQTWLSTALTNLETCKTGFEELGVSDYILPLMSN  155

Query  410  GRHASQNLTLSL-KQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVV  586
                    TL+L K      S K    T  K   +K         L   +S +S+ANIVV
Sbjct  156  NVSKLICNTLALNKVPYTEPSYKEGFPTWLKPGDRK---------LLQSTSPASQANIVV  206

Query  587  AQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDR  766
            AQDGSGNYK+INEAV+A S+    G GR ++YVK+G Y E V+I + +KN+M VGDG+ +
Sbjct  207  AQDGSGNYKTINEAVAAASK--RSGTGRYIIYVKSGTYKENVQIGKSLKNIMFVGDGIGK  264

Query  767  TIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TI+TG+++V  G+TTF SATF V GDGF AR
Sbjct  265  TIVTGSKSVGGGATTFNSATFAVVGDGFIAR  295



>gb|KHN16553.1| Pectinesterase 2 [Glycine soja]
Length=415

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 114/192 (59%), Gaps = 15/192 (8%)
 Frame = +2

Query  323  DDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLK-----------QALARFS  469
            +D +TW SA++++H++C +G  +  L SH  +    L+                 L   S
Sbjct  7    NDRMTWQSASIANHQTCQNGFTDFNLPSHLNYFPSMLSNLSGLLSNSLSISKAMTLRSLS  66

Query  470  QKRNVKTT--RKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALS  643
                 K +  RK++                   +SKA++VVAQDGSGNYK+I+E V+A S
Sbjct  67   SSPTTKQSGGRKLLSDGFPYWLSRSDRKLLQETASKADVVVAQDGSGNYKTISEGVAAAS  126

Query  644  RMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSA  823
            R+   G+GRVVV+VKAGVY E ++I+R +KN+M+VGDGM  TI+TGN N  DGSTTF SA
Sbjct  127  RLS--GKGRVVVHVKAGVYKENIDIKRTVKNLMIVGDGMGATIVTGNHNAIDGSTTFRSA  184

Query  824  TFRVSGDGFWAR  859
            TF V GDGF AR
Sbjct  185  TFAVDGDGFIAR  196



>ref|XP_010654104.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=534

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 96/224 (43%), Positives = 134/224 (60%), Gaps = 24/224 (11%)
 Frame = +2

Query  251  SDCATLYADAEERLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHAS  424
            +DC  LY +  + + R    I      D+ TWLSAA+++ ++CLDG  +    S    + 
Sbjct  94   ADCLELYENTIDLVNRSINSISPAVMFDSQTWLSAAIANQQTCLDGFIDFNPSSDQFQSF  153

Query  425  QNLTLS-------LKQALARFSQKRNVKTT-----------RKVVHKKPs-ssdggglld  547
             ++++S       L  +LA    K  V  T           R + +  P+  S     L 
Sbjct  154  PSMSISTSNFSKLLSNSLA--INKAAVSATSILSNNQAGGRRLLSNGFPTWVSAADRKLL  211

Query  548  swssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERG  727
              S A+S+A+IVVA DGSGNYK+I+EAV+A  ++ +G + R V+YVKAGVY E VEI+R 
Sbjct  212  QSSGAASRADIVVAHDGSGNYKTISEAVAASVKLRSGTK-RFVIYVKAGVYRENVEIKRK  270

Query  728  IKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +KN+M++GDG D TI+TGN+NVQDGSTTF SATF VSG GF AR
Sbjct  271  MKNIMIIGDGKDATIVTGNKNVQDGSTTFRSATFAVSGHGFIAR  314



>gb|AER38244.1| PME5 [Gossypium barbadense]
Length=519

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 123/213 (58%), Gaps = 21/213 (10%)
 Frame = +2

Query  251  SDCATLYADAEERLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSH-----  409
            SDC  LY     RL +        + DDA TWLS A+++  +C  G  E G+  H     
Sbjct  99   SDCVNLYELTILRLNKTVDSGTNLNKDDAQTWLSTALTNLETCRTGFMELGVPDHLLPMM  158

Query  410  GRHASQNL--TLSLKQALAR-FSQKRNVKTTRKVVHKKPsssdggglldswssassKANI  580
              + SQ +  TL+L +A  +  + K    T  K   +K         L   SS +S ANI
Sbjct  159  SNNVSQLISNTLALNKAPYKEPTYKDGFPTWVKPGDRK---------LLQSSSPASTANI  209

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVAQDGSGNYK+I +A+SA S+    G GR V+YVKAG Y E VEI   +KN+M+VGDG+
Sbjct  210  VVAQDGSGNYKTIKDAISAASK--RSGSGRYVIYVKAGTYKENVEIGSKLKNIMMVGDGI  267

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             +TIITG+++V  GSTTF SAT  V GDGF AR
Sbjct  268  GKTIITGSKSVGGGSTTFNSATVAVVGDGFIAR  300



>gb|AFW03479.1| pectin methylesterase 5 [Gossypium barbadense]
Length=519

 Score =   137 bits (344),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 95/213 (45%), Positives = 124/213 (58%), Gaps = 21/213 (10%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDH--DDAVTWLSAAMSSHRSCLDGLNEKGLVSH-----  409
            SDC  LY     RL +      +H  DDA TWLS A+++  +C  G  E G+  +     
Sbjct  99   SDCVNLYELTILRLNKTVDSGTNHNKDDAQTWLSTALTNLETCRTGFMELGVPDYLLPMM  158

Query  410  GRHASQNL--TLSLKQALAR-FSQKRNVKTTRKVVHKKPsssdggglldswssassKANI  580
              + SQ +  TL+L +A  +  + K    T  K   +K         L   SS +S ANI
Sbjct  159  SNNVSQLISNTLALNKAPYKEPTYKDGFPTWVKPGDRK---------LLQSSSPASTANI  209

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVAQDGSGNYK+I +A+SA S+    G GR V+YVKAG Y E VEI   +KN+M+VGDG+
Sbjct  210  VVAQDGSGNYKTIKDAISAASK--RSGSGRYVIYVKAGTYKENVEIGSKLKNIMMVGDGI  267

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             +TIITG+++V  GSTTF SAT  V GDGF AR
Sbjct  268  GKTIITGSKSVGGGSTTFNSATVAVVGDGFIAR  300



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score =   136 bits (343),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 100/258 (39%), Positives = 139/258 (54%), Gaps = 13/258 (5%)
 Frame = +2

Query  95   DTRNALTASNQDLLAIRTARSNVLRALEWSQSLHE-LHEPSRESGnnaaaaaVSDCATLY  271
            D + A      D L +     ++  ALE +Q  H   H    +  N    A  +DC  LY
Sbjct  49   DPKQASIKQKSDFLKV-----SMQLALERAQMAHSNTHSLGSKCSNEREKAVWADCLQLY  103

Query  272  ADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-ASQNLTLSLK  448
                 RL R  +    HD+A TWLS A+++  +C  G  E G+  +     S N++  + 
Sbjct  104  EHTILRLNRTIVHDCTHDEAQTWLSTALTNLETCRAGFVELGVSGNVLPLMSNNVSKLIS  163

Query  449  QALARFSQKRNVKTTRKVVHKKPs-ssdggglldswssassKANIVVAQDGSGNYKSINE  625
              LA         TT     K P+    G   L   SSA SKANI+VAQDGSGNYK+I+E
Sbjct  164  NTLAL---NYAPYTTPNYTKKFPTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISE  220

Query  626  AVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGS  805
            A++A S+    G  R ++Y+KAG Y+E VE+   ++N+M VGDG+ +TIITG+++V  GS
Sbjct  221  AITAASK--RSGTARYIIYIKAGTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGS  278

Query  806  TTFGSATFRVSGDGFWAR  859
            TTF SAT  V GDGF A+
Sbjct  279  TTFNSATVAVVGDGFIAQ  296



>ref|XP_007052106.1| Pectinesterase 2 [Theobroma cacao]
 gb|EOX96263.1| Pectinesterase 2 [Theobroma cacao]
Length=517

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 96/216 (44%), Positives = 125/216 (58%), Gaps = 27/216 (13%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIE-----KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSH-G  412
            +DC  LY   E  + RL+       K + DDA TWLS A+++  +C  G  E G+  +  
Sbjct  97   ADCLNLY---ELTILRLNKTVDSSIKLNKDDAQTWLSTALTNLETCRTGFIELGVPDYIL  153

Query  413  RHASQNL------TLSLKQALAR-FSQKRNVKTTRKVVHKKPsssdggglldswssassK  571
               S N+      TL+L +A  +  S K    T  K   +K         L   SS +S+
Sbjct  154  PMMSNNVSNLISNTLALNKAPYKEPSYKDGFPTWVKPGDRK---------LLQSSSPASR  204

Query  572  ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVG  751
            ANIVVAQDGSGNYK+I +A+SA S+    G GR V+YVKAG Y E VEI   +KN+MLVG
Sbjct  205  ANIVVAQDGSGNYKTIKDAISAASK--RSGSGRYVIYVKAGTYKENVEIRSKLKNIMLVG  262

Query  752  DGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            DG+ +TIITG+++V  GSTTF SAT    GDGF AR
Sbjct  263  DGIGKTIITGSKSVGQGSTTFNSATVAAVGDGFIAR  298



>ref|XP_009409661.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 94/248 (38%), Positives = 136/248 (55%), Gaps = 18/248 (7%)
 Frame = +2

Query  131  LLAIRTARSNV-LRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLARLDI  307
            LL   TAR+ + LR +  S  +  L +P++ +        ++DC  LY D   RL     
Sbjct  60   LLRATTARTVLALRQIS-SMDMTLLDKPAKAA--------LADCLKLYNDTIIRLQHSMR  110

Query  308  EKYDHDDAVTWLSAAMSSHRSCLDGLNEKG----LVSHG---RHASQNLTLSLKQALARF  466
                 +D+ TWLSAA ++ R+C DG  E G    L S      H S++L+  L   +A  
Sbjct  111  SSSSIEDSQTWLSAAKANERTCRDGFVELGSTFPLASSSFVTNHLSESLSNMLAVNIATP  170

Query  467  SQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSR  646
              K   K  R +    P            +  + K ++VVA+DGSGNYK+I+EAV+A   
Sbjct  171  RDKPPPKNRRLLSDGFPRWVKAADRKLIQTGVTIKPDLVVAKDGSGNYKTISEAVAASVN  230

Query  647  MGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSAT  826
            +      R V+YVKAGVY+E V+I   + N+M+VGDG D TI+TG++NV DG++TF +AT
Sbjct  231  L-RQTTSRFVIYVKAGVYSETVDIALNMVNLMMVGDGKDDTIVTGSKNVVDGTSTFNTAT  289

Query  827  FRVSGDGF  850
            FRV G+GF
Sbjct  290  FRVDGEGF  297



>ref|XP_010101978.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90902.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=240

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 88/206 (43%), Positives = 117/206 (57%), Gaps = 15/206 (7%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQ-  427
            DC  LY D  + L R ++    +  D  TWLSA++++  +C +G  +  + SH       
Sbjct  29   DCLELYKDTVDLLNRSVNSNNKNPLDTHTWLSASLANQHTCRNGFTDFQIPSHYDSFPSM  88

Query  428  --NLTLSLKQALA---------RFSQKRNVKTTRKVVHKKPs-ssdggglldswssassK  571
              N +  L  +LA           S  + V++ R +    P   S     L     A+ K
Sbjct  89   LSNFSKLLSNSLAINKATNPSTATSFSKQVRSRRLLSDGFPEWVSAADRKLLQSGGAAEK  148

Query  572  ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVG  751
            A+IV AQDGSG +K+I+EAV A   +G GG  R+VVYVKAGVYNE VEI+  IKN+M VG
Sbjct  149  ADIVGAQDGSGGFKTISEAVEAAKNLG-GGSKRIVVYVKAGVYNENVEIKNDIKNLMFVG  207

Query  752  DGMDRTIITGNRNVQDGSTTFGSATF  829
            DG+D TI+TGNRN  DGSTTF SATF
Sbjct  208  DGIDATIVTGNRNNVDGSTTFQSATF  233



>ref|XP_011038599.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=531

 Score =   135 bits (341),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 91/219 (42%), Positives = 129/219 (59%), Gaps = 18/219 (8%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNL  433
            DC  LY D  + + R  +   +  D+ TWLSAA+++ R+C +G  +  +VS+       L
Sbjct  94   DCLKLYEDTVDHVNR-SMSSNNLADSQTWLSAAIANQRTCENGFIDFNIVSYLEFLPNML  152

Query  434  ---------TLSLKQALAR-----FSQKRNVKTTRKVVHKKPs--ssdggglldswssas  565
                     TLSL +A+          K++    R +V   PS   +    LL S   A+
Sbjct  153  RNFTKLLSNTLSLNKAIISSPPILLDTKQDGGRRRLLVDGFPSWVPASDRKLLQSNGRAA  212

Query  566  sKANIVVAQDGSGNYKSINEAVSALSRMGNGGEG-RVVVYVKAGVYNERVEIERGIKNVM  742
              A+IVVAQDGSG+YK+I+EA++A +++  G    R V+YVK GVY E VEI++ +KN+M
Sbjct  213  PMADIVVAQDGSGDYKTISEALAASAKLRRGTRSKRFVIYVKRGVYKENVEIKKSMKNLM  272

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             VGDG+D T+IT N+N QDG+TTF SAT  VSG GF AR
Sbjct  273  FVGDGIDATVITSNKNTQDGTTTFRSATVGVSGKGFIAR  311



>ref|XP_002511679.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50348.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=514

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 122/212 (58%), Gaps = 21/212 (10%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-ASQ  427
            +DC  LY  A   L      K    DA TWLS A+++  +C  G  E G+  +     S 
Sbjct  96   ADCLELYEYAVLWLNHTTTSKCTKYDAQTWLSTALTNLETCRTGFMELGVSDYVLPLMSN  155

Query  428  NLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdgggl--------ldswssassKANIV  583
            N++  +   LA             V +++P+   G           L   ++ +S+ANIV
Sbjct  156  NVSKLISNTLA----------INNVPYEEPTYKGGFPTWVKPGDRKLLQTTTPASQANIV  205

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            VA+DGSGN+K+INEAV+A S+    G GR ++YVKAGVYNE VEI   +KN+M VGDG+ 
Sbjct  206  VAKDGSGNFKTINEAVAAASK--RSGSGRFIIYVKAGVYNENVEIGTKLKNLMFVGDGIG  263

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +TI+TG+++V  G+TTF SATF V G+GF AR
Sbjct  264  KTIVTGSKSVGGGATTFRSATFAVVGEGFIAR  295



>ref|XP_009351517.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=537

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 85/223 (38%), Positives = 123/223 (55%), Gaps = 21/223 (9%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVS-HGRHASQ  427
            +DC  LY D  ++L R  I   +  D  TWLSA++++ ++C +G     + S H +    
Sbjct  96   NDCLELYEDTVDKLNR-SIGSTNTLDVSTWLSASLTNQQTCQNGFTNLNIPSSHLQSFPN  154

Query  428  NLTLSLKQALARFSQK--RNVKTTRKVVHKKPs-----------------ssdgggllds  550
             +TLS   +    +      V T+   +H                      S     L  
Sbjct  155  YVTLSTNLSKLLSNSLSIHKVSTSSSALHFSKQIRGRRRHLLSDDGFPGWVSAADRKLLQ  214

Query  551  wssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGI  730
              S+   A++VVAQDGSGNYKSI+EAV A  ++  G   R V++VKAGVY E +EI++ +
Sbjct  215  SISSGPNADMVVAQDGSGNYKSISEAVDAAYKLQGGATKRFVIHVKAGVYRENIEIKKTM  274

Query  731  KNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            KN+M +GDG+D TI+TGN+NV DGSTT+ SATF  +GDGF A+
Sbjct  275  KNIMFIGDGIDATIVTGNKNVPDGSTTYRSATFGATGDGFIAQ  317



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 129/213 (61%), Gaps = 19/213 (9%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDG---LNEKGLVSHGRHA  421
            +DC  L  D   +L R  +    +DDA TWLSAAM++ ++C +G   L+    +      
Sbjct  93   ADCLELCEDTIGKLNR-SMSSSSYDDAQTWLSAAMANQQTCRNGFLELDSSFPLGSSPFM  151

Query  422  SQNLTLSLKQALARFSQKRNVKTT-------RKVVHKKPsssdggglldswssassKANI  580
            S N++ SL   LA      N+ TT       R+++     +           S++  A++
Sbjct  152  SYNISESLSNLLAI-----NMATTPAMSGGNRRLLSDGFPNWLSATDRKLLRSSTINADL  206

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVA+DGSG+YK+I+EA++A  +  +G + R V++VK GVY+E V+    +KN+M++GDGM
Sbjct  207  VVAKDGSGDYKTISEAIAAAMKQSSG-KSRFVIHVKTGVYDENVQTS--MKNLMIIGDGM  263

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            D T++TG++NV+DGSTTF SATF V+GDGF AR
Sbjct  264  DATVVTGSKNVKDGSTTFRSATFAVTGDGFIAR  296



>gb|AFW03484.1| pectin methylesterase 5 [Gossypium hirsutum]
Length=519

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 122/213 (57%), Gaps = 21/213 (10%)
 Frame = +2

Query  251  SDCATLYADAEERLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSH-----  409
            SDC  LY     RL +        + DDA TWLS A+++  +C  G  E G+  +     
Sbjct  99   SDCVNLYELTILRLNKTVDSGTNLNKDDAQTWLSTALTNLETCQTGFMELGVPDYLLPMM  158

Query  410  GRHASQNL--TLSLKQA-LARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANI  580
              + SQ +  TL+L +A     + K    T  K   +K         L   SS +S ANI
Sbjct  159  SNNVSQLISNTLALNKAPYQEPTYKDGFPTWVKPGDRK---------LLQSSSPASTANI  209

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVAQDGSGNYK+I +A+SA S+    G GR V+YVKAG Y E VEI   +KN+M+VGDG+
Sbjct  210  VVAQDGSGNYKTIKDAISAASK--RSGSGRYVIYVKAGTYKENVEIGSKLKNIMMVGDGI  267

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             +TIITG+++V  GSTTF SAT  V GDGF AR
Sbjct  268  GKTIITGSKSVGGGSTTFNSATVAVVGDGFIAR  300



>gb|KHG19575.1| Uncharacterized protein F383_07269 [Gossypium arboreum]
Length=519

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 123/213 (58%), Gaps = 21/213 (10%)
 Frame = +2

Query  251  SDCATLYADAEERLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSH-----  409
            SDC  LY     RL +        + DDA TWLS A+++  +C  G  E G+  +     
Sbjct  99   SDCVNLYELTILRLNKTVDSGTNLNKDDAQTWLSTALTNLETCRTGFMELGVPDYLLPMM  158

Query  410  GRHASQNL--TLSLKQALAR-FSQKRNVKTTRKVVHKKPsssdggglldswssassKANI  580
              + SQ +  TL+L +A  +  + K    T  K   +K         L   SS +S ANI
Sbjct  159  SNNVSQLISNTLALNKAPYKEPTYKDGFPTWVKPGDRK---------LLQSSSPASTANI  209

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVAQDGSGNYK+I +A+SA S+    G GR V+YVKAG Y E VEI   +KN+M+VGDG+
Sbjct  210  VVAQDGSGNYKTIKDAISAASK--RSGSGRYVIYVKAGTYKENVEIGSKLKNIMMVGDGI  267

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             +TIITG+++V  GSTTF SAT  V GDGF AR
Sbjct  268  GKTIITGSKSVGGGSTTFNSATVAVVGDGFIAR  300



>ref|XP_006646399.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase 2.2-like [Oryza 
brachyantha]
Length=523

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 119/198 (60%), Gaps = 11/198 (6%)
 Frame = +2

Query  272  ADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLV--SHGRHAS--QNLTL  439
            +D  +R A  D  +   DDA TWLSA ++ H +CLDGL+  G +  S G H    ++L  
Sbjct  107  SDPRQRAALEDCVQL-MDDARTWLSAVLTDHVTCLDGLDADGPLRDSVGAHLEPLKSLAS  165

Query  440  SLKQALARFSQKRNVKTTRKVVHKKPs-ssdggglldswssassKANIVVAQDGSGNYKS  616
            +    L      R+V    +VV + PS        L    + + +A++VVAQDGSG YK+
Sbjct  166  ASLAVLNAVGGARDVLA--EVVDRFPSWVPARDRALLEAGAGAVQADVVVAQDGSGKYKT  223

Query  617  INEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQ  796
            I EAV A     +GG+ R V+YVK GVY E +E+ +  + VM+VGDGMD+T+ITG+RNV 
Sbjct  224  IKEAVDAAP---DGGKSRYVIYVKKGVYKENLEVGKKKREVMIVGDGMDQTVITGSRNVV  280

Query  797  DGSTTFGSATFRVSGDGF  850
            DG+TTF SAT  +SGDG 
Sbjct  281  DGATTFNSATLALSGDGI  298



>ref|XP_011034009.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 120/211 (57%), Gaps = 21/211 (10%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-ASQN  430
            DC  LY +    L +    K    DA TWLS A+++  +C  G  E G+  +     S N
Sbjct  97   DCLELYQEIVLWLNKTTGSKCTKYDAQTWLSTALTNLATCRTGFAEFGMTDYILPLMSNN  156

Query  431  LTLSLKQALARFSQKRNVKTTRKVVHKKPsssdgggl--------ldswssassKANIVV  586
            ++  +   LA            K  +++PS + G           L   SS +S+ANIVV
Sbjct  157  VSKLISNTLA----------INKAPYREPSFNGGFPSWVRPGDRKLLQSSSPASQANIVV  206

Query  587  AQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDR  766
            AQDGSGN K+I EA+ A S+    G GR V+YVKAG YNE VEI R +KNVM+VGDG+ +
Sbjct  207  AQDGSGNVKTIKEAIDAASK--RSGSGRYVIYVKAGTYNENVEIARKVKNVMVVGDGIGK  264

Query  767  TIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TI+TG+++V  G+TTF SATF V GD F AR
Sbjct  265  TIVTGSKSVGGGTTTFKSATFAVVGDNFIAR  295



>ref|XP_010056335.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 100/258 (39%), Positives = 139/258 (54%), Gaps = 13/258 (5%)
 Frame = +2

Query  95   DTRNALTASNQDLLAIRTARSNVLRALEWSQSLHE-LHEPSRESGnnaaaaaVSDCATLY  271
            D + A      D L +     ++  ALE +Q  H   H    +  N    AA +DC  LY
Sbjct  49   DPKQASIKQKSDFLKV-----SMQLALERAQMAHSNTHSLGSKCSNEHEKAAWADCLQLY  103

Query  272  ADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-ASQNLTLSLK  448
                 RL R  +     D+A TWLS A+++  +C  G  E G+  +     S N++  + 
Sbjct  104  EYTILRLNRTIVHDCTQDEAQTWLSTALTNLETCQAGFVELGVSGNVLPLMSNNVSKLIS  163

Query  449  QALARFSQKRNVKTTRKVVHKKPs-ssdggglldswssassKANIVVAQDGSGNYKSINE  625
              LA         TT     K P+    G   L   SSA SKANI+VAQDGSGNYK+I+E
Sbjct  164  NTLAL---NYAPYTTPNYTKKFPTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISE  220

Query  626  AVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGS  805
            A++A S+    G  R ++Y+KAG Y+E VE+   ++N+M VGDG+ +TIITG+++V  GS
Sbjct  221  AITAASK--RSGTARYIIYIKAGTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGS  278

Query  806  TTFGSATFRVSGDGFWAR  859
            TTF SAT  V GDGF A+
Sbjct  279  TTFNSATVAVVGDGFIAQ  296



>gb|KCW73020.1| hypothetical protein EUGRSUZ_E01454 [Eucalyptus grandis]
Length=480

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 100/258 (39%), Positives = 139/258 (54%), Gaps = 13/258 (5%)
 Frame = +2

Query  95   DTRNALTASNQDLLAIRTARSNVLRALEWSQSLHE-LHEPSRESGnnaaaaaVSDCATLY  271
            D + A      D L +     ++  ALE +Q  H   H    +  N    AA +DC  LY
Sbjct  14   DPKQASIKQKSDFLKV-----SMQLALERAQMAHSNTHSLGSKCSNEHEKAAWADCLQLY  68

Query  272  ADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-ASQNLTLSLK  448
                 RL R  +     D+A TWLS A+++  +C  G  E G+  +     S N++  + 
Sbjct  69   EYTILRLNRTIVHDCTQDEAQTWLSTALTNLETCQAGFVELGVSGNVLPLMSNNVSKLIS  128

Query  449  QALARFSQKRNVKTTRKVVHKKPs-ssdggglldswssassKANIVVAQDGSGNYKSINE  625
              LA         TT     K P+    G   L   SSA SKANI+VAQDGSGNYK+I+E
Sbjct  129  NTLAL---NYAPYTTPNYTKKFPTWVRPGDRKLLQSSSAVSKANIIVAQDGSGNYKTISE  185

Query  626  AVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGS  805
            A++A S+    G  R ++Y+KAG Y+E VE+   ++N+M VGDG+ +TIITG+++V  GS
Sbjct  186  AITAASK--RSGTARYIIYIKAGTYSENVEVGSKLENIMFVGDGIGKTIITGSKSVGGGS  243

Query  806  TTFGSATFRVSGDGFWAR  859
            TTF SAT  V GDGF A+
Sbjct  244  TTFNSATVAVVGDGFIAQ  261



>gb|KFK44409.1| hypothetical protein AALP_AA1G253400 [Arabis alpina]
Length=468

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 93/229 (41%), Positives = 131/229 (57%), Gaps = 28/229 (12%)
 Frame = +2

Query  254  DCATLYADAEERLA---RLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVS-----H  409
            DC  LY D  ++L    R   + Y   D  T LSAAM++  +C +G  +  L S      
Sbjct  30   DCLELYEDTIDQLNHSRRSYGQNYSAHDRQTSLSAAMANQVTCRNGFKDFNLTSSYSKYF  89

Query  410  GRHASQNLTLSLKQAL----------------ARFSQKRNVKTTRKVVH--KKPs-ssdg  532
              H  +NLT+SL  +L                 RFS++      R +    K PS  S  
Sbjct  90   PLHIHRNLTMSLSNSLAVAKAAAEAEAVTTAFTRFSKQGGGGGRRLMFSDDKFPSWLSLP  149

Query  533  gglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERV  712
               L   S  ++ A++VVA+DGSG Y SI +AV+A +++    + R+V+YVKAG+Y E V
Sbjct  150  DRKLLEISKTTANADLVVAKDGSGQYTSIQQAVNAAAKLPRKNK-RLVIYVKAGIYKENV  208

Query  713  EIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            EI++ IKN+M++GDG+D TI+TGNRNV+DG+TTF SATF VSG GF A+
Sbjct  209  EIKKSIKNLMVIGDGIDSTIVTGNRNVKDGTTTFRSATFAVSGVGFIAQ  257



>ref|XP_006307093.1| hypothetical protein CARUB_v10008680mg [Capsella rubella]
 gb|EOA39991.1| hypothetical protein CARUB_v10008680mg [Capsella rubella]
Length=582

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 136/239 (57%), Gaps = 36/239 (15%)
 Frame = +2

Query  248  VSDCATLYADAEERL--ARLDIEKYD-HDDAVTWLSAAMSSHRSCLDGLNEKGLVS----  406
            + DC  LY D  ++L   R    +Y    D  T LSAA+++  +C +G  +  L S    
Sbjct  134  LHDCLELYEDTIDQLNHTRSSYAQYSSMHDRQTSLSAAIANQDTCKNGFKDFNLTSSYSK  193

Query  407  -HGRHASQNLTLSLKQALA-------------------RFSQKRNVKTT---RKVV----  505
                H  +NLT SL  +LA                    F+++RN+      R+++    
Sbjct  194  FFPIHIHRNLTKSLSNSLAVTKAAAEAIAEKYPSTGFTEFNKQRNIGRDGGHRRLLMSSD  253

Query  506  HKKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVY  682
             K PS        L   +  ++KA++VVA+DGSG+Y SI +AV+A + +    + R+V+Y
Sbjct  254  EKYPSWFPLTDRKLLEDTETTTKADLVVAKDGSGHYTSIQQAVNAAATLPRRNK-RLVIY  312

Query  683  VKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            VKAGVY E V I++ IKNVM++GDG+D TI+TGN+NV+DG+TTF SATF VSGDGF AR
Sbjct  313  VKAGVYRENVVIKKSIKNVMVIGDGIDSTIVTGNKNVKDGTTTFRSATFAVSGDGFIAR  371



>ref|XP_008438193.1| PREDICTED: pectinesterase 2 [Cucumis melo]
Length=511

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 87/206 (42%), Positives = 122/206 (59%), Gaps = 12/206 (6%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQN  430
            +DC  LY +   RL R   ++    DA TWLSAA+++  +C  G +E GL + G   + N
Sbjct  100  TDCVDLYDEIITRLNRTS-DRCTPADAQTWLSAALTALETCRTGFDELGLSAFGYPLTAN  158

Query  431  ---LTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGS  601
                 +S   ++ + +     + T  +    P+    G      S +  KAN+VVAQDGS
Sbjct  159  NVSKLISDGLSVNKPASPEGYEPTTIMDDGFPTWVRPGDRKLLQSGSP-KANVVVAQDGS  217

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            GN+K++ EAV+A       G GR V+YVK+GVYNE ++I+   KNVM+VGDG+ +TIITG
Sbjct  218  GNFKTVKEAVAAAK-----GGGRFVIYVKSGVYNENLDIKA--KNVMMVGDGIGKTIITG  270

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            +R+V  GSTTF SAT  V GDGF AR
Sbjct  271  SRSVGGGSTTFRSATVAVDGDGFIAR  296



>emb|CDP00815.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   133 bits (334),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 90/221 (41%), Positives = 126/221 (57%), Gaps = 24/221 (11%)
 Frame = +2

Query  251  SDCATLYADAEERLAR--LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSH-----  409
            +DC  LY D+ + L R          DDA TWLSAA+++H++C +G  +  L S+     
Sbjct  97   ADCVELYEDSIDNLNRAITSANPTKLDDAQTWLSAAIANHQTCQNGFLDFQLSSNLQSFP  156

Query  410  -------GRHASQNLTLS--LKQALARFSQKRNVKTTRKVVHK--KPsssdggglldsws  556
                    +H S +L ++     A +  S  + +K  R +         S G   L   S
Sbjct  157  FLVNSTFSKHLSNSLAINKAALSAASAHSSTQQIKGRRLLSSNGFPEWLSVGDRKLLQSS  216

Query  557  sassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKN  736
               +KA+I VAQDGSGNYK+I EA++A      G  GRVV+YVK G+Y E V +   +KN
Sbjct  217  GGPTKADITVAQDGSGNYKTIAEALAA----AKGKGGRVVIYVKKGIYKENVVVT--MKN  270

Query  737  VMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +M +GDG+D T++TGN+NVQDGSTTF SATF ++G GF AR
Sbjct  271  IMFIGDGIDATVVTGNKNVQDGSTTFRSATFAITGSGFIAR  311



>ref|XP_010056338.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   132 bits (333),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 95/238 (40%), Positives = 132/238 (55%), Gaps = 18/238 (8%)
 Frame = +2

