BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25441_g2_i1 len=864 path=[27856:0-863]

Length=864
                                                                      Score     E

ref|XP_009628695.1|  PREDICTED: probable pectinesterase/pectinest...    353   1e-115   
ref|XP_006347998.1|  PREDICTED: probable pectinesterase/pectinest...    353   2e-115   
ref|XP_009764218.1|  PREDICTED: probable pectinesterase/pectinest...    353   3e-115   
ref|XP_010513751.1|  PREDICTED: probable pectinesterase/pectinest...    346   2e-114   
emb|CDX71786.1|  BnaC08g30880D                                          348   5e-113   
ref|XP_009116752.1|  PREDICTED: probable pectinesterase/pectinest...    347   1e-112   
emb|CDY41145.1|  BnaA09g38700D                                          347   1e-112   
ref|XP_004231159.2|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    346   2e-112   
ref|XP_010247589.1|  PREDICTED: probable pectinesterase/pectinest...    345   4e-112   
ref|XP_010544635.1|  PREDICTED: probable pectinesterase/pectinest...    344   4e-112   
ref|XP_006402549.1|  hypothetical protein EUTSA_v10006472mg             344   1e-111   
ref|XP_006292970.1|  hypothetical protein CARUB_v10019247mg             343   3e-111   
ref|XP_003521962.2|  PREDICTED: probable pectinesterase/pectinest...    342   5e-111   
gb|KHN35621.1|  Putative pectinesterase/pectinesterase inhibitor 36     342   6e-111   
ref|NP_191632.2|  putative pectinesterase/pectinesterase inhibito...    341   2e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KEH29120.1|  pectinesterase/pectinesterase inhibitor                 339   5e-110   
ref|XP_010469150.1|  PREDICTED: probable pectinesterase/pectinest...    340   1e-109   
ref|XP_002876579.1|  pectinesterase family protein                      339   1e-109   
ref|XP_011090455.1|  PREDICTED: probable pectinesterase/pectinest...    338   2e-109   
ref|XP_007134835.1|  hypothetical protein PHAVU_010G080300g             336   7e-109   
gb|AAP04164.1|  putative pectinesterase                                 337   8e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413524.1|  PREDICTED: probable pectinesterase/pectinest...    337   2e-108   
ref|XP_010692199.1|  PREDICTED: probable pectinesterase/pectinest...    332   5e-108   
ref|XP_010058465.1|  PREDICTED: probable pectinesterase/pectinest...    333   2e-107   
ref|XP_002511680.1|  Pectinesterase-2 precursor, putative               330   7e-107   Ricinus communis
ref|XP_010941122.1|  PREDICTED: pectinesterase                          330   2e-106   
ref|XP_004506985.1|  PREDICTED: probable pectinesterase/pectinest...    328   7e-106   
ref|XP_003553884.1|  PREDICTED: probable pectinesterase/pectinest...    326   4e-105   
gb|EYU31970.1|  hypothetical protein MIMGU_mgv1a025432mg                324   3e-104   
ref|XP_010661658.1|  PREDICTED: probable pectinesterase/pectinest...    323   5e-104   
ref|XP_007219055.1|  hypothetical protein PRUPE_ppa004770mg             323   7e-104   
emb|CAB82677.1|  pectinesterase-like protein                            322   2e-103   Arabidopsis thaliana [mouse-ear cress]
emb|CAN75818.1|  hypothetical protein VITISV_005130                     321   5e-103   Vitis vinifera
ref|XP_008232608.1|  PREDICTED: probable pectinesterase/pectinest...    320   1e-102   
ref|XP_010271283.1|  PREDICTED: pectinesterase                          320   7e-102   
ref|XP_002314796.1|  pectin methylesterase 6 family protein             320   7e-102   Populus trichocarpa [western balsam poplar]
ref|XP_010271268.1|  PREDICTED: pectinesterase-like                     318   2e-101   
ref|XP_002527782.1|  Pectinesterase-1 precursor, putative               317   6e-101   Ricinus communis
ref|XP_008794816.1|  PREDICTED: pectinesterase                          315   6e-101   
gb|KDP28779.1|  hypothetical protein JCGZ_14550                         315   6e-101   
ref|XP_007052105.1|  Plant invertase/pectin methylesterase inhibi...    317   2e-100   
ref|XP_010271269.1|  PREDICTED: pectinesterase-like                     314   9e-100   
ref|XP_004134349.1|  PREDICTED: probable pectinesterase/pectinest...    313   1e-99    
ref|XP_004168286.1|  PREDICTED: probable pectinesterase/pectinest...    312   1e-99    
ref|XP_008438191.1|  PREDICTED: probable pectinesterase/pectinest...    312   2e-99    
ref|XP_011038599.1|  PREDICTED: pectinesterase-like                     313   2e-99    
ref|XP_010266280.1|  PREDICTED: pectinesterase-like                     313   3e-99    
ref|XP_008812473.1|  PREDICTED: pectinesterase-like                     312   4e-99    
gb|KEH15723.1|  pectinesterase                                          302   5e-99    
ref|XP_010654104.1|  PREDICTED: pectinesterase                          311   1e-98    
ref|XP_008372811.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    304   2e-98    
ref|XP_008389982.1|  PREDICTED: pectinesterase                          311   2e-98    
gb|KEH21378.1|  pectinesterase                                          305   3e-98    
emb|CDO97715.1|  unnamed protein product                                309   5e-98    
emb|CAN77092.1|  hypothetical protein VITISV_026596                     308   6e-98    Vitis vinifera
ref|XP_003630894.1|  Pectinesterase                                     301   3e-97    
ref|XP_010101977.1|  putative pectinesterase/pectinesterase inhib...    306   4e-97    
gb|KDP38089.1|  hypothetical protein JCGZ_04732                         307   6e-97    
ref|XP_010271267.1|  PREDICTED: pectinesterase-like                     306   1e-96    
ref|XP_004503381.1|  PREDICTED: probable pectinesterase/pectinest...    306   1e-96    
ref|XP_010271266.1|  PREDICTED: pectinesterase-like                     305   4e-96    
ref|XP_008775930.1|  PREDICTED: pectinesterase-like                     304   4e-96    
ref|XP_009385345.1|  PREDICTED: pectinesterase-like                     305   4e-96    
gb|KEH21379.1|  pectinesterase/pectinesterase inhibitor                 305   5e-96    
ref|XP_007222925.1|  hypothetical protein PRUPE_ppa005208mg             302   6e-96    
ref|XP_004297462.1|  PREDICTED: probable pectinesterase/pectinest...    305   7e-96    
ref|XP_010910186.1|  PREDICTED: pectinesterase-like                     303   2e-95    
ref|XP_006826911.1|  hypothetical protein AMTR_s00010p00161740          302   2e-95    
ref|XP_010101979.1|  putative pectinesterase/pectinesterase inhib...    299   1e-94    
ref|XP_008221458.1|  PREDICTED: pectinesterase                          299   3e-94    
ref|XP_011017534.1|  PREDICTED: probable pectinesterase/pectinest...    295   5e-94    
ref|XP_007045218.1|  Plant invertase/pectin methylesterase inhibi...    299   6e-94    
ref|XP_006367816.1|  PREDICTED: probable pectinesterase/pectinest...    297   7e-94    
gb|KHN35618.1|  Pectinesterase 2                                        293   7e-94    
emb|CBI38888.3|  unnamed protein product                                289   1e-93    
ref|XP_010684811.1|  PREDICTED: pectinesterase-like                     298   2e-93    
emb|CDO97717.1|  unnamed protein product                                289   2e-93    
gb|KHN35620.1|  Pectinesterase 2                                        292   2e-93    
ref|XP_004514851.1|  PREDICTED: pectinesterase 2-like                   297   2e-93    
gb|KDO64577.1|  hypothetical protein CISIN_1g047288mg                   297   2e-93    
gb|KDP28780.1|  hypothetical protein JCGZ_14551                         297   3e-93    
ref|XP_006469215.1|  PREDICTED: probable pectinesterase/pectinest...    297   3e-93    
ref|XP_010271372.1|  PREDICTED: pectinesterase-like                     297   4e-93    
gb|EYU24929.1|  hypothetical protein MIMGU_mgv1a025888mg                296   4e-93    
gb|KHN25547.1|  Pectinesterase 2                                        291   4e-93    
gb|KHN16553.1|  Pectinesterase 2                                        293   5e-93    
gb|KHG13344.1|  Uncharacterized protein F383_18528                      296   5e-93    
ref|XP_010264199.1|  PREDICTED: pectinesterase 2-like                   296   6e-93    
ref|XP_006448208.1|  hypothetical protein CICLE_v10014888mg             296   8e-93    
ref|XP_006445298.1|  hypothetical protein CICLE_v10019773mg             295   8e-93    
ref|XP_009351519.1|  PREDICTED: pectinesterase-like                     296   9e-93    
emb|CDY18942.1|  BnaC04g04080D                                          286   2e-92    
ref|XP_002301275.2|  hypothetical protein POPTR_0002s14660g             291   2e-92    Populus trichocarpa [western balsam poplar]
emb|CBI24582.3|  unnamed protein product                                286   2e-92    
emb|CDP20891.1|  unnamed protein product                                295   3e-92    
ref|XP_002510940.1|  Pectinesterase-2 precursor, putative               292   3e-92    Ricinus communis
ref|XP_004234932.2|  PREDICTED: probable pectinesterase/pectinest...    294   5e-92    