Query  170  ALEWSQSLHELHEPSRESGnnaaaaaVS--DCATLYADAEERLARLDIEKYDHDDAVTWL  343
            ALE +Q  H+ H  S ES  +      +  DC  LY     RL R    +   D+A TWL
Sbjct  69   ALERAQLAHD-HTHSLESKCSNEREKAAWADCLQLYEHTVLRLNRTIGHECTQDEAQTWL  127

Query  344  SAAMSSHRSCLDGLNEKGLVSH-----GRHASQNLTLSLKQALARFSQKRNVKTTRKVVH  508
            S A+++  +C  G  E G+  +       + S+ ++ +L    A F       TT     
Sbjct  128  STALTNLETCRAGFVELGISDNVLPLMSNNVSKLISNTLALNYAPF-------TTPNYTK  180

Query  509  KKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYV  685
            K P+        L   SSA SKANIVVA+DGSGNYK+I+EA++A S+    G  R ++Y+
Sbjct  181  KFPTWVRPSDRKLLQSSSAVSKANIVVARDGSGNYKTISEAITAASK--QTGAARYIIYI  238

Query  686  KAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            KAG YNE +E+   + N+M VGDG+ +TIITG+++V  GSTTF SAT  V GDGF A+
Sbjct  239  KAGTYNENIEVGSKLDNIMFVGDGIGKTIITGSKSVGGGSTTFKSATVAVVGDGFVAQ  296



>ref|XP_002302526.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE81799.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 117/211 (55%), Gaps = 21/211 (10%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-ASQN  430
            DC  LY D+   L +    K    DA TWLS A+++  +C  G  E G+        S N
Sbjct  97   DCLELYEDSILWLTKTTSSKCTDYDAQTWLSTALTNLETCRTGFTEFGMTDFILPLMSNN  156

Query  431  LTLSLKQALARFSQKRNVKTTRKVVHKKPsssdgggl--------ldswssassKANIVV  586
            ++  +   LA            KV + +PS  +G           L   SS +S+ANIVV
Sbjct  157  VSKLISNTLA----------INKVPYSEPSYKEGFPSWVRPGDRKLLQSSSPASQANIVV  206

Query  587  AQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDR  766
            A DGSGN K+I EA+ A S+    G GR V+YVKAG YNE VE+ + +KNVM VGDG+ +
Sbjct  207  ATDGSGNVKTIKEAIDAASK--RSGSGRYVIYVKAGTYNENVEVGKKVKNVMFVGDGIGK  264

Query  767  TIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TI+TG+++   G+TTF SATF V GD F AR
Sbjct  265  TIVTGSKSAGGGTTTFKSATFAVVGDNFIAR  295



>ref|XP_003630890.1| Pectinesterase [Medicago truncatula]
 gb|AET05366.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=500

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/230 (37%), Positives = 126/230 (55%), Gaps = 45/230 (20%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-----  418
            DC  LY D   +L R  I   + +D +TW SA++++H++C +G  +  L SH  +     
Sbjct  95   DCLELYEDTIYQLKR-SINSNNLNDKLTWQSASITNHQTCQNGFIDFNLPSHLNYFPSML  153

Query  419  ------------ASQNLTLSLKQALARFSQKRN--------------VKTTRKVVHKKPs  520
                         S  LT S   + +  S K+N                + RK++   P 
Sbjct  154  SNFTKLLSNSLSISNTLTSSQSSSSSSSSTKQNGGRRLLSDGFSYWLSGSDRKLLQATPG  213

Query  521  ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVY  700
            S  G            +A+IVVAQDGSGNYK+I+E V+A +++   G+GRVV+++KAG+Y
Sbjct  214  SGTGP-----------RADIVVAQDGSGNYKTISEGVAAAAKLS--GKGRVVIHLKAGIY  260

Query  701  NERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGF  850
             E ++I+  + N+M+ GDGMD T +TGN+N  DGSTTF SATF V GDGF
Sbjct  261  KENIDIKSTVSNLMIFGDGMDSTSVTGNQNAIDGSTTFRSATFGVMGDGF  310



>ref|XP_010056337.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 118/212 (56%), Gaps = 21/212 (10%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-ASQ  427
            +DC  LY     RL R    K   +D  TWLS A+++  +C  G  E G+  +     S 
Sbjct  97   ADCLELYEQTILRLNRTVDLKCTQEDVQTWLSTALTNLETCRTGFVELGVSDYVLPLMSN  156

Query  428  NLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggg--------lldswssassKANIV  583
            N+T  +   LA             V +K PS ++G           L   SS SSKANIV
Sbjct  157  NVTKLISNTLA----------LNHVPYKPPSYTNGYPNWVRPGDRKLLQSSSPSSKANIV  206

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            VA+DGSG YK+I EA++A S+    G  R V+YVKAG Y E +E+   +KN+M VGDG+ 
Sbjct  207  VAKDGSGKYKTIKEAITAASK--RFGTARYVIYVKAGTYKENIEVGSKLKNIMFVGDGIG  264

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +TIITG+R+V  GSTTF SAT  V GDGF AR
Sbjct  265  KTIITGSRSVGGGSTTFKSATVAVVGDGFIAR  296



>ref|XP_007222925.1| hypothetical protein PRUPE_ppa005208mg [Prunus persica]
 gb|EMJ24124.1| hypothetical protein PRUPE_ppa005208mg [Prunus persica]
Length=472

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/226 (38%), Positives = 130/226 (58%), Gaps = 27/226 (12%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGL-NEKGLVSHGRHASQN  430
            DC  L+ D  +++ R  I   +  DA TWLSA++++ ++C +G  N K   S+ +     
Sbjct  30   DCLELHEDTVDKINR-SIRSSNALDANTWLSASIANQQTCQNGFTNLKIPNSYLQSFPNY  88

Query  431  LTL-----------------SLKQALARFSQKRNVKTTRKVVHKKPs------ssdgggl  541
            +TL                 S   +   FS++  V+  R+++  +         S     
Sbjct  89   VTLTTNLSKLLSNSLSLHKASTSPSALHFSKQ--VRGKRRLLLSESDDGFPEWVSFADRK  146

Query  542  ldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIE  721
            L   +    KA++VVAQDGSGNY++I+EAV A   + +G   R V++VKAGVY E VEI+
Sbjct  147  LLRSTGGGPKADMVVAQDGSGNYETISEAVGAAQNLRSGSTERFVIHVKAGVYKENVEIK  206

Query  722  RGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            + +KN+M +GDG+D TI+TGNRN QDGSTT+ SATF V+G+GF A+
Sbjct  207  KTLKNIMFIGDGIDATIVTGNRNSQDGSTTYSSATFGVTGEGFIAQ  252



>ref|XP_004503381.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Cicer arietinum]
Length=546

 Score =   131 bits (330),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 123/226 (54%), Gaps = 27/226 (12%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNL  433
            DC  LY D   +L R  I   + +D +TW SA++++H++C +G  +  L S   +    L
Sbjct  104  DCLELYEDTIYQLKR-SINSNNINDKLTWQSASITNHQTCQNGFIDFNLPSQLNYFPSML  162

Query  434  T---------LSLKQALARFSQKR---------------NVKTTRKVVHKKPsssdgggl  541
            +         LS+   +A  S                  N +   + +      +     
Sbjct  163  SNFSKLLSNSLSITNTIASSSHSLSSTSTSSSSSSSSSTNKQNGGRRLLSDGFPNWVSFS  222

Query  542  ldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIE  721
                   + +A+IVVAQDGSGNYK+I+E V+A +++   G+GRVVVYVK GVY E V+++
Sbjct  223  DRKLLQETIEADIVVAQDGSGNYKTISEGVAAAAKLR--GKGRVVVYVKRGVYKENVDVK  280

Query  722  RGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            + +KN+M+VGDGMD TIIT N N Q G TTF SATF + GDGF A+
Sbjct  281  KTVKNLMIVGDGMDSTIITSNHNAQHGYTTFRSATFGIMGDGFIAK  326



>ref|XP_008775930.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 126/208 (61%), Gaps = 9/208 (4%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKG---LVSHGRHA  421
            +DC  L  D   +L R  +    +DD+ TWLSAAM++H++C +G  E G    +      
Sbjct  92   ADCLELCQDTIGKLNR-SMSSPSYDDSQTWLSAAMANHQTCRNGFIELGSSFPLDSLPFT  150

Query  422  SQNLTLSLKQALARFSQKRNVKT--TRKVVHKKPsssdggglldswssassKANIVVAQD  595
            S N++  L  +LA        K+   R+++     +           S+S  A++VVA+D
Sbjct  151  SYNISELLSNSLAINKAMAPAKSGGIRRLLSDGFPNWLSAADRKLLQSSSINADLVVAKD  210

Query  596  GSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTII  775
            GSG+Y +I+ A++A ++  +G   R V++VKAGVYNE V     IKN+M++GDG+D T++
Sbjct  211  GSGDYDTISAAIAAATKQSSG-TSRFVIHVKAGVYNENVGTS--IKNLMIIGDGIDATVV  267

Query  776  TGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TG++NVQDGSTTF SATF V+GDGF AR
Sbjct  268  TGSKNVQDGSTTFSSATFAVTGDGFIAR  295



>ref|XP_010056336.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 131/238 (55%), Gaps = 18/238 (8%)
 Frame = +2

Query  170  ALEWSQSLHELHEPSRESGnnaaaaaVS--DCATLYADAEERLARLDIEKYDHDDAVTWL  343
            ALE +Q  H+ H  S ES  +     V+  DC  LY     RL R        D+A TWL
Sbjct  69   ALERAQLAHD-HTHSLESKCSNEREKVAWADCLQLYEHTVLRLNRTIGHDCTQDEAQTWL  127

Query  344  SAAMSSHRSCLDGLNEKGLVSH-----GRHASQNLTLSLKQALARFSQKRNVKTTRKVVH  508
            S A+++  +C  G  E G+  +       + S+ ++ +L    A F       TT     
Sbjct  128  STALTNLETCRAGFVELGISDNVLPLMSNNVSKLISNTLALNYAPF-------TTPNYTK  180

Query  509  KKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYV  685
            K P+        L   SSA SKANIVVA+D SGNYK+I+EA++A S+    G  R ++Y+
Sbjct  181  KFPTWVRPSDRKLLQSSSAVSKANIVVARDSSGNYKTISEAITAASK--RTGTARYIIYI  238

Query  686  KAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            KAG YNE +E+   + N+M +GDG+ +TIITG+++V  GSTTF SAT  V GDGF A+
Sbjct  239  KAGTYNENIEVGSKLDNIMFIGDGIGKTIITGSKSVGGGSTTFNSATVAVVGDGFIAQ  296



>ref|XP_008367065.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6 
[Malus domestica]
Length=299

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 121/214 (57%), Gaps = 21/214 (10%)
 Frame = +2

Query  248  VSDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVS-HGRHAS  424
             +DC  LY D  ++L R  I   +  DA TWLSA++++ ++C +G  +  + S H +   
Sbjct  80   CNDCLELYEDTVDKLNR-SIGSSNXFDANTWLSASLANLKTCQNGFVDFNISSSHLQSFP  138

Query  425  QNLTLS--LKQALARFSQKRNVKTTRKVVHKKPss-----------------sdggglld  547
              +TLS  L + L+       V T    +H                      S     L 
Sbjct  139  NYVTLSSNLSKMLSNSLSVHKVSTFPSALHFSKQVRGRRRTLLSDDGFPEWVSAADRRLL  198

Query  548  swssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERG  727
               S+  KA+++VAQDGSGNYKSI+EAV++  ++ +G   R V++VKAGVY E VEI++ 
Sbjct  199  QSGSSGPKADMIVAQDGSGNYKSISEAVNSAHKLRSGATKRFVIHVKAGVYRENVEIKKT  258

Query  728  IKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATF  829
            +KN+M +GDG+D TI+TGN+N QDGSTT+ SAT 
Sbjct  259  MKNIMFIGDGIDATIVTGNKNSQDGSTTYRSATL  292



>emb|CAN77092.1| hypothetical protein VITISV_026596 [Vitis vinifera]
Length=507

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 82/97 (85%), Gaps = 1/97 (1%)
 Frame = +2

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLV  748
            +A+IVVA DGSGNYK+I+EAV+A  ++ +G + R V+YVKAGVY E VEI+R +KN+M++
Sbjct  192  RADIVVAHDGSGNYKTISEAVAASVKLRSGTK-RFVIYVKAGVYRENVEIKRKMKNIMII  250

Query  749  GDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GDG D TI+TGN+NVQDGSTTF SATF VSG+GF AR
Sbjct  251  GDGKDATIVTGNKNVQDGSTTFRSATFAVSGNGFIAR  287



>ref|XP_002320714.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE99029.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 119/211 (56%), Gaps = 21/211 (10%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHG-RHASQN  430
            DC  LY +    L +    K    DA TWLS A+++  +C  G  E G+  +     S N
Sbjct  97   DCLELYQEIVLWLNKTTGSKCTKYDAQTWLSTALTNLETCRTGFAEFGMTDYILPMMSNN  156

Query  431  LTLSLKQALARFSQKRNVKTTRKVVHKKPsssdgggl--------ldswssassKANIVV  586
            ++  +   LA            K  + +PS + G           L   SS +S+ANIVV
Sbjct  157  VSKLISNTLA----------INKAPYSEPSFNGGFPSWVRPGDRKLLQSSSPASQANIVV  206

Query  587  AQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDR  766
            AQDGSGN K+I EA+ A S+    G GR V+YVKAG YNE VE+ + +KNVM+VGDG+ +
Sbjct  207  AQDGSGNVKTIKEAIVAASK--RSGSGRYVIYVKAGTYNENVEVGQKVKNVMVVGDGIGK  264

Query  767  TIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TI+TG+++V  G+TTF SATF V GD F AR
Sbjct  265  TIVTGSKSVGGGTTTFKSATFAVVGDNFIAR  295



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 134/250 (54%), Gaps = 23/250 (9%)
 Frame = +2

Query  134  LAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLAR-LDIE  310
            +A++ A    LRA   ++ L       RE          +DC  LY D   +L R LD  
Sbjct  72   MALQVAMDRALRAESHTKWLEPKCRNEREKAAW------ADCLKLYQDTVLQLNRTLDPS  125

Query  311  -KYDHDDAVTWLSAAMSSHRSCLDGLNEKG-------LVSHGRHASQNLTLSLKQALARF  466
             K    DA TWLS A+++ ++C  G  E G       L+S+      + TL++ +A+   
Sbjct  126  IKCTDFDAQTWLSTALTNLQTCRAGFIELGVSDFMLPLMSNNVSKLISNTLAINKAI---  182

Query  467  SQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSR  646
            SQ +N    R      P            S    +AN+VVAQDGSGN+++I  A+ A+S+
Sbjct  183  SQNQNYTDGRFPSWVSPGDRKLLQSSSPAS----RANMVVAQDGSGNFRTIKAALDAVSK  238

Query  647  MGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSAT  826
                G GR +++VKAGVY E +EI  G+KN+MLVGDGM  TIITG+R+V  G TTF SAT
Sbjct  239  Q-RKGSGRFIIHVKAGVYRENLEIGNGMKNIMLVGDGMRSTIITGSRSVGGGFTTFNSAT  297

Query  827  FRVSGDGFWA  856
              V+G+GF A
Sbjct  298  VAVTGEGFIA  307



>ref|XP_009589961.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase-like [Nicotiana 
tomentosiformis]
Length=548

 Score =   130 bits (328),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 90/213 (42%), Positives = 123/213 (58%), Gaps = 14/213 (7%)
 Frame = +2

Query  248  VSDCATLYADAEERL-----ARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLV-SH  409
            ++DC  L   + +RL     +  ++    H D  TWLS+ +++H +C DGLN  GLV S 
Sbjct  122  LADCLELMDLSRDRLMDSMMSLGNLSTQVHFDVHTWLSSILTNHVTCKDGLN--GLVQSI  179

Query  410  GRHASQNLTLSLKQALARFSQKRNVKTT--RKVVHKKPs-ssdggglldswssassKANI  580
                 ++L    K +LA   +   VKT     V H  PS  +     L   S+ +  AN+
Sbjct  180  MEPMLKDLITRAKTSLALMVKMAPVKTMDLPSVTHGLPSWVTSNDRRLLQLSANAITANV  239

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVA+DGSG +K++ EAV++     + G+ R V+YVK G+Y E VEI +  KNVMLVGDGM
Sbjct  240  VVAKDGSGKFKTVKEAVASAP---DNGKTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGM  296

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            D TIITG+ N  DGSTTF SAT    GDGF A+
Sbjct  297  DATIITGSLNFVDGSTTFKSATVAAVGDGFIAQ  329



>ref|XP_009589755.1| PREDICTED: pectinesterase-like [Nicotiana tomentosiformis]
Length=548

 Score =   130 bits (326),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 121/212 (57%), Gaps = 12/212 (6%)
 Frame = +2

Query  248  VSDCATLYADAEERL-----ARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHG  412
            ++DC  L   + +RL     +  ++    H D  TWLS+ +++H +C DGLN +   S  
Sbjct  122  LADCLELMDLSRDRLMDSMMSLGNLSSQAHFDVHTWLSSILTNHVTCKDGLNAQAQ-SIM  180

Query  413  RHASQNLTLSLKQALARFSQ--KRNVKTTRKVVHKKPs-ssdggglldswssassKANIV  583
            +   ++L    K +LA   +    N      V H  PS  +     L   S+ +  AN+V
Sbjct  181  KPMLKDLIARAKTSLALMVKMAPSNTMDLPSVTHGLPSWVTSNDRRLLQLSANAITANVV  240

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            VA+DGSG +K++ EAV++     + G+ R V+YVK G+Y E VEI +  KNVMLVGDGMD
Sbjct  241  VAKDGSGKFKTVKEAVASAP---DNGKTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMD  297

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             TIITGN NV DG+TTF SAT    GDGF A+
Sbjct  298  TTIITGNLNVVDGATTFNSATVAAVGDGFIAQ  329



>ref|XP_003630895.1| Pectinesterase [Medicago truncatula]
Length=379

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 84/224 (38%), Positives = 123/224 (55%), Gaps = 45/224 (20%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-----  418
            DC  LY D   +L R  I   + +D +TW SA++++H++C +G  +  L SH  +     
Sbjct  95   DCLELYEDTIYQLKR-SINSNNLNDKLTWQSASITNHQTCQNGFIDFNLPSHLNYFPSML  153

Query  419  ------------ASQNLTLSLKQALARFSQKRN--------------VKTTRKVVHKKPs  520
                         S  LT S   + +  S K+N                + RK++   P 
Sbjct  154  SNFTKLLSNSLSISNTLTSSQSSSSSSSSTKQNGGRRLLSDGFPYWLSGSDRKLLQATPG  213

Query  521  ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVY  700
            S  G            +A+IVVAQDGSGNYK+I+E V+A +++   G+GRVV+++KAG+Y
Sbjct  214  SGIGP-----------RADIVVAQDGSGNYKTISEGVAAAAKLS--GKGRVVIHLKAGIY  260

Query  701  NERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFR  832
             E V+I++ +KN+M+ GDGMD TI+TGN N  DGSTTF SATF 
Sbjct  261  KENVDIKKTVKNLMIFGDGMDSTIVTGNHNAIDGSTTFRSATFE  304



>ref|XP_010460102.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6 
isoform X1 [Camelina sativa]
 ref|XP_010460103.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6 
isoform X2 [Camelina sativa]
Length=553

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/235 (37%), Positives = 137/235 (58%), Gaps = 34/235 (14%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDH-DDAVTWLSAAMSSHRSCLDGLNEKGLVS-----HGR  415
            DC  LY D  ++L      +Y    D  T LSAA+++  +C +G  +  L+S        
Sbjct  109  DCLELYEDTIDQLNHTRSSQYSSMHDRQTSLSAAIANQDTCRNGFKDFKLISSYSKYFPI  168

Query  416  HASQNLTLSLKQAL-------------------ARFSQKRNVKT---TRKVV----HKKP  517
            H  +NLT SL  +L                    +++++RN       R+++     + P
Sbjct  169  HHHRNLTKSLSNSLAVTKAAAEAVAEKYASTGFTKYNKQRNSNGGGGHRRLLMFSDEEYP  228

Query  518  s-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAG  694
            S        L   ++ ++KA++VVA+DGSG+Y SI +AV+A++++    + R+V+YVKAG
Sbjct  229  SWFPLSDRKLLEDTTTTTKADLVVAKDGSGHYTSIQQAVNAVAKLSRRNK-RLVIYVKAG  287

Query  695  VYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            VY E V +++ IKNVM++GDG+D TI+TGN+NV+DG+TTF SATF VSG+GF AR
Sbjct  288  VYRENVVVKKSIKNVMVIGDGIDSTIVTGNKNVKDGTTTFRSATFAVSGEGFIAR  342



>ref|XP_009769268.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=548

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 122/212 (58%), Gaps = 12/212 (6%)
 Frame = +2

Query  248  VSDCATLYADAEERL-----ARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHG  412
            ++DC  L   + +RL     A  ++    H D  TWLS+ +++H +C+DGLN +   S  
Sbjct  122  LADCLELMNLSRDRLMDSMMALGNLSAQAHFDVHTWLSSILTNHVTCMDGLNGQAQ-SIM  180

Query  413  RHASQNLTLSLKQALARFSQ--KRNVKTTRKVVHKKPs-ssdggglldswssassKANIV  583
            +   ++L +  K +LA   +    N      V    PS  +     L   S+ + KAN++
Sbjct  181  KPMLKDLIVRAKTSLALMVKMTPSNTMDLPSVTDGLPSWVTSNDRRLLQLSANAIKANVI  240

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            VA+DGSG YK++ EAV++     +  + R V+YVK G+Y E VEI +  KNVMLVGDGMD
Sbjct  241  VAKDGSGKYKTVKEAVASAP---DNSKTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGMD  297

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             TIITG+ NV DGSTTF SAT    GDGF A+
Sbjct  298  ATIITGSLNVVDGSTTFKSATVAAVGDGFIAQ  329



>ref|XP_010684811.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=537

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 98/282 (35%), Positives = 145/282 (51%), Gaps = 31/282 (11%)
 Frame = +2

Query  98   TRNALTASNQDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaV-SDCATLYA  274
            T   L +S +  L +R    N+   L+ +Q +H L      S     A     DC  LY 
Sbjct  39   TSKVLVSSQESNLEVRNIFLNI--TLDHAQKVHTLISSMDISSFQDLAKFAWEDCLELYE  96

Query  275  DAEERLARLDIEKYDH---DDAVTWLSAAMSSHRSCLDGL-------NEKGLVSHGRHAS  424
            D   +L +  +   D     D  T+LSAA +++ +C +G        N +         S
Sbjct  97   DTIYQLNQTILLSKDFTTIQDIQTYLSAATTNYETCKNGFVDLNISTNLEFFTFTSSKFS  156

Query  425  QNLT--LSLKQALARFSQKRNVKTTRK--------------VVHKKPs-ssdggglldsw  553
            Q LT  L++ QA++  S K   +                  + +  PS        L   
Sbjct  157  QFLTNALAINQAISTTSFKPYTRERGGGGIGGRGGSGGRRLLANGLPSWMFKADHKLLQT  216

Query  554  ssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIK  733
            S  ++KA++VVA+DG+GNYK+I+EA++A   +  G + R ++YVKAG+Y E V I   +K
Sbjct  217  SMPTTKADLVVAKDGTGNYKTISEAITAAKNLRIGTK-RFIIYVKAGIYKENVVITNKMK  275

Query  734  NVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            N+ML+GDG+D TI+T N+NVQDGSTTF SATF +SGDGF A+
Sbjct  276  NLMLIGDGIDATIVTCNKNVQDGSTTFRSATFAISGDGFIAK  317



>ref|XP_006448208.1| hypothetical protein CICLE_v10014888mg [Citrus clementina]
 gb|ESR61448.1| hypothetical protein CICLE_v10014888mg [Citrus clementina]
Length=525

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 130/217 (60%), Gaps = 18/217 (8%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGR---HAS  424
            DC  LY D    L R  +   +  D+VTWLSAA+++  +C +G  +  L SH +     S
Sbjct  96   DCKDLYDDTVNHLNR-SMSSSNPIDSVTWLSAAIANQETCKNGFTDFNLHSHLQSLPFMS  154

Query  425  QNLTLSLKQALA-----------RFSQKRNVKTTRKVVHKKPs-ssdggglldswssass  568
             N +  L  +LA            ++ KRN    R +V+  P+  S     L   S    
Sbjct  155  GNFSKLLSNSLAITKSTVSSSSIPYAYKRN-GGRRLLVNGFPTWVSAADRRLLQSSGVGP  213

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLV  748
            KA++VVAQDGSGNYK+I+E V+A  ++G GG  RVV+YVK GVY E VEI+R +KN+ML+
Sbjct  214  KADVVVAQDGSGNYKTISEGVAAAVKLG-GGSKRVVIYVKRGVYRENVEIKRSMKNLMLI  272

Query  749  GDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GDG+D TI+T N+N + G+TTF +ATF VSG GF AR
Sbjct  273  GDGIDATIVTSNKNGKGGTTTFRTATFAVSGQGFIAR  309



>ref|XP_006469215.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Citrus sinensis]
Length=525

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 95/217 (44%), Positives = 130/217 (60%), Gaps = 18/217 (8%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGR---HAS  424
            DC  LY D    L R  +   +  D+VTWLSAA+++  +C +G  +  L SH +     S
Sbjct  96   DCKDLYDDTVNHLNR-SMSSSNPIDSVTWLSAAIANQETCKNGFTDFNLHSHLQSLPFMS  154

Query  425  QNLTLSLKQALA-----------RFSQKRNVKTTRKVVHKKPs-ssdggglldswssass  568
             N +  L  +LA            ++ KRN    R +V+  P+  S     L   S    
Sbjct  155  GNFSKLLSNSLAITKSTVSSSSIPYAYKRN-GGRRLLVNGFPTWVSAADRRLLQSSGVGP  213

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLV  748
            KA++VVAQDGSGNYK+I+E V+A  ++G GG  RVV+YVK GVY E VEI+R +KN+ML+
Sbjct  214  KADVVVAQDGSGNYKTISEGVAAAVKLG-GGSKRVVIYVKRGVYRENVEIKRSMKNLMLI  272

Query  749  GDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GDG+D TI+T N+N + G+TTF +ATF VSG GF AR
Sbjct  273  GDGIDATIVTSNKNGKGGTTTFRTATFAVSGQGFIAR  309



>gb|KDO75533.1| hypothetical protein CISIN_1g008722mg [Citrus sinensis]
Length=556

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 151/279 (54%), Gaps = 48/279 (17%)
 Frame = +2

Query  104  NALTASNQ-DLLAIRTARS--NVLRALEWSQSL-HELHEPSRESGnnaaaaaVSDCATLY  271
            NA T  N+ DLL I  ++S  N+   +E +  + H ++ P  ++        ++DC  L 
Sbjct  79   NATTKMNEVDLLLIFLSKSTSNIQETIEVANHVKHRINSPRGQAA-------LTDCVELL  131

Query  272  ADAEER----LARLDIEKYD-HDDAVTWLSAAMSSHRSCLDGLN-------EKGLVSHGR  415
              + +R    +A L   +   ++DA  WLS  +++H +CLDGL+       E  LV    
Sbjct  132  ELSVDRITDSMAALKKRRTSSNEDAHAWLSGVLTNHVTCLDGLDGSATKLMEPRLVELMA  191

Query  416  HASQNLTLSL------KQALARFSQKRNVK-----TTRKVVHKKPsssdggglldswssa  562
             A+ +L + +         + ++  ++ ++     T+R  +  +PS ++           
Sbjct  192  RAANSLAILVAISPYNTNVIQQYYLRKEIQFPSWVTSRDRLLLRPSQAEAA---------  242

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVM  742
              KAN+VVA+DGSGNYK++ EAV++     +  + R V+YVK G Y E VE+ +  KN+M
Sbjct  243  --KANVVVAKDGSGNYKTVKEAVASAP---DNSKTRYVIYVKKGTYKENVEVGKKKKNLM  297

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +VGDGMD TIITG+ NV DGSTTF SAT  V GDGF A+
Sbjct  298  IVGDGMDLTIITGSLNVVDGSTTFKSATIAVGGDGFIAQ  336



>ref|XP_006467993.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Citrus 
sinensis]
Length=556

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 151/279 (54%), Gaps = 48/279 (17%)
 Frame = +2

Query  104  NALTASNQ-DLLAIRTARS--NVLRALEWSQSL-HELHEPSRESGnnaaaaaVSDCATLY  271
            NA T  N+ DLL I  ++S  N+   +E +  + H ++ P  ++        ++DC  L 
Sbjct  79   NATTKMNEVDLLLIFLSKSTSNIQETIEVANHVKHRINSPRGQAA-------LTDCVELL  131

Query  272  ADAEER----LARLDIEKYD-HDDAVTWLSAAMSSHRSCLDGLN-------EKGLVSHGR  415
              + +R    +A L   +   ++DA  WLS  +++H +CLDGL+       E  LV    
Sbjct  132  ELSVDRITDSMAALKKRRTSSNEDAHAWLSGVLTNHVTCLDGLDGSATKLMEPRLVELMA  191

Query  416  HASQNLTLSL------KQALARFSQKRNVK-----TTRKVVHKKPsssdggglldswssa  562
             A+ +L + +         + ++  ++ ++     T+R  +  +PS ++           
Sbjct  192  RAANSLAILVAISPYNTNVIQQYYLRKEIQFPSWVTSRDRLLLRPSQAEAA---------  242

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVM  742
              KAN+VVA+DGSGNYK++ EAV++     +  + R V+YVK G Y E VE+ +  KN+M
Sbjct  243  --KANVVVAKDGSGNYKTVKEAVASAP---DNSKTRYVIYVKKGTYKENVEVGKKKKNLM  297

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +VGDGMD TIITG+ NV DGSTTF SAT  V GDGF A+
Sbjct  298  IVGDGMDLTIITGSLNVVDGSTTFKSATIAVGGDGFIAQ  336



>ref|XP_004150118.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Cucumis sativus]
 gb|KGN51481.1| hypothetical protein Csa_5G568300 [Cucumis sativus]
Length=539

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 85/224 (38%), Positives = 122/224 (54%), Gaps = 26/224 (12%)
 Frame = +2

Query  254  DCATLYADAEERLAR--LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQ  427
            DC   Y D+   L R  L     +  D  T LSA++++H++CLDG  + G +      S 
Sbjct  100  DCLEFYEDSIAELNRSTLSSTSANSIDHSTMLSASLANHQTCLDGFRDFGFLVDD---SN  156

Query  428  NLTLSLKQALARFSQ--KRNVKTTRKVVHKK-----------------Psssdgggllds  550
            N  L + Q ++ FS+    ++  T+ +                     P           
Sbjct  157  NFFLPI-QIMSNFSKLVSNSLAITKAIAAAPSTSSSTSCGQPLLDGLCPEWVYDDDKTLL  215

Query  551  wssassKANIVVAQDGSGNYKSINEAVSALSRMGNG-GEGRVVVYVKAGVYNERVEIERG  727
                   A++VVAQDGSG++++I+EAV+A      G G GR V+YVK G+Y E V IE+ 
Sbjct  216  QDMVGKGADMVVAQDGSGDFRTISEAVAAAEEARKGSGSGRFVIYVKGGIYKENVVIEKR  275