sp|O04887.1|PME2_CITSI  RecName: Full=Pectinesterase 2; Short=PE ...    293   5e-92    Citrus sinensis [apfelsine]
ref|XP_009351517.1|  PREDICTED: pectinesterase-like                     294   5e-92    
gb|KDO85751.1|  hypothetical protein CISIN_1g010441mg                   293   5e-92    
ref|XP_002322401.1|  putative pectin methylesterase family protein      293   6e-92    Populus trichocarpa [western balsam poplar]
gb|ABQ42392.1|  pectin methylesterase-like protein                      295   8e-92    Taiwania cryptomerioides
ref|XP_009627969.1|  PREDICTED: probable pectinesterase/pectinest...    293   1e-91    
gb|EYU33116.1|  hypothetical protein MIMGU_mgv1a022674mg                293   1e-91    
ref|XP_010259035.1|  PREDICTED: pectinesterase 2-like                   293   1e-91    
gb|KEH29121.1|  pectinesterase/pectinesterase inhibitor                 293   1e-91    
gb|KDP22414.1|  hypothetical protein JCGZ_26245                         293   1e-91    
ref|XP_007160398.1|  hypothetical protein PHAVU_002G318500g             293   1e-91    
ref|XP_009370475.1|  PREDICTED: pectinesterase 2-like                   292   2e-91    
ref|XP_010269596.1|  PREDICTED: pectinesterase-like                     293   2e-91    
ref|XP_011076334.1|  PREDICTED: probable pectinesterase/pectinest...    291   2e-91    
ref|XP_003530788.1|  PREDICTED: probable pectinesterase/pectinest...    292   2e-91    
ref|XP_009372890.1|  PREDICTED: pectinesterase 2-like                   292   2e-91    
ref|XP_007220109.1|  hypothetical protein PRUPE_ppa021446mg             291   2e-91    
ref|XP_010062184.1|  PREDICTED: pectinesterase-like                     292   3e-91    
ref|NP_001275775.1|  pectinesterase 2 precursor                         291   3e-91    
ref|XP_007038413.1|  Pectinesterase                                     291   5e-91    
ref|XP_004148139.1|  PREDICTED: pectinesterase 2-like                   291   6e-91    
ref|XP_008439095.1|  PREDICTED: pectinesterase-like                     292   6e-91    
ref|XP_010552690.1|  PREDICTED: probable pectinesterase/pectinest...    291   7e-91    
ref|XP_003521940.1|  PREDICTED: pectinesterase 2-like                   290   7e-91    
ref|XP_006576427.1|  PREDICTED: pectinesterase 2-like                   283   8e-91    
ref|XP_007052106.1|  Pectinesterase 2                                   291   8e-91    
ref|XP_002280446.1|  PREDICTED: pectinesterase 2                        290   8e-91    Vitis vinifera
ref|XP_010417837.1|  PREDICTED: probable pectinesterase/pectinest...    286   8e-91    
ref|XP_003517029.1|  PREDICTED: pectinesterase 2-like                   290   9e-91    
ref|XP_003521947.1|  PREDICTED: pectinesterase 2-like                   290   1e-90    
ref|XP_010910881.1|  PREDICTED: pectinesterase-like                     290   1e-90    
ref|XP_011070723.1|  PREDICTED: LOW QUALITY PROTEIN: pectinesterase     290   1e-90    
ref|XP_006580436.1|  PREDICTED: probable pectinesterase/pectinest...    290   1e-90    
gb|KHN21591.1|  Putative pectinesterase/pectinesterase inhibitor 6      290   1e-90    
ref|XP_011029953.1|  PREDICTED: pectinesterase 2-like                   290   1e-90    
emb|CDP00815.1|  unnamed protein product                                290   2e-90    
gb|KGN57272.1|  hypothetical protein Csa_3G175720                       291   2e-90    
ref|XP_008232606.1|  PREDICTED: pectinesterase 2                        290   2e-90    
gb|EYU24970.1|  hypothetical protein MIMGU_mgv1a022192mg                290   2e-90    
ref|XP_002318285.1|  putative pectin methylesterase family protein      290   2e-90    Populus trichocarpa [western balsam poplar]
ref|XP_006576426.1|  PREDICTED: pectinesterase 2-like                   290   2e-90    
ref|XP_011010931.1|  PREDICTED: pectinesterase 2-like                   289   3e-90    
ref|XP_006490097.1|  PREDICTED: pectinesterase 2-like                   289   3e-90    
gb|KDO65446.1|  hypothetical protein CISIN_1g010103mg                   289   3e-90    
ref|XP_008234391.1|  PREDICTED: pectinesterase 2-like                   289   3e-90    
ref|XP_006421695.1|  hypothetical protein CICLE_v10004742mg             289   4e-90    
gb|KHN35616.1|  Pectinesterase 2                                        284   4e-90    
gb|AFW03479.1|  pectin methylesterase 5                                 289   4e-90    
ref|XP_010058467.1|  PREDICTED: pectinesterase 2-like                   286   4e-90    
ref|XP_002511679.1|  Pectinesterase-2 precursor, putative               288   5e-90    Ricinus communis
ref|XP_010101099.1|  putative pectinesterase/pectinesterase inhib...    288   6e-90    
ref|XP_009773838.1|  PREDICTED: pectinesterase 2-like                   288   7e-90    
gb|AAN84553.1|  methyl pectinesterase                                   278   7e-90    Lolium perenne [perennial ryegrass]
ref|XP_006838619.1|  hypothetical protein AMTR_s00002p00230630          288   8e-90    
ref|XP_010544633.1|  PREDICTED: probable pectinesterase/pectinest...    288   9e-90    
ref|XP_011010930.1|  PREDICTED: pectinesterase-like                     287   1e-89    
ref|XP_009378667.1|  PREDICTED: pectinesterase 2-like                   287   1e-89    
ref|XP_004160886.1|  PREDICTED: pectinesterase 2-like                   293   1e-89    
ref|XP_011010924.1|  PREDICTED: pectinesterase-like isoform X1          287   1e-89    
ref|XP_002884520.1|  hypothetical protein ARALYDRAFT_896648             288   1e-89    
ref|XP_007220661.1|  hypothetical protein PRUPE_ppa004413mg             287   2e-89    
ref|XP_011010925.1|  PREDICTED: pectinesterase-like isoform X2          287   2e-89    
ref|XP_008467117.1|  PREDICTED: pectinesterase                          288   2e-89    
gb|KHN35617.1|  Pectinesterase 2                                        287   2e-89    
ref|XP_008377824.1|  PREDICTED: pectinesterase 2-like                   287   2e-89    
ref|XP_010692197.1|  PREDICTED: pectinesterase 2                        287   2e-89    
emb|CDX74715.1|  BnaA05g04610D                                          285   2e-89    
gb|KHG19575.1|  Uncharacterized protein F383_07269                      287   2e-89    
ref|XP_010056337.1|  PREDICTED: pectinesterase 2-like                   286   3e-89    
ref|XP_004971511.1|  PREDICTED: pectinesterase 1-like                   284   3e-89    
ref|XP_003634048.1|  PREDICTED: pectinesterase 2-like                   286   3e-89    
ref|XP_004307817.1|  PREDICTED: pectinesterase 2-like                   285   3e-89    
ref|XP_010524372.1|  PREDICTED: probable pectinesterase/pectinest...    286   3e-89    
ref|XP_006397702.1|  hypothetical protein EUTSA_v10001409mg             286   4e-89    
gb|KFK37970.1|  hypothetical protein AALP_AA3G053400                    287   4e-89    
ref|XP_004514850.1|  PREDICTED: pectinesterase 2-like                   286   4e-89    
ref|XP_002320714.1|  putative pectin methylesterase LuPME1 family...    286   5e-89    Populus trichocarpa [western balsam poplar]
ref|XP_009143104.1|  PREDICTED: probable pectinesterase/pectinest...    285   7e-89    
ref|XP_010486017.1|  PREDICTED: pectinesterase-like                     286   7e-89    
emb|CDX83392.1|  BnaA03g21140D                                          283   8e-89    
ref|XP_006841486.1|  hypothetical protein AMTR_s00003p00120050          286   9e-89    
ref|XP_010508199.1|  PREDICTED: probable pectinesterase/pectinest...    285   1e-88    
ref|XP_010518135.1|  PREDICTED: probable pectinesterase/pectinest...    285   1e-88    
ref|XP_010321856.1|  PREDICTED: pectinesterase                          286   1e-88    
ref|XP_009147300.1|  PREDICTED: pectinesterase-like                     286   1e-88    
ref|XP_004174049.1|  PREDICTED: pectinesterase 2-like                   282   1e-88    
ref|XP_009340592.1|  PREDICTED: pectinesterase 2-like                   285   2e-88    
ref|XP_009374493.1|  PREDICTED: pectinesterase 2-like                   285   2e-88    
ref|XP_002322399.1|  putative pectin methylesterase family protein      285   2e-88    Populus trichocarpa [western balsam poplar]
gb|KDP28190.1|  hypothetical protein JCGZ_13961                         281   2e-88    
gb|KHN42767.1|  Pectinesterase 2                                        282   2e-88    
gb|AFW03484.1|  pectin methylesterase 5                                 284   3e-88    
emb|CDP20872.1|  unnamed protein product                                284   3e-88    
ref|XP_009133718.1|  PREDICTED: probable pectinesterase/pectinest...    283   4e-88    
ref|XP_004150118.1|  PREDICTED: probable pectinesterase/pectinest...    284   4e-88    
emb|CDX95641.1|  BnaC03g25220D                                          281   5e-88    
gb|KEH29125.1|  pectinesterase/pectinesterase inhibitor                 283   6e-88    
ref|XP_006355816.1|  PREDICTED: pectinesterase-like                     282   6e-88    
ref|XP_010548770.1|  PREDICTED: pectinesterase-like                     285   6e-88    
ref|XP_008343201.1|  PREDICTED: pectinesterase 2                        283   7e-88    
ref|XP_010464090.1|  PREDICTED: pectinesterase-like                     284   7e-88    
ref|XP_006293950.1|  hypothetical protein CARUB_v10022941mg             284   7e-88    
gb|KHN43496.1|  Putative pectinesterase/pectinesterase inhibitor 40     282   7e-88    
ref|XP_011034009.1|  PREDICTED: pectinesterase 2                        283   8e-88    
ref|XP_010257625.1|  PREDICTED: pectinesterase 2-like                   283   9e-88    
ref|XP_004155863.1|  PREDICTED: pectinesterase 2-like                   273   9e-88    
gb|AER38244.1|  PME5                                                    283   1e-87    
ref|XP_009599511.1|  PREDICTED: pectinesterase 2-like                   283   1e-87    
ref|XP_009388374.1|  PREDICTED: pectinesterase-like                     273   1e-87    
ref|XP_010044212.1|  PREDICTED: pectinesterase                          283   1e-87    
ref|XP_011090444.1|  PREDICTED: pectinesterase 2                        282   2e-87    
ref|XP_010506460.1|  PREDICTED: probable pectinesterase/pectinest...    282   2e-87    
ref|XP_006396440.1|  hypothetical protein EUTSA_v10028546mg             283   2e-87    
ref|XP_004143735.1|  PREDICTED: pectinesterase 2-like                   282   2e-87    
gb|ACN40984.1|  unknown                                                 284   2e-87    Picea sitchensis
emb|CDY68840.1|  BnaCnng60750D                                          279   2e-87    
ref|XP_003526378.1|  PREDICTED: probable pectinesterase/pectinest...    282   2e-87    
ref|XP_003591484.1|  Pectinesterase                                     275   2e-87    
ref|XP_006287360.1|  hypothetical protein CARUB_v10000558mg             283   3e-87    
emb|CBI24284.3|  unnamed protein product                                273   3e-87    
ref|XP_008386773.1|  PREDICTED: pectinesterase-like                     272   3e-87    
ref|XP_010921648.1|  PREDICTED: pectinesterase-like                     272   3e-87    
ref|XP_006604725.1|  PREDICTED: probable pectinesterase/pectinest...    282   4e-87    
ref|XP_004167644.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    281   4e-87    
gb|KCW73020.1|  hypothetical protein EUGRSUZ_E01454                     280   6e-87    
ref|XP_004290811.1|  PREDICTED: probable pectinesterase/pectinest...    282   6e-87    
gb|KHN24739.1|  Putative pectinesterase/pectinesterase inhibitor 7      280   6e-87    
gb|KHN08672.1|  Putative pectinesterase/pectinesterase inhibitor 40     279   7e-87    
ref|XP_006433466.1|  hypothetical protein CICLE_v10003641mg             282   7e-87    
emb|CDX68522.1|  BnaC01g26000D                                          271   7e-87    
emb|CDX83076.1|  BnaA01g20760D                                          271   7e-87    
ref|XP_003591498.1|  Pectinesterase                                     275   7e-87    
ref|NP_001042866.1|  Os01g0312500                                       278   7e-87    Oryza sativa Japonica Group [Japonica rice]
ref|NP_566038.1|  putative pectinesterase/pectinesterase inhibito...    280   7e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007134831.1|  hypothetical protein PHAVU_010G079900g             280   7e-87    
ref|XP_002882002.1|  predicted protein                                  280   7e-87    
emb|CDY27750.1|  BnaA05g31590D                                          281   7e-87    
gb|KHN47891.1|  Pectinesterase 2                                        280   9e-87    
gb|AAF35897.1|AF229849_1  pectin methylesterase isoform alpha           272   1e-86    Vigna radiata var. radiata [golden gram]
ref|XP_007145198.1|  hypothetical protein PHAVU_007G218500g             281   1e-86    
ref|XP_008436965.1|  PREDICTED: pectinesterase 2-like                   280   1e-86    
ref|XP_010259481.1|  PREDICTED: pectinesterase-like                     281   1e-86    
ref|XP_010930858.1|  PREDICTED: pectinesterase-like                     278   1e-86    
gb|AGG23325.1|  pectin methylesterase 1                                 281   1e-86    
ref|XP_010056335.1|  PREDICTED: pectinesterase 2-like                   280   1e-86    
ref|XP_008347782.1|  PREDICTED: probable pectinesterase/pectinest...    281   2e-86    
ref|XP_003553658.2|  PREDICTED: probable pectinesterase/pectinest...    282   2e-86    
dbj|BAF42040.1|  pectin methylesterase 3                                281   2e-86    Pyrus communis
gb|KDO36280.1|  hypothetical protein CISIN_1g027636mg                   270   2e-86    
gb|KHN47892.1|  Pectinesterase 2                                        279   2e-86    
ref|XP_006577155.1|  PREDICTED: probable pectinesterase/pectinest...    280   2e-86    
ref|XP_010056339.1|  PREDICTED: pectinesterase 2-like                   279   2e-86    
ref|XP_009382521.1|  PREDICTED: pectinesterase-like                     280   2e-86    
gb|ACQ85264.1|  pectin methylesterase                                   280   2e-86    Musa acuminata AAA Group [Cavendish banana]
ref|XP_003517028.1|  PREDICTED: pectinesterase 2-like                   279   2e-86    
ref|XP_009628696.1|  PREDICTED: pectinesterase 2                        280   3e-86    
ref|XP_002265740.2|  PREDICTED: pectinesterase 2-like                   279   3e-86    Vitis vinifera
ref|XP_007201179.1|  hypothetical protein PRUPE_ppa003400mg             280   3e-86    
ref|XP_010932734.1|  PREDICTED: pectinesterase-like                     279   3e-86    
ref|XP_008235121.1|  PREDICTED: pectinesterase-like                     280   3e-86    
ref|XP_009766156.1|  PREDICTED: pectinesterase 2-like                   279   3e-86    
ref|XP_009783075.1|  PREDICTED: pectinesterase-like                     280   3e-86    
ref|XP_002523113.1|  Pectinesterase-3 precursor, putative               280   3e-86    Ricinus communis
ref|XP_006853048.1|  hypothetical protein AMTR_s00038p00046180          279   4e-86    
gb|KDO85752.1|  hypothetical protein CISIN_1g041032mg                   270   4e-86    
emb|CAN76835.1|  hypothetical protein VITISV_043176                     278   5e-86    Vitis vinifera
ref|XP_003519757.1|  PREDICTED: probable pectinesterase/pectinest...    280   5e-86    
ref|XP_010253281.1|  PREDICTED: probable pectinesterase/pectinest...    279   6e-86    
ref|XP_002455538.1|  hypothetical protein SORBIDRAFT_03g012830          280   6e-86    Sorghum bicolor [broomcorn]
ref|XP_011101124.1|  PREDICTED: probable pectinesterase/pectinest...    278   6e-86    
ref|XP_008781656.1|  PREDICTED: pectinesterase-like                     276   6e-86    
emb|CDY65637.1|  BnaAnng20820D                                          278   6e-86    
ref|XP_006359860.1|  PREDICTED: probable pectinesterase/pectinest...    279   7e-86    
ref|XP_004247400.1|  PREDICTED: pectinesterase-like                     279   7e-86    
ref|XP_003591169.1|  Pectinesterase                                     278   8e-86    
ref|XP_011017474.1|  PREDICTED: pectinesterase 2                        278   8e-86    
ref|XP_007163135.1|  hypothetical protein PHAVU_001G209400g             280   8e-86    
emb|CAE76634.1|  pectin methylesterase                                  269   1e-85    Cicer arietinum [garbanzo]
ref|XP_002271665.2|  PREDICTED: pectinesterase-like                     278   1e-85    Vitis vinifera
ref|XP_010056338.1|  PREDICTED: pectinesterase 2-like                   277   1e-85    
ref|XP_006347887.1|  PREDICTED: pectinesterase 2-like                   277   1e-85    
ref|XP_003535331.2|  PREDICTED: probable pectinesterase/pectinest...    278   1e-85    
ref|XP_008809854.1|  PREDICTED: pectinesterase-like                     278   1e-85    
gb|AGR44472.1|  pectin methylesterase 3                                 278   1e-85    
ref|XP_010426431.1|  PREDICTED: probable pectinesterase/pectinest...    268   1e-85    
ref|XP_006445297.1|  hypothetical protein CICLE_v10024598mg             273   2e-85    
ref|XP_002874923.1|  pectinesterase family protein                      278   2e-85    
ref|XP_009614504.1|  PREDICTED: pectinesterase-like                     278   2e-85    
ref|XP_010456048.1|  PREDICTED: probable pectinesterase/pectinest...    278   2e-85    
ref|XP_010056340.1|  PREDICTED: pectinesterase 2-like                   276   2e-85    
ref|XP_010429512.1|  PREDICTED: probable pectinesterase/pectinest...    278   2e-85    
ref|XP_010098937.1|  putative pectinesterase/pectinesterase inhib...    277   2e-85    
ref|XP_009111298.1|  PREDICTED: probable pectinesterase/pectinest...    278   2e-85    
ref|XP_004234960.1|  PREDICTED: probable pectinesterase/pectinest...    278   2e-85    
sp|P85076.1|PME_ACTDE  RecName: Full=Pectinesterase; Short=PE; Al...    270   2e-85    
ref|XP_006350555.1|  PREDICTED: probable pectinesterase/pectinest...    278   2e-85    
ref|XP_010556727.1|  PREDICTED: probable pectinesterase/pectinest...    278   3e-85    
ref|NP_567227.1|  Probable pectinesterase/pectinesterase inhibito...    278   3e-85    