Query  728  IKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +KN+M+VGDGMDRTI+T  +NVQDGSTTF SATF V+G+GF A+
Sbjct  276  MKNIMMVGDGMDRTIVTAMKNVQDGSTTFQSATFAVAGEGFIAK  319



>ref|XP_006826911.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
 gb|ERM94148.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
Length=515

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 121/208 (58%), Gaps = 5/208 (2%)
 Frame = +2

Query  251  SDCATLYADAEERLAR-LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKG-LVSHGRHAS  424
            +DC  L  D   +L + L        D +TWLSAA+++  +C  G +E   L S      
Sbjct  89   ADCLELTEDTVSKLNKTLVSSNLASSDTLTWLSAAITNDDTCRTGFSETPWLKSTDLSKL  148

Query  425  QNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdgggll---dswssassKANIVVAQD  595
             + +L+++++ A      +  T RK++  +        +        +++ KAN+VVA+D
Sbjct  149  LSNSLAVEKSFAARLDGLSGHTNRKLLSVQSRGFPEWVVAGDRRLLQASTGKANLVVAKD  208

Query  596  GSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTII  775
            GSG + +I+ A++A  +       R V+YVK G Y E +EI++ +KN+M VGDG+D+TII
Sbjct  209  GSGGFATISAAITASEKQRKTSTSRFVIYVKEGTYKENIEIKKSMKNLMFVGDGIDKTII  268

Query  776  TGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TG+RNVQDGSTTF SATF V+ DGF A+
Sbjct  269  TGSRNVQDGSTTFRSATFAVAADGFIAK  296



>emb|CBI23178.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 118/216 (55%), Gaps = 20/216 (9%)
 Frame = +2

Query  248  VSDCATLYA-------DAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVS  406
            +SDC  L         D+ E L R  ++   H DA  WLS  ++++ +C DG+N    +S
Sbjct  101  LSDCVELMDLSMGRIRDSVEALGRGTVDS--HADAHAWLSGVLTNYITCTDGINGPSRIS  158

Query  407  HGR---HASQNLTLSLKQALARFSQKRNVKTTRKVVHKK--PsssdggglldswssassK  571
              R   H       SL   +A    K +V    + +H +  P        +   SS   K
Sbjct  159  MERGLKHLISRAETSLAMLVAVSPAKEDV---LQPLHSEFPPWVDSRDRKILESSSKDIK  215

Query  572  ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVG  751
            AN+VVA+DGSGNYK++ EA++++    N  + R V++VK G Y E VEI    KNVM+VG
Sbjct  216  ANVVVAKDGSGNYKTVKEAIASVP---NNSKTRYVIHVKKGTYKENVEIVTKQKNVMIVG  272

Query  752  DGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            DGMD T+ITG+ NV DGSTTF SAT    GDGF A+
Sbjct  273  DGMDSTVITGSLNVIDGSTTFKSATLAAVGDGFIAQ  308



>ref|XP_010552690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6 
[Tarenaya hassleriana]
Length=543

 Score =   128 bits (322),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 96/262 (37%), Positives = 147/262 (56%), Gaps = 37/262 (14%)
 Frame = +2

Query  173  LEWSQSLHELHEPS--RESGnnaaaaaVSDCATLYADAEERLARLDIEKYDHD-DAVTWL  343
            ++ ++ LH L   S  R   +  A +A+ DC  LY D   +L R     +    D  T L
Sbjct  71   IDLTKQLHRLVSDSKRRRFLSKCATSALFDCLELYRDTLLQLNRSTNRHFPSSMDIQTSL  130

Query  344  SAAMSSHRSCLDGLNEKGLVSHGRHAS----QNLTLSLKQALA---------------RF  466
            SAA+++  +C +G  +  L S+  +      +NL+ SL  +LA                F
Sbjct  131  SAAIANQETCKNGFFDFNLTSYSTYFPLEMHRNLSKSLSNSLAVTKAAADESSAAAFTEF  190

Query  467  SQKRNVKTT-RKVV---HKKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAV  631
            +++ +   + R+++    K P   S     L      ++KA++VVA+DGSG+Y S+++AV
Sbjct  191  NKQGHFGGSGRRLLLSGEKFPLWVSYSDRKLLESLETTAKADLVVAKDGSGHYTSVSKAV  250

Query  632  SALSRM------GNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNV  793
             A  R+      GN    R V+YVKAG+YNE +EI+R +KN+M+VGDG+D T+ITGNRNV
Sbjct  251  EAAMRLHRQEKSGN----RFVIYVKAGIYNENIEIKRSMKNLMVVGDGIDSTVITGNRNV  306

Query  794  QDGSTTFGSATFRVSGDGFWAR  859
            +DG+TTF SATF V+G+GF  R
Sbjct  307  RDGTTTFQSATFAVTGEGFIGR  328



>emb|CDO99717.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 102/187 (55%), Gaps = 20/187 (11%)
 Frame = +2

Query  320  HDDAVTWLSAAMSSHRSCLDGLN----------EKGLVSHGRHASQNLTLSLKQALARFS  469
            H D  +WLS+ +++H +CLDGLN           K L+S  R +   L            
Sbjct  151  HSDVHSWLSSVLTNHVTCLDGLNGLARPAMEPLMKELISRARTSLAMLVAIAPSEEEMIQ  210

Query  470  QKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRM  649
            +  N      V HK          L   S+ +  AN+VVAQDGSGNYK++ EAV+A    
Sbjct  211  EPLNGDFPSWVTHKD-------RRLLQSSAKNINANVVVAQDGSGNYKTVQEAVTAAP--  261

Query  650  GNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATF  829
             N  + R V+YVK G Y E+V+I +  KN+MLVGDGMD TIITG+ NV DG+TTF SAT 
Sbjct  262  -NNPQTRYVIYVKKGTYKEKVDIGKSKKNLMLVGDGMDLTIITGSLNVVDGTTTFQSATV  320

Query  830  RVSGDGF  850
                DGF
Sbjct  321  AAVADGF  327



>ref|XP_004133929.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN56617.1| hypothetical protein Csa_3G126810 [Cucumis sativus]
Length=509

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 83/210 (40%), Positives = 114/210 (54%), Gaps = 21/210 (10%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQN  430
            +DC  LY     RL R    +    DA TWLSAA+++  +C  G  E GL + G   + N
Sbjct  99   TDCVDLYDQIITRLNRTS-ARCSPADAQTWLSAALTALETCRTGFEELGLSAFGYPLTAN  157

Query  431  LT-------LSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVA  589
                     LS+ +  +    +    T        P +               KA++VVA
Sbjct  158  NVSKLISDGLSVNKPASPEGYEPTTMTDGFPTWVSPGNRKLLQSESP------KADVVVA  211

Query  590  QDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRT  769
            QDGSGN+K++ +A+SA       G GR V+Y+K+GVYNE ++I+   KNVM+VGDG+ +T
Sbjct  212  QDGSGNFKTVKDAISAAK-----GGGRFVIYIKSGVYNENLDIKA--KNVMMVGDGIGKT  264

Query  770  IITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            IITG+R+V  GSTTF SAT  V GDGF AR
Sbjct  265  IITGSRSVGGGSTTFRSATVAVDGDGFIAR  294



>ref|XP_002266980.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=528

 Score =   128 bits (321),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 86/216 (40%), Positives = 118/216 (55%), Gaps = 20/216 (9%)
 Frame = +2

Query  248  VSDCATLYA-------DAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVS  406
            +SDC  L         D+ E L R  ++   H DA  WLS  ++++ +C DG+N    +S
Sbjct  101  LSDCVELMDLSMGRIRDSVEALGRGTVDS--HADAHAWLSGVLTNYITCTDGINGPSRIS  158

Query  407  HGR---HASQNLTLSLKQALARFSQKRNVKTTRKVVHKK--PsssdggglldswssassK  571
              R   H       SL   +A    K +V    + +H +  P        +   SS   K
Sbjct  159  MERGLKHLISRAETSLAMLVAVSPAKEDV---LQPLHSEFPPWVDSRDRKILESSSKDIK  215

Query  572  ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVG  751
            AN+VVA+DGSGNYK++ EA++++    N  + R V++VK G Y E VEI    KNVM+VG
Sbjct  216  ANVVVAKDGSGNYKTVKEAIASVP---NNSKTRYVIHVKKGTYKENVEIVTKQKNVMIVG  272

Query  752  DGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            DGMD T+ITG+ NV DGSTTF SAT    GDGF A+
Sbjct  273  DGMDSTVITGSLNVIDGSTTFKSATLAAVGDGFIAQ  308



>ref|XP_002265599.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=512

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 125/212 (59%), Gaps = 21/212 (10%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKG-----LVSHG  412
            DC  LY     +L + LD   +    DA TWLS A+++ ++C DG  E G     L S  
Sbjct  93   DCLELYEHTILKLNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDGFIELGVSDYLLPSMS  152

Query  413  RHASQNL--TLSL-KQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIV  583
             + S+ +  TLS+ K   A  S K    T  K   +K         L   SS +S+ANIV
Sbjct  153  NNVSKLISNTLSINKVPYAEPSYKGGYPTWVKPGDRK---------LLQSSSLASQANIV  203

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            V++DGSG+Y +I  A++A S+    G GR V+YVKAG Y+E V+I  G+KN+ML+GDG+ 
Sbjct  204  VSKDGSGDYTTIGAAITAASK--RSGSGRYVIYVKAGTYSENVQIGSGLKNIMLLGDGIG  261

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +TI+TG+++V  GSTTF SAT  V GDGF AR
Sbjct  262  KTIVTGSKSVGGGSTTFKSATVAVVGDGFIAR  293



>emb|CAN83663.1| hypothetical protein VITISV_017689 [Vitis vinifera]
Length=512

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 125/212 (59%), Gaps = 21/212 (10%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKG-----LVSHG  412
            DC  LY     +L + LD   +    DA TWLS A+++ ++C DG  E G     L S  
Sbjct  93   DCLELYEHTILKLNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDGFIELGVSDYLLPSMS  152

Query  413  RHASQNL--TLSL-KQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIV  583
             + S+ +  TLS+ K   A  S K    T  K   +K         L   SS +S+ANIV
Sbjct  153  NNVSKLISNTLSINKVPYAEPSYKGGYPTWVKPGDRK---------LLQSSSLASQANIV  203

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            V++DGSG+Y +I  A++A S+    G GR V+YVKAG Y+E V+I  G+KN+ML+GDG+ 
Sbjct  204  VSKDGSGDYTTIGAAITAASK--RSGSGRYVIYVKAGTYSENVQIGSGLKNIMLLGDGIG  261

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +TI+TG+++V  GSTTF SAT  V GDGF AR
Sbjct  262  KTIVTGSKSVGGGSTTFKSATVAVVGDGFIAR  293



>ref|XP_010259196.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=515

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 127/206 (62%), Gaps = 7/206 (3%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-ASQ  427
            +DC  LY +   RL   D    ++DD +TWLS A+++  +C  G  E G+  +       
Sbjct  97   ADCLELYDNTIIRLN--DTINSNYDDYMTWLSTALTNLETCRTGFVELGITDYILPLMPN  154

Query  428  NLTLSLKQALARFSQKRNVKTTRKVVHKKPs--ssdggglldswssassKANIVVAQDGS  601
            N++  +   LA          T +    +PS   +D   LL + S  +S+A++VVAQDG+
Sbjct  155  NVSELISNTLAVSKLPTGEPATYEDGSWRPSWVKADDQKLLQTASRPTSEADVVVAQDGT  214

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            G+++++NEA++A ++      GR+++YVKAG Y E V+I + +KN+ML+GDGM +TIITG
Sbjct  215  GDFETVNEAMNAAAKQKR--RGRLLIYVKAGTYRENVQIGKKLKNIMLIGDGMGKTIITG  272

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            +++V+ GSTTF SAT  VSGDGF AR
Sbjct  273  SKSVRGGSTTFSSATVAVSGDGFIAR  298



>ref|XP_004167644.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 6-like [Cucumis sativus]
Length=539

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/224 (38%), Positives = 121/224 (54%), Gaps = 26/224 (12%)
 Frame = +2

Query  254  DCATLYADAEERLAR--LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQ  427
            DC   Y D+   L R  L     +  D  T LSA++ +H++CLDG  + G +      S 
Sbjct  100  DCLEFYEDSIAELNRSTLSSTSANSIDHSTMLSASLVNHQTCLDGFRDFGFLVDD---SN  156

Query  428  NLTLSLKQALARFSQ--KRNVKTTRKVVHKK-----------------Psssdgggllds  550
            N  L + Q ++ FS+    ++  T+ +                     P           
Sbjct  157  NFFLPI-QIMSNFSKLVSNSLAITKAIAAAPSTSSSTSCGQPLLDGLCPEWVYDDDKTLL  215

Query  551  wssassKANIVVAQDGSGNYKSINEAVSALSRMGNG-GEGRVVVYVKAGVYNERVEIERG  727
                   A++VVAQDGSG++++I+EAV+A      G G GR V+YVK G+Y E V IE+ 
Sbjct  216  QDMVGKGADMVVAQDGSGDFRTISEAVAAAEEARKGSGSGRFVIYVKGGIYKENVVIEKR  275

Query  728  IKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +KN+M+VGDGMDRTI+T  +NVQDGSTTF SATF V+G+GF A+
Sbjct  276  MKNIMMVGDGMDRTIVTAMKNVQDGSTTFQSATFAVAGEGFIAK  319



>dbj|BAJ34238.1| unnamed protein product [Thellungiella halophila]
Length=552

 Score =   127 bits (320),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 132/237 (56%), Gaps = 37/237 (16%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHD----DAVTWLSAAMSSHRSCLDGLNEKGLVS-----  406
            DC  LY D  ++L       YD +    D  T LSAA+++  +C +G  +  L S     
Sbjct  107  DCLELYEDTIDQL-NYSRRSYDQNSSAHDRQTSLSAAIANQDTCKNGFKDFNLTSSYSKY  165

Query  407  HGRHASQNLTLSLKQAL-----------------ARFSQKRNVKTTRKVV------HKKP  517
               H+ +NLT S+  +L                  +FS++ +               K P
Sbjct  166  FPIHSHRNLTKSISNSLAVAKAAATAEKYPATTFTKFSKQGSRGGGGGSRRLMFSDEKFP  225

Query  518  s---ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVK  688
            S    SD   L DS ++  +KA++VVA+DGSG Y SI +AV+A ++     + R+V+YVK
Sbjct  226  SWIPFSDRKLLQDSGTTTKAKADLVVAKDGSGRYTSIQQAVNAAAKFSRRNK-RLVIYVK  284

Query  689  AGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            AGVY E VEI++ IKN+M++GDG+D TI+TGNRNV+DG+TTF SATF VSG GF  R
Sbjct  285  AGVYQENVEIKKSIKNLMVIGDGIDSTIVTGNRNVKDGTTTFRSATFAVSGSGFIGR  341



>ref|XP_006416115.1| hypothetical protein EUTSA_v10007274mg [Eutrema salsugineum]
 gb|ESQ34468.1| hypothetical protein EUTSA_v10007274mg [Eutrema salsugineum]
Length=552

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 132/237 (56%), Gaps = 37/237 (16%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHD----DAVTWLSAAMSSHRSCLDGLNEKGLVS-----  406
            DC  LY D  ++L       YD +    D  T LSAA+++  +C +G  +  L S     
Sbjct  107  DCLELYEDTIDQL-NYSRRSYDQNSSAHDRQTSLSAAIANQDTCKNGFKDFNLTSSYSKY  165

Query  407  HGRHASQNLTLSLKQAL-----------------ARFSQKRNVKTTRKVV------HKKP  517
               H+ +NLT S+  +L                  +FS++ +               K P
Sbjct  166  FPIHSHRNLTKSISNSLAVAKAAATAEKYPATTFTKFSKQGSRGGGGGSRRLMFSDEKFP  225

Query  518  s---ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVK  688
            S    SD   L DS ++  +KA++VVA+DGSG Y SI +AV+A ++     + R+V+YVK
Sbjct  226  SWIPFSDRKLLQDSGTTTKAKADLVVAKDGSGRYTSIQQAVNAAAKFSRRNK-RLVIYVK  284

Query  689  AGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            AGVY E VEI++ IKN+M++GDG+D TI+TGNRNV+DG+TTF SATF VSG GF  R
Sbjct  285  AGVYQENVEIKKSIKNLMVIGDGIDSTIVTGNRNVKDGTTTFRSATFAVSGSGFIGR  341



>gb|KDP20786.1| hypothetical protein JCGZ_21257 [Jatropha curcas]
Length=544

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 104/190 (55%), Gaps = 21/190 (11%)
 Frame = +2

Query  320  HDDAVTWLSAAMSSHRSCLDGLNEKG----------LVSHGRHASQNLTLSLKQALARFS  469
            H +A  WLS+ +++H +CLDGL              L+S  R  S  L + +  A     
Sbjct  146  HANAHVWLSSVLTNHFTCLDGLTGPARSIMEPELNDLISKSR-TSLALLVGISPAKDYLI  204

Query  470  QKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRM  649
               N      V  K          L   S    KAN++VA+DGSGNYK+I EAV+A    
Sbjct  205  SPLNRDFPSWVTTKD-------RKLLEASVKDIKANVIVAKDGSGNYKTIKEAVAAAP--  255

Query  650  GNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATF  829
             N G+ R V+YVK G Y E+VEI +  KNVMLVGDGMD TIITG+ NV DGSTTF SAT 
Sbjct  256  -NNGKTRHVIYVKKGTYKEQVEIGKSKKNVMLVGDGMDLTIITGSLNVVDGSTTFDSATV  314

Query  830  RVSGDGFWAR  859
               GDGF A+
Sbjct  315  AAVGDGFIAQ  324



>ref|XP_010267745.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=553

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 81/194 (42%), Positives = 110/194 (57%), Gaps = 33/194 (17%)
 Frame = +2

Query  326  DAVTWLSAAMSSHRSCLDGLNE----------KGLVSHGRHASQNLTL---SLKQALARF  466
            DA +WLS+ +++H +CLDGLN           +GL++  + +   LT    S + AL   
Sbjct  157  DAHSWLSSILTNHVTCLDGLNGSARAAMEDKLQGLIARAKTSLAMLTAISSSKEDALRPL  216

Query  467  SQKRN---VKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSA  637
              K      K  RK++   P +               KAN+VVA+DGSGNY+++ EAV++
Sbjct  217  DGKFPSWVTKNDRKLLQSLPRNI--------------KANVVVAKDGSGNYQTVQEAVNS  262

Query  638  LSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFG  817
                 + G+ R V+YVK G Y E VE+ +   NVMLVGDGMD TIITG+ NV DGSTTF 
Sbjct  263  AP---DKGKSRYVIYVKKGTYKENVEVGKKKMNVMLVGDGMDSTIITGSLNVVDGSTTFK  319

Query  818  SATFRVSGDGFWAR  859
            SAT    GDGF A+
Sbjct  320  SATVAAVGDGFIAQ  333



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score =   127 bits (318),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 94/245 (38%), Positives = 134/245 (55%), Gaps = 11/245 (4%)
 Frame = +2

Query  134  LAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLAR-LDIE  310
            +A++ A    +RA + ++SL       RE          +DC  LY +A E+L + +D  
Sbjct  19   MAVQLALERAIRAGDNTKSLGHKCRNEREKAAW------ADCVKLYDNAIEQLNKTIDPN  72

Query  311  KYDHD-DAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-ASQNLTLSLKQALARFSQKRNV  484
                D DA TWLS A+++  +C  G  E G+        S N++  +   LA  S K   
Sbjct  73   TKCTDFDAQTWLSTALTNLETCRTGFVELGVSDFVLPLMSNNVSKLICNTLALGSNKTTH  132

Query  485  KTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGE  664
            +T+         +    G      S+S + N+VVAQDGSGNY++I  A+ A +  G  G 
Sbjct  133  ETSGYYKDDGFPTWVSPGDRRLLQSSSVRPNLVVAQDGSGNYRTIKAALDAAA--GRSGS  190

Query  665  GRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGD  844
            GR V++VK GVY E +EI   ++N+MLVGDGM  TIITG+R+V  GSTTF SAT  V+G+
Sbjct  191  GRFVIHVKRGVYRENLEIGSKLRNIMLVGDGMKYTIITGSRSVGGGSTTFNSATVAVTGE  250

Query  845  GFWAR  859
            GF AR
Sbjct  251  GFIAR  255



>ref|XP_011000694.1| PREDICTED: pectinesterase [Populus euphratica]
Length=557

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 126/244 (52%), Gaps = 19/244 (8%)
 Frame = +2

Query  155  SNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERL-----ARLDIEKYD  319
            S++   +E ++ +H     +RE         + DC  L   ++ R+     A   +    
Sbjct  104  SHIQDTIEKAEVIHSRINDAREQAA------LGDCVELMEISKYRIKDTIVALERVTSES  157

Query  320  HDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQKRNVKTTRK  499
            H +A+TWLS+ +++H +CLDGLN     S       +L L  + +LA  +     K    
Sbjct  158  HANALTWLSSVLTNHDTCLDGLNGPAR-STMELDLNDLILRARTSLAILAAISPSKENND  216

Query  500  VVHKK---Ps-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEG  667
            +   K   PS        L         A++ VA+DGSG YK++ EAV++     + G+ 
Sbjct  217  IFPLKEDFPSWLPSMDRKLLITLPKDINADVTVAKDGSGKYKTVKEAVASAP---DNGKT  273

Query  668  RVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDG  847
            R V+YVK G Y E VE+ +  KNVMLVGDGMD TIITGN NV DGSTTF SAT    GDG
Sbjct  274  RYVIYVKKGTYKENVEVGKKKKNVMLVGDGMDSTIITGNLNVVDGSTTFKSATVAAVGDG  333

Query  848  FWAR  859
            F A+
Sbjct  334  FIAQ  337



>ref|NP_173733.1| probable pectinesterase/pectinesterase inhibitor 6 [Arabidopsis 
thaliana]
 sp|O49298.1|PME6_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
6; Includes: RecName: Full=Pectinesterase inhibitor 6; AltName: 
Full=Pectin methylesterase inhibitor 6; Includes: RecName: 
Full=Pectinesterase 6; Short=PE 6; AltName: Full=Pectin 
methylesterase 6; Short=AtPME6; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF86993.1|AC005292_2 F26F24.2 [Arabidopsis thaliana]
 gb|AAC00600.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAL38739.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AAM14264.1| putative pectinesterase [Arabidopsis thaliana]
 dbj|BAE99088.1| putative pectinesterase [Arabidopsis thaliana]
 gb|AEE30354.1| probable pectinesterase/pectinesterase inhibitor 6 [Arabidopsis 
thaliana]
Length=554

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 139/239 (58%), Gaps = 38/239 (16%)
 Frame = +2

Query  254  DCATLYADAEERL--ARLDIEKYDHD-DAVTWLSAAMSSHRSCLDGLNEKGLVS-HGRHA  421
            DC  LY D  ++L  +R    +Y    D  T LSAA+++  +C +G  +  L S + ++ 
Sbjct  106  DCLELYEDTIDQLNHSRRSYGQYSSPHDRQTSLSAAIANQDTCRNGFRDFKLTSSYSKYF  165

Query  422  S----QNLTLSLKQAL---------------------ARFSQKRNVK---TTRKVV----  505
                 +NLT S+  +L                      +FS++R+     + R+++    
Sbjct  166  PVQFHRNLTKSISNSLAVTKAAAEAEAVAEKYPSTGFTKFSKQRSSAGGGSHRRLLLFSD  225

Query  506  HKKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVY  682
             K PS        L   S  ++KA++VVA+DGSG+Y SI +AV+A +++    + R+V+Y
Sbjct  226  EKFPSWFPLSDRKLLEDSKTTAKADLVVAKDGSGHYTSIQQAVNAAAKLPRRNQ-RLVIY  284

Query  683  VKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            VKAGVY E V I++ IKNVM++GDG+D TI+TGNRNVQDG+TTF SATF VSG+GF A+
Sbjct  285  VKAGVYRENVVIKKSIKNVMVIGDGIDSTIVTGNRNVQDGTTTFRSATFAVSGNGFIAQ  343



>ref|XP_010101471.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88454.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=552

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 121/213 (57%), Gaps = 14/213 (7%)
 Frame = +2

Query  254  DCATLYADAEER----LARLDIEK---YDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHG  412
            DCA L   +++R    ++ L ++K   + H+D   WLS+ +++H +CLD L +     + 
Sbjct  123  DCAELMDISKDRVVDSISTLFLQKQTSHSHEDVHAWLSSVLTNHVTCLDALEDGSYAKNL  182

Query  413  RHASQN-LTLSLKQALARFSQ--KRNVKTTRKVVHKKPs-ssdggglldswssassKANI  580
              +  N L L  + +LA        N +    +    P+  + G   L   S  + KA+I
Sbjct  183  MDSHLNELILRARTSLAILVSVFPSNSEAIETLTDDLPTWVTAGDRRLLQASVKAIKADI  242

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVA+DGSG YK++ EAV+A+    +  + R  +YVK G Y E VEI +  KNVMLVGDGM
Sbjct  243  VVAEDGSGKYKTVKEAVAAVP---DNSKTRFTIYVKKGTYKENVEIGKKKKNVMLVGDGM  299

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            D TIITG+ NV DGSTTF SAT    GDGF A+
Sbjct  300  DSTIITGSLNVIDGSTTFNSATVAAVGDGFIAQ  332



>ref|XP_010056340.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=508

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 82/211 (39%), Positives = 118/211 (56%), Gaps = 19/211 (9%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQN  430
            +DC  LY     RL      +   DD  TWLS A+++  +C  G  E G+       S N
Sbjct  90   ADCLQLYKHTILRLNHTINRQCTQDDKQTWLSTALTNLETCRAGFVELGV-------SDN  142

Query  431  LTLSLKQALARFSQKRNVKTTRKVVHKKPsssdgggl--------ldswssassKANIVV  586
            +   +   ++     RN+ +   V +  P+ ++            L   SSA+SKANIVV
Sbjct  143  VLPLMSNNVSEL--IRNILSANHVPYVTPNYTNEFPTWVRPGDRKLLQSSSAASKANIVV  200

Query  587  AQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDR  766
            AQDGSGNYK+I+EA++  S+    G  R ++Y+KAG YNE V +   + N+M VGDG+ +
Sbjct  201  AQDGSGNYKTISEAITTTSK--RSGTTRYIIYIKAGTYNENVGVGTNLVNIMFVGDGIGK  258

Query  767  TIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TIITG+++V  GSTTF SAT  + GDGF A+
Sbjct  259  TIITGSKSVGGGSTTFNSATVAIVGDGFIAQ  289



>ref|XP_011017474.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 111/210 (53%), Gaps = 19/210 (9%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNL  433
            DC  LY D    L +    K    DA TWLS A+++  +C  G  + G+         N 
Sbjct  97   DCLELYEDTILWLTQTTSSKCTDYDAQTWLSTALTNLETCRTGFTDFGMTDFILPLMNNN  156

Query  434  TLSLKQALARFSQKRNVKTTRKVVHKKPsssdgggl--------ldswssassKANIVVA  589
               L           N     KV + +PS  +G           L   SS +S+ANIVVA
Sbjct  157  VSKLIS---------NTLAINKVPYSEPSYKEGFPSWLRPGDRKLLQSSSPASQANIVVA  207

Query  590  QDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRT  769
             DGSGN K+I EA+ A S+    G GR V+YVKAG YNE VE+ + +KNVM VGDG+ +T
Sbjct  208  TDGSGNVKTIKEAIDAASK--RSGSGRYVIYVKAGTYNENVEVGKKVKNVMFVGDGIGKT  265

Query  770  IITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            I+TG+++   G+TTF SATF   GD F AR
Sbjct  266  IVTGSKSAGGGTTTFRSATFAAVGDNFIAR  295



>emb|CBI24286.3| unnamed protein product [Vitis vinifera]
Length=415

 Score =   125 bits (314),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 124/212 (58%), Gaps = 21/212 (10%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKG-------LVS  406
            DC  LY     +L + LD   +    DA TWLS A+++ ++C DG  + G       L+S
Sbjct  93   DCLELYEHTILKLNKTLDSNTRCTQADAQTWLSTALTNLQTCQDGFIDLGVSDYVLPLMS  152

Query  407  HGRHASQNLTLSL-KQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIV  583
            +      + TLS+ K   A  S K    T  K   +K         L   SS +S+ANIV
Sbjct  153  NNVSKLISNTLSINKVPYAEPSYKGGYPTWVKPGDRK---------LLQSSSLASQANIV  203

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            V++DGSG+Y +I  A++A S+    G GR V+YVKAG Y+E V+I  G+KN+ML+GDG+ 
Sbjct  204  VSKDGSGDYTTIGAAITAASK--RSGSGRYVIYVKAGTYSENVQIGSGLKNIMLLGDGIG  261

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +TI+TG+++V  GSTTF SAT  V GDGF AR
Sbjct  262  KTIVTGSKSVGGGSTTFNSATVAVVGDGFIAR  293



>ref|XP_002265740.2| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=512

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 124/212 (58%), Gaps = 21/212 (10%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKG-------LVS  406
            DC  LY     +L + LD   +    DA TWLS A+++ ++C DG  + G       L+S
Sbjct  93   DCLELYEHTILKLNKTLDSNTRCTQADAQTWLSTALTNLQTCQDGFIDLGVSDYVLPLMS  152

Query  407  HGRHASQNLTLSL-KQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIV  583
            +      + TLS+ K   A  S K    T  K   +K         L   SS +S+ANIV
Sbjct  153  NNVSKLISNTLSINKVPYAEPSYKGGYPTWVKPGDRK---------LLQSSSLASQANIV  203

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            V++DGSG+Y +I  A++A S+    G GR V+YVKAG Y+E V+I  G+KN+ML+GDG+ 
Sbjct  204  VSKDGSGDYTTIGAAITAASK--RSGSGRYVIYVKAGTYSENVQIGSGLKNIMLLGDGIG  261

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +TI+TG+++V  GSTTF SAT  V GDGF AR
Sbjct  262  KTIVTGSKSVGGGSTTFNSATVAVVGDGFIAR  293



>ref|XP_002264156.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 123/212 (58%), Gaps = 21/212 (10%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-AS  424
            DC  LY     +L + LD   +    DA TWLS A+++ ++C DG  E G+  H     S
Sbjct  94   DCVELYDHTILKLNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDGFIELGVSDHFLPLIS  153

Query  425  QNL------TLSL-KQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIV  583
             N+      TLS+ K   A  S K    T  K   +K         L   SS +S+ANIV
Sbjct  154  NNVSKLISNTLSINKVPYAEPSYKGGYPTWVKPGDRK---------LLQSSSLASQANIV  204

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            V++DGSG+Y +I  A++A S+    G GR V+YVKAG Y+E V+I  G+KN+ L+GDG+ 
Sbjct  205  VSKDGSGDYTTIGAAITAASK--RSGSGRYVIYVKAGTYSENVQIGSGLKNITLLGDGIG  262

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +TI+TG+R+V  GSTT+ SAT  V GDGF AR
Sbjct  263  KTIVTGSRSVGGGSTTYNSATVAVVGDGFIAR  294



>ref|XP_010325628.1| PREDICTED: pectinesterase 2 [Solanum lycopersicum]
Length=524

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/213 (41%), Positives = 127/213 (60%), Gaps = 12/213 (6%)
 Frame = +2