ref|XP_009592542.1|  PREDICTED: pectinesterase-like                     278   3e-85    
ref|XP_003591482.1|  Pectinesterase                                     277   3e-85    
gb|KHN20388.1|  Putative pectinesterase/pectinesterase inhibitor 7      277   3e-85    
ref|XP_010422609.1|  PREDICTED: probable pectinesterase/pectinest...    278   3e-85    
ref|XP_006416115.1|  hypothetical protein EUTSA_v10007274mg             277   3e-85    
emb|CBI24285.3|  unnamed protein product                                274   3e-85    
ref|XP_011079629.1|  PREDICTED: pectinesterase-like                     277   3e-85    
gb|EPS62329.1|  pectinesterase                                          277   3e-85    
ref|XP_003521574.1|  PREDICTED: probable pectinesterase/pectinest...    277   4e-85    
gb|KFK37315.1|  hypothetical protein AALP_AA4G241100                    276   4e-85    
gb|KDO87166.1|  hypothetical protein CISIN_1g0440421mg                  266   4e-85    
ref|XP_010056336.1|  PREDICTED: pectinesterase 2-like                   276   4e-85    
gb|KEH24404.1|  pectinesterase/pectinesterase inhibitor                 277   5e-85    
emb|CAN78759.1|  hypothetical protein VITISV_000562                     275   5e-85    
gb|EMS63917.1|  putative pectinesterase/pectinesterase inhibitor 41     271   5e-85    
ref|XP_002890570.1|  predicted protein                                  276   6e-85    
gb|KDP28189.1|  hypothetical protein JCGZ_13960                         276   8e-85    
gb|KFK44409.1|  hypothetical protein AALP_AA1G253400                    273   8e-85    
gb|EEC70505.1|  hypothetical protein OsI_01594                          276   8e-85    
ref|XP_009776000.1|  PREDICTED: probable pectinesterase/pectinest...    277   9e-85    
ref|XP_008219291.1|  PREDICTED: probable pectinesterase/pectinest...    276   9e-85    
gb|EEE54425.1|  hypothetical protein OsJ_01485                          277   9e-85    
ref|XP_010938361.1|  PREDICTED: probable pectinesterase/pectinest...    276   9e-85    
ref|XP_008795768.1|  PREDICTED: pectinesterase-like                     276   1e-84    
gb|ABK24761.1|  unknown                                                 276   1e-84    
ref|XP_010910890.1|  PREDICTED: probable pectinesterase/pectinest...    276   1e-84    
ref|XP_008359413.1|  PREDICTED: pectinesterase-like                     276   1e-84    
ref|XP_010325628.1|  PREDICTED: pectinesterase 2                        275   2e-84    
gb|KFK30820.1|  pectinesterase family protein                           276   2e-84    
ref|XP_010260072.1|  PREDICTED: pectinesterase-like                     275   2e-84    
emb|CDY08117.1|  BnaA06g16090D                                          273   2e-84    
gb|KHN11656.1|  Putative pectinesterase/pectinesterase inhibitor 33     272   2e-84    
emb|CBI24581.3|  unnamed protein product                                266   2e-84    
ref|XP_010088304.1|  putative pectinesterase/pectinesterase inhib...    275   2e-84    
ref|XP_010277646.1|  PREDICTED: pectinesterase 2-like                   274   2e-84    
ref|NP_001146685.1|  pectinesterase precursor                           275   2e-84    
gb|KEH29375.1|  pectinesterase/pectinesterase inhibitor                 275   2e-84    
ref|XP_007144963.1|  hypothetical protein PHAVU_007G198200g             274   2e-84    
emb|CDY05911.1|  BnaC08g20880D                                          273   3e-84    
ref|XP_004133929.1|  PREDICTED: pectinesterase 2-like                   273   3e-84    
ref|XP_007163134.1|  hypothetical protein PHAVU_001G209300g             275   3e-84    
ref|XP_006444393.1|  hypothetical protein CICLE_v10023718mg             274   3e-84    
ref|XP_010273801.1|  PREDICTED: pectinesterase                          275   3e-84    
ref|XP_009771845.1|  PREDICTED: pectinesterase-like                     275   3e-84    
ref|XP_008219290.1|  PREDICTED: probable pectinesterase/pectinest...    275   3e-84    
ref|XP_004306939.1|  PREDICTED: probable pectinesterase/pectinest...    273   3e-84    
ref|XP_004496026.1|  PREDICTED: probable pectinesterase/pectinest...    274   3e-84    
ref|XP_010522800.1|  PREDICTED: probable pectinesterase/pectinest...    275   3e-84    
ref|XP_006645812.1|  PREDICTED: pectinesterase 2-like                   270   3e-84    
gb|AAQ21125.1|  pectinesterase                                          263   4e-84    
ref|XP_006449081.1|  hypothetical protein CICLE_v10014787mg             274   4e-84    
ref|XP_002264156.1|  PREDICTED: pectinesterase 2                        273   4e-84    
gb|AAL87311.1|  unknown protein                                         275   4e-84    
emb|CDX96216.1|  BnaC02g14350D                                          271   4e-84    
gb|ABZ89800.1|  pectin methylesterase-like protein                      275   4e-84    
ref|XP_010098938.1|  Pectinesterase 2                                   273   4e-84    
gb|EYU43523.1|  hypothetical protein MIMGU_mgv1a026199mg                272   5e-84    
ref|XP_002265599.1|  PREDICTED: pectinesterase 2                        273   6e-84    
ref|XP_010316615.1|  PREDICTED: pectinesterase-like                     274   6e-84    
ref|XP_006480114.1|  PREDICTED: probable pectinesterase/pectinest...    274   6e-84    
gb|KEH41800.1|  pectinesterase/pectinesterase inhibitor                 274   6e-84    
emb|CAN83663.1|  hypothetical protein VITISV_017689                     273   6e-84    
dbj|BAJ34238.1|  unnamed protein product                                273   7e-84    
ref|XP_010230835.1|  PREDICTED: pectinesterase-like                     274   7e-84    
gb|EYU24971.1|  hypothetical protein MIMGU_mgv1a004327mg                273   7e-84    
gb|KHN21590.1|  Putative pectinesterase/pectinesterase inhibitor 6      273   7e-84    
ref|XP_006580437.1|  PREDICTED: probable pectinesterase/pectinest...    273   7e-84    
emb|CDY00192.1|  BnaA06g20930D                                          271   8e-84    
ref|XP_009383893.1|  PREDICTED: pectinesterase-like                     274   8e-84    
ref|XP_009628637.1|  PREDICTED: pectinesterase-like                     274   8e-84    
ref|XP_004494389.1|  PREDICTED: probable pectinesterase/pectinest...    273   8e-84    
ref|XP_010260073.1|  PREDICTED: pectinesterase-like                     273   9e-84    
ref|XP_008438193.1|  PREDICTED: pectinesterase 2                        272   9e-84    
ref|XP_004299719.1|  PREDICTED: probable pectinesterase/pectinest...    274   9e-84    
ref|XP_010259034.1|  PREDICTED: pectinesterase 2-like                   272   9e-84    
gb|KDP23442.1|  hypothetical protein JCGZ_23275                         266   1e-83    
ref|XP_007222884.1|  hypothetical protein PRUPE_ppa003581mg             273   1e-83    
ref|XP_010266532.1|  PREDICTED: probable pectinesterase/pectinest...    274   1e-83    
gb|EYU25227.1|  hypothetical protein MIMGU_mgv1a0032971mg               263   1e-83    
ref|XP_003540571.1|  PREDICTED: probable pectinesterase/pectinest...    272   2e-83    
ref|XP_003533518.1|  PREDICTED: probable pectinesterase/pectinest...    272   2e-83    
ref|XP_011010963.1|  PREDICTED: pectinesterase-like                     273   2e-83    
ref|XP_006828580.1|  hypothetical protein AMTR_s00129p00035520          263   2e-83    
gb|EYU46749.1|  hypothetical protein MIMGU_mgv1a0044631mg               266   2e-83    
ref|XP_009765668.1|  PREDICTED: pectinesterase-like                     273   2e-83    
ref|XP_008812398.1|  PREDICTED: probable pectinesterase/pectinest...    272   2e-83    
ref|XP_009149756.1|  PREDICTED: probable pectinesterase/pectinest...    274   2e-83    
ref|XP_011015915.1|  PREDICTED: pectinesterase-like                     272   2e-83    
ref|XP_006360163.1|  PREDICTED: probable pectinesterase/pectinest...    273   2e-83    
ref|XP_002322402.2|  putative pectin methylesterase family protein      270   2e-83    
ref|XP_004513409.1|  PREDICTED: probable pectinesterase/pectinest...    272   2e-83    
gb|KDO75533.1|  hypothetical protein CISIN_1g008722mg                   272   2e-83    
gb|KDO65445.1|  hypothetical protein CISIN_1g0366961mg                  262   2e-83    
emb|CDY21422.1|  BnaA09g30050D                                          271   3e-83    
ref|XP_009340595.1|  PREDICTED: probable pectinesterase/pectinest...    270   3e-83    
ref|XP_004232737.1|  PREDICTED: pectinesterase-like                     272   3e-83    
ref|XP_006467993.1|  PREDICTED: pectinesterase/pectinesterase inh...    272   3e-83    
gb|KHN44643.1|  Putative pectinesterase/pectinesterase inhibitor 61     273   3e-83    
ref|XP_008673992.1|  PREDICTED: LOW QUALITY PROTEIN: pectinestera...    272   3e-83    
gb|AFI23412.1|  pectin methylesterase                                   266   3e-83    
ref|XP_009614734.1|  PREDICTED: probable pectinesterase/pectinest...    273   3e-83    
gb|KHG05999.1|  putative pectinesterase/pectinesterase inhibitor ...    272   4e-83    
ref|XP_010445741.1|  PREDICTED: probable pectinesterase/pectinest...    273   4e-83    
ref|XP_002301486.2|  hypothetical protein POPTR_0002s20370g             272   4e-83    
ref|XP_002302526.1|  putative pectin methylesterase LuPME1 family...    270   4e-83    
emb|CDY04739.1|  BnaC05g18500D                                          271   4e-83    
ref|XP_007131333.1|  hypothetical protein PHAVU_011G005000g             271   4e-83    
gb|AAR03544.1|  pectin methylesterase isoform 1                         261   4e-83    
ref|XP_004513411.1|  PREDICTED: probable pectinesterase/pectinest...    271   5e-83    
emb|CDY14384.1|  BnaA10g06710D                                          269   5e-83    
ref|XP_003588521.1|  Pectinesterase                                     273   5e-83    
ref|XP_009151913.1|  PREDICTED: probable pectinesterase/pectinest...    273   5e-83    
ref|XP_002510939.1|  Pectinesterase-2 precursor, putative               270   6e-83    
emb|CDO97716.1|  unnamed protein product                                270   6e-83    
ref|XP_007163133.1|  hypothetical protein PHAVU_001G209200g             271   7e-83    
ref|XP_008369099.1|  PREDICTED: probable pectinesterase/pectinest...    270   7e-83    
ref|XP_007031046.1|  Pectinesterase-2 precursor                         271   7e-83    
ref|XP_010259196.1|  PREDICTED: pectinesterase 2-like                   270   8e-83    
ref|XP_010482728.1|  PREDICTED: probable pectinesterase/pectinest...    272   8e-83    
ref|XP_004136014.1|  PREDICTED: probable pectinesterase/pectinest...    271   8e-83    
gb|KHG26245.1|  Pectinesterase/pectinesterase inhibitor                 269   8e-83    
ref|XP_011010932.1|  PREDICTED: probable pectinesterase/pectinest...    270   8e-83    
gb|KCW73025.1|  hypothetical protein EUGRSUZ_E01468                     270   1e-82    
gb|KHG26122.1|  putative pectinesterase/pectinesterase inhibitor ...    270   1e-82    
ref|XP_004513410.1|  PREDICTED: probable pectinesterase/pectinest...    270   1e-82    
ref|XP_010481250.1|  PREDICTED: probable pectinesterase/pectinest...    271   1e-82    
emb|CDY35644.1|  BnaC09g29660D                                          268   1e-82    
ref|XP_008451544.1|  PREDICTED: probable pectinesterase/pectinest...    270   1e-82    
ref|XP_004502642.1|  PREDICTED: probable pectinesterase/pectinest...    271   1e-82    
ref|XP_004240956.1|  PREDICTED: probable pectinesterase/pectinest...    271   1e-82    
ref|XP_002522859.1|  Pectinesterase-2 precursor, putative               270   1e-82    
ref|XP_004299718.1|  PREDICTED: probable pectinesterase/pectinest...    270   1e-82    
ref|XP_010264200.1|  PREDICTED: pectinesterase 2-like                   269   1e-82    
ref|XP_009409661.1|  PREDICTED: pectinesterase-like                     269   2e-82    
ref|XP_006444394.1|  hypothetical protein CICLE_v10020108mg             267   2e-82    
ref|XP_010457268.1|  PREDICTED: probable pectinesterase/pectinest...    271   2e-82    
ref|XP_007222797.1|  hypothetical protein PRUPE_ppa003578mg             270   2e-82    
ref|XP_006441080.1|  hypothetical protein CICLE_v10019376mg             271   2e-82    
emb|CDY49170.1|  BnaA02g10290D                                          267   2e-82    
ref|XP_009150156.1|  PREDICTED: probable pectinesterase/pectinest...    271   2e-82    
ref|XP_008451545.1|  PREDICTED: pectinesterase-like                     271   2e-82    
ref|NP_563662.1|  pectinesterase 7                                      270   2e-82    
ref|XP_006404164.1|  hypothetical protein EUTSA_v10010220mg             271   2e-82    
ref|XP_002318284.2|  pectinesterase family protein                      269   2e-82    
ref|XP_006828586.1|  hypothetical protein AMTR_s00129p00044320          270   2e-82    
ref|XP_010537086.1|  PREDICTED: probable pectinesterase/pectinest...    270   3e-82    
ref|NP_173733.1|  probable pectinesterase/pectinesterase inhibitor 6    270   3e-82    
ref|XP_009335753.1|  PREDICTED: probable pectinesterase/pectinest...    268   3e-82    
gb|KGN44975.1|  Pectinesterase                                          271   3e-82    
ref|XP_002865971.1|  pectinesterase family protein                      270   3e-82    
ref|XP_010550514.1|  PREDICTED: probable pectinesterase/pectinest...    271   3e-82    
ref|XP_008795770.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    270   3e-82    
gb|KDP22413.1|  hypothetical protein JCGZ_26244                         268   3e-82    
ref|XP_010088299.1|  putative pectinesterase/pectinesterase inhib...    270   4e-82    
ref|XP_002457749.1|  hypothetical protein SORBIDRAFT_03g012820          270   4e-82    
ref|XP_006493306.1|  PREDICTED: probable pectinesterase/pectinest...    270   4e-82    
ref|XP_010932335.1|  PREDICTED: probable pectinesterase/pectinest...    268   4e-82    
gb|AAM67242.1|  putative pectinesterase                                 260   4e-82    
ref|XP_009115554.1|  PREDICTED: probable pectinesterase/pectinest...    270   4e-82    
ref|XP_009763675.1|  PREDICTED: probable pectinesterase/pectinest...    270   4e-82    
ref|NP_566379.1|  pectinesterase 25                                     260   4e-82    
ref|XP_006444392.1|  hypothetical protein CICLE_v10023588mg             269   4e-82    
ref|XP_004494388.1|  PREDICTED: probable pectinesterase/pectinest...    269   4e-82    
ref|XP_004494387.1|  PREDICTED: probable pectinesterase/pectinest...    269   4e-82    
ref|XP_009142324.1|  PREDICTED: probable pectinesterase/pectinest...    268   4e-82    
ref|XP_004498516.1|  PREDICTED: probable pectinesterase/pectinest...    270   4e-82    
ref|XP_006371892.1|  hypothetical protein POPTR_0018s05350g             259   4e-82    
gb|EYU19641.1|  hypothetical protein MIMGU_mgv1a003247mg                270   4e-82    
ref|XP_010267633.1|  PREDICTED: probable pectinesterase/pectinest...    270   5e-82    
ref|NP_200149.1|  pectin methylesterase PCR fragment F                  270   5e-82    
ref|XP_009378757.1|  PREDICTED: probable pectinesterase/pectinest...    268   5e-82    
ref|XP_004516727.1|  PREDICTED: probable pectinesterase/pectinest...    268   6e-82    
ref|XP_010426432.1|  PREDICTED: probable pectinesterase/pectinest...    270   6e-82    
gb|EPS67025.1|  pectinesterase                                          258   6e-82    
gb|KEH24402.1|  pectinesterase/pectinesterase inhibitor                 269   6e-82    
gb|KHN08673.1|  Putative pectinesterase/pectinesterase inhibitor 41     268   6e-82    
ref|XP_009127434.1|  PREDICTED: probable pectinesterase/pectinest...    258   6e-82    
ref|XP_010474855.1|  PREDICTED: probable pectinesterase/pectinest...    269   6e-82    
ref|XP_009596446.1|  PREDICTED: probable pectinesterase/pectinest...    270   7e-82    
ref|XP_003518980.1|  PREDICTED: probable pectinesterase/pectinest...    268   7e-82    
emb|CDY27388.1|  BnaC04g50170D                                          267   7e-82    
ref|XP_010058471.1|  PREDICTED: pectinesterase 2-like                   269   7e-82    
ref|XP_010442899.1|  PREDICTED: probable pectinesterase/pectinest...    269   7e-82    
ref|XP_004171768.1|  PREDICTED: probable pectinesterase/pectinest...    269   7e-82    
ref|XP_004292667.1|  PREDICTED: probable pectinesterase/pectinest...    268   8e-82    
ref|XP_010069898.1|  PREDICTED: probable pectinesterase/pectinest...    268   8e-82    
ref|XP_010503572.1|  PREDICTED: probable pectinesterase/pectinest...    270   8e-82    
ref|XP_008465623.1|  PREDICTED: probable pectinesterase/pectinest...    258   8e-82    
dbj|BAJ96804.1|  predicted protein                                      268   8e-82    
ref|XP_008361835.1|  PREDICTED: pectinesterase-like                     258   9e-82    
ref|XP_010553426.1|  PREDICTED: pectinesterase/pectinesterase inh...    268   9e-82    
dbj|BAF00855.1|  hypothetical protein                                   269   1e-81    
ref|XP_006306147.1|  hypothetical protein CARUB_v10011654mg             269   1e-81    
gb|KHN30453.1|  Pectinesterase 2.2                                      265   1e-81    
ref|XP_004967522.1|  PREDICTED: probable pectinesterase/pectinest...    268   1e-81    
ref|XP_009590338.1|  PREDICTED: pectinesterase 3-like                   258   1e-81    
gb|ABK94644.1|  unknown                                                 261   1e-81    
ref|XP_004290810.1|  PREDICTED: probable pectinesterase/pectinest...    268   1e-81    
gb|KEH24403.1|  pectinesterase/pectinesterase inhibitor                 268   1e-81    
ref|XP_010684346.1|  PREDICTED: pectinesterase-like                     268   1e-81    
ref|XP_009119880.1|  PREDICTED: probable pectinesterase/pectinest...    269   1e-81    
ref|XP_009771843.1|  PREDICTED: probable pectinesterase/pectinest...    268   1e-81    
gb|EEC82670.1|  hypothetical protein OsI_27314                          268   1e-81    
ref|NP_001060620.1|  Os07g0675100                                       268   1e-81    
ref|XP_009771844.1|  PREDICTED: probable pectinesterase/pectinest...    268   1e-81    