Query  251  SDCATLYADAEERL-ARLDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSH--GRH  418
            +DC  LY ++  ++ + +D   K    DA TWLS A+++  +C  G  E G+  +     
Sbjct  99   ADCIELYENSINKIKSTVDPNTKCSATDAQTWLSTALTNLETCKAGFEELGVTDYVMPLM  158

Query  419  ASQNLTLSLKQALAR---FSQKRNVKTTRKVVHKKPsssdg---gglldswssassKANI  580
            ++ N++  +  ALA    +  +    +T   V   P+         L  S SS +S+AN+
Sbjct  159  SNNNVSSLISNALALNHGYYTEPTKSSTSTQVDGFPTWVSPGDRKLLQSSSSSTASQANV  218

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVA DGSG++K++ EAV A ++  N G GR V+YVKAG YNE VEI   +KNVML+GDG+
Sbjct  219  VVATDGSGDFKTVKEAVDAAAK--NKGSGRFVIYVKAGTYNENVEIGEKVKNVMLIGDGI  276

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             +TIITG+++V  GSTTF SAT   SGDGF A+
Sbjct  277  GKTIITGSKSVGGGSTTFRSATVGASGDGFIAQ  309



>ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 92/213 (43%), Positives = 119/213 (56%), Gaps = 21/213 (10%)
 Frame = +2

Query  251  SDCATLYADAEERLAR-LDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKG-------LV  403
            SDC  LY     RL + +D   K    D+ TWLS A+++  +C  G  E G       L+
Sbjct  93   SDCLKLYEYTILRLNKTVDPNTKCSQVDSQTWLSTALTNLETCRAGFVELGVSDYLLPLM  152

Query  404  SHGRHASQNLTLSL-KQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANI  580
            S+      + TLSL K      S K    T  K   +K         L   SS +S+ANI
Sbjct  153  SNNVSKLISNTLSLNKVPYTEPSYKEGFPTWVKPGDRK---------LLQSSSPASQANI  203

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVA+DGSG+Y +I  AVSA S+    G GR V+YVKAG YNE +EI   +KN+ML+GDG+
Sbjct  204  VVAKDGSGDYTTITAAVSAASK--RSGTGRYVIYVKAGTYNENIEIGAKLKNIMLLGDGI  261

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             +TIITG+++V  GSTTF SAT    GDGF  R
Sbjct  262  GKTIITGSKSVGGGSTTFNSATVAAVGDGFIGR  294



>sp|P83947.1|PME1_FICPW RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: 
RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin 
methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; 
Short=PE; AltName: Full=Pectin methylesterase; Flags: 
Precursor [Ficus pumila var. awkeotsang]
Length=545

 Score =   125 bits (315),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 118/217 (54%), Gaps = 20/217 (9%)
 Frame = +2

Query  254  DCATLYADAEER-------LARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNE------K  394
            DCA L   ++ER       L   ++    H+D   WLS  +++H +CLDGL E      K
Sbjct  112  DCAELMDLSKERVVDSISILFHQNLTTRSHEDLHVWLSGVLTNHVTCLDGLEEGSTDYIK  171

Query  395  GLV-SHGRHASQNLTLSLKQALARFSQKRNVKTTRKVVHKKPs-ssdggglldswssass  568
             L+ SH          SL   +  F  K NV     V    P+  + G   L        
Sbjct  172  TLMESHLNELILRARTSLAIFVTLFPAKSNV--IEPVTGNFPTWVTAGDRRLLQTLGKDI  229

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLV  748
            + +IVVA+DGSG+Y+++NEAV+A+    +  + RV+V V+ G+Y E V+     KNVMLV
Sbjct  230  EPDIVVAKDGSGDYETLNEAVAAIP---DNSKKRVIVLVRTGIYEENVDFGYQKKNVMLV  286

Query  749  GDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            G+GMD TIITG+RNV DGSTTF SAT    GDGF A+
Sbjct  287  GEGMDYTIITGSRNVVDGSTTFDSATVAAVGDGFIAQ  323



>emb|CBI24285.3| unnamed protein product [Vitis vinifera]
Length=444

 Score =   125 bits (313),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 123/212 (58%), Gaps = 21/212 (10%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-AS  424
            DC  LY     +L + LD   +    DA TWLS A+++ ++C DG  E G+  H     S
Sbjct  25   DCVELYDHTILKLNKTLDPNTRCTQVDAQTWLSTALTNLQTCQDGFIELGVSDHFLPLIS  84

Query  425  QNL------TLSL-KQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIV  583
             N+      TLS+ K   A  S K    T  K   +K         L   SS +S+ANIV
Sbjct  85   NNVSKLISNTLSINKVPYAEPSYKGGYPTWVKPGDRK---------LLQSSSLASQANIV  135

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            V++DGSG+Y +I  A++A S+    G GR V+YVKAG Y+E V+I  G+KN+ L+GDG+ 
Sbjct  136  VSKDGSGDYTTIGAAITAASK--RSGSGRYVIYVKAGTYSENVQIGSGLKNITLLGDGIG  193

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +TI+TG+R+V  GSTT+ SAT  V GDGF AR
Sbjct  194  KTIVTGSRSVGGGSTTYNSATVAVVGDGFIAR  225



>ref|XP_008221458.1| PREDICTED: pectinesterase [Prunus mume]
Length=520

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 86/225 (38%), Positives = 127/225 (56%), Gaps = 26/225 (12%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGL-NEKGLVSHGRHASQ  427
            +DC  L+ D  +++    I   +  DA TWLSA++++ ++C +G  N K   S+ +    
Sbjct  80   NDCLELHEDTVDKI-NCSIRSNNALDANTWLSASIANQQTCQNGFTNLKIPDSYLQSFPN  138

Query  428  NLTL-----------------SLKQALARFSQ----KRNVKTTRKVVHKKPsssdgggll  544
             +TL                 S   +   FS+    KR++  +          S     L
Sbjct  139  YVTLTSNLSKLLSNSLSLHKASTSPSALHFSKQVRGKRHLLLSESDDGFPEWVSFADRKL  198

Query  545  dswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIER  724
               +   +KA+I+VAQDGSGNYK+I+EAV+ L    +G   R V++VKAGVY E VEI++
Sbjct  199  LHSTGGGAKADILVAQDGSGNYKTISEAVANLR---SGSTERFVIHVKAGVYKENVEIKK  255

Query  725  GIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             +KN+M +GDG+D TI+TGNRN QDGSTT+ SATF V G+GF A+
Sbjct  256  TMKNIMFIGDGIDATIVTGNRNSQDGSTTYSSATFGVQGEGFIAQ  300



>emb|CAN76835.1| hypothetical protein VITISV_043176 [Vitis vinifera]
Length=497

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 89/212 (42%), Positives = 124/212 (58%), Gaps = 21/212 (10%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKG-------LVS  406
            DC  LY     +L + LD   +    DA TWLS A+++ ++C DG  + G       L+S
Sbjct  78   DCLELYEHTILKLNKTLDSNTRCTQADAQTWLSTALTNLQTCQDGFIDLGVSDYVLPLMS  137

Query  407  HGRHASQNLTLSL-KQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIV  583
            +      + TLS+ K   A  S K    T  K   +K         L   SS +S+ANIV
Sbjct  138  NNVSKLISNTLSINKVPYAEPSYKGGYPTWVKPGDRK---------LLQSSSLASQANIV  188

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            V++DGSG+Y +I  A++A S+    G GR V+YVKAG Y+E V+I  G+KN+ML+GDG+ 
Sbjct  189  VSKDGSGDYTTIGAAITAASK--RSGSGRYVIYVKAGTYSENVQIGSGLKNIMLLGDGIG  246

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +TI+TG+++V  GSTTF SAT  V GDGF AR
Sbjct  247  KTIVTGSKSVGGGSTTFNSATVAVVGDGFIAR  278



>ref|XP_006449081.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
 gb|ESR62321.1| hypothetical protein CICLE_v10014787mg [Citrus clementina]
Length=556

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 149/279 (53%), Gaps = 48/279 (17%)
 Frame = +2

Query  104  NALTASNQ-DLLAIRTARSN--VLRALEWSQSL-HELHEPSRESGnnaaaaaVSDCATLY  271
            NA T  N+ DLL I   +S   +   +E +  + H ++ P  ++        ++DC  L 
Sbjct  79   NATTKMNEVDLLLIFLNKSTSYIQETIEVANHVKHRINSPRGQAA-------LTDCVELL  131

Query  272  ADAEER----LARLDIEKYD-HDDAVTWLSAAMSSHRSCLDGLN-------EKGLVSHGR  415
              + +R    +A L   +   ++DA  WLS  +++H +CLDGL+       E  LV    
Sbjct  132  ELSVDRITDSMAALKKRRTSSNEDAHAWLSGVLTNHVTCLDGLDGSATKLMEPRLVELMA  191

Query  416  HASQNLTLSL------KQALARFSQKRNVK-----TTRKVVHKKPsssdggglldswssa  562
             A+ +L + +         + ++  ++ ++     T+R  +  +PS ++           
Sbjct  192  RAANSLAILVAISPYNTNVIQQYYLRKEIQFPSWVTSRDRLLLRPSQAEAA---------  242

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVM  742
              KAN+VVA+DGSGNYK++ EAV++     +  + R V+YVK G Y E VE+ +  KN+M
Sbjct  243  --KANVVVAKDGSGNYKTVKEAVASAP---DNSKTRYVIYVKKGTYKENVEVGKKKKNLM  297

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +VGDGMD TIITG+ NV DGSTTF SAT  V GDGF A+
Sbjct  298  IVGDGMDLTIITGSLNVVDGSTTFKSATIAVGGDGFIAQ  336



>emb|CDO99718.1| unnamed protein product [Coffea canephora]
Length=548

 Score =   125 bits (314),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/262 (34%), Positives = 138/262 (53%), Gaps = 27/262 (10%)
 Frame = +2

Query  116  ASNQDLLAIRTARSN--VLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEER  289
            +S+ DLL +  A+S+  +   ++ +++++      RE         ++DC  L   + +R
Sbjct  80   SSDVDLLQMILAKSSAQIQETIKLTENINRRINDQREQAA------LADCLELMDMSVDR  133

Query  290  LARLDI-----EKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQA  454
            L    +           DA +WL + +++H +CLDGLN     S      ++L L  + +
Sbjct  134  LMDSMVALGSQTAQSQSDAHSWLGSVLTNHVTCLDGLNGPAR-SVVEPMMKDLILKARTS  192

Query  455  LARFSQKRNVKTTRKVVHKKPs-------ssdggglldswssassKANIVVAQDGSGNYK  613
            LA       +   ++ + ++P         +     L        KAN VVA+DGSGNYK
Sbjct  193  LAMVVA---IAPPKEEMIEQPLNGDLPSWVTSKDRRLLEALPKDVKANSVVAKDGSGNYK  249

Query  614  SINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNV  793
            ++ EAV+A     N  + R V+YVKAG Y E+V+I +  KN+MLVGDGMD+TIITG+ NV
Sbjct  250  TVQEAVNAAP---NNAQSRYVIYVKAGTYKEKVDIGKNKKNLMLVGDGMDKTIITGSLNV  306

Query  794  QDGSTTFGSATFRVSGDGFWAR  859
             DGSTTF SAT     DGF A+
Sbjct  307  VDGSTTFNSATVAAVADGFIAQ  328



>gb|KDO65446.1| hypothetical protein CISIN_1g010103mg [Citrus sinensis]
Length=518

 Score =   125 bits (313),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 114/206 (55%), Gaps = 9/206 (4%)
 Frame = +2

Query  251  SDCATLYADAEERLAR-LDIEKYDHD-DAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-A  421
            +DC  LY D   +L   LD      D DA TWLS A+++  +C  G  E G+  +     
Sbjct  99   ADCLKLYQDTINQLNHTLDSNTKCTDFDAQTWLSTALTNLETCRAGFVELGVPDYVLPLM  158

Query  422  SQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGS  601
            S N+T  +   LA     RN  T  +       S    G      ++  + N+VVAQDGS
Sbjct  159  SNNVTKLISNTLAL----RNASTVPETYKGGFPSWVKPGDRKLLQTSPVRPNLVVAQDGS  214

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            GNY++I  A+ A ++    G GR V++VK GVY E +EI   +KN+MLVGDG+  TIITG
Sbjct  215  GNYRTIKAALDAAAK--RTGSGRFVIHVKRGVYKENLEIGNKMKNIMLVGDGLRYTIITG  272

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            +R+V  G TTF SAT  V+GDGF AR
Sbjct  273  SRSVGGGFTTFNSATVAVTGDGFIAR  298



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 114/206 (55%), Gaps = 9/206 (4%)
 Frame = +2

Query  251  SDCATLYADAEERLAR-LDIEKYDHD-DAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-A  421
            +DC  LY D   +L   LD      D DA TWLS A+++  +C  G  E G+  +     
Sbjct  99   ADCLKLYQDTINQLNHTLDSNTKCTDFDAQTWLSTALTNLETCRAGFVELGVPDYVLPLM  158

Query  422  SQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGS  601
            S N+T  +   LA     RN  T  +       S    G      ++  + N+VVAQDGS
Sbjct  159  SNNVTKLISNTLAL----RNASTVPETYKGGFPSWVKPGDRKLLQTSPVRPNLVVAQDGS  214

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            GNY++I  A+ A ++    G GR V++VK GVY E +EI   +KN+MLVGDG+  TIITG
Sbjct  215  GNYRTIKAALDAAAK--RTGSGRFVIHVKRGVYKENLEIGNKMKNIMLVGDGLRYTIITG  272

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            +R+V  G TTF SAT  V+GDGF AR
Sbjct  273  SRSVGGGFTTFNSATVAVTGDGFIAR  298



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score =   124 bits (312),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 114/206 (55%), Gaps = 9/206 (4%)
 Frame = +2

Query  251  SDCATLYADAEERLAR-LDIEKYDHD-DAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-A  421
            +DC  LY D   +L   LD      D DA TWLS A+++  +C  G  E G+  +     
Sbjct  99   ADCLKLYQDTINQLNHTLDSNTKCTDFDAQTWLSTALTNLETCRAGFVELGVPDYVLPLM  158

Query  422  SQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGS  601
            S N+T  +   LA     RN  T  +       S    G      ++  + N+VVAQDGS
Sbjct  159  SNNVTKLISNTLAL----RNASTVPETYKGGFPSWVKPGDRKLLQTSPVRPNLVVAQDGS  214

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            GNY++I  A+ A ++    G GR V++VK GVY E +EI   +KN+MLVGDG+  TIITG
Sbjct  215  GNYRTIKAALDAAAK--RTGSGRFVIHVKRGVYKENLEIGNKMKNIMLVGDGLRYTIITG  272

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            +R+V  G TTF SAT  V+GDGF AR
Sbjct  273  SRSVGGGFTTFNSATVAVTGDGFIAR  298



>emb|CDY04739.1| BnaC05g18500D [Brassica napus]
Length=529

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 125/219 (57%), Gaps = 19/219 (9%)
 Frame = +2

Query  254  DCATLYADAEERL----ARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVS-----  406
            DC  LY D  ++L       D+    HD   T LSAA+++  +C +G  +  L S     
Sbjct  102  DCLELYEDTIDQLNHSRKSYDLNFSAHDRQ-TSLSAAIANQDTCKNGFKDFNLTSSYSKY  160

Query  407  HGRHASQNLTLSLKQALARFSQKRNVKTTRKVVH-------KKPs-ssdggglldswssa  562
               H  +NLT S+  +LA           +           + PS        L   S  
Sbjct  161  FPIHVHRNLTKSISNSLAVSKAAAEAVAEKHPATALMFWDTQFPSWIPLTDRKLLEGSVT  220

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVM  742
            ++K ++VVA+DGSG+Y SI +A++A +++    + R+VVYVKAGVY E VEI++ +KNVM
Sbjct  221  TAKPDLVVAKDGSGHYTSIQQAINAAAKLPRRNK-RLVVYVKAGVYRENVEIKKSVKNVM  279

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            ++GDG+D T++TG+RNV+DG+TTF SATF V+G GF AR
Sbjct  280  VIGDGIDSTVVTGSRNVKDGTTTFRSATFAVAGSGFIAR  318



>ref|XP_002317208.1| pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE97820.1| pectin methylesterase family protein [Populus trichocarpa]
Length=549

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 87/238 (37%), Positives = 123/238 (52%), Gaps = 19/238 (8%)
 Frame = +2

Query  173  LEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERL-----ARLDIEKYDHDDAVT  337
            +E ++ +H     +RE         + DC  L   ++ R+     A   +    H +A+T
Sbjct  102  IEKAEVIHSRINDAREQAA------LGDCVELMEISKYRIKDTIVALERVTSKSHANALT  155

Query  338  WLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVVHKK-  514
            WLS+ +++H +CLDGLN     S       +L L  + +LA  +     K    +   K 
Sbjct  156  WLSSVLTNHDTCLDGLNGPAR-STMEPDLNDLILRARTSLAILAAISPSKENNDIFSLKE  214

Query  515  --Ps-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYV  685
              PS        L         A++ VA+DGSG YK++ EAV++     + G+ R V+YV
Sbjct  215  DFPSWLPSMDRKLLVALPKDINADVTVAKDGSGKYKTVKEAVASAP---DNGKTRYVIYV  271

Query  686  KAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            K G Y E VE+ +  KNVMLVGDGMD TIITG+ NV DGSTTF SAT    GDGF A+
Sbjct  272  KKGTYKENVEVGKKKKNVMLVGDGMDSTIITGSLNVVDGSTTFNSATVAAVGDGFIAQ  329



>ref|XP_008232606.1| PREDICTED: pectinesterase 2 [Prunus mume]
Length=511

 Score =   124 bits (312),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 120/210 (57%), Gaps = 19/210 (9%)
 Frame = +2

Query  254  DCATLYADAEERLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKG------LVSH  409
            DC  L+    ++L +    I K   DD+ TWLS A+++  +C +G  + G        S 
Sbjct  96   DCHELFDFTIQKLNKTVNPITKCTQDDSQTWLSTALTNLETCREGFADLGVSNNYIFPSM  155

Query  410  GRHASQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVA  589
              + S  ++ +L    A F+ + N K       K        G      S+S+KA++VVA
Sbjct  156  SNNVSNLISNTLAINKAPFTSQPNYKNGFPTWVKP-------GDRKLLQSSSAKADVVVA  208

Query  590  QDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRT  769
            +DGSGNYK+I+EAVSA S+    G  R V+YVKAG Y E V+I+   KN+ML GDG+ +T
Sbjct  209  KDGSGNYKTISEAVSAASK--RKGSARYVIYVKAGTYKENVQIKS--KNIMLRGDGIGKT  264

Query  770  IITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            IITG+++V  GSTTF SAT  V GDGF A+
Sbjct  265  IITGSKSVGGGSTTFNSATVAVVGDGFIAQ  294



>ref|XP_003622699.1| Pectinesterase [Medicago truncatula]
 gb|ABD33414.1| Pectinesterase; Pectinesterase inhibitor [Medicago truncatula]
 gb|AES78917.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=555

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 88/221 (40%), Positives = 120/221 (54%), Gaps = 27/221 (12%)
 Frame = +2

Query  248  VSDCATLYADAEERL--ARLDIEKYDHD---DAVTWLSAAMSSHRSCLDGL---------  385
            +SDC  L   +  R+    L + K + D   DA TWLS+ +++H +CLDGL         
Sbjct  123  LSDCEQLMDLSMNRIWDTMLKLTKNNIDSQQDAHTWLSSVLTNHATCLDGLEGSSRVVME  182

Query  386  -NEKGLVSHGRHASQNLTLSLKQALARFSQK-RNVKTTRKVVHKKPs-ssdggglldsws  556
             + + L+S  R        SL   L  F QK R+      ++ + PS  +     L   +
Sbjct  183  NDLQDLISRARS-------SLAVFLVVFPQKDRDQFIDETLIGEFPSWVTSKDRRLLETA  235

Query  557  sassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKN  736
                KAN+VVAQDGSG +K++ EAV++     + G+ + V+YVK G Y E VEI     N
Sbjct  236  VGDIKANVVVAQDGSGKFKTVAEAVASAP---DNGKTKYVIYVKKGTYKENVEIGSKKTN  292

Query  737  VMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            VMLVGDGMD TIITGN N  DG+TTF S+T    GDGF A+
Sbjct  293  VMLVGDGMDATIITGNLNFIDGTTTFKSSTVAAVGDGFIAQ  333



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   124 bits (312),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 125/218 (57%), Gaps = 20/218 (9%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEK--YDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSH-----  409
            +DC  LYAD   +L R    K      DA TWLSAA+++ ++C +G  E  L S+     
Sbjct  98   ADCVELYADTVTQLNRTMGSKNPLSWSDAQTWLSAAITNEQTCQNGFTELNLPSYLSSFP  157

Query  410  ------GRHASQNLTLSLKQALARFSQKRNVKTTRKVVHK--KPsssdggglldswssas  565
                   +  S +L ++   A +  S        R+++        S     L   SSA+
Sbjct  158  FMLSNFSKMVSNSLAINKAAASSVASLMGKQGGNRRLLSDGFPTWVSAADRKLLQSSSAA  217

Query  566  sKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVML  745
            S+A++VVA DGSGNY++I++AV+A S+       R V+YVK GVY E VEI+    N+ML
Sbjct  218  SQADVVVAADGSGNYRTISQAVAASSKRSGK---RFVIYVKRGVYKENVEIKA--SNIML  272

Query  746  VGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +GDG+D TI+TG++NVQDGSTTF SAT  V+G GF AR
Sbjct  273  IGDGIDATIVTGSKNVQDGSTTFRSATVAVTGGGFIAR  310



>ref|XP_010098938.1| Pectinesterase 2 [Morus notabilis]
 gb|EXB76240.1| Pectinesterase 2 [Morus notabilis]
Length=518

 Score =   124 bits (311),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 89/208 (43%), Positives = 122/208 (59%), Gaps = 14/208 (7%)
 Frame = +2

Query  251  SDCATLYADAEERLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-A  421
            +DC  LY     RL +      K   DD  TWLS A+++  +C  GL E G+  +     
Sbjct  105  ADCLELYESTVLRLNKTSKPTSKCTQDDLQTWLSTALTNLETCRAGLLELGVSDYLLPLM  164

Query  422  SQNLTLSLKQALARFSQKRNVKTTRKVVHKKPs--ssdggglldswssassKANIVVAQD  595
            S N++  +  +LA    K   K   K  +  P+        LL S SS +S+AN+VVA+D
Sbjct  165  SNNVSKLISNSLAI--NKSPYKPDNKYNNGFPTWVKPGDRRLLQSSSSPASRANVVVAKD  222

Query  596  GSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTII  775
            GSG+Y ++  AV+A+      G GR V+YVKAG YNE VEI+  +KNVML+GDG+ +TII
Sbjct  223  GSGDYTTVKAAVTAVK-----GSGRFVIYVKAGTYNENVEIK--VKNVMLLGDGIGKTII  275

Query  776  TGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TG+++V  GSTTF SAT  V GDGF A+
Sbjct  276  TGSKSVGGGSTTFQSATVAVVGDGFIAQ  303



>ref|XP_002890570.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66829.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=552

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 95/257 (37%), Positives = 139/257 (54%), Gaps = 44/257 (17%)
 Frame = +2

Query  194  HELHEPSRESGnnaaaaaVSDCATLYADAEERL--ARLDIEKYDHD-DAVTWLSAAMSSH  364
            H LH+ +R +        + DC  LY D  ++L  +R    +Y    D  T LSAA+++ 
Sbjct  94   HSLHKHARSA--------LFDCLELYEDTIDQLNHSRRSYGQYSSPHDRQTALSAAIANQ  145

Query  365  RSCLDGLNEKGLVS-HGRHAS----QNLTLSLKQAL-------------------ARFSQ  472
             +C +G  +  L S + ++      +NLT SL  +L                    +FS+
Sbjct  146  DTCRNGFKDFNLTSSYSKYFPVQIHRNLTKSLSNSLAVTKAAAEAVAEKYPSTGFTKFSK  205

Query  473  KRNVKTTRKVVH-------KKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEA  628
            +R+                K PS        L   S  + KA++VVA+DGSG+Y SI +A
Sbjct  206  QRSSGGGGGRRRLLMFSDDKFPSWFPLSDRKLLEDSETTVKADLVVAKDGSGHYTSIQQA  265

Query  629  VSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGST  808
            V+A +++      R+V+YVKAGVY E V I++ IKNVM++GDG+D TI+TGN+NV+DG+T
Sbjct  266  VNAAAKLPRRNT-RLVIYVKAGVYKENVVIKKSIKNVMVIGDGIDSTIVTGNKNVKDGTT  324

Query  809  TFGSATFRVSGDGFWAR  859
            TF SATF VSG GF AR
Sbjct  325  TFRSATFAVSGSGFIAR  341



>ref|XP_006843574.1| hypothetical protein AMTR_s00007p00101250 [Amborella trichopoda]
 gb|ERN05249.1| hypothetical protein AMTR_s00007p00101250 [Amborella trichopoda]
Length=553

 Score =   124 bits (312),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 85/226 (38%), Positives = 123/226 (54%), Gaps = 27/226 (12%)
 Frame = +2

Query  251  SDCATLYADAEERL-----ARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGR  415
            +DC  L   A +RL     A          +A TWLSA ++++ +C DGLNE G      
Sbjct  112  ADCTELLDQARDRLLETRAALRTPSPLSLAEAHTWLSATLTNYITCEDGLNE-GKTKLEA  170

Query  416  HASQNLTLSLKQ-------ALARFSQKRNVKTTRKVVHKKPsssdgggllds--------  550
             A++ + ++L +       +LA  S  RN   + +    +P    G   L +        
Sbjct  171  KATKAMVVALGECKAMASTSLATISAMRNALGSTEASGYEPMIEVGSTRLPAWVRDIETR  230

Query  551  ---wssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIE  721
                  +  KA++VVA+DGSGNYK+++EAV+A     +  + R V+YVK G Y E+VEI 
Sbjct  231  LLESKVSEIKADVVVAKDGSGNYKTVSEAVAAAP---DKSKKRYVIYVKKGTYEEKVEIG  287

Query  722  RGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +  KN+MLVGDGMD T+ITG+ N  DG+TTF SAT  V G+GF A+
Sbjct  288  KNKKNLMLVGDGMDFTVITGSLNFIDGTTTFNSATLAVVGEGFIAQ  333



>emb|CDO97716.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 124/214 (58%), Gaps = 23/214 (11%)
 Frame = +2

Query  251  SDCATLYADAEERLAR-LDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHAS  424
            SDC TLY D   +L + +D   K+  +D  TWLSAA ++  +C  G  + G       AS
Sbjct  95   SDCVTLYEDIPLKLNKTVDPSGKFTSEDVQTWLSAASTNLETCKQGFVDLG-------AS  147

Query  425  QNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggg--------lldswssassKANI  580
             N   SL   +   +   N   T K  +    + DG           L   S+ +++ANI
Sbjct  148  DNAMPSLYDGVLG-NLISNALATNKGYYGGAGNKDGFPGWVSPGDRKLLQSSAQAAQANI  206

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVAQDGSGNY+++N+AV+A S+    G GR V+YVKAG Y+E V I  G KN+MLVGDG+
Sbjct  207  VVAQDGSGNYRTVNDAVAAASK--RSGNGRFVIYVKAGTYSETVSI--GSKNIMLVGDGI  262

Query  761  DRTIITGNRNV-QDGSTTFGSATFRVSGDGFWAR  859
             +TIITG ++V   GSTT+ SAT  ++GDGF AR
Sbjct  263  GKTIITGRKSVGGGGSTTYSSATVGITGDGFLAR  296



>ref|XP_004296684.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 35-like 
[Fragaria vesca subsp. vesca]
Length=579

 Score =   124 bits (312),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 83/223 (37%), Positives = 117/223 (52%), Gaps = 19/223 (9%)
 Frame = +2

Query  248  VSDCATLYADAEERLARLDI----EKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGR  415
            VSDC  L  DA + L  +      + ++ DD  TWLSAA+++  +CL+ L +    +   
Sbjct  134  VSDCLELLDDAVDMLDNVMTTSLSKPHNDDDVHTWLSAALTNQETCLESLEKDKFKTDKS  193

Query  416  ---HASQNLTLSLKQALARF--------SQKRNVKTTRKVVHKKPsssdggglldswssa  562
                 +QNL+  +  +LA F         + +N    RK++            L   S  
Sbjct  194  IMDATAQNLSQYISNSLALFMLTMGSKSKEAKNANPNRKLLSFPTWVPAAERKLLEASVE  253

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGN----GGEGRVVVYVKAGVYNERVEIERGI  730
              +A+ VVAQDGSG +KSI EA+  L   G+    G  GR V++V AG Y+E + I    
Sbjct  254  EIEADAVVAQDGSGTHKSIGEALKGLLLTGSLESSGTGGRSVIHVTAGTYHEYINIPTKQ  313

Query  731  KNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            KNVML+GDG+ +TII GNRN  DG TT+ +AT    GDGF AR
Sbjct  314  KNVMLIGDGVGKTIIVGNRNSDDGWTTYKTATVAAMGDGFIAR  356



>ref|XP_003564371.1| PREDICTED: pectinesterase [Brachypodium distachyon]
Length=549

 Score =   124 bits (312),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 122/210 (58%), Gaps = 13/210 (6%)
 Frame = +2

Query  248  VSDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNE-----KGLVSHG  412
            ++DC  L   A +RLA   + +++ DDA TWLSA ++ H +CLDGL++     + +V   
Sbjct  121  LADCILLLELARDRLADAAVARHE-DDARTWLSAVLTDHVTCLDGLDDDDQPLRDVVGAH  179

Query  413  RHASQNLTLSLKQALARFS--QKRNVKTTRKVVHKKPs--ssdggglldswssassKANI  580
                ++L  +    L   S    R+V    + V   PS   +    LL+     + +A++
Sbjct  180  LEPLKSLASASLAVLNTVSSDDARDVLQLAEAVDGFPSWVPTRDRALLEGGGERAVEADV  239

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVA+DGSG YK++ EAV A     N G  R V+ VK GVY E VE+ R  + +M+VGDGM
Sbjct  240  VVAKDGSGRYKTVKEAVDAAPE--NKGR-RYVIRVKKGVYKENVEVGRKKRELMIVGDGM  296

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGF  850
            D T+ITG+RNV DG+TTF SAT  V+GDG 
Sbjct  297  DATVITGSRNVVDGATTFNSATLAVAGDGI  326



>ref|XP_010477609.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6 
[Camelina sativa]
Length=555

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/237 (38%), Positives = 137/237 (58%), Gaps = 36/237 (15%)
 Frame = +2

Query  254  DCATLYADAEERL--ARLDIEKYD-HDDAVTWLSAAMSSHRSCLDGLNEKGLVS-----H  409
            DC  LY D  ++L   R    +Y    D  T LSAA+++  +C +G  +  L+S      
Sbjct  109  DCLELYEDTIDQLNHTRSSYGQYSSMHDRQTSLSAAIANQDTCRNGFKDFKLISSYSKYF  168

Query  410  GRHASQNLTLSLKQALA-------------------RFSQKRNVKT---TRKVVH----K  511
              H  + LT SL  +LA                   +++++RN       R+++     +
Sbjct  169  PIHPHRILTKSLSNSLAVTKAAADAVAETYTSTGFTKYNKQRNSNGGGGHRRLLMFSDDE  228

Query  512  KPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVK  688
             PS        L   ++ ++KA++VVA+DGSG+Y SI +AV+A +++    + R+V+YVK
Sbjct  229  FPSWFPLSDRKLLEDTTTTTKADLVVAKDGSGHYISIQQAVNAAAKLPRRNK-RLVIYVK  287

Query  689  AGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            AGVY E V I++ IKNVM++GDG+D TI+TGN+NV+DG+TTF SATF VSG+GF AR
Sbjct  288  AGVYRENVVIKKSIKNVMVIGDGIDSTIVTGNKNVKDGTTTFRSATFAVSGEGFIAR  344



>ref|NP_001044480.1| Os01g0788400 [Oryza sativa Japonica Group]
 dbj|BAD53265.1| putative pectin esterase [Oryza sativa Japonica Group]
 dbj|BAF06394.1| Os01g0788400 [Oryza sativa Japonica Group]
 dbj|BAH00252.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE55512.1| hypothetical protein OsJ_03720 [Oryza sativa Japonica Group]
Length=546

 Score =   124 bits (311),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 85/207 (41%), Positives = 119/207 (57%), Gaps = 9/207 (4%)
 Frame = +2

Query  248  VSDCATLYADAEERLARL---DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLV-SHGR  415
            + DC  L   A +RLA          D DDA TWLSA ++ H +CLDGL++  L  S G 
Sbjct  119  LEDCVQLMGLARDRLADAAGAPDVDVDVDDARTWLSAVLTDHVTCLDGLDDGPLRDSVGA  178

Query  416  HASQNLTLSLKQALARFSQKRNVK-TTRKVVHKKPs-ssdggglldswssassKANIVVA  589
            H     +L+        +  R  +    + V + PS  +     L    + + +A++VVA
Sbjct  179  HLEPLKSLASASLAVLSAAGRGARDVLAEAVDRFPSWLTARDRTLLDAGAGAVQADVVVA  238

Query  590  QDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRT  769
            +DGSG Y +I EAV A     +GG+ R V+YVK GVY E +E+ +  + +M+VGDGMD+T
Sbjct  239  KDGSGKYTTIKEAVDAAP---DGGKSRYVIYVKKGVYKENLEVGKTKRVLMIVGDGMDQT  295

Query  770  IITGNRNVQDGSTTFGSATFRVSGDGF  850
            +ITG+RNV DGSTTF SAT  +SGDG 
Sbjct  296  VITGSRNVVDGSTTFNSATLALSGDGI  322



>gb|KEH29125.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=509

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 123/212 (58%), Gaps = 25/212 (12%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA-SQ  427
            +DC  LY    ++L++    K    ++ TWLS A+++  +C +G  + G+ ++     S 
Sbjct  97   ADCLELYDFTVQKLSQTKYTKCTQYESQTWLSTALTNLETCKNGFYDLGVTNYVLPLLSN  156

Query  428  NLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdgggl--------ldswssassKANIV  583
            N+T  L   L+            KV +++PS  DG           L   SSA+SKAN+V
Sbjct  157  NVTKLLSNTLSL----------NKVPYQQPSYKDGFPTWVKPGDRKLLQTSSAASKANVV  206

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            VA+DGSG Y ++  A  A       G GR V+YVKAGVYNE+VEI+   KNVMLVGDG+ 
Sbjct  207  VAKDGSGKYTTVKAATDA----APSGSGRYVIYVKAGVYNEQVEIKA--KNVMLVGDGIG  260

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +TIITG+++V  G+TTF SAT   +GDGF A+
Sbjct  261  KTIITGSKSVGGGTTTFRSATVAATGDGFIAQ  292



>ref|XP_010264200.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=516

 Score =   123 bits (309),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 84/206 (41%), Positives = 121/206 (59%), Gaps = 9/206 (4%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIEKYDHD-DAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-AS  424
            DC  LY +   RL R ++      D D  TWLS A+++  +C +G  E G+  +     S
Sbjct  97   DCLELYENTIIRLNRTVNPSASCTDVDFQTWLSTALTNLETCRNGFMELGVTDYVLPLMS  156

Query  425  QNLTLSLKQALARFSQKRNVKTTRKVVHKKPs-ssdggglldswssassKANIVVAQDGS  601
             N++  +  +LA     +   + +      PS    G   L   SS +S+AN+VVAQDGS
Sbjct  157  NNVSKLISNSLA---INKPPPSPQAYTEGFPSWVKPGDRKLLQTSSPTSQANLVVAQDGS  213

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            GN+K++NEA+SA S+      GR V+YVKAG Y E ++I   + N+ML+GDG+ +T+ITG
Sbjct  214  GNFKTVNEAISAASKQKR--SGRFVIYVKAGTYKENLQIGNKLNNIMLIGDGIGKTVITG  271

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            +++V  GSTTF SAT  V GDGF AR
Sbjct  272  SKSVGGGSTTFNSATVAVLGDGFIAR  297



>ref|XP_010266280.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 124/220 (56%), Gaps = 22/220 (10%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYD--HDDAVTWLSAAMSSHRSCLDGLNEKG---------  397
            +DC  LYAD   +L R    K      DA TWLSAA+++ ++C +G  E           
Sbjct  96   ADCVELYADTVSQLNRSMASKNPLIWSDAQTWLSAAITNEQTCRNGFIELSSSSQLSSFP  155

Query  398  --LVSHGRHASQNLTLS---LKQALARFSQKRNVKTTRKVVHKKPs-ssdggglldswss  559
              L +  +  S +L ++      + A    K+     R +    P+  S     L   S 
Sbjct  156  FMLTNLSKMVSNSLAINKAAASTSSASLFGKQGANNRRLLSDGFPTWVSAADRKLLQSSG  215

Query  560  assKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNV  739
            A+S+A++VVA DGSGNYK+I+EAV+A S+       R V+YVK GVY E VEI+    N+
Sbjct  216  AASQADVVVAADGSGNYKTISEAVAASSKRSGS---RFVIYVKRGVYKENVEIKA--SNI  270

Query  740  MLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            ML+GDG+D TI+TG+RNVQDGSTTF SAT  V+G GF AR
Sbjct  271  MLIGDGIDATIVTGSRNVQDGSTTFRSATVAVTGGGFIAR  310



>gb|KHG26245.1| Pectinesterase/pectinesterase inhibitor [Gossypium arboreum]
Length=477

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 128/232 (55%), Gaps = 23/232 (10%)
 Frame = +2

Query  194  HELHEPSRESGnnaaaaaVSDCATLYADAEERL--ARLDIEKYD---HDDAVTWLSAAMS  358
            H ++ P  ++        ++DC  L   + +R+  + + ++K D   + +A  WLS+ ++
Sbjct  39   HRINNPGEQAA-------LADCMELMESSMDRIMDSMVAVDKQDATSYSNAHAWLSSVLT  91

Query  359  SHRSCLDGL--NEKGLVSHGRHASQNLTLSLKQALARFSQ--KRNVKTTRKVVHKKPs-s  523
            +H +CLDGL  + + L+  G +   +L    + +LA F     R  K    ++   PS  
Sbjct  92   NHVTCLDGLEGSARTLMEPGLN---DLISRARTSLAIFVSFSPRKTKLIDPLIDGFPSWV  148

Query  524  sdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYN  703
            S     L        KAN+VVA+DGSG YK++ EAV+A     +  + R ++YVK G Y 
Sbjct  149  SSKDRKLLQSLPNEIKANVVVAKDGSGKYKTLGEAVAAAP---DKSKTRYIIYVKKGTYK  205

Query  704  ERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            E VEI +  KN+M+VGDGM  TIITG+ NV DGSTTF SAT    GDGF A+
Sbjct  206  ENVEIGKNKKNLMIVGDGMKSTIITGSLNVIDGSTTFRSATVAAVGDGFMAQ  257



>ref|XP_007038413.1| Pectinesterase [Theobroma cacao]
 gb|EOY22914.1| Pectinesterase [Theobroma cacao]
Length=516

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 118/205 (58%), Gaps = 7/205 (3%)
 Frame = +2

Query  251  SDCATLYADAEERLAR-LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-AS  424
            +DC  LY +   +L + LD  K    D  TWLS A+++  +C  G  E G+  +     S
Sbjct  97   ADCLKLYEETILQLNQTLDSTKCTDFDVQTWLSTALTNLETCRAGFVELGVSDYILPLMS  156

Query  425  QNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSG  604
             N++  +   LA  +    V  T K  H  P     G      SS+ +  N+VVAQDGSG
Sbjct  157  NNVSKLISNTLALNNNASFVPQTYK--HGFPRWLKAGDRKLLQSSSPT-PNLVVAQDGSG  213

Query  605  NYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGN  784
            N+++I EA+ A ++    G GR V++VK GVY E +EI   +KN+MLVGDG+  TIITG+
Sbjct  214  NHRTIKEALDAAAK--RSGSGRFVIHVKRGVYKENLEIGNKLKNIMLVGDGLRYTIITGS  271

Query  785  RNVQDGSTTFGSATFRVSGDGFWAR  859
            R+V  GSTTF SAT  V+G+GF AR
Sbjct  272  RSVGGGSTTFNSATVAVTGEGFIAR  296



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/205 (41%), Positives = 113/205 (55%), Gaps = 4/205 (2%)
 Frame = +2

Query  251  SDCATLYADAEERLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-A  421
            +DC  LY +   +L        +Y   D  TWLS A+++  +C  G  E G+        
Sbjct  103  ADCLQLYQNTVLQLNTTLNPYSRYTDVDVQTWLSTALTNLETCKTGFIELGVSDFMLPLM  162

Query  422  SQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGS  601
            S N++  +   LA  +     +            S G   L   SS +S+ANIVVAQDGS
Sbjct  163  SNNVSKLISNTLAINNNATTTQNQSYTGGYPSWVSAGDRKLLQSSSPASQANIVVAQDGS  222

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            GN+++I EA+SA S+    G GR V+YVK G Y E +EI   ++N+MLVGDGM  TIITG
Sbjct  223  GNFRTIKEALSAASQQ-RTGSGRFVIYVKKGAYIENLEIGSSLQNIMLVGDGMRNTIITG  281

Query  782  NRNVQDGSTTFGSATFRVSGDGFWA  856
            NR+V  GSTTF SAT  V+G GF A
Sbjct  282  NRSVGGGSTTFNSATVAVTGQGFIA  306



>ref|XP_009766156.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=525

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 117/206 (57%), Gaps = 5/206 (2%)
 Frame = +2

Query  251  SDCATLYADAEERL-ARLDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHAS  424
            +DC  LY     ++ + +D   K    DA +WLS A+++  +C  G  E G+  +     
Sbjct  103  ADCLELYEHTIHKIKSTVDPNTKCTAADAQSWLSTALTNLETCRAGFEELGVTDYVMPLM  162

Query  425  QNLTLSLKQALARFSQKRNVKTTRKVVHKKPs-ssdggglldswssassKANIVVAQDGS  601
             N   SL       +     + T   V   P+  + G   L   SS +S+ANIVVA+DGS
Sbjct  163  SNNVSSLISNTLSLNHGYYTEPTATQVDGFPTWVAPGDRKLLQSSSPASQANIVVAKDGS  222

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            GN+K++ EAV+A  +    G  R V+YVKAG+Y+E VE+   +KN+M VGDG+ +TIITG
Sbjct  223  GNFKTVKEAVAAAGK--RKGSARFVIYVKAGIYSENVELGSKLKNIMFVGDGIGKTIITG  280

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            +++V  GSTTF SAT  V GDGF  R
Sbjct  281  SKSVGGGSTTFKSATVAVVGDGFICR  306



>ref|XP_010498826.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6 
[Camelina sativa]
Length=547

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 136/235 (58%), Gaps = 34/235 (14%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDH-DDAVTWLSAAMSSHRSCLDGLNEKGLVS--------  406
            DC  LY D  ++L      +Y    D  T LSAA+++  +C +G  +  L+S        
Sbjct  103  DCLELYEDTIDQLNHTRSSQYSSMHDRKTSLSAAIANQDTCRNGFKDFKLISSYSKYFPI  162

Query  407  -HGRHASQNLTLSLKQ---------------ALARFSQKRNVKT---TRKVV----HKKP  517
             H R+ +++L+ SL                    + +++RN       R+++     + P
Sbjct  163  HHHRNLTKSLSNSLAVTKAAAEAVAEKYTSTGFTKNNKQRNSSGGGGHRRLLMSSDEEFP  222

Query  518  s-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAG  694
            S        L   ++ ++KA++VVA+DGSG+Y SI +AV+A +++    + R+V+YVKAG
Sbjct  223  SWFPLSDRKLLEDTTTTTKADLVVAKDGSGHYTSIQQAVNAAAKLSRRNK-RLVIYVKAG  281

Query  695  VYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            VY E V +++ IKNVM++GDG+D T++TGN+NV+DG+TTF SATF VSG+GF AR
Sbjct  282  VYRENVVVKKSIKNVMVIGDGIDSTVVTGNKNVKDGTTTFRSATFAVSGEGFIAR  336



>emb|CDY21422.1| BnaA09g30050D [Brassica napus]
Length=529

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 125/219 (57%), Gaps = 19/219 (9%)
 Frame = +2

Query  254  DCATLYADAEERLAR----LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVS-----  406
            DC  LY D  ++L       D     HD   T LSAA+++  +C +G  +  L S     
Sbjct  102  DCLELYEDTIDQLNHSRRSYDFNFSAHDRQ-TSLSAAIANQDTCKNGFKDFNLTSSYSKY  160

Query  407  HGRHASQNLTLSLKQALARFSQKRNVKTTRKVV-------HKKPs-ssdggglldswssa  562
               H  +NLT S+  +LA           +          ++ PS        L   S  
Sbjct  161  FPIHVHRNLTKSISNSLAVSKAAAEAVAEKHPGTALMFWDNQFPSWIPLTDRKLLEGSVT  220

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVM  742
            ++K ++VVA+DGSG+Y SI +A++A +++    + R+V+YVKAGVY E VEI++ +KNVM
Sbjct  221  TAKPDLVVAKDGSGHYTSIQQAINAAAKLPRRNK-RLVIYVKAGVYRENVEIKKSVKNVM  279

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            ++GDG+D T++TG+RNV+DG+TTF SATF V+G GF AR
Sbjct  280  VIGDGIDSTVVTGSRNVKDGTTTFRSATFAVAGSGFIAR  318



>ref|XP_009599511.1| PREDICTED: pectinesterase 2-like [Nicotiana tomentosiformis]
Length=522

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/210 (40%), Positives = 122/210 (58%), Gaps = 9/210 (4%)
 Frame = +2

Query  251  SDCATLYADAEERLAR-LDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA-  421
            +DC  LY +   ++ + +D   K   DD  TWLS A+++  +C  G  E G+  +     
Sbjct  96   ADCVELYQNIIVKINKTIDPSIKSTADDVQTWLSTALTNIETCRSGFIELGVTDYVMPIL  155

Query  422  SQNLTLSLKQALARFSQKRNVKTTRKVVHKK--P--sssdggglldswssassKANIVVA  589
              N+ +S   +   F  +    T     ++   P   S +   LL S S+  S+ANIVVA
Sbjct  156  MSNINVSYLISNTLFLNRGYYSTEPSTNYEDGFPNWVSPNDQTLLQSSSNLGSQANIVVA  215

Query  590  QDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRT  769
            +DGSGN+K++ EAV A ++    G GR V+YV  G+YNE VEI   +KN+MLVGDG+ +T
Sbjct  216  KDGSGNFKTVTEAVVAAAK--RTGSGRFVIYVNVGIYNENVEIGINLKNIMLVGDGIGKT  273

Query  770  IITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            IITG+++V  GSTTF SAT  V GDGF A+
Sbjct  274  IITGSKSVGGGSTTFKSATVAVDGDGFIAQ  303



>ref|XP_006347887.1| PREDICTED: pectinesterase 2-like [Solanum tuberosum]
Length=516

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 83/210 (40%), Positives = 119/210 (57%), Gaps = 13/210 (6%)
 Frame = +2

Query  251  SDCATLYADAEERL-ARLDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-A  421
            +DC  LY     ++ + +D   K    DA TWLS A+++  +C  G  E G+  +     
Sbjct  99   ADCVELYEHTINKIKSTVDPNTKCSATDAQTWLSTALTNLETCKAGFEELGVTDYVMPLM  158

Query  422  SQNLTLSLKQALA----RFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVA  589
            S N++  +  ALA     +++  N +         P          S +S   +AN+VVA
Sbjct  159  SNNVSSLISNALALNHGYYTESSNTQVDGFPTWVSPGDRKLLQSSSSPAS---QANVVVA  215

Query  590  QDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRT  769
             DGSG++K++ EAV A     N G GR V+YVKAG+Y+E VEI   +KNVML+GDG+ +T
Sbjct  216  TDGSGDFKTVKEAVDAAK---NKGSGRFVIYVKAGIYSENVEIGEKVKNVMLIGDGIGKT  272

Query  770  IITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            IITG+++V  GSTT  SAT  VSGDGF A+
Sbjct  273  IITGSKSVGGGSTTLRSATVGVSGDGFIAQ  302



>ref|XP_008343201.1| PREDICTED: pectinesterase 2 [Malus domestica]
Length=511

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 125/214 (58%), Gaps = 26/214 (12%)
 Frame = +2

Query  251  SDCATLYADAEERLAR-LD--IEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA  421
            +DC  LY    ++L + +D        +DA +WLS A+++  +CL G  +  + ++    
Sbjct  96   ADCLELYDYTIQKLNKSIDPVTNGATQNDAQSWLSTALTNLETCLAGFVDLAVSNNQLMP  155

Query  422  SQNL------TLSLKQA--LARFSQKRNVKTTRKVVHKKPsssdggglldswssassKAN  577
            S N+      TLS+ +    ++   K+   T  K   +K              S+S KA+
Sbjct  156  SNNVSNLISNTLSINKVPYTSQPEYKQGFPTWVKPGDRK-----------LLQSSSPKAD  204

Query  578  IVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDG  757
            IVVA+DGSGNYK+INEA+SA S+    G GR V+YVKAG Y E V+I+  + N+ML+GDG
Sbjct  205  IVVAKDGSGNYKTINEAISAASK--RKGSGRYVIYVKAGSYKENVQIK--LNNIMLLGDG  260

Query  758  MDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            + +TIITG+++V  G+TTF SAT  V GDGF A+
Sbjct  261  IGKTIITGSKSVGGGTTTFNSATVAVVGDGFIAQ  294



>ref|XP_008224789.1| PREDICTED: pectinesterase [Prunus mume]
Length=555

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 119/219 (54%), Gaps = 20/219 (9%)
 Frame = +2

Query  248  VSDCATLYADAEERLARLDIEKYDH------DDAVTWLSAAMSSHRSCLDGLNEKGLVSH  409
            ++DC  L   + +R+    I   +       +DA  WLS+ +++H +CLDGL  +G    
Sbjct  122  IADCVELMDVSIDRVMHSTIALQNFTLQNSLEDAHAWLSSILTNHVTCLDGL--QGPART  179

Query  410  GRHASQNLTLSLKQA-LARFSQKRNVKTTRKVVHKK-----Psssdgg---glldswssa  562
                  N  +S  +A LA      N+   +  +H+      PS         L D   + 
Sbjct  180  IMEPRLNDLISRSRASLAIMVAISNLSKLKAEIHEPLNGEFPSWVTSRDRRLLQDYNLAK  239

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVM  742
              KANIVVA+DGSGNYK++ EAV+A     N  + R ++YVK G Y E VE+ +  KN+M
Sbjct  240  EVKANIVVAKDGSGNYKTVKEAVAAAP---NNSKTRYIIYVKKGTYKENVEVGKNKKNLM  296

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +VGDGMD T+ITG+ NV DGSTTF SAT    GDGF A+
Sbjct  297  IVGDGMDNTVITGSLNVVDGSTTFKSATLAAVGDGFIAQ  335



>ref|XP_006348082.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Solanum 
tuberosum]
Length=486

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/217 (39%), Positives = 120/217 (55%), Gaps = 17/217 (8%)
 Frame = +2

Query  248  VSDCATLYADAEERLARL-----DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHG  412
            ++DC  L   + +RL        ++    H D  +WLS+ +++H +C+DGLN +   S  
Sbjct  54   LADCLELMDLSRDRLMDSMMGLGNLSAQAHFDVHSWLSSILTNHVTCIDGLNGQAR-SIM  112

Query  413  RHASQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdgggl--------ldswssass  568
                 +L    + +LA        K+T    +  P+ SDG           L   S+ + 
Sbjct  113  EPMLNDLIARARTSLALMVAIAPPKSTNNNNNLPPTVSDGLPSWVSANDRKLLQLSANAI  172

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLV  748
             AN+VVA+DGSG YK++ EAV++     + G+ R V+YVK G Y E VEI +  KN+ML+
Sbjct  173  AANVVVAKDGSGKYKTVKEAVASAP---DNGKTRFVIYVKKGTYKENVEIGKKKKNIMLM  229

Query  749  GDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GDGMD TIITGN NV DGSTTF SAT    GDGF A+
Sbjct  230  GDGMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQ  266



>ref|XP_009628696.1| PREDICTED: pectinesterase 2 [Nicotiana tomentosiformis]
Length=549

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 116/206 (56%), Gaps = 5/206 (2%)
 Frame = +2

Query  251  SDCATLYADAEERLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHAS  424
            +DC  LY +   ++        K    DA +WLS A+++  +C  G  E G+  +     
Sbjct  127  ADCLELYENTIHKIKSTVGPNTKCTAADAQSWLSTALTNLETCRAGFEELGVTDYVMPLM  186

Query  425  QNLTLSLKQALARFSQKRNVKTTRKVVHKKPs-ssdggglldswssassKANIVVAQDGS  601
             N   SL       +     + T   V   P+  + G   L   SS +S+ANIVVA+DGS
Sbjct  187  SNNVSSLISNTLSLNHGYYTEPTATQVDGFPTWVALGDRKLLQSSSPASQANIVVAKDGS  246

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            GN+K++ EAV+A  +    G  R V+YVKAG+Y+E V++   +KN+MLVGDG+ +TIITG
Sbjct  247  GNFKTVKEAVAAAGK--RKGSARFVIYVKAGIYSENVDLGSKLKNIMLVGDGIGKTIITG  304

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            +++V  GSTTF SAT  V GDGF  R
Sbjct  305  SKSVGGGSTTFKSATVAVVGDGFICR  330



>ref|XP_009771261.1| PREDICTED: pectinesterase-like [Nicotiana sylvestris]
Length=547

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 121/213 (57%), Gaps = 14/213 (7%)
 Frame = +2

Query  248  VSDCATLYADAEERLARL-----DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLV-SH  409
            ++DC  L   + +RL        ++    H D  TWLS+ +++H +C+DGL+  GL  + 
Sbjct  121  LADCLELMDLSSDRLMDSMMLLGNLSAQTHFDVHTWLSSILTNHATCMDGLS--GLARTI  178

Query  410  GRHASQNLTLSLKQALARFSQ--KRNVKTTRKVVHKKPs-ssdggglldswssassKANI  580
             +   ++L +  K +LA   +    N      V    PS  +     L   S+ +  AN+
Sbjct  179  MKPILKDLIVRAKTSLALMVKMAPSNTMDLPSVTDGLPSWVTSYDRRLLQLSANAITANV  238

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVA+DGSG +K+I EAV++     +  + R V+YVK G+Y E VEI +  KNVMLVGDGM
Sbjct  239  VVAKDGSGKFKTIKEAVASAP---DNSKTRYVIYVKKGIYKENVEIGKKKKNVMLVGDGM  295

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            D TIITG+ NV DG+TTF SAT    GDGF A+
Sbjct  296  DATIITGSLNVVDGATTFNSATVAAVGDGFIAQ  328



>ref|XP_011016743.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 111/181 (61%), Gaps = 7/181 (4%)
 Frame = +2

Query  317  DHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQ--KRNVKT  490
            D  DA TWLS  +++H +CLDG++     S  +   Q+L   ++ +LA  S     +   
Sbjct  151  DASDANTWLSGVLTNHVTCLDGVDTIDQPSM-KKLLQDLISRMRTSLATVSSLSAPDTDL  209

Query  491  TRKVVHKKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEG  667
             + +    PS        L   S ++ +AN+VVAQDGSG+Y +I EAV+++    +  + 
Sbjct  210  VQPLNGGVPSWILGRDRKLLESSVSNVEANVVVAQDGSGDYTTIQEAVNSVP---DKSKS  266

Query  668  RVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDG  847
            R V++VK+G+Y E VE+ +  KNVM+VGDGMD TI+TGN NV DGSTTF SAT  V+GDG
Sbjct  267  RYVIHVKSGIYKENVEVGKKKKNVMIVGDGMDFTILTGNLNVVDGSTTFRSATLAVAGDG  326

Query  848  F  850
            F
Sbjct  327  F  327



>ref|XP_008367911.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 35 
[Malus domestica]
Length=382

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 89/231 (39%), Positives = 127/231 (55%), Gaps = 28/231 (12%)
 Frame = +2

Query  248  VSDCATLYADAEERLARLDIEKYDH---------DDAVTWLSAAMSSHRSCLDGL-NEKG  397
            ++DC  L  D+ + L  + I KYD          DD  +WLSAA+++  +CLD L ++K 
Sbjct  152  INDCLELLEDSIDLLDNV-ILKYDSTKSAYGHTDDDIQSWLSAALTNQETCLDSLESDKS  210

Query  398  LVSHG--RHASQNLTLSLKQALARF---------SQKRN----VKTTRKVVHKKPs-ssd  529
            +V  G    ++QN+   +  +L+ F         +Q +N    V   R +    PS  S 
Sbjct  211  VVDKGAMETSAQNMNQFISNSLSLFMLTSRSPKQAQNKNPSNIVGGRRLLSDDFPSWVSG  270

Query  530  ggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMG-NGGEGRVVVYVKAGVYNE  706
                L   S    +A+ VVA DGSG +KSI EA+  ++ +  +GG GR V++VKAG Y+E
Sbjct  271  AERKLLEASVGDLEAHTVVALDGSGTHKSIGEALGLVASLAESGGGGRSVIHVKAGTYHE  330

Query  707  RVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             ++I    KNVML+GDG+  TII G+RN  DG TTF SAT    GDGF AR
Sbjct  331  YIKIPTKQKNVMLIGDGLGTTIIVGDRNSDDGWTTFQSATVAAMGDGFIAR  381



>ref|XP_008467117.1| PREDICTED: pectinesterase [Cucumis melo]
Length=534

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 86/227 (38%), Positives = 124/227 (55%), Gaps = 37/227 (16%)
 Frame = +2

Query  254  DCATLYADAEERLAR-----LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH  418
            DC   Y D+  +L R       +   DH   +T LSA++++H++CLDG  +         
Sbjct  100  DCLEFYEDSIAKLNRSVFSSTSVNSIDH---LTMLSASLANHQTCLDGFRD-------FD  149

Query  419  ASQNLTLSLKQALARFSQ--KRNVKTTRKVVHKK----------------Psssdgggll  544
             S N  L + Q ++ FS+    ++  T+  V                   P         
Sbjct  150  NSNNFFLPI-QIMSNFSKLVSNSLAITKAAVAPASSSSTSCGQPLPDGLCPEWVYDDDKT  208

Query  545  dswssassKANIVVAQDGSGNYKSINEAVSALS--RMGNGGEGRVVVYVKAGVYNERVEI  718
                     A++VVAQDGSG++++I+EAV+A    R G+G E R V+YVK G+Y E V I
Sbjct  209  LLRDMVGKGADMVVAQDGSGDFRTISEAVAAAEEARKGSGSE-RFVIYVKGGIYKENVVI  267

Query  719  ERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            ++ +KNVM++GDGMDRTIIT  +NVQDGSTTF SATF V+G+GF A+
Sbjct  268  KKSMKNVMMIGDGMDRTIITAMKNVQDGSTTFQSATFAVAGEGFIAK  314



>ref|XP_010101474.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB88457.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=556

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 117/214 (55%), Gaps = 16/214 (7%)
 Frame = +2

Query  254  DCATLYADAEER-------LARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHG  412
            DCA L   +++R       L   ++  +  +D   WLS  +S+H +CLDGL +     + 
Sbjct  125  DCAELMDLSKDRVLDSISTLLLQNLTTHSREDVNAWLSGILSNHVTCLDGLEDGSYAKNL  184

Query  413  RHASQNLTLSLKQA----LARFSQKRNVKTTRKVVHKKPs-ssdggglldswssassKAN  577
              +  N  +S  +     L  FSQ +  +    +    P+  + G   L          +
Sbjct  185  MESHLNELISGARTSLAILVSFSQSK-CEALEPLTKDFPTWVTPGDRRLLRSLEKEITPD  243

Query  578  IVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDG  757
            IVVA+DGSG+Y ++NEAV+A+ +     + R V+YV  GVY E VE+ +  KNVML+GDG
Sbjct  244  IVVAKDGSGDYTTVNEAVAAVPK---NSKKRFVIYVTTGVYYENVELAKNKKNVMLLGDG  300

Query  758  MDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            MD TIIT + NV DGSTT+ SAT  V+GDGF A+
Sbjct  301  MDYTIITASLNVDDGSTTYKSATVAVNGDGFIAQ  334



>gb|EAY76103.1| hypothetical protein OsI_04029 [Oryza sativa Indica Group]
Length=546

 Score =   122 bits (306),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 84/207 (41%), Positives = 118/207 (57%), Gaps = 9/207 (4%)
 Frame = +2

Query  248  VSDCATLYADAEERLARL---DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLV-SHGR  415
            + DC  L   A +RLA          D DD  TWLSA ++ H +CLDGL++  L  S G 
Sbjct  119  LEDCVQLMGLARDRLADAAGAPDVDVDVDDVRTWLSAVLTDHVTCLDGLDDGPLRDSVGA  178

Query  416  HASQNLTLSLKQALARFSQKRNVK-TTRKVVHKKPs-ssdggglldswssassKANIVVA  589
            H     +L+        +  R  +    + V + PS  +     L    + + +A++VVA
Sbjct  179  HLEPLKSLASASLAVLSAAGRGARDVLAEAVDRFPSWLTARDRTLLDAGAGAVQADVVVA  238

Query  590  QDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRT  769
            +DGSG Y +I EAV A     +GG+ R V+YVK GVY E +E+ +  + +M+VGDGMD+T
Sbjct  239  KDGSGKYTTIKEAVDAAP---DGGKSRYVIYVKKGVYKENLEVGKTKRVLMIVGDGMDQT  295

Query  770  IITGNRNVQDGSTTFGSATFRVSGDGF  850
            +ITG+RNV DGSTTF SAT  +SGDG 
Sbjct  296  VITGSRNVVDGSTTFNSATLALSGDGI  322



>ref|XP_009339900.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 35 
[Pyrus x bretschneideri]
Length=590

 Score =   123 bits (308),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 96/269 (36%), Positives = 143/269 (53%), Gaps = 44/269 (16%)
 Frame = +2

Query  152  RSNVLRALEWS------QSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLARLDIEK  313
            +++++RAL ++      Q+ H+ H              ++DC  L  D+ + L  + I K
Sbjct  110  KASLVRALAYNLTISHRQTSHQTHS----------LGVINDCLELVEDSIDLLDNV-ILK  158