>ref|XP_009628695.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Nicotiana tomentosiformis]
Length=490

 Score =   353 bits (907),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 184/213 (86%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V SD ++FYRCS +GYQDTL VHSLRQFYRDCHIYGTIDFIFG+
Sbjct  276  FENTAGPHKHQAVALRVGSDLSIFYRCSFRGYQDTLLVHSLRQFYRDCHIYGTIDFIFGD  335

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAV QNCDIFVK+PMDHQSN+ITAQGRDD NENTGI ILNSRV P+ E     G   ++
Sbjct  336  AAAVFQNCDIFVKRPMDHQSNMITAQGRDDSNENTGIVILNSRVAPSSEFSAVKGSFMNY  395

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVFIKTDLDGLI PKGW EWSG+FALSTLYYGEYMNTG+GA   NRVNWP
Sbjct  396  LGRPWKKYSRTVFIKTDLDGLIHPKGWKEWSGNFALSTLYYGEYMNTGSGADIGNRVNWP  455

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+LR  +EASPF V NFIQG+SWIP SGVP+
Sbjct  456  GFHVLRDANEASPFTVRNFIQGESWIPASGVPY  488



>ref|XP_006347998.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Solanum tuberosum]
Length=495

 Score =   353 bits (906),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 186/213 (87%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V SD ++FYRCS KGYQDTL VHSLRQFYRDCH+YGTIDFIFG+
Sbjct  279  FENTAGPNKHQAVALRVGSDLSIFYRCSFKGYQDTLLVHSLRQFYRDCHVYGTIDFIFGD  338

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A+AV QNCDIFVK+PMD+QSN+ITAQGRDD NENTGI ILNSRV  + E        K++
Sbjct  339  ASAVFQNCDIFVKRPMDYQSNMITAQGRDDSNENTGIVILNSRVSSSSEFTAVKDSFKNY  398

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVFIKTDLDGLIDPKGW EWSGDFALSTLYY EYMNTG+GA+T NRVNWP
Sbjct  399  LGRPWKKYSRTVFIKTDLDGLIDPKGWKEWSGDFALSTLYYAEYMNTGSGANTGNRVNWP  458