Query  314  YDH---------DDAVTWLSAAMSSHRSCLDGL-NEKGLVSHG--RHASQNLTLSLKQAL  457
            YD          DD  +WLSAA+++  +CLD L ++K +V  G    A+QN+   +  +L
Sbjct  159  YDSTKSAYSHADDDIQSWLSAALTNQETCLDSLASDKSMVDKGSMETAAQNINQFISNSL  218

Query  458  ARF---------SQKRN----VKTTRKVVHKKPs-ssdggglldswssassKANIVVAQD  595
            + F         +QK+N    V   R +    PS  S     L   S    +A+ VVA D
Sbjct  219  SLFMLTSRSPKQAQKKNPSNNVGGRRLLSDDFPSWVSGAERKLLEASVGDLEAHAVVALD  278

Query  596  GSGNYKSINEAVSALSRMGNGGEG-RVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTI  772
            GSG +KSI EA+  ++ +   G+G R V++VKAG Y+E ++I    KNVML+GDG+  TI
Sbjct  279  GSGTHKSIGEALGLVASLAESGDGGRSVIHVKAGTYHEYIKIPTKQKNVMLIGDGLGATI  338

Query  773  ITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            I G+RN +DG TTF SAT    GDGF AR
Sbjct  339  IVGDRNSEDGWTTFQSATVAAMGDGFIAR  367



>ref|XP_010316615.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=548

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 122/220 (55%), Gaps = 29/220 (13%)
 Frame = +2

Query  248  VSDCATLYADAEERLARL-----DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEK------  394
            + DC  L   + +RL        ++    H D  +WLS+ +++H +C+DGLN +      
Sbjct  122  LEDCLELMDLSRDRLMDSMMGLGNLTAQAHFDVHSWLSSILTNHVTCIDGLNGQVRSIME  181

Query  395  ----GLVSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVVHKKPs-ssdggglldswss  559
                 LV+  R      +L+L  A+A   QK  V T   V    PS  S     L   S+
Sbjct  182  PMLNDLVARAR-----TSLALMVAIA--PQKNIVPT---VSDGLPSWVSANDRRLLQLSA  231

Query  560  assKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNV  739
             +  AN+VVA+DGSG YK++ EAV++     +  + R V+YVK G+Y E VEI +  KN+
Sbjct  232  NAIAANVVVAKDGSGKYKTVKEAVASAP---DNSKTRYVIYVKKGIYKENVEIGKTKKNL  288

Query  740  MLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            MLVGDGMD TIITGN NV DGSTTF SAT    GDGF A+
Sbjct  289  MLVGDGMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQ  328



>gb|KEH21378.1| pectinesterase [Medicago truncatula]
Length=372

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +2

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLV  748
            +A+IVVAQDGSGNYK+I++ V+A +++   G+GRVV+++KAGVY E ++I+R + N+M+ 
Sbjct  58   RADIVVAQDGSGNYKTISDGVAAAAKLS--GKGRVVIHLKAGVYKENIDIKRTMSNLMIF  115

Query  749  GDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GDGMD TI+TGN+N  DGSTTF SATF V GDGF A+
Sbjct  116  GDGMDSTIVTGNQNAIDGSTTFRSATFAVMGDGFIAK  152



>ref|XP_007045218.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY01050.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=520

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 90/215 (42%), Positives = 126/215 (59%), Gaps = 24/215 (11%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHD--DAVTWLSAAMSSHRSCLDGLNEKGLVSHGR----  415
            DC  LY   E  +  L+  K  ++  DA TWLSAA+++ ++C +G  +  L SH +    
Sbjct  98   DCLELY---ENTVNHLNHSKSTNNPMDAQTWLSAAIANQQTCQNGFIDFNLASHLQTFPS  154

Query  416  ---HASQNLTLSL---KQALARFSQKRNVKTTRKVVHKKPs-ssdggglldswssassKA  574
               + S+ L+ SL   K  +   S  + V   R + H  P+  S     L   + A  KA
Sbjct  155  MLGNFSKLLSNSLAINKATVTSSSTAKQVGNRRLLAHGFPAWLSAADRKLLQKTGAPPKA  214

Query  575  NIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGD  754
            +IVVAQDGSGN+KSI+EAV+A      GG  R V+YVKAGVY E V I++   N+ML+GD
Sbjct  215  DIVVAQDGSGNFKSISEAVAAA-----GGGKRTVIYVKAGVYRENVNIKK--SNIMLIGD  267

Query  755  GMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GMD T++TG+++ Q  +TTF SAT  V+GD F AR
Sbjct  268  GMDATVVTGSKSAQT-TTTFSSATVGVAGDRFVAR  301



>ref|XP_011030843.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   122 bits (306),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 111/181 (61%), Gaps = 7/181 (4%)
 Frame = +2

Query  317  DHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQ--KRNVKT  490
            D  DA TWLS  +++H +CLDG++     S  +   Q+L   ++ +LA  S     +   
Sbjct  151  DASDANTWLSGVLTNHVTCLDGVDTIDQPSM-KKLLQDLISRMRTSLATVSSLSASDTDL  209

Query  491  TRKVVHKKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEG  667
             + +    PS        L   S ++ +AN++VAQDGSG+Y +I EAV+++    +  + 
Sbjct  210  VQPLNGGFPSWILGRDRKLLESSVSNVEANVIVAQDGSGDYTTIQEAVNSVP---DKSKS  266

Query  668  RVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDG  847
            R V++VK+G+Y E VE+ +  KNVM+VGDGMD TI+TGN NV DGSTTF SAT  V+GDG
Sbjct  267  RYVIHVKSGIYKENVEVGKKKKNVMIVGDGMDFTILTGNLNVVDGSTTFRSATLAVAGDG  326

Query  848  F  850
            F
Sbjct  327  F  327



>ref|XP_011016647.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=550

 Score =   122 bits (306),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 111/181 (61%), Gaps = 7/181 (4%)
 Frame = +2

Query  317  DHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQ--KRNVKT  490
            D  DA TWLS  +++H +CLDG++     S  +   Q+L   ++ +LA  S     +   
Sbjct  151  DASDANTWLSGVLTNHVTCLDGVDTIDQPSM-KKLLQDLISRMRTSLATVSSLSASDTDL  209

Query  491  TRKVVHKKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEG  667
             + +    PS        L   S ++ +AN++VAQDGSG+Y +I EAV+++    +  + 
Sbjct  210  VQPLNGGFPSWILGRDRKLLESSVSNVEANVIVAQDGSGDYTTIQEAVNSVP---DKSKS  266

Query  668  RVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDG  847
            R V++VK+G+Y E VE+ +  KNVM+VGDGMD TI+TGN NV DGSTTF SAT  V+GDG
Sbjct  267  RYVIHVKSGIYKENVEVGKKKKNVMIVGDGMDFTILTGNLNVVDGSTTFRSATLAVAGDG  326

Query  848  F  850
            F
Sbjct  327  F  327



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 123/218 (56%), Gaps = 22/218 (10%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEK--YDHDDAVTWLSAAMSSHRSCLDGLNEKG----------  397
            DC  LYAD   +L R    K      DA TWLSAA+++ ++C +G  E G          
Sbjct  99   DCVELYADTVTQLNRALGSKNPLSWSDAQTWLSAAITNQQTCQNGFIELGKSSYLSSFPF  158

Query  398  -LVSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVVHK--KPsssdggglldswssass  568
             L +  +  S +L ++ + A +  S        R+++        S     L    SA+S
Sbjct  159  MLSNFSKMVSNSLAINKEAASSAASLLGKQGGNRRLLSDGFPTWVSAADRKLLQSPSAAS  218

Query  569  KANIVVAQDGSGNYKSINEAVSA-LSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVML  745
            +A++VVA DGSGNYK+I++AV+A   R G     R V+YVK GVY E VEI     N+ML
Sbjct  219  QADVVVAADGSGNYKTISQAVAASPKRSGK----RFVIYVKRGVYRENVEITA--SNIML  272

Query  746  VGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +GDG+D T +TG++NVQDGSTTF +AT  V+GDGF AR
Sbjct  273  IGDGIDATTVTGSKNVQDGSTTFRTATVAVTGDGFIAR  310



>emb|CAN78759.1| hypothetical protein VITISV_000562 [Vitis vinifera]
Length=513

 Score =   121 bits (304),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 117/207 (57%), Gaps = 11/207 (5%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIE-KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-AS  424
            DC  LY     +L + LD   +    DA TWLS A+++ ++C DG  E G+  H     S
Sbjct  94   DCLELYDHTILKLNKTLDPNTRCTQADAQTWLSTALTNLQTCQDGFIELGVSGHFLPLMS  153

Query  425  QNLTLSLKQALARFSQKRNVKTTR--KVVHKKPsssdggglldswssassKANIVVAQDG  598
             N++  +   L+      +V T +       KP            S    +ANIVV++DG
Sbjct  154  NNVSKLISNTLSINKVPYSVPTYKGGYPTWVKPGDRKLLQSSSLAS----QANIVVSKDG  209

Query  599  SGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIIT  778
            + +Y +I  A++A S+    G GR V+YVKAG Y+E V+I  G+KN+ML+GDG+ +TI+T
Sbjct  210  THDYTTIGAAITAASK--RSGSGRYVIYVKAGTYSENVQIGSGLKNIMLLGDGIGKTIVT  267

Query  779  GNRNVQDGSTTFGSATFRVSGDGFWAR  859
            G+++V  GSTT+ SAT  V GDGF AR
Sbjct  268  GSKSVGGGSTTYNSATVAVVGDGFIAR  294



>ref|XP_004232737.1| PREDICTED: pectinesterase-like [Solanum lycopersicum]
Length=546

 Score =   122 bits (305),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 91/222 (41%), Positives = 122/222 (55%), Gaps = 33/222 (15%)
 Frame = +2

Query  248  VSDCATLYADAEERL-------ARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEK----  394
            + DC  L   + +RL         L ++   H D  +WLS+ +++H +C+DGLN +    
Sbjct  120  LEDCLELMDLSRDRLMDSMVGLGNLTVQA--HFDVHSWLSSILTNHVTCIDGLNGQVRSI  177

Query  395  ------GLVSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVVHKKPs-ssdggglldsw  553
                   LV+  R      +L+L  A+A   QK  V T   V    PS  S     L   
Sbjct  178  MEPMLNDLVARART-----SLALMVAIA--PQKNIVPT---VSDGLPSWVSANDRRLLQL  227

Query  554  ssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIK  733
            S+ +  AN+VVA+DGSG YK++ EAV++     +  + R V+YVK G Y E VEI +  K
Sbjct  228  SANAIAANVVVAKDGSGKYKTVKEAVASAP---DNSKTRYVIYVKKGTYKENVEIGKKKK  284

Query  734  NVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            N+MLVGDGMD TIITGN NV DGSTTF SAT    GDGF A+
Sbjct  285  NIMLVGDGMDATIITGNLNVIDGSTTFKSATVAAVGDGFIAQ  326



>ref|XP_011095339.1| PREDICTED: pectinesterase 2.1-like [Sesamum indicum]
Length=550

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 108/183 (59%), Gaps = 13/183 (7%)
 Frame = +2

Query  320  HDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFS-----QKRNV  484
            H DA  WLSA + +H +C DGLN  G  S G    ++L    + +LA  +     +K  V
Sbjct  152  HADAQAWLSAVLDNHVTCFDGLNSFGRNSLGA-VLEDLISRARASLAMLAAVSEPEKEMV  210

Query  485  KTTRKVVHKKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGG  661
            ++ R    K PS  +     L    + +  A++VVA+DGSGNYK++ EA++A     +  
Sbjct  211  QSLRG---KLPSWITAVDRKLLQSRANAIDADLVVAKDGSGNYKTVAEAIAAAP---DKS  264

Query  662  EGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSG  841
            + R V+YVK G Y E VE+ +  KN+M++GDGMD TIITG+ NV DGSTTF SAT    G
Sbjct  265  KKRYVIYVKKGTYKENVEVGKNKKNLMIIGDGMDSTIITGDLNVVDGSTTFKSATLAAVG  324

Query  842  DGF  850
            +GF
Sbjct  325  EGF  327



>ref|XP_004492228.1| PREDICTED: pectinesterase 2.1-like [Cicer arietinum]
Length=555

 Score =   121 bits (304),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 120/219 (55%), Gaps = 27/219 (12%)
 Frame = +2

Query  254  DCATLYADAEERL--ARLDIEKYDHD---DAVTWLSAAMSSHRSCLDGL----------N  388
            DC  L   + +R+  + L + K   D   DA TWLS+ +++H +CLDGL          +
Sbjct  125  DCEQLMEISMDRIWDSMLALTKNTIDSQQDAHTWLSSVLTNHVTCLDGLEAISQVLMESD  184

Query  389  EKGLVSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVVHKK-Ps-ssdggglldswssa  562
             + L+S  R        SL   LA F Q+ + +   + ++   PS  +     L   S  
Sbjct  185  FQDLISRAR-------TSLAVFLAVFPQQGHDQFVDETLNGDFPSWITSKDRRLLESSVG  237

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVM  742
              KAN+VVA+DGSG +K++ EAV+      + G+ R V+YVK G Y E +EI    KNVM
Sbjct  238  DIKANVVVAKDGSGKFKTVAEAVATAP---DNGKTRYVIYVKKGTYKENIEIGSIKKNVM  294

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            LVGDGMD TIITGN N  DG+TTF SAT    GDGF A+
Sbjct  295  LVGDGMDATIITGNLNFIDGTTTFKSATVAAVGDGFIAQ  333



>ref|XP_002522859.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF39557.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=553

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 108/183 (59%), Gaps = 7/183 (4%)
 Frame = +2

Query  311  KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQ--KRNV  484
            K D DDA TWLS  +++H +CLDG+   G  S  ++  Q+L    + +LA  +     N 
Sbjct  152  KSDADDAHTWLSGVLTNHVTCLDGIVLTGQQSI-KNLMQDLISRTRTSLAVLASLSASNK  210

Query  485  KTTRKVVHKKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGG  661
               R +    P         +   SS + +AN+VVAQDGSG+Y +I EAV++     +  
Sbjct  211  GNLRPLSGGFPWWIRVKDRKILGSSSENIQANVVVAQDGSGDYSTIQEAVASAP---DKS  267

Query  662  EGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSG  841
            + R V+YVK G Y E VEI +  KN+M+ GDGM+ TIITG+ NV DGSTTF SAT  V+G
Sbjct  268  KTRYVIYVKKGTYIENVEIAKKKKNLMIFGDGMNLTIITGSLNVADGSTTFRSATLAVAG  327

Query  842  DGF  850
            DGF
Sbjct  328  DGF  330



>ref|XP_007213952.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
 gb|EMJ15151.1| hypothetical protein PRUPE_ppa003697mg [Prunus persica]
Length=555

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/219 (39%), Positives = 118/219 (54%), Gaps = 20/219 (9%)
 Frame = +2

Query  248  VSDCATLYADAEERLARLDIEKYDH------DDAVTWLSAAMSSHRSCLDGLNEKGLVSH  409
            ++DC  L   + +R+    I   +       +DA  WLS+ +++H +CLDGL  +G    
Sbjct  122  IADCVELMDVSRDRVMHSIIALQNFTLQNSLEDAHAWLSSILTNHVTCLDGL--QGPART  179

Query  410  GRHASQNLTLSLKQA-LARFSQKRNVKTTRKVVHKK-----Psssdgg---glldswssa  562
                  N  +S  +A LA      N    +  +H+      PS         L D   + 
Sbjct  180  IMEPRLNDLISRSRASLAIMVAISNPSKPKAEIHEPLNGEFPSWVTSRDRRLLQDYNLAK  239

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVM  742
              KANIVVA+DGSGNYK++ EAV+A     N  + R ++YVK G Y E VE+ +  KN+M
Sbjct  240  EVKANIVVAKDGSGNYKTLKEAVAAAP---NNSKTRYIIYVKKGTYKENVEVGKDKKNLM  296

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +VGDGMD T+ITG+ NV DGSTTF SAT    GDGF A+
Sbjct  297  IVGDGMDDTVITGSLNVVDGSTTFKSATLAAVGDGFIAQ  335



>gb|AAC14742.1| pectin methylesterase [Pisum sativum]
 gb|AAC32273.1| pectin methylesterase [Pisum sativum]
Length=554

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 98/292 (34%), Positives = 152/292 (52%), Gaps = 52/292 (18%)
 Frame = +2

Query  89   AIDTRNALT-----------ASNQD-----LLAIRT-ARSNVLRALEWSQSLHE-LHEPS  214
            A+DT++ LT           A+ +D     L+++ T + S++ +A+E +  +   ++ P 
Sbjct  58   AVDTKSCLTHVSEVVQGQALANTKDHKLSTLISLLTKSTSHIQKAMETANVIKRRVNSPK  117

Query  215  RESGnnaaaaaVSDCATLYADAEERL--ARLDIEKYDHD---DAVTWLSAAMSSHRSCLD  379
            +E+        ++DC  L   + +R+  + L + K + D   DA TWLS+ +++H +CL+
Sbjct  118  KETA-------LNDCEQLMDLSMDRVWDSVLTLTKNNIDSQQDAHTWLSSVLTNHATCLN  170

Query  380  GL----------NEKGLVSHGRHASQNLT--LSLKQALARFSQKRNVKTTRKVVHKKPss  523
            GL          + + L+S  R +   L   L  K       +  N +    V  K    
Sbjct  171  GLEGTSRVVMESDLQDLISRARSSLAVLVSVLPAKSNDGFIDESLNGEFPSWVTSKD---  227

Query  524  sdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYN  703
                  L   +    KAN+VVA+DGSG +K++ EAV++     + G+ R V+YVK G Y 
Sbjct  228  ----RRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAP---DNGKARYVIYVKRGTYK  280

Query  704  ERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            E+VEI +   NVMLVGDGMD TIITGN N  DG+TTF SAT    GDGF A+
Sbjct  281  EKVEIGKKKTNVMLVGDGMDATIITGNLNFIDGTTTFNSATVAAVGDGFIAQ  332



>gb|KDP42887.1| hypothetical protein JCGZ_23829 [Jatropha curcas]
Length=580

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 99/303 (33%), Positives = 154/303 (51%), Gaps = 30/303 (10%)
 Frame = +2

Query  26   PKMSNSSATFllvfnlslllAAIDTRNALTASNQDL--LAIRTARSNVLRALEWSQSLHE  199
            P +S++            LL ++ T   L  + ++L  L+++ +   V  ALE + +L  
Sbjct  64   PSISSTCKNIPHKAACKSLLMSLKTTTTLPKNPKELFDLSVQYSFKKVRSALELASTLG-  122

Query  200  LHEPSRESGnnaaaaaVSDCATLYADAEERLARLDIEKY--------DHDDAVTWLSAAM  355
            L   S+E     A+ A++DC  L  D+ ++L+ ++             H D  TWLSAA+
Sbjct  123  LSYQSKEQKTRLASDAMNDCIELLEDSLDQLSNINSNNNNDNNNPIKSHSDIQTWLSAAL  182

Query  356  SSHRSCLDGLNEKG-------LVSHGRHASQNLTLSLKQALARFSQKRNVK---TTRKVV  505
            ++  +C+  L E         +VS  R    NL+  +  +LA F    N +     RK++
Sbjct  183  TNQETCIQSLQETNKKVETGIMVSTAR----NLSHYISNSLAIFVSNHNTEDFINGRKLL  238

Query  506  HKKPsss---dggglldswssassKANIVVAQDGSGNYKSINEAVSALSR--MGNGGEGR  670
             +    S        L   S    +A+ VVA+DGSG ++++ EA+  ++R   GNGG GR
Sbjct  239  SEDEFPSWVSPSERKLLEASIGEIEAHAVVAKDGSGTHETLAEAIDGVARSLAGNGGGGR  298

Query  671  VVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGF  850
             V+YVKAG Y E + I    KNVMLVGDG  +T+I G+RN  +G +TF SAT    GDGF
Sbjct  299  NVIYVKAGTYQENINIPTNQKNVMLVGDGKGKTVIVGSRNADNGWSTFQSATVAAMGDGF  358

Query  851  WAR  859
             A+
Sbjct  359  IAK  361



>ref|XP_006307176.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
 gb|EOA40074.1| hypothetical protein CARUB_v10008769mg [Capsella rubella]
Length=547

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/198 (40%), Positives = 113/198 (57%), Gaps = 14/198 (7%)
 Frame = +2

Query  281  EERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALA  460
            E R   L++E Y   +  TWLS+ ++++ +CLD  NE  +    +   ++L    + ALA
Sbjct  139  ELRGGNLNLESYS--NVHTWLSSVLTNYMTCLDTTNEPRV----KAQLEDLVSRARVALA  192

Query  461  RFSQKRNVKTTRKVV---HKKPsssdggglldswssassK--ANIVVAQDGSGNYKSINE  625
             F      +   K++   H     +     L   +  + K  AN+VVA+DGSG YK++NE
Sbjct  193  IFVSVLPARDDLKMILFDHFPSWLTTLDRELLESAPKALKVNANVVVAKDGSGKYKTVNE  252

Query  626  AVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGS  805
            AV+A     N    R V+YVK GVY E ++I +  KN+MLVGDG D TIITG+ NV DGS
Sbjct  253  AVAAAPENSN---SRYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDATIITGSLNVVDGS  309

Query  806  TTFGSATFRVSGDGFWAR  859
            TTF SAT   +GDGF A+
Sbjct  310  TTFRSATIAANGDGFMAQ  327



>ref|XP_009115554.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6 
[Brassica rapa]
Length=570

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 84/239 (35%), Positives = 129/239 (54%), Gaps = 39/239 (16%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHD----DAVTWLSAAMSSHRSCLDGLNEKGLVS-----  406
            DC  LY D  ++L       YD +    D  T LSAA+++  +C +G  +  L S     
Sbjct  123  DCLELYEDTIDQLNH-SRRSYDFNFSAHDRQTSLSAAIANQDTCKNGFKDFNLTSSYSKY  181

Query  407  HGRHASQNLTLSLKQ-------------------ALARFSQKRNVKTTRKVVHKK-----  514
               H  +NLT S+                     A  +F+++ +         ++     
Sbjct  182  FPIHVHRNLTKSISNSLAVSKAAAEAVAEKHPGTAFTKFNKQGSSGGGGGGGGRRLMFWD  241

Query  515  ---Ps-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVY  682
               PS        L   S  ++K ++VVA+DGSG+Y SI +A++A +++    + R+V+Y
Sbjct  242  NQFPSWIPLTDRKLLEGSVTTAKPDLVVAKDGSGHYTSIQQAINAAAKLPRRNK-RLVIY  300

Query  683  VKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            VKAGVY E VEI++ +KNVM++GDG+D T++TG+RNV+DG+TTF SATF V+G GF AR
Sbjct  301  VKAGVYRENVEIKKSVKNVMVIGDGIDSTVVTGSRNVKDGTTTFRSATFAVAGSGFIAR  359



>ref|XP_009378667.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
 ref|XP_009339421.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=510

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 123/206 (60%), Gaps = 11/206 (5%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYD---HDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA  421
            +DC  LY    ++L +  I+  +    +DA +WLS A+++  +C  G  +  + ++    
Sbjct  96   ADCLELYDYTIQKLNK-SIDPTNGATQNDAQSWLSTALTNLETCRAGFVDLAVSNNQLMP  154

Query  422  SQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGS  601
            S N++  +   L   S  +   T++    +   +    G      S+S KA+IVVA+DGS
Sbjct  155  SNNVSNLISNTL---SVNKVPYTSQPEYKQGFPTWVKPGDRKLLKSSSPKADIVVAKDGS  211

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            GNYK+INEA+SA S+    G GR V+YVKAG Y E V+I+  + N+ML+GDG+ +TIITG
Sbjct  212  GNYKTINEAISAASK--RKGSGRYVIYVKAGSYKENVQIK--LNNIMLLGDGIGKTIITG  267

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            +++V  G+TTF SAT  V GDGF A+
Sbjct  268  SKSVGGGTTTFNSATVAVVGDGFIAQ  293



>ref|XP_010271267.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 123/218 (56%), Gaps = 20/218 (9%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEK--YDHDDAVTWLSAAMSSHRSCLDGLNEKG---------  397
            +DC  LY+D   +L R    K      DA TWLSAA+++ ++C +G  E G         
Sbjct  95   ADCVELYSDTVTQLNRAMGSKNPLSWSDAQTWLSAAITNQQTCQNGFVELGKSSYLSSFP  154

Query  398  --LVSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVVHK--KPsssdggglldswssas  565
              L +  +  S +L ++ +   +  S        R+++        S     L    SA+
Sbjct  155  FMLSNFSKMVSNSLAINKEADSSAASLLGKQGGNRRLLSDGFPTWVSAADRKLLQSPSAA  214

Query  566  sKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVML  745
            S+A++VVA DGSGNYK+I+EAV+A S+       R V+YVK GVY E VEI+    N+ML
Sbjct  215  SQADVVVAADGSGNYKTISEAVAASSKRSGK---RFVIYVKKGVYKENVEIKA--SNIML  269

Query  746  VGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +GDG+D TI+T ++N QDGSTTF +AT  V+GDGF AR
Sbjct  270  IGDGIDATIVTDSKNAQDGSTTFRTATVGVTGDGFMAR  307



>ref|XP_010062184.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=519

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 113/208 (54%), Gaps = 8/208 (4%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA--S  424
            +DC  LY +   RL R   +  D D   TWLSAA+++  +C  G  E G+  +      +
Sbjct  95   ADCLKLYQETIHRLNRTAGDCTDSDQQ-TWLSAALTNLDTCRTGFAELGVADYVFQLMYN  153

Query  425  QNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdgggllds---wssassKANIVVAQD  595
             N+T  +  ALA  +   +   T+   H                   SAS   ++ VAQD
Sbjct  154  SNVTKLISNALALKNNNASSSATQDTTHNDGQGFPSWVTAGVRRLLQSASPTPDVTVAQD  213

Query  596  GSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTII  775
            GSGN+++I +A+ A ++    G  R V+YVK GVY E + I  G+ N+M+VGDG+  T+I
Sbjct  214  GSGNFRTIQQALDAAAK--RSGSKRFVIYVKRGVYQENLVIGSGLDNIMMVGDGLRFTVI  271

Query  776  TGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TG+R+V  GSTTF SAT  V+GDGF AR
Sbjct  272  TGSRSVGGGSTTFNSATVAVTGDGFIAR  299



>ref|XP_010458561.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/218 (38%), Positives = 120/218 (55%), Gaps = 23/218 (11%)
 Frame = +2

Query  248  VSDCATLYADAEERLAR---------LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGL  400
            ++DC  +   +++R+           L+ E Y   +  TWLS+ ++++ +CLD  NE  +
Sbjct  119  LADCEEMMDVSKDRMVNSMEQLRGGNLNFESYS--NVHTWLSSVLTNYMTCLDTTNEPRV  176

Query  401  VSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVV---HKKPsssdggglldswssassK  571
                +   ++L    + ALA F      +   K+V   H     +     L   +  + K
Sbjct  177  ----KPQLEDLVSRARVALAIFVSVLPARDDLKMVLFDHFPSWLTALDRELLESAPKTLK  232

Query  572  --ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVML  745
              AN+VVA+DGSG YK++NEAV+A     N    R V+YVK GVY E ++I +  KN+ML
Sbjct  233  VNANVVVAKDGSGKYKTVNEAVAAAPENSNS---RYVIYVKKGVYKETIDIGKKKKNLML  289

Query  746  VGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            VGDG D TIITG+ NV DGSTTF SAT   +GDGF A+
Sbjct  290  VGDGKDATIITGSLNVVDGSTTFRSATIAANGDGFMAQ  327



>ref|XP_010271372.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 92/226 (41%), Positives = 122/226 (54%), Gaps = 37/226 (16%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEK--YDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHAS  424
            +DC  LYAD   +L R    K      D+ TWLSAA+++ ++C +G  +  L       S
Sbjct  96   ADCVELYADTVSQLNRSLGSKNPLSWSDSQTWLSAALTNEQTCRNGFMDLNL-------S  148

Query  425  QNLTLSLKQALARFSQK--------------------RNVKTTRKVVHKKPs-ssdgggl  541
              L+ SL   L+ FS+                     R     R +    P+  S     
Sbjct  149  HRLS-SLPSMLSNFSKMVSNSLAINKAAASSSASLLGRQGGNRRLLSDGFPAWVSAADRK  207

Query  542  ldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIE  721
            L   S A+S+A++VVA DGSGNYK+I+EAV+A S    GG  R ++YVK GVY E VEI 
Sbjct  208  LLQSSGAASQADVVVAADGSGNYKTISEAVAAAS----GGGSRFIIYVKRGVYKENVEIR  263

Query  722  RGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
                N+ML+GDG+D TI++ +RNVQ GSTTF SAT  VSG GF AR
Sbjct  264  A--SNIMLIGDGIDATIVSSSRNVQQGSTTFRSATVAVSGGGFIAR  307



>ref|XP_010932734.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 79/208 (38%), Positives = 115/208 (55%), Gaps = 10/208 (5%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKG--LVSHGRHAS  424
            +DC     D  +++ R  +     DD  TWLSAAM++ ++C +G N+ G          S
Sbjct  92   ADCLKFSKDTIKQINR-SMGSTSKDDVQTWLSAAMTNQQTCRNGFNDLGSSFPLGSPFLS  150

Query  425  QNLTLSLKQALA---RFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQD  595
             N++  L   LA     + K++    R +    P            SS +  A++VVA+D
Sbjct  151  YNISELLSNCLAINKAMTPKKSGGNPRFLSDGFPKWMSTTERKLLQSSNT-NADLVVAKD  209

Query  596  GSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTII  775
            GSG+Y +I+EA++A +   NG   R V++VKAG+YNE VE    + N+M+ GDG+  TII
Sbjct  210  GSGDYTTISEAIAAATIRSNG-TSRFVIHVKAGIYNETVETS--MNNLMITGDGIGATII  266

Query  776  TGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TGN+N  DG  T  +ATF VSGDGF AR
Sbjct  267  TGNKNFHDGFPTAQTATFAVSGDGFIAR  294



>ref|XP_010058468.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=720

 Score =   121 bits (304),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 83/211 (39%), Positives = 115/211 (55%), Gaps = 19/211 (9%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-ASQ  427
            +DC  LY      L R    +   DD  TWLS A+++  +C  G  E G++ +     S 
Sbjct  97   TDCLRLYEHIVHHLNRTIHRQCTQDDVQTWLSTALTNLETCRAGFVELGILDNVLPLMSN  156

Query  428  NLTLSLKQAL-------ARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVV  586
            N++  +  AL       A  +  R   T  +  ++K         L    SASS ANIVV
Sbjct  157  NISKLISNALSANHEPYAMPNYTREFPTWLRPGNRK---------LLRSLSASSMANIVV  207

Query  587  AQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDR  766
            A DGSGNYK+I+EAV A S     G  R ++Y+KAG Y E +E+   ++N++ VGDG+  
Sbjct  208  AHDGSGNYKTISEAVIAASE--RSGMARCIIYIKAGTYEENIEVGSKLENIVFVGDGIGM  265

Query  767  TIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            TIITG+R+V +G TTF SAT  V GDGF A+
Sbjct  266  TIITGSRSVGEGFTTFNSATVAVDGDGFIAQ  296



>ref|XP_002518523.1| Pectinesterase precursor, putative [Ricinus communis]
 gb|EEF43910.1| Pectinesterase precursor, putative [Ricinus communis]
Length=547