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+LR  +EASPF V+NFIQG+SWIP SGVP+
Sbjct  459  GFHVLRDANEASPFTVTNFIQGESWIPASGVPY  491



>ref|XP_009764218.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Nicotiana sylvestris]
Length=491

 Score =   353 bits (905),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 185/213 (87%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+   SD ++FYRCS +GYQDTL VHSLRQFYRDCHIYGT+DFIFG+
Sbjct  275  FENTAGPHKHQAVALRAGSDLSIFYRCSFRGYQDTLLVHSLRQFYRDCHIYGTVDFIFGD  334

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAV QNCDIFVK+PM HQSN+ITAQGRDD NENTGI+ILNSRV P+ E     G  +++
Sbjct  335  AAAVFQNCDIFVKRPMGHQSNMITAQGRDDSNENTGIAILNSRVSPSSEFSAVKGSFQNY  394

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVFIKTDLDGLI P+GW EWSG+FALSTLYYGEYMNTG+GA T NRVNWP
Sbjct  395  LGRPWKKYSRTVFIKTDLDGLIHPQGWKEWSGNFALSTLYYGEYMNTGSGADTGNRVNWP  454

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+LR  +EASPF V NFIQG+SWIP SGVP+
Sbjct  455  GFHVLRDANEASPFTVRNFIQGESWIPASGVPY  487



>ref|XP_010513751.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Camelina sativa]
Length=358

 Score =   346 bits (887),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 183/215 (85%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V SD ++FYRCS KGYQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  142  FENTAGPHKHQAVALRVNSDLSLFYRCSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  201

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAV QNCDIFV++PMDHQ N+ITAQGRDDP+  TGISI +SRV   PE     G  K++
Sbjct  202  AAAVFQNCDIFVRRPMDHQGNMITAQGRDDPHATTGISIQHSRVRAAPEFEAVKGRFKNY  261

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KTDLDGLIDP+GW EWSG +ALSTLYYGE+MNTGAGA T  RVNWP
Sbjct  262  LGRPWKKYSRTVFLKTDLDGLIDPRGWREWSGSYALSTLYYGEFMNTGAGAETTRRVNWP  321

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+LR  +EASPF VS FIQGDSWIP +GVPF +
Sbjct  322  GFHVLRGEEEASPFTVSRFIQGDSWIPITGVPFSA  356



>emb|CDX71786.1| BnaC08g30880D [Brassica napus]
Length=522

 Score =   348 bits (892),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 164/215 (76%), Positives = 185/215 (86%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V SD +VFYRCS +GYQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  306  FENTAGPHKHQAVALRVNSDLSVFYRCSFRGYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  365

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAV QNCDIFV++PMDHQ N+ITAQGRD+P+ENTGISI NSRV  +PE     G  KS+
Sbjct  366  AAAVFQNCDIFVRRPMDHQGNMITAQGRDNPHENTGISIQNSRVRASPEFEAVKGQFKSY  425

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KTDLDGLIDP+GW EW GDFALSTLYYGE+MNTG+GA T  RV+WP
Sbjct  426  LGRPWKKYSRTVFLKTDLDGLIDPRGWREWRGDFALSTLYYGEFMNTGSGAGTSRRVSWP  485

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+L   DEASPF VS FIQGDSWIP +GVPF +
Sbjct  486  GFHVLHGADEASPFTVSRFIQGDSWIPITGVPFSA  520



>ref|XP_009116752.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Brassica rapa]
Length=521

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 185/215 (86%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V SD +VFYRCS +GYQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  305  FENTAGPHKHQAVALRVNSDLSVFYRCSFRGYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  364

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A+AV QNCDIFV++PMDHQ N+ITAQGRD+P+ENTGISI NSRV  +PE     G  KS+
Sbjct  365  ASAVFQNCDIFVRRPMDHQGNMITAQGRDNPHENTGISIQNSRVRASPEFEAVKGQFKSY  424

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KTDLDGLIDP+GW EW GDFALSTLYYGE+MNTG+GA T  RV+WP
Sbjct  425  LGRPWKKYSRTVFLKTDLDGLIDPRGWREWRGDFALSTLYYGEFMNTGSGAGTSRRVSWP  484

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+L   DEASPF VS FIQGDSWIP +GVPF +
Sbjct  485  GFHVLHGADEASPFTVSRFIQGDSWIPITGVPFSA  519



>emb|CDY41145.1| BnaA09g38700D [Brassica napus]
Length=521

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 185/215 (86%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V SD +VFYRCS +GYQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  305  FENTAGPHKHQAVALRVNSDLSVFYRCSFRGYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  364

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A+AV QNCDIFV++PMDHQ N+ITAQGRD+P+ENTGISI NSRV  +PE     G  KS+
Sbjct  365  ASAVFQNCDIFVRRPMDHQGNMITAQGRDNPHENTGISIQNSRVRASPEFEAVKGQFKSY  424

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KTDLDGLIDP+GW EW GDFALSTLYYGE+MNTG+GA T  RV+WP
Sbjct  425  LGRPWKKYSRTVFLKTDLDGLIDPRGWREWRGDFALSTLYYGEFMNTGSGAGTSRRVSWP  484

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+L   DEASPF VS FIQGDSWIP +GVPF +
Sbjct  485  GFHVLHGADEASPFTVSRFIQGDSWIPITGVPFSA  519



>ref|XP_004231159.2| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 36 [Solanum lycopersicum]
Length=502

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 182/213 (85%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V+SD ++FYRCS KGYQDTL VHSLRQFYRDCHIYGTIDFIFG+
Sbjct  286  FENTAGPHKHQAVALRVSSDLSIFYRCSFKGYQDTLLVHSLRQFYRDCHIYGTIDFIFGD  345

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A+AV QNCDIFVK+PMD QSN+ITAQG DD NENTGI ILNSRV  + E        K++
Sbjct  346  ASAVFQNCDIFVKRPMDSQSNMITAQGXDDSNENTGIVILNSRVSSSSEFTAVKDSFKNY  405

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVFIKTDLDGLIDPKGW EWSGDFALSTLYY EYMNTG+GA+T NRVNWP
Sbjct  406  LGRPWKKYSRTVFIKTDLDGLIDPKGWKEWSGDFALSTLYYAEYMNTGSGANTGNRVNWP  465

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+L   +EAS F V NFIQG+SWIP SGVP+
Sbjct  466  GFHVLHDANEASQFTVRNFIQGESWIPASGVPY  498



>ref|XP_010247589.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Nelumbo nucifera]
Length=515

 Score =   345 bits (886),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/217 (75%), Positives = 184/217 (85%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGPEKHQAVA  V SDHA+FYRCS +GYQDTL VHS RQFYR+CHIYGT DFIFGN
Sbjct  299  FENTAGPEKHQAVAARVGSDHAIFYRCSFRGYQDTLLVHSQRQFYRECHIYGTQDFIFGN  358

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNCDIFV++PM HQSN+ITAQGR+DPNENTGISI +SRV+P  +L    G  +S+
Sbjct  359  AAVVLQNCDIFVRRPMAHQSNVITAQGREDPNENTGISIHSSRVVPATDLIAVKGSFRSY  418

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KTDLDGLIDPKGW EWSG+FALSTLYYGEYMN G GAS   RV WP
Sbjct  419  LGRPWKKYSRTVFLKTDLDGLIDPKGWTEWSGNFALSTLYYGEYMNYGNGASIGGRVKWP  478

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH+L  P +ASPF V +FIQG+SWIP +GVPF + L
Sbjct  479  GFHVLNNPRDASPFTVGSFIQGNSWIPMAGVPFSAGL  515



>ref|XP_010544635.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Tarenaya hassleriana]
Length=486

 Score =   344 bits (883),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 182/213 (85%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V+SD +VFYRCS KGYQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  270  FENTAGPHKHQAVALRVSSDLSVFYRCSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  329

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AAAV QNCDIFV++PMDHQ+N+ITAQGRD+P+ NTGISI  SRV P PEL       +S+
Sbjct  330  AAAVFQNCDIFVRRPMDHQANMITAQGRDNPHTNTGISIQESRVRPAPELEVMKSRFRSY  389

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KTDLDGLI P GW EWSG FALSTLYYGEYMNTGAGA T  RV WP
Sbjct  390  LGRPWKKYSRTVFMKTDLDGLIHPNGWTEWSGAFALSTLYYGEYMNTGAGARTDERVKWP  449

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+LR  +EASPF VS FIQG+SWIP +GVPF
Sbjct  450  GFHVLRGSEEASPFSVSRFIQGESWIPATGVPF  482