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/217 (39%), Positives = 113/217 (52%), Gaps = 26/217 (12%)
 Frame = +2

Query  254  DCATLYADAEER-----LARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLN-------EKG  397
            DC  L   + ++     LA  ++    H DA +WLS  +++H +CLDGL        E G
Sbjct  122  DCVDLMELSLDKIKNSVLALDNVTTDSHADAHSWLSTVLTNHVTCLDGLKGLARSTMEPG  181

Query  398  L---VSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssass  568
            L   ++  R  S  + +++  A        N      V  K          L   S  + 
Sbjct  182  LKDIITRAR-TSLAMVVAISPAKNDLISPLNGDFPSWVTSKD-------RKLLESSGKNI  233

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLV  748
             A+++VA+DGSG YK++ EAV+A     N G+ R V+YVK G Y E VEI    KN+MLV
Sbjct  234  NADVIVAKDGSGKYKTVKEAVAAAP---NNGKTRYVIYVKKGTYKENVEIGNSKKNIMLV  290

Query  749  GDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GD MD TIITG+ NV DGSTTF SAT    GDGF A+
Sbjct  291  GDSMDSTIITGSLNVVDGSTTFNSATVAAVGDGFIAQ  327



>ref|XP_004293266.1| PREDICTED: pectinesterase/pectinesterase inhibitor-like [Fragaria 
vesca subsp. vesca]
Length=528

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/190 (41%), Positives = 104/190 (55%), Gaps = 18/190 (9%)
 Frame = +2

Query  323  DDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQ--NLTLSLKQALARFSQKRNVKTTR  496
            +D  TWLS+ +++H +CLDGL  KGL +      +   L    K  LA+  +    K   
Sbjct  126  EDVHTWLSSVLTNHVTCLDGL--KGLSARTIMEPRLNGLISKSKAFLAKLVEISPSK--E  181

Query  497  KVVHKKPsssdgggl---------ldswssassKANIVVAQDGSGNYKSINEAVSALSRM  649
            KV+  +P                 +        +AN+VVA DGSG YK++ EAV+A    
Sbjct  182  KVIGDQPLEIGDFPTWVKRRDRRLMSRDFQKGVEANVVVANDGSGKYKTVKEAVAAAP--  239

Query  650  GNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATF  829
             +    R V+YVK G Y E VE+ +  KN+M+VGDGMD+TIITG+ NV DGSTTF SAT 
Sbjct  240  -DKSTTRYVIYVKKGTYKENVEVVKNKKNLMIVGDGMDKTIITGSLNVVDGSTTFNSATL  298

Query  830  RVSGDGFWAR  859
               GDGF A+
Sbjct  299  AAVGDGFIAQ  308



>dbj|BAC67661.1| pectin methylesterase [Pisum sativum]
Length=554

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 98/292 (34%), Positives = 151/292 (52%), Gaps = 52/292 (18%)
 Frame = +2

Query  89   AIDTRNALT-----------ASNQD-----LLAIRT-ARSNVLRALEWSQSL-HELHEPS  214
            A+DT++ LT           A+ +D     L+++ T + S++ +A+E +  +   ++ P 
Sbjct  58   AVDTKSCLTHVSEVVQGQALANTKDHKLSTLISLLTKSTSHIQKAMETANVIKRRVNSPR  117

Query  215  RESGnnaaaaaVSDCATLYADAEERL--ARLDIEKYDHD---DAVTWLSAAMSSHRSCLD  379
             E+        ++DC  L   + +R+  + L + K + D   DA TWLS+ +++H +CL+
Sbjct  118  EETA-------LNDCEQLMDLSMDRVWDSVLTLTKNNIDSQQDAHTWLSSVLTNHATCLN  170

Query  380  GL----------NEKGLVSHGRHASQNLT--LSLKQALARFSQKRNVKTTRKVVHKKPss  523
            GL          + + L+S  R +   L   L  K       +  N +    V  K    
Sbjct  171  GLEGTSRVVMEGDLQDLISRARSSLAVLVSVLPAKSNDGFIDESLNGEFPSWVTSKD---  227

Query  524  sdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYN  703
                  L   +    KAN+VVA+DGSG +K++ EAV++     + G+ R V+YVK G Y 
Sbjct  228  ----RRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAP---DNGKARYVIYVKRGTYK  280

Query  704  ERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            E+VEI +   NVMLVGDGMD TIITGN N  DG+TTF SAT    GDGF A+
Sbjct  281  EKVEIGKKKTNVMLVGDGMDATIITGNLNFIDGTTTFNSATVAAVGDGFIAQ  332



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 90/227 (40%), Positives = 127/227 (56%), Gaps = 36/227 (16%)
 Frame = +2

Query  251  SDCATLYADAEERLARL---DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA  421
            +DC  LYAD   +L R    +       DA TWLSAA+++ ++C +G  E  L S+    
Sbjct  98   ADCVELYADTITQLNRTMGSNKNPLRWSDAQTWLSAAITNQQTCQNGFTELNLSSY----  153

Query  422  SQNLTLSLKQALARFSQ---------KRNVKTTRKVVHKK-----------Ps-ssdggg  538
               L+ S    L+ FS+         K    +   ++ K+           P+  S    
Sbjct  154  ---LSNSFPFMLSNFSKMISNSLAINKAAASSVASLMGKQGGNRRLLSDGFPTWVSAADR  210

Query  539  lldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEI  718
             L   SSA+S+A++VVA DGSGNY++I++AV+A S+       R V+YVK GVY E VEI
Sbjct  211  KLLQSSSAASQADVVVAADGSGNYRTISQAVAASSKRSGK---RFVIYVKRGVYKENVEI  267

Query  719  ERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +    N+ML+GDG+D TI+TG++NVQDGSTTF SAT  V+ D F AR
Sbjct  268  KA--SNIMLIGDGIDATIVTGSKNVQDGSTTFRSATVAVTRDRFMAR  312



>ref|XP_010493017.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Camelina 
sativa]
Length=547

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 119/218 (55%), Gaps = 23/218 (11%)
 Frame = +2

Query  248  VSDCATLYADAEERLAR---------LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGL  400
            ++DC  +   +++R+           L+ E Y   +  TWLS+ ++++ +CLD  NE  +
Sbjct  119  LADCEEMMDASKDRMVNSMEQLRGGNLNFESYS--NVHTWLSSVLTNYMTCLDTTNEPRV  176

Query  401  VSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVV---HKKPsssdggglldswssassK  571
                +   ++L    + ALA F      +   K+V   H     +     L      + K
Sbjct  177  ----KPQLEDLVSRARVALAIFVSVLPARDDLKMVLFDHFPSWLTALDRELLESDPKTLK  232

Query  572  --ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVML  745
              AN+VVA+DGSG YK++NEAV+A     N    R V+YVK GVY E ++I +  KN+ML
Sbjct  233  VNANVVVAKDGSGKYKTVNEAVAAAPENSNS---RYVIYVKKGVYKETIDIGKKKKNLML  289

Query  746  VGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            VGDG D T+ITG+ NV DGSTTF SAT   +GDGF A+
Sbjct  290  VGDGKDATVITGSLNVVDGSTTFRSATIAANGDGFMAQ  327



>ref|XP_004492227.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18-like [Cicer 
arietinum]
Length=557

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 100/279 (36%), Positives = 143/279 (51%), Gaps = 26/279 (9%)
 Frame = +2

Query  89   AIDTRNALT-----ASNQDLLAIRTARSNVLRALEWSQSLH------ELHEPSRESGnna  235
            AIDT++ LT     + +Q L   +  + N L +L    + H      + +   R   +  
Sbjct  61   AIDTKSCLTHVSEVSQHQTLPNTKDHKFNTLISLLTKSTTHIKKTMDKANVIKRRVNSPK  120

Query  236  aaaaVSDCATLYADAEERL--ARLDIEKYDHD---DAVTWLSAAMSSHRSCLDGLNEKGL  400
               A++DC  L   + +R+  + L +   + D   +A TWLS  +++H +CLDGL    L
Sbjct  121  EELALNDCEELMDLSMDRVWNSVLTLTNNNIDSQQNAHTWLSTVLTNHVTCLDGLEGSSL  180

Query  401  VSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVVHKK-----Ps-ssdggglldswssa  562
            V        +L    + +LA        K +   + +K     PS  +     L   S  
Sbjct  181  VVMESDL-HDLISRARSSLAVLVAVFPSKDSDGFIEEKLNGDFPSWVTSKDRKLLESSIG  239

Query  563  ssKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVM  742
              KAN+VVA+DGSG +K++ EAV++    GN    R V+YVK G+Y E VEI +  KNVM
Sbjct  240  DIKANVVVAKDGSGKFKTVVEAVASAPDNGNT---RYVIYVKKGIYKENVEIGKKKKNVM  296

Query  743  LVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            LVGDGMD T ITG+ NV DGSTTF SAT    GDGF A+
Sbjct  297  LVGDGMDVTTITGSLNVIDGSTTFKSATVAAVGDGFIAQ  335



>ref|XP_010088582.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
 gb|EXB36723.1| Pectinesterase/pectinesterase inhibitor [Morus notabilis]
Length=658

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/216 (38%), Positives = 116/216 (54%), Gaps = 19/216 (9%)
 Frame = +2

Query  254  DCATLYADAEER-------LARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKG-----  397
            DCA L   +++R       L   ++  +  +D   WLS  +++H +CLDGL   G     
Sbjct  226  DCAELMDLSKDRVLDSISTLLLQNLTTHSREDVNAWLSGILTNHVTCLDGLERDGSYAKN  285

Query  398  -LVSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVVHKKPs-ssdggglldswssassK  571
             + SH          SL   L  FSQ +  +    +    P+  + G   L         
Sbjct  286  LMESHLNELISRARTSLA-ILVSFSQSK-FEALEPLTKDFPTWVTPGDRRLLRSLGKEIT  343

Query  572  ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVG  751
            A+IVVA+DGSG+Y ++NEAV+A+ +     + R+V+YV  GVY E  E+ +  KNVML+G
Sbjct  344  ADIVVAKDGSGDYTTVNEAVAAVPK---NSKKRLVIYVTTGVYYENFELAKNKKNVMLLG  400

Query  752  DGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            DGMD T+IT + N  DGSTTF SAT  V+GDGF A+
Sbjct  401  DGMDYTLITASLNADDGSTTFKSATVAVNGDGFIAQ  436



>emb|CAA47810.1| pectinesterase [Pisum sativum]
Length=554

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 98/292 (34%), Positives = 151/292 (52%), Gaps = 52/292 (18%)
 Frame = +2

Query  89   AIDTRNALT-----------ASNQD-----LLAIRT-ARSNVLRALEWSQSL-HELHEPS  214
            A+DT++ LT           A+ +D     L+++ T + S++ +A+E +  +   ++ P 
Sbjct  58   AVDTKSCLTHVSEVVQGQALANTKDHKLSTLISLLTKSTSHIQKAMETANVIKRRVNSPR  117

Query  215  RESGnnaaaaaVSDCATLYADAEERL--ARLDIEKYDHD---DAVTWLSAAMSSHRSCLD  379
             E+        ++DC  L   + +R+  + L + K + D   DA TWLS+ +++H +CL+
Sbjct  118  EETA-------LNDCEQLMDLSMDRVWDSVLTLTKNNIDSQQDAHTWLSSVLTNHATCLN  170

Query  380  GL----------NEKGLVSHGRHASQNLT--LSLKQALARFSQKRNVKTTRKVVHKKPss  523
            GL          + + L+S  R +   L   L  K       +  N +    V  K    
Sbjct  171  GLEGTSRVVMESDLQDLISRARSSLAVLVSVLPAKSNDGFIDESLNGEFPSWVTSKD---  227

Query  524  sdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYN  703
                  L   +    KAN+VVA+DGSG +K++ EAV++     + G+ R V+YVK G Y 
Sbjct  228  ----RRLLESTVGDIKANVVVAKDGSGKFKTVAEAVASAP---DNGKARYVIYVKRGTYK  280

Query  704  ERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            E+VEI +   NVMLVGDGMD TIITGN N  DG+TTF SAT    GDGF A+
Sbjct  281  EKVEIGKKKTNVMLVGDGMDATIITGNLNFIDGTTTFNSATVAAVGDGFIAQ  332



>gb|KDP34079.1| hypothetical protein JCGZ_07650 [Jatropha curcas]
Length=566

 Score =   120 bits (300),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 112/192 (58%), Gaps = 17/192 (9%)
 Frame = +2

Query  323  DDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQKRNVKTT---  493
            DD  +WLSAA S  ++C+DGL E G + +G+   +N T  +  +LA  +    V +T   
Sbjct  164  DDLRSWLSAAGSCQQTCIDGLEEAGKI-NGKDYLKNSTELISNSLAIITWIYKVSSTVNM  222

Query  494  RKVVH---------KKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALS  643
            R++++         K P+   +    L        KA+ VVA+DGSG YK I++A+ A+ 
Sbjct  223  RRLLNYPKNDRATMKMPTWLHEKERKLIESKDLKLKADAVVAKDGSGKYKRISDALKAVP  282

Query  644  RMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSA  823
               +  + R ++YVK G+Y E V IE+   NVM++GDGMD TI++GN NV DG+ TF +A
Sbjct  283  ---SKSKKRFIIYVKKGIYLENVRIEKSKWNVMVIGDGMDATIVSGNLNVVDGTPTFSTA  339

Query  824  TFRVSGDGFWAR  859
            TF V G GF AR
Sbjct  340  TFAVFGKGFVAR  351



>ref|XP_010692197.1| PREDICTED: pectinesterase 2 [Beta vulgaris subsp. vulgaris]
Length=527

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/216 (37%), Positives = 121/216 (56%), Gaps = 20/216 (9%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA---  421
            DC  +Y  + + L   +       DD  TWLS+A++  ++C +G  E G+  +       
Sbjct  103  DCLDVYELSIQGLNNTMTTSSCTKDDTQTWLSSALTLMQTCQNGFRELGVTENIMPMLSN  162

Query  422  SQNLTLSLKQALA--------RFSQKRNVKTTRKVVHK--KPsssdggglldswssassK  571
              N++  +  ALA        R  + ++   T+    +  +PS       + S      +
Sbjct  163  DNNVSCLISNALAINGDGSNGRRLEGQDWAGTKGGFPRWVRPSDRKLLQSVSSSG----R  218

Query  572  ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVG  751
            A++VVAQDGSG+YK+I +A+S  SR   GG GR V+Y+K G+Y E +EIE  +KN+ML+G
Sbjct  219  ADLVVAQDGSGDYKTIGQAISDASR--KGGSGRFVIYIKKGIYKENLEIEDKLKNIMLLG  276

Query  752  DGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            DG+ RTIITG+++V  GSTTF SAT  V G GF A+
Sbjct  277  DGIGRTIITGSKSVGGGSTTFRSATVAVMGSGFMAQ  312



>gb|EYU31969.1| hypothetical protein MIMGU_mgv1a005025mg [Erythranthe guttata]
Length=500

 Score =   119 bits (297),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 115/206 (56%), Gaps = 5/206 (2%)
 Frame = +2

Query  251  SDCATLYADAEERLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSH-GRHA  421
            +DC  LY      + +      K    DA TWLSAA+++  +C  G  + GL  +     
Sbjct  101  ADCIELYDSTIHAVNKTVDPTTKCTPADAQTWLSAALTNLETCKSGFVDFGLTDYIFPLM  160

Query  422  SQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGS  601
            S N++L L   LA       V                 G      S++ +AN+VVA+DGS
Sbjct  161  SNNVSLLLSNTLALNKGGAYVGGASNNNKDGFPRWVNTGDRKLLQSSNPRANVVVAKDGS  220

Query  602  GNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITG  781
            GN++++  AV+A  +    G GR V+YVK GVY+E V+I +G+KN+ML+GDG+ +TIITG
Sbjct  221  GNFRTVAAAVAAAGK--RTGSGRYVIYVKQGVYSENVDIGKGLKNIMLLGDGIGKTIITG  278

Query  782  NRNVQDGSTTFGSATFRVSGDGFWAR  859
            +R+V  GSTTF SATF V G GF AR
Sbjct  279  SRSVDGGSTTFKSATFSVVGSGFIAR  304



>ref|XP_010544633.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 84/213 (39%), Positives = 117/213 (55%), Gaps = 26/213 (12%)
 Frame = +2

Query  254  DCATLYADAEERLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKG-------LVS  406
            DC  LY     +L        K    DA TWLS+A+++  +C  G  E G       L+S
Sbjct  97   DCLKLYDYTVSKLNETVDPYVKCSKVDAQTWLSSALTNLETCRTGFIELGVPDFLLPLMS  156

Query  407  HGRHASQNLTLSLKQALARF--SQKRNVKTTRKVVHKKPsssdggglldswssassKANI  580
            +      + TL++ +    +  SQ+       +   +K              S++ +AN+
Sbjct  157  NNVSKLISNTLAINKVPFNYTPSQENGFPEWVRPGDRK-----------LLQSSTPQANV  205

Query  581  VVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGM  760
            VVA+DGSGN+++I EAV+A SR    G GR V+YVK GVYNE +EI    KN+ML GDG+
Sbjct  206  VVAKDGSGNFRTIKEAVNAASR--RSGSGRFVIYVKQGVYNENIEIR--AKNIMLRGDGI  261

Query  761  DRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             +TIITG+++V  GSTTF SAT  V GDGF AR
Sbjct  262  GKTIITGSKSVGGGSTTFNSATVAVVGDGFIAR  294



>ref|XP_009402517.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=527

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 80/208 (38%), Positives = 118/208 (57%), Gaps = 10/208 (5%)
 Frame = +2

Query  254  DCATLYADAEERLAR-LDIEK--YDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSH-----  409
            DC  LY +   +L R LD         D+ TWLSAA+++ ++CL G N+ G  S      
Sbjct  99   DCWKLYDNTVLQLNRTLDAPHGACTAFDSQTWLSAALTNLQTCLTGFNDTGTSSEIIEPV  158

Query  410  GRHASQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVA  589
             R+   +L +S   A+ R +             +   SS            S+ A++VVA
Sbjct  159  TRYNVSDL-ISNCLAINRPAAAAAATNVSTTTDRGRVSSWMMIANRRLLQLSASADLVVA  217

Query  590  QDGSGNYKSINEAV-SALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDR  766
            +DGSGN+++I EA+ +A +RM +G   + V+YVKAGVYNE V++   + N++++GDG+ +
Sbjct  218  KDGSGNFRTIKEALDAAAARMQSGRLSKFVIYVKAGVYNEYVQVTSSLSNLVMLGDGIGK  277

Query  767  TIITGNRNVQDGSTTFGSATFRVSGDGF  850
            TIITGNR+V  G TT  SATF V GDGF
Sbjct  278  TIITGNRSVASGYTTLSSATFSVFGDGF  305



>ref|XP_010476087.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Camelina 
sativa]
Length=550

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 119/218 (55%), Gaps = 23/218 (11%)
 Frame = +2

Query  248  VSDCATLYADAEERLAR---------LDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGL  400
            ++DC  +   +++R+           L+ E Y   +  TWLS+ ++++ +CLD  NE  +
Sbjct  122  LADCEEMMDVSKDRMVNSMEQLRGGNLNFESYS--NVHTWLSSVLTNYMTCLDTTNEPKV  179

Query  401  VSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVV---HKKPsssdggglldswssassK  571
                +   ++L    + ALA F      +   K+V   H     +     L      + K
Sbjct  180  ----KPQLEDLVSRARVALAIFVSVLPARDDLKMVLFDHFPSWLTALDRELLESDPKTIK  235

Query  572  --ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVML  745
              AN+VVA+DGSG +K++NEAV+A     N    R V+YVK GVY E ++I +  KN+ML
Sbjct  236  VNANVVVAKDGSGKFKTVNEAVAAAPENSNS---RYVIYVKKGVYKETIDIGKKKKNLML  292

Query  746  VGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            VGDG D TIITG+ NV DGSTTF SAT   +GDGF A+
Sbjct  293  VGDGKDATIITGSLNVVDGSTTFRSATIAANGDGFMAQ  330



>gb|ACJ85768.1| unknown [Medicago truncatula]
Length=554

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 117/221 (53%), Gaps = 27/221 (12%)
 Frame = +2

Query  248  VSDCATLYADAEERL--ARLDIEKYDHD---DAVTWLSAAMSSHRSCLDGL---------  385
            ++DC  L   + +R+  + L + K + D   DA TWLS+ +++H +CLDGL         
Sbjct  122  LNDCEELMDLSMDRVWDSVLTLTKNNIDSQHDAHTWLSSVLTNHATCLDGLEGSSRVVME  181

Query  386  -NEKGLVSHGRHASQNLT--LSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldsws  556
             +   L+S  R +   L   L  K       +K N      V  K          L   S
Sbjct  182  SDLHDLISRARSSLAVLVSVLPPKANDGFIDEKLNGDFPSWVTSKD-------RRLLESS  234

Query  557  sassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKN  736
                KAN+VVAQDGSG +K++ +AV++     + GE R V+YVK G Y E +EI +   N
Sbjct  235  VGDIKANVVVAQDGSGKFKTVAQAVASAP---DNGETRYVIYVKKGTYKENIEIGKKKTN  291

Query  737  VMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            VMLVGDGMD TIITG+ N  DG+TTF SAT    GDGF A+
Sbjct  292  VMLVGDGMDATIITGSLNFTDGTTTFKSATVAAVGDGFIAQ  332



>ref|XP_002456465.1| hypothetical protein SORBIDRAFT_03g036790 [Sorghum bicolor]
 gb|EES01585.1| hypothetical protein SORBIDRAFT_03g036790 [Sorghum bicolor]
Length=552

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 73/178 (41%), Positives = 103/178 (58%), Gaps = 9/178 (5%)
 Frame = +2

Query  335  TWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQA-LARFSQKRNVKTTRK----  499
            TWLSAA++ + +C DG+   G +     A      SL  A LA  S   +   +R     
Sbjct  154  TWLSAALTYYATCTDGVVVDGPLRDAVVARLEPLKSLASASLAVLSAVVDDSGSRDAGLA  213

Query  500  -VVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVV  676
               +  PS           + A+ +A++VVAQDGSG ++++ EAV A     +GG+ R V
Sbjct  214  DTTYTFPSWVPARDRALLEAGAAIEADVVVAQDGSGKFRTVKEAVDAAP---DGGKSRYV  270

Query  677  VYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGF  850
            +YVK GVY E VE+ +  + +M+VGDGMD T+ITG+RNV DG+TTF SAT  V+GDG 
Sbjct  271  IYVKKGVYKENVEVGKKKRELMIVGDGMDATVITGSRNVVDGATTFNSATLAVAGDGI  328



>gb|KDO64577.1| hypothetical protein CISIN_1g047288mg [Citrus sinensis]
Length=508

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 86/217 (40%), Positives = 117/217 (54%), Gaps = 35/217 (16%)
 Frame = +2

Query  254  DCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGR---HAS  424
            DC  LY D    L R  +   +  D+VTWLSAA+++  +C +G  +  L SH +     S
Sbjct  96   DCKDLYDDTVNHLNR-SMSSSNPIDSVTWLSAAIANQETCKNGFTDFNLHSHLQSLPFMS  154

Query  425  QNLTLSLKQALA-----------RFSQKRNVKTTRKVVHKKPs-ssdggglldswssass  568
             N +  L  +LA            ++ KRN    R +V+  P+  S     L   S    
Sbjct  155  GNFSKLLSNSLAITKSTVSSSSIPYAYKRN-GGRRLLVNGFPTWVSAADRRLLQSSGVGP  213

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLV  748
            KA++VVAQDGSGNYK+I+E V+A  ++G GG  RVV+YVK GVY E VEI+R +KN+ML+
Sbjct  214  KADVVVAQDGSGNYKTISEGVAAAVKLG-GGSKRVVIYVKRGVYRENVEIKRSMKNLMLI  272

Query  749  GDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            GDG+D TI+T                  VSG GF AR
Sbjct  273  GDGIDATIVT-----------------TVSGQGFIAR  292



>ref|XP_007025998.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
 gb|EOY28620.1| Pectinesterase/pectinesterase inhibitor, putative [Theobroma 
cacao]
Length=543

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 86/237 (36%), Positives = 124/237 (52%), Gaps = 33/237 (14%)
 Frame = +2

Query  194  HELHEPSRESGnnaaaaaVSDCATLYADAEERLA--RLDIEKYD---HDDAVTWLSAAMS  358
            H ++ P  ++        ++DC  L   + +R+A   + + K D   H DA  WLS+ ++
Sbjct  105  HRINNPRDQAA-------LADCLELMESSMDRIADSMVALGKKDVDSHSDAHAWLSSVLT  157

Query  359  SHRSCLDG-------LNEKGL---VSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVVH  508
            +H +CLDG       L E GL   +S  R  S  + +S+     RF      +    V  
Sbjct  158  NHVTCLDGVQGSARTLMEPGLNDLISRAR-TSLAVFVSISPGKTRFVDPSIDEFPSWVSS  216

Query  509  KKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVK  688
            K          L        KAN+VVA+DGSGNYK++ EAV+A     +  + R +++VK
Sbjct  217  KD-------RKLLQALLNEIKANVVVAKDGSGNYKTLAEAVAAAP---DKSKIRYIIHVK  266

Query  689  AGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             G Y E VEI +  KN+M+VGDGM+ TIITG+ N  DG+TTF SAT    GDGF A+
Sbjct  267  NGTYKENVEIGKKKKNLMIVGDGMNSTIITGSLNFVDGTTTFKSATVAAVGDGFIAQ  323



>gb|AFC98398.1| pectin methylesterase [Lepidium sativum]
Length=556

 Score =   119 bits (298),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 91/261 (35%), Positives = 139/261 (53%), Gaps = 25/261 (10%)
 Frame = +2

Query  125  QDLLAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLA---  295
            QDLL +   +++V R LE + S+  + E    S        +SDC  +   +++R+    
Sbjct  85   QDLLQV-FLKNSVWR-LERTTSI--VKEARTSSNGLNDKVGLSDCDEMMDVSKDRMVSSI  140

Query  296  ------RLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQ--NLTLSLKQ  451
                   L++E Y +    TWLS+ ++++ +C + + +  + S+ R   Q  +L    + 
Sbjct  141  KELRGGNLELESYSN--VHTWLSSVLTNYMTCQESITDVSVDSNSRVMPQLEDLVSRARV  198

Query  452  ALARFSQKRNVKTTRKVVHKKPsssdggglldswssassK-----ANIVVAQDGSGNYKS  616
            ALA F     VK   +++      S           ++ K     AN+VVA+DG+G +K+
Sbjct  199  ALAIFVSVTPVKDDLQMIVSNHFPSWLTTFDRKLLESAPKSLEVNANVVVAKDGTGKFKT  258

Query  617  INEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQ  796
            +NEAV+A     N    R VVYVK GVY E ++I +  KN+MLVGDG D TIITG+ NV 
Sbjct  259  VNEAVTAAPENSNS---RYVVYVKKGVYKETIDIGKKKKNLMLVGDGKDLTIITGSLNVV  315

Query  797  DGSTTFGSATFRVSGDGFWAR  859
            DGSTTF SAT   +GDGF A+
Sbjct  316  DGSTTFRSATVAANGDGFMAQ  336



>ref|XP_011017534.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Populus euphratica]
Length=389

 Score =   117 bits (294),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 88/129 (68%), Gaps = 6/129 (5%)
 Frame = +2

Query  479  NVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMG-N  655
            NVK+ R +  +KP+           S    KA+ VVAQDGSG +K+IN+A++AL + G N
Sbjct  46   NVKSGRGLKRRKPNGKILTSWNPENS----KADYVVAQDGSGTHKTINDALAALDKTGGN  101

Query  656  GGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQ-DGSTTFGSATFR  832
                RV+ YVKAGVYNE+V I++ ++N+M VGDG+DRTI+TGNRN + DG  T  +ATF 
Sbjct  102  RRNQRVIFYVKAGVYNEKVVIKKNMENLMFVGDGIDRTIVTGNRNAKRDGHATHETATFG  161

Query  833  VSGDGFWAR  859
            V  DGFWAR
Sbjct  162  VHADGFWAR  170



>ref|XP_009397166.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=553

 Score =   119 bits (297),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 87/229 (38%), Positives = 124/229 (54%), Gaps = 24/229 (10%)
 Frame = +2

Query  191  LHELHEPSRESGnnaaaaaVSDCATLYADAEERLARLDIEKYDH--DDAVTWLSAAMSSH  364
            L  L EP +++        ++DC  L   + +R+    +   D    DA TW+SA +++H
Sbjct  117  LRLLKEPKQQAA-------LADCMQLLQLSRDRI----VSSGDAAGTDARTWMSAVLTNH  165

Query  365  RSCLDGLNEKGLVSHGRH-----ASQNLTLSLKQALARFSQKRNVKTTRKVVHKKPs--s  523
             +CLDGL+     +   H     AS + +L++  A+   S+  N     K V   PS  S
Sbjct  166  ATCLDGLHGAAKSAMQAHLESLKASASASLAVLHAVPS-SEHDNDDDIVKPVATFPSWLS  224

Query  524  sdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYN  703
                 LL   S  + +AN VVA+DGSG +K++  AV ++    NG + R V+YVK GVY 
Sbjct  225  HRDRKLLQMTSPNAVQANAVVAKDGSGTFKTVQAAVDSVP---NGNKNRYVIYVKKGVYK  281

Query  704  ERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGF  850
            E V + +   NVM+VGDGMD T+ITG+ NV DGSTTF SAT    GDG 
Sbjct  282  ENVSLGKKTTNVMIVGDGMDATVITGSLNVVDGSTTFDSATLAAVGDGL  330



>ref|XP_010058445.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=445

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 113/216 (52%), Gaps = 29/216 (13%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLV-----SHGR  415
            +DC  LY  A   L R    +   DDA  WLSAA++   +C  G  E GL      S   
Sbjct  97   ADCLQLYEHAVLSLNRSIDHQCTPDDAQIWLSAALTDLDTCRTGFIELGLPDKMLPSMCN  156

Query  416  HASQNLTLSLKQALARFSQKRNVKTT--------RKVVHKKPsssdggglldswssassK  571
              S+ ++ +L      +    +            RK++H                S +S+
Sbjct  157  DISKLISDALSTNYVPYVMPNHTNEFPTWVRPGDRKLLHSS--------------SVASR  202

Query  572  ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVG  751
            ANI+VAQDGSGN+K+I EAV+A S+    G  R ++Y+KAG + E+VE+   + N+M VG
Sbjct  203  ANILVAQDGSGNFKTIGEAVTAASK--RSGTARYIIYIKAGTFEEKVELGLELTNIMFVG  260

Query  752  DGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            DG+ +TIITGNR+V  G +T  SAT  ++G GF A+
Sbjct  261  DGIGKTIITGNRSVGGGFSTLSSATVAITGVGFIAQ  296



>ref|XP_009622987.1| PREDICTED: pectinesterase 2.1-like [Nicotiana tomentosiformis]
Length=345

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 99/173 (57%), Gaps = 6/173 (3%)
 Frame = +2

Query  320  HDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARF---SQKRNVKT  490
            H +A  WLS  +++H +CLDGL+     +      + L    K ALA     +   N + 
Sbjct  158  HANAQVWLSGVLTNHVTCLDGLDSLSNTASTGTILEELISRAKTALAILASVTTDPNEEV  217

Query  491  TRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGR  670
             R ++ K P  S     L   S+   KAN VVAQDGSG+Y+++ EAV+A     +  + R
Sbjct  218  FRPLLGKIPWVSSSDRKLLESSAKDIKANAVVAQDGSGDYQTLTEAVAA---APDKSKNR  274

Query  671  VVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATF  829
             V+YVK G Y E VE+ +   N+M+VGDGM+ TIITG+ NV DGSTTF SAT 
Sbjct  275  YVIYVKKGTYKENVEVTKKKMNLMIVGDGMNSTIITGSLNVVDGSTTFRSATL  327



>ref|XP_010069353.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=537

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 119/226 (53%), Gaps = 22/226 (10%)
 Frame = +2

Query  248  VSDCATLYADAEERLARL------DIEKYDHDDAVTWLSAAMSSHRSCLDGLNE-----K  394
            ++DC  L+ D  + LA +        +    DD  TWLSA++++  +CLD L +     +
Sbjct  90   IADCLELFDDTIDLLANVVSCGGGTAKGCQPDDVETWLSASLTNQETCLDSLQDINKVRE  149

Query  395  GLVSHGRHASQNLTLSLKQALARFSQKRNVKTTRK------VVHKKPs-ssdggglldsw  553
              V   R  SQN++ SL   LA ++  R  K   +      +    P   S     L   
Sbjct  150  SRVDMMRTISQNISHSLNHTLALYASTRPTKEASRQRRRALLSDTFPHWVSGMERKLLEA  209

Query  554  ssassKANIVVAQDGSGNYKSINEAV----SALSRMGNGGEGRVVVYVKAGVYNERVEIE  721
                 KA+ VV++DG+G + +I EA+    ++ ++ G G +GR V+YVK+G Y E ++I 
Sbjct  210  PVEKIKASAVVSKDGTGTHTTIGEALLFVHASKAKEGGGSKGRTVIYVKSGTYKENLKIP  269

Query  722  RGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
               KNVMLVGDG  +T+I  +RN +DG TTF SAT    G+GF +R
Sbjct  270  SKQKNVMLVGDGKGKTVIVSDRNAKDGWTTFQSATVAAMGEGFMSR  315



>emb|CDY34642.1| BnaC08g42010D [Brassica napus]
Length=451

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 117/200 (59%), Gaps = 12/200 (6%)
 Frame = +2

Query  281  EERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHAS--QNLTLSLKQA  454
            E R   L++E Y   +  TWLS+ ++++ +CLD +++  + S  R     ++L    + A
Sbjct  37   ELRGGNLNLESYS--NVHTWLSSVLTNYMTCLDSISDVSIDSKHRVQPKLEDLVSRARVA  94

Query  455  LARF---SQKRNVKTTRKVVHKKP--sssdggglldswssassKANIVVAQDGSGNYKSI  619
            L+ F   S  ++       +H     +S D   L  +  +   KAN+VVA+DG+G YK++
Sbjct  95   LSIFVSVSPSKDYLEMILPIHFPSWLNSLDRKLLESAPKTLEVKANVVVAKDGTGKYKTV  154

Query  620  NEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQD  799
            NEAV+A     N    R V+YVK GVY E ++I +  KN+MLVGDG D TIITG+ NV D
Sbjct  155  NEAVAAAPENSNS---RYVIYVKKGVYKETIDIGKKKKNLMLVGDGKDVTIITGSLNVVD  211

Query  800  GSTTFGSATFRVSGDGFWAR  859
            GSTTF SAT   +GDGF A+
Sbjct  212  GSTTFRSATVAANGDGFMAQ  231



>ref|XP_009627969.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Nicotiana tomentosiformis]
Length=521

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 91/247 (37%), Positives = 131/247 (53%), Gaps = 16/247 (6%)
 Frame = +2

Query  134  LAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLAR-LDIE  310
            +A++ A    L+A  +++ L       RE          SDC  LY     +L + LD  
Sbjct  66   MAMQIAMERALQAETYTKQLGTKCRNEREKAAW------SDCVNLYESTILQLNKTLDPN  119

Query  311  KYDHD-DAVTWLSAAMSSHRSCLDGLNEKGLVSH---GRHASQNLTLSLKQALARFSQKR  478
                D D  TWLS A+++  +C  G  E G+ S        S N++  +   LA  +   
Sbjct  120  TKCTDFDTQTWLSTALTNLETCRTGFVELGVNSDYILPSIMSNNVSELICNTLALNNNGS  179

Query  479  NVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNG  658
             +K T K  +  P+    G      SS   + NIVVAQDG+GN+++I  A+ A ++    
Sbjct  180  TLKQTYK--YGFPTWFSPGDRKLLQSSTV-RPNIVVAQDGTGNFRTIKAALDAAAK--RS  234

Query  659  GEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVS  838
            G GR +++VK GVY E +EI   +KN+MLVGDG+  TIITG+R+V  GSTTF SAT  V+
Sbjct  235  GNGRFIIHVKRGVYRENLEIGSKMKNIMLVGDGLRYTIITGSRSVVGGSTTFKSATVAVT  294

Query  839  GDGFWAR  859
            G+GF AR
Sbjct  295  GEGFIAR  301



>ref|XP_010069351.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=537

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/226 (35%), Positives = 119/226 (53%), Gaps = 22/226 (10%)
 Frame = +2

Query  248  VSDCATLYADAEERLARL------DIEKYDHDDAVTWLSAAMSSHRSCLDGLNE-----K  394
            ++DC  L+ D  + LA +        +    DD  TWLSA++++  +CLD L +     +
Sbjct  90   IADCLELFDDTIDLLANVVSCGGGTAKGCQPDDVETWLSASLTNQETCLDSLQDINKVRE  149

Query  395  GLVSHGRHASQNLTLSLKQALARFSQKRNVKTTRK------VVHKKPs-ssdggglldsw  553
              V   R  SQN++ SL   LA ++  R  K   +      +    P   S     L   
Sbjct  150  SRVDMMRTISQNISHSLNHTLALYASTRPTKEASRQRRRALLSDTFPHWVSGTERKLLEA  209

Query  554  ssassKANIVVAQDGSGNYKSINEAV----SALSRMGNGGEGRVVVYVKAGVYNERVEIE  721
                 KA+ VV++DG+G + +I EA+    ++ ++ G G +GR V+YVK+G Y E ++I 
Sbjct  210  PVEKIKASAVVSKDGTGTHTTIGEALLFVHASKAKEGGGSKGRTVIYVKSGTYKENLKIP  269

Query  722  RGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
               KNVMLVGDG  +T+I  +RN +DG TTF SAT    G+GF +R
Sbjct  270  SKQKNVMLVGDGKGKTVIVSDRNAKDGWTTFQSATVAAMGEGFMSR  315



>ref|XP_009118185.1| PREDICTED: pectinesterase/pectinesterase inhibitor 18 [Brassica 
rapa]
Length=556

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 114/212 (54%), Gaps = 36/212 (17%)
 Frame = +2

Query  281  EERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHAS--QNLTLSLKQA  454
            E R   L++E Y   +  TWLS+ ++++ +CLD +++  + S  R     ++L    + A
Sbjct  142  ELRGGNLNLESYS--NVHTWLSSVLTNYMTCLDSISDVSIDSKHRVQPKLEDLVSRARVA  199

Query  455  LARFSQKRNVK-----------------TTRKVVHKKPsssdggglldswssassKANIV  583
            L+ F      K                   RK++   P + +             KAN+V
Sbjct  200  LSIFVSVLPSKDYLEMILPIHFPSWLNSLDRKLLESAPKTFEV------------KANVV  247

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            VA+DG+G YK++NEAV+A     N    R V+YVK GVY E ++I +  KN+MLVGDG D
Sbjct  248  VAKDGTGKYKTVNEAVAAAPENSNS---RYVIYVKKGVYKETIDIGKKKKNLMLVGDGKD  304

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
             TIITG+ NV DGSTTF SAT   +GDGF A+
Sbjct  305  VTIITGSLNVVDGSTTFRSATVAANGDGFMAQ  336



>ref|XP_002301275.2| hypothetical protein POPTR_0002s14660g [Populus trichocarpa]
 gb|EEE80548.2| hypothetical protein POPTR_0002s14660g [Populus trichocarpa]
Length=389

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +2

Query  569  KANIVVAQDGSGNYKSINEAVSALSRMG-NGGEGRVVVYVKAGVYNERVEIERGIKNVML  745
            KA+ VVAQDGSG +K+IN+A++AL + G N    RV+VYVKAGVYNE+V I++ ++ +M 
Sbjct  72   KADYVVAQDGSGTHKTINDALAALDKTGGNRRNQRVIVYVKAGVYNEKVVIKKNMEKLMF  131

Query  746  VGDGMDRTIITGNRNVQ-DGSTTFGSATFRVSGDGFWAR  859
            VGDG+DRTI+TGNRN + DG  T  +ATF V  DGFWAR
Sbjct  132  VGDGIDRTIVTGNRNAKRDGYATHETATFGVHADGFWAR  170



>ref|XP_004168287.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 17-like, partial [Cucumis sativus]
Length=284

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/199 (38%), Positives = 107/199 (54%), Gaps = 21/199 (11%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQN  430
            +DC  LY     RL R    +    DA TWLSAA+++  +C  G  E GL + G   + N
Sbjct  99   TDCVDLYDQIITRLNRTS-ARCSPADAQTWLSAALTALETCRTGFEELGLSAFGYPLTAN  157

Query  431  LT-------LSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVA  589
                     LS+ +  +    +    T        P +               KA++VVA
Sbjct  158  NVSKLISDGLSVNKPASPEGYEPTTMTDGFPTWVSPGNRKLLQSESP------KADVVVA  211

Query  590  QDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRT  769
            QDGSGN+K++ +A+SA       G GR V+Y+K+GVYNE ++I+   KNVM+VGDG+ +T
Sbjct  212  QDGSGNFKTVKDAISAAK-----GGGRFVIYIKSGVYNENLDIKA--KNVMMVGDGIGKT  264

Query  770  IITGNRNVQDGSTTFGSAT  826
            IITG+R+V  GSTTF SAT
Sbjct  265  IITGSRSVGGGSTTFRSAT  283



>ref|XP_002527752.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF34613.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=583

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 123/205 (60%), Gaps = 17/205 (8%)
 Frame = +2

Query  296  RLDIEKYDHDDAVTWLSAAMSSHRSCLDGL-NEKGL---------VSHGRHASQNLTLSL  445
            R +  K+ H+D  TWLSAA+++  +C++ L N+K L         +   R+ SQ+++ SL
Sbjct  164  RKNNPKHTHNDVQTWLSAALTNQETCIESLQNDKLLFKLDRGQEMIRTARNLSQHISNSL  223

Query  446  KQALARF-SQKRNVKTTRKVVHKK--Ps-ssdggglldswssassKANIVVAQDGSGNYK  613
               ++ + + K + K  RK++     P+  S+    L     A  KA+ VVA+DGSG + 
Sbjct  224  ALYMSHYYNTKESNKGGRKLLSGDDFPAWVSESERKLLETPVAEIKAHAVVAKDGSGTHT  283

Query  614  SINEAVS---ALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGN  784
            +I EA++   + S  G GG GR V+YVKAG Y+E +++    KNVMLVGDG  +++ITG+
Sbjct  284  TIGEAIAEVMSYSLAGEGGGGRNVIYVKAGTYHENLKLPTKQKNVMLVGDGKGKSVITGS  343

Query  785  RNVQDGSTTFGSATFRVSGDGFWAR  859
            R+  DG +TF +AT  V GDGF A+
Sbjct  344  RSADDGYSTFQTATVSVMGDGFMAK  368



>gb|KCW73025.1| hypothetical protein EUGRSUZ_E01468, partial [Eucalyptus grandis]
Length=513

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 92/256 (36%), Positives = 125/256 (49%), Gaps = 37/256 (14%)
 Frame = +2

Query  152  RSNVLRA-----LEWSQSLHELHEPSRESGnnaaaaaVS--DCATLYADAEERLARLDIE  310
            RS+ LRA     LE +Q L + H  S  SG +      +  DC  LY      L R    
Sbjct  58   RSHFLRASMQVALESAQ-LAQTHTYSLGSGCHDEREKAAWADCLKLYEHTVHHLNRTINR  116

Query  311  KYDHDDAVTWLSAAMSSHRSCLDGLNEKG-------LVSHGRHASQNLTLSLKQALARFS  469
            +   DD  TWLSAA+++ ++C  G  E G       L+S+      + TLS         
Sbjct  117  RCTQDDMQTWLSAALTNLQTCGTGFVELGISDNVLPLMSNNVSKLISNTLSANYVPYTTP  176

Query  470  QKRNVKTT------RKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAV  631
               N   T      RK++   P  S               ANI+VAQDGSGNYK+INEAV
Sbjct  177  NYTNEFPTWVRLGDRKLLQSSPMLST--------------ANIMVAQDGSGNYKTINEAV  222

Query  632  SALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTT  811
            +    +      R ++Y+KAG Y E VE+   ++N+  VGDG+ +TIITG+++   G TT
Sbjct  223  TV--GLMRSDTTRFIIYIKAGTYEENVEVGSKLENIAFVGDGIGKTIITGSKSNAGGFTT  280

Query  812  FGSATFRVSGDGFWAR  859
            F SAT  V GDGF A+
Sbjct  281  FNSATVAVDGDGFIAQ  296



>ref|XP_006377839.1| hypothetical protein POPTR_0011s13830g [Populus trichocarpa]
 gb|ERP55636.1| hypothetical protein POPTR_0011s13830g [Populus trichocarpa]
Length=550

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 109/181 (60%), Gaps = 7/181 (4%)
 Frame = +2

Query  317  DHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHASQNLTLSLKQALARFSQ--KRNVKT  490
            D  DA TWLS  +++H +CLDG++     S  +   Q+L   ++ +LA  S     +   
Sbjct  151  DASDANTWLSGVLTNHVTCLDGIDTIDQPSM-KKLLQDLISRMRTSLAAVSSLSASDTDL  209

Query  491  TRKVVHKKPs-ssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEG  667
             + +    PS        L   S ++ +AN+VVAQDGSG+  +I E+V+++    +  + 
Sbjct  210  VQPLNGGFPSWILGRDRKLLESSVSTVEANVVVAQDGSGDNTTIQESVNSVP---DKSKS  266

Query  668  RVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDG  847
            R V+ VK+G+Y E VE+ +  KNVM+VGDGMD TI+TGN NV DGSTTF SAT  V+GDG
Sbjct  267  RYVICVKSGIYKENVEVGKKKKNVMIVGDGMDSTILTGNLNVVDGSTTFRSATLAVAGDG  326

Query  848  F  850
            F
Sbjct  327  F  327



>ref|XP_010910881.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 117/189 (62%), Gaps = 16/189 (8%)
 Frame = +2

Query  320  HDDAVTWLSAAMSSHRSCLDGLNEKG---------LVSHGRHASQNLTLSLKQALARFSQ  472
            +DDA TWLSAAM++ ++C +G  E G          +SH      + +L++ +A+A    
Sbjct  114  YDDAQTWLSAAMANQQTCRNGFIELGSSFPLDSLPFMSHNISELLSNSLAINKAMAPAKS  173

Query  473  KRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMG  652
              N    R ++     +           S++  A++VVA+DGSG+Y +I+ A++A S+  
Sbjct  174  GGN----RGLLLDGFPNWLSASDRKFLQSSAINADLVVAKDGSGDYDTISAAIAAASKQS  229

Query  653  NGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFR  832
            NG   R V++VKAGVYNE   I+  +KN+ ++GDG++ TI+TG++NV+DGSTTF SATF 
Sbjct  230  NG-TSRFVIHVKAGVYNE--NIDTSMKNLTIIGDGINATIVTGSKNVKDGSTTFRSATFA  286

Query  833  VSGDGFWAR  859
            V+GDGF AR
Sbjct  287  VTGDGFIAR  295



>dbj|BAC67662.1| pectin methylesterase [Pisum sativum]
Length=553

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 122/221 (55%), Gaps = 27/221 (12%)
 Frame = +2

Query  248  VSDCATLYADAEERL--ARLDIEKYDHD---DAVTWLSAAMSSHRSCLDGL---------  385
            ++DC  L   + ER+  + L + + + D   DA TWLS+ +++H +CLDGL         
Sbjct  122  LNDCEQLMKLSIERVWDSVLTLTQDNMDSQQDAHTWLSSVLTNHATCLDGLEGTSRMVME  181

Query  386  -NEKGLVSHGRHASQNLTLSLKQALARFSQKRNVKTTRKVVHKK-Ps-ssdggglldsws  556
             + + L+S  R        SL   +A   +K N     + ++ + PS  +     L   S
Sbjct  182  SDLQDLISRARS-------SLAVLVAVLPEKSNDGFIDESLNGEFPSWVTSKDRRLLESS  234

Query  557  sassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKN  736
                 AN+VVA+DGSG +K++ EAV+++    N G+ R V+YVK G Y E VEI     N
Sbjct  235  VGDITANVVVAKDGSGKFKTVAEAVASVP---NKGKTRYVIYVKKGTYKENVEISSQKTN  291

Query  737  VMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            VMLVGDGMD TIITG+ NV DG+ TF SAT    GDGF A+
Sbjct  292  VMLVGDGMDATIITGSLNVVDGTGTFQSATVAAVGDGFIAQ  332



>gb|KCW73024.1| hypothetical protein EUGRSUZ_E01466, partial [Eucalyptus grandis]
Length=523

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/205 (39%), Positives = 111/205 (54%), Gaps = 7/205 (3%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-ASQ  427
            +DC  LY      L R    +   DD  TWLSAA+++ ++C  G  E G+  +     S 
Sbjct  97   ADCLKLYEHTVHHLNRTINRQCTQDDMQTWLSAALTNLQTCGTGFVELGISDNVLPLMSN  156

Query  428  NLTLSLKQALARFSQKRNVKTTRKVVHKKPs-ssdggglldswssassKANIVVAQDGSG  604
            N++  +   L   S      TT    ++ P+        L   S   S ANI+VAQDGSG
Sbjct  157  NVSKLISNTL---SANYVPYTTLNYTNEFPTWVRPSDRKLLQSSPVLSTANIMVAQDGSG  213

Query  605  NYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGN  784
            NYK+INEAV+A   +      R ++Y+KAG Y E VE+   ++N+  VGDG+ +TIITG+
Sbjct  214  NYKTINEAVTA--ALMRSDTTRFIIYIKAGTYEENVEVGSKLENIAFVGDGIGKTIITGS  271

Query  785  RNVQDGSTTFGSATFRVSGDGFWAR  859
            ++   G TTF SAT  V GDGF A+
Sbjct  272  KSNAGGFTTFHSATVAVDGDGFIAQ  296



>ref|XP_006576426.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=517

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 84/216 (39%), Positives = 123/216 (57%), Gaps = 28/216 (13%)
 Frame = +2

Query  251  SDCATLYADAEERLAR-LDIE---KYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH  418
            +DC  LY     +L   L+ +   KY   DA TWLS A+++  +C  G  E G+  +   
Sbjct  98   ADCVELYEQTIRKLNETLNPDPNTKYSQVDAQTWLSTALTNLETCKAGFYELGVQDYVLP  157

Query  419  -ASQNLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdgggl--------ldswssassK  571
              S N+T  L   L+            KV +++PS  +G           L   SS +S+
Sbjct  158  LMSNNVTKLLSNTLS----------LNKVEYEEPSYKEGFPKWVKPDDRKLLQSSSPASR  207

Query  572  ANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVG  751
            AN+VVA+DGSG Y +++ AV++  +      GR V+YVK G+YNE+VE++   KN+MLVG
Sbjct  208  ANVVVAKDGSGKYTTVSAAVNSAPK---NSRGRYVIYVKGGIYNEQVEVKS--KNIMLVG  262

Query  752  DGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            DG+ +TIITG+++V  G+TTF SAT  V GDGF A+
Sbjct  263  DGIGKTIITGSKSVGGGTTTFRSATVAVVGDGFIAQ  298



>dbj|BAK05307.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=548

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 115/210 (55%), Gaps = 14/210 (7%)
 Frame = +2

Query  248  VSDCATLYADAEERLA-RLDIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLV-SHGRHA  421
            ++DC  L   A ERLA   D  K   +DA TWLSAA++ H +CLDGL+   L  + G H 
Sbjct  119  LADCVQLMELARERLAGAADRAKVAPEDARTWLSAALTDHVTCLDGLDGGPLRDAVGAHL  178

Query  422  SQ-----NLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKA---N  577
                   + +L++  A+   +        R V   +  S              ++A   +
Sbjct  179  EPLESLASASLAVLNAVGSGTAA-AADIARDVAADELPSWLPTADRALLELEGARAVQPD  237

Query  578  IVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDG  757
            +VVA+DGSG Y ++  AV A     +GG+ R V+YVK GVY E +E+ +  + +M+V DG
Sbjct  238  VVVAKDGSGKYTTVQAAVDAAP---DGGKSRYVIYVKKGVYKENLEVGKKKRKLMIVRDG  294

Query  758  MDRTIITGNRNVQDGSTTFGSATFRVSGDG  847
            MD T+ITG+RNV DG+TTF SAT  V+ DG
Sbjct  295  MDATVITGSRNVVDGATTFNSATLAVAADG  324



>ref|XP_010257625.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   117 bits (292),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 83/209 (40%), Positives = 118/209 (56%), Gaps = 20/209 (10%)
 Frame = +2

Query  254  DCATLYADAEERLARL--DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRH-AS  424
            DC  LY D   +L R    I      D  TWLS A+++  +C  G+ E G+        S
Sbjct  107  DCLKLYEDTILQLNRTLNPIANCTDSDTQTWLSTALTNLDTCKAGIVELGVSDVLLPLVS  166

Query  425  QNLTLSLKQALAR---FSQKRN----VKTTRKVVHKKPsssdggglldswssassKANIV  583
             N++  +  ALA     S+++N      T      +K         L   SS +S+AN+V
Sbjct  167  NNVSHLISNALAINDIPSEQQNYTGGFPTWVSAADRK---------LLQSSSLASRANLV  217

Query  584  VAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMD  763
            VAQDGSG++++I  A+SA S++  G   R ++YVKAGVY E +EI   + N+ML+GDGM 
Sbjct  218  VAQDGSGHFRTIKAAISAASKLRRGSR-RFIIYVKAGVYRENIEIGNNMPNIMLIGDGMR  276

Query  764  RTIITGNRNVQDGSTTFGSATFRVSGDGF  850
            RT+ITG+R+V+ G TTF SAT  VSG+ F
Sbjct  277  RTLITGSRSVRKGYTTFNSATVAVSGERF  305



>ref|NP_001275775.1| pectinesterase 2 precursor [Citrus sinensis]
 gb|AAB57671.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 107/184 (58%), Gaps = 21/184 (11%)
 Frame = +2

Query  326  DAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA-SQNLTLSLKQALARFSQKRNVKTTRKV  502
            D  TWLS+A+++  +C   L + G+  +     S N+T  +  AL+            KV
Sbjct  123  DKQTWLSSALTNLETCRASLEDLGVPEYVLPLLSNNVTKLISNALS----------LNKV  172

Query  503  VHKKPsssdggglldsw-----ssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEG  667
             + +PS  DG               + +ANIVVAQDGSGN K+I EAV+A SR G     
Sbjct  173  PYNEPSYKDGFPTWVKPGDRKLLQTTPRANIVVAQDGSGNVKTIQEAVAAASRAGGS---  229

Query  668  RVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDG  847
            R V+Y+KAG YNE +E++  +KN+M VGDG+ +TIITG+++V  G+TTF SAT  V GD 
Sbjct  230  RYVIYIKAGTYNENIEVK--LKNIMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDN  287

Query  848  FWAR  859
            F AR
Sbjct  288  FIAR  291



>ref|XP_009773838.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=524

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 86/247 (35%), Positives = 126/247 (51%), Gaps = 13/247 (5%)
 Frame = +2

Query  134  LAIRTARSNVLRALEWSQSLHELHEPSRESGnnaaaaaVSDCATLYADAEERLAR-LDIE  310
            +A++ A    L A  +++ L       RE          SDC  LY     +L + LD  
Sbjct  66   MAMQIAMERALEAETYTKQLGAKCRNEREKAAW------SDCVNLYESTILQLNKTLDPN  119

Query  311  KYDHD-DAVTWLSAAMSSHRSCLDGLNEKGLVSH---GRHASQNLTLSLKQALARFSQKR  478
                D D  TWLS A+++  +C  G  E G+ S        S N++  +   LA      
Sbjct  120  TKCTDFDTQTWLSTALTNLETCRTGFVELGVNSDYILPSLMSNNVSELICNTLAL--NNI  177

Query  479  NVKTTRKVVHKKPsssdggglldswssassKANIVVAQDGSGNYKSINEAVSALSRMGNG  658
            N  T ++       +    G       +S + N+VVAQDG+GN+++I  A+ A ++    
Sbjct  178  NGSTLKQTYRDGFPTWVPPGDRKLLQLSSIRPNLVVAQDGTGNFRTIKAALDAAAKRSGN  237

Query  659  GEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVS  838
            G GR +++VK G Y E +EI   +KN+MLVGDG+  TIITG+R+V  GSTTF SAT  V+
Sbjct  238  GNGRFIIHVKRGAYRENLEIGNKMKNIMLVGDGLRYTIITGSRSVVGGSTTFKSATVAVT  297

Query  839  GDGFWAR  859
            G+GF AR
Sbjct  298  GEGFIAR  304



>ref|XP_006445298.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
 gb|ESR58538.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
Length=510

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 107/184 (58%), Gaps = 21/184 (11%)
 Frame = +2

Query  326  DAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA-SQNLTLSLKQALARFSQKRNVKTTRKV  502
            D  TWLS+A+++  +C   L + G+  +     S N+T  +  AL+            KV
Sbjct  123  DKQTWLSSALTNLETCRASLEDLGVPEYVLPLLSNNVTKLISNALS----------LNKV  172

Query  503  VHKKPsssdggglldsw-----ssassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEG  667
             + +PS  DG               + +ANIVVAQDGSGN K+I EAV+A SR G     
Sbjct  173  PYNEPSYKDGFPTWVKPGDRKLLQTTPRANIVVAQDGSGNVKTIQEAVAAASRAGGS---  229

Query  668  RVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDG  847
            R V+Y+KAG YNE +E++  +KN+M VGDG+ +TIITG+++V  G+TTF SAT  V GD 
Sbjct  230  RYVIYIKAGTYNENIEVK--LKNIMFVGDGIGKTIITGSKSVGGGATTFKSATVAVVGDN  287

Query  848  FWAR  859
            F AR
Sbjct  288  FIAR  291



>ref|XP_010271266.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=532

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/221 (37%), Positives = 126/221 (57%), Gaps = 25/221 (11%)
 Frame = +2

Query  251  SDCATLYADAEERLARLDIEKYDHD---DAVTWLSAAMSSHRSCLDG---LNEKGLVSHG  412
            +DC  LYAD   +L R  +   +     +A TWLSAA+++ ++C +G   LN    +S  
Sbjct  100  ADCVELYADTITQLNRTVLVTQNPLAWWNAQTWLSAAIANEQTCQNGFLDLNMSSYLSSF  159

Query  413  RHASQNLTLSLKQALARFSQKRNVKTTRKVVHKK-----------Ps-ssdggglldsws  556
             +   N +  +  +LA    K +V +   ++ K+           P+  S     L    
Sbjct  160  PYMLSNFSKMVSNSLAI--NKASVLSAASLLGKQGGNRRLLSDGFPTWVSAADRKLLQSP  217

Query  557  sassKANIVVAQDGSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKN  736
             A+ +A++VVA DGSGNYK+I++AV+A      GG  R V+YVK GVY E VEI+    N
Sbjct  218  GAALRADVVVAADGSGNYKTISQAVAAAP---GGGSKRFVIYVKRGVYKETVEIKA--PN  272

Query  737  VMLVGDGMDRTIITGNRNVQDGSTTFGSATFRVSGDGFWAR  859
            +ML+GDG+D T++TG++++QD  T+F SAT  ++G+GF AR
Sbjct  273  IMLIGDGIDVTVVTGSKSIQDAGTSFRSATVGITGNGFIAR  313



>gb|AAX93021.1| hypothetical protein LOC_Os11g07090 [Oryza sativa Japonica Group]
 gb|AAX95081.1| Similar to pectinesterase 2.1 precursor (ec 3.1.1.11) (pectin 
methylesterase)(pe) [Oryza sativa Japonica Group]
 gb|ABA91640.1| Pectinesterase family protein, expressed [Oryza sativa Japonica 
Group]
Length=533

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 109/198 (55%), Gaps = 9/198 (5%)
 Frame = +2

Query  251  SDCATLYADAEERLARL---DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA  421
            +DC  L A A   L R         D DD   WLSAA ++  +CLDG  E G       A
Sbjct  77   ADCDQLVAFAVGHLNRTVAAAARGVDGDDVAAWLSAARTTVGTCLDGFGELGASPGPEFA  136

Query  422  SQ--NLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQD  595
            +   N++  +  ALA  + +R  +   +           G +L    +    A++VVA+D
Sbjct  137  AALANVSRLVTDALAATALRRGTENGARAATNS--GDGDGRMLPLDMARPGDADVVVAKD  194

Query  596  GSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTII  775
            G+G++ ++ EA+ A +R    G GR VVYVKAGVYNE VE+     N+MLVGDG+ RT+I
Sbjct  195  GTGHFCTVGEALKAAARRATNGGGRTVVYVKAGVYNENVEVW--TTNLMLVGDGIGRTVI  252

Query  776  TGNRNVQDGSTTFGSATF  829
            TG+R+V+ G TTF SATF
Sbjct  253  TGSRSVRGGYTTFSSATF  270



>gb|EAZ17589.1| hypothetical protein OsJ_33128 [Oryza sativa Japonica Group]
Length=533

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/198 (39%), Positives = 109/198 (55%), Gaps = 9/198 (5%)
 Frame = +2

Query  251  SDCATLYADAEERLARL---DIEKYDHDDAVTWLSAAMSSHRSCLDGLNEKGLVSHGRHA  421
            +DC  L A A   L R         D DD   WLSAA ++  +CLDG  E G       A
Sbjct  77   ADCDQLVAFAVGHLNRTVAAAARGVDGDDVAAWLSAARTTVGTCLDGFGELGASPGPEFA  136

Query  422  SQ--NLTLSLKQALARFSQKRNVKTTRKVVHKKPsssdggglldswssassKANIVVAQD  595
            +   N++  +  ALA  + +R  +   +           G +L    +    A++VVA+D
Sbjct  137  AALANVSRLVTDALAATALRRGTENGARAATNS--GDGDGRMLPLDMARPGDADVVVAKD  194

Query  596  GSGNYKSINEAVSALSRMGNGGEGRVVVYVKAGVYNERVEIERGIKNVMLVGDGMDRTII  775
            G+G++ ++ EA+ A +R    G GR VVYVKAGVYNE VE+     N+MLVGDG+ RT+I
Sbjct  195  GTGHFCTVGEALKAAARRATNGGGRTVVYVKAGVYNENVEVW--TTNLMLVGDGIGRTVI  252

Query  776  TGNRNVQDGSTTFGSATF  829
            TG+R+V+ G TTF SATF
Sbjct  253  TGSRSVRGGYTTFSSATF  270



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1700790535626