>ref|XP_006402549.1| hypothetical protein EUTSA_v10006472mg [Eutrema salsugineum]
 gb|ESQ44002.1| hypothetical protein EUTSA_v10006472mg [Eutrema salsugineum]
Length=519

 Score =   344 bits (883),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 185/215 (86%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+ V+SD ++FYRCS KGYQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  303  FENTAGPQKHQAVALRVSSDLSLFYRCSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  362

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AV QNCDIFV++PMDHQ N+ITAQGRD+P+ENTGISI +SRV   PE     G  KS+
Sbjct  363  AVAVFQNCDIFVRRPMDHQGNMITAQGRDNPHENTGISIQHSRVRAAPEFEAVKGRFKSY  422

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT++DGLIDP+GW EW GDFALSTLYYGE+MNTG+GA T  RVNWP
Sbjct  423  LGRPWKKYSRTVFLKTEIDGLIDPRGWREWRGDFALSTLYYGEFMNTGSGAGTSRRVNWP  482

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFHLL   +EASPF VS FIQGDSWIP +GVPF +
Sbjct  483  GFHLLHGEEEASPFTVSRFIQGDSWIPITGVPFSA  517



>ref|XP_006292970.1| hypothetical protein CARUB_v10019247mg [Capsella rubella]
 gb|EOA25868.1| hypothetical protein CARUB_v10019247mg [Capsella rubella]
Length=527

 Score =   343 bits (881),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 183/215 (85%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V+SD ++FYRCS KGYQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  311  FENTAGPHKHQAVALRVSSDLSLFYRCSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  370

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAV QNCDIFV++PMDHQ N+ITAQGRDDP+ NTGISI +SRV   PE     G  K++
Sbjct  371  AAAVFQNCDIFVRRPMDHQGNMITAQGRDDPHANTGISIQHSRVRAAPEFEAVKGQFKNY  430

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KTDLDGLIDP+GW EWSG +ALSTLYYGE+MNTG GA T  RVNWP
Sbjct  431  LGRPWKKYSRTVFLKTDLDGLIDPRGWREWSGGYALSTLYYGEFMNTGTGAGTSRRVNWP  490

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+LR   EASPF VS FIQGDSWIP +GVPF +
Sbjct  491  GFHVLRDEGEASPFSVSRFIQGDSWIPITGVPFSA  525



>ref|XP_003521962.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Glycine max]
Length=490

 Score =   342 bits (876),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 183/215 (85%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGPEKHQAVA+ V+SD +VFYRCS + YQDTLYVHS RQFYRDC++YGTIDFIFG+
Sbjct  274  FENSAGPEKHQAVALKVSSDLSVFYRCSFRAYQDTLYVHSNRQFYRDCYVYGTIDFIFGD  333

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPE-LRGGGGVKSF  358
            A  VLQNCDIFV+KPM HQSN ITAQGRDDPN+NTGISI + RV P  E L      K+F
Sbjct  334  ATVVLQNCDIFVRKPMSHQSNFITAQGRDDPNKNTGISIQSCRVRPDSEFLTLKESFKTF  393

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWRKYSRTVF+KTDLDGL+ P+GW EWSG+FALSTLYYGEY+NTG GASTQNRVNWP
Sbjct  394  LGRPWRKYSRTVFLKTDLDGLVHPRGWGEWSGEFALSTLYYGEYLNTGYGASTQNRVNWP  453

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+LR   EA+PF V+ F+QG+ WIP +GVPF S
Sbjct  454  GFHVLRSASEATPFTVNQFLQGERWIPATGVPFSS  488



>gb|KHN35621.1| Putative pectinesterase/pectinesterase inhibitor 36 [Glycine 
soja]
Length=490

 Score =   342 bits (876),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 183/215 (85%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGPEKHQAVA+ V+SD +VFYRCS + YQDTLYVHS RQFYRDC++YGTIDFIFG+
Sbjct  274  FENSAGPEKHQAVALKVSSDLSVFYRCSFRAYQDTLYVHSNRQFYRDCYVYGTIDFIFGD  333

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPE-LRGGGGVKSF  358
            A  VLQNCDIFV+KPM HQSN ITAQGRDDPN+NTGISI + RV P  E L      K+F
Sbjct  334  ATVVLQNCDIFVRKPMSHQSNFITAQGRDDPNKNTGISIQSCRVRPDSEFLTLKESFKTF  393

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWRKYSRTVF+KTDLDGL+ P+GW EWSG+FALSTLYYGEY+NTG GASTQNRVNWP
Sbjct  394  LGRPWRKYSRTVFLKTDLDGLVHPRGWGEWSGEFALSTLYYGEYLNTGYGASTQNRVNWP  453

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+LR   EA+PF V+ F+QG+ WIP +GVPF S
Sbjct  454  GFHVLRSASEATPFTVNQFLQGERWIPATGVPFSS  488



>ref|NP_191632.2| putative pectinesterase/pectinesterase inhibitor 36 [Arabidopsis 
thaliana]
 sp|Q84R10.2|PME36_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
36; Includes: RecName: Full=Pectinesterase inhibitor 36; AltName: 
Full=Pectin methylesterase inhibitor 36; Includes: RecName: 
Full=Pectinesterase 36; Short=PE 36; AltName: Full=Pectin 
methylesterase 36; Short=AtPME36; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE80101.1| putative pectinesterase/pectinesterase inhibitor 36 [Arabidopsis 
thaliana]
Length=519

 Score =   341 bits (875),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 184/215 (86%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V+SD ++FYRCS KGYQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  303  FENTAGPHKHQAVALRVSSDLSLFYRCSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  362

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAV QNCDIFV++PMDHQ N+ITAQGRDDP+ N+GISI +SR+   PE     G  KS+
Sbjct  363  AAAVFQNCDIFVRRPMDHQGNMITAQGRDDPHTNSGISIQHSRIRAAPEFEAVKGRFKSY  422

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KTD+D LIDP+GW EWSG +ALSTLYYGE+MNTGAGA T  RVNWP
Sbjct  423  LGRPWKKYSRTVFLKTDIDELIDPRGWREWSGSYALSTLYYGEFMNTGAGAGTGRRVNWP  482

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+LR  +EASPF VS FIQGDSWIP +GVPF +
Sbjct  483  GFHVLRGEEEASPFTVSRFIQGDSWIPITGVPFSA  517



>gb|KEH29120.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=489

 Score =   339 bits (870),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 163/215 (76%), Positives = 179/215 (83%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGPE HQAVA+ V+SD +VFYRCS K YQDTLYVHS RQFYRDCHIYGTIDFIFG+
Sbjct  273  FENTAGPENHQAVALKVSSDLSVFYRCSFKAYQDTLYVHSNRQFYRDCHIYGTIDFIFGD  332

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNCDIF++KPM HQSN ITAQGRDDPN+ TGISI N RV P  +       +KSF
Sbjct  333  AAVVLQNCDIFIRKPMSHQSNFITAQGRDDPNKPTGISIQNCRVRPDSDFSMVKDSIKSF  392

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVFIK+DLDGLI PKGW EW G+FALSTLYYGEYMNTG GASTQNRVNWP
Sbjct  393  LGRPWKKYSRTVFIKSDLDGLIHPKGWGEWEGNFALSTLYYGEYMNTGNGASTQNRVNWP  452

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+L+  DEAS F VS F+QG+ WI  SGVP  S
Sbjct  453  GFHVLKSSDEASQFTVSRFLQGEHWISASGVPVWS  487



>ref|XP_010469150.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Camelina sativa]
Length=533

 Score =   340 bits (871),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 181/215 (84%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V SD ++FYRCS KGYQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  317  FENTAGPHKHQAVALRVNSDLSLFYRCSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  376

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAV QNCDIFV++PMDHQ N+ITAQGRDDP+  TGISI +SRV   PE     G  K++
Sbjct  377  AAAVFQNCDIFVRRPMDHQGNVITAQGRDDPHATTGISIQHSRVRAAPEFEAVKGRFKNY  436

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KTDLDGLIDP+GW EWSG FAL TLYYGE+MNTGAGA T  RV WP
Sbjct  437  LGRPWKKYSRTVFLKTDLDGLIDPRGWREWSGSFALLTLYYGEFMNTGAGAETSRRVGWP  496

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+LR  +EASPF VS FIQGDSWIP +GVPF +
Sbjct  497  GFHVLRGEEEASPFTVSRFIQGDSWIPITGVPFSA  531



>ref|XP_002876579.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52838.1| pectinesterase family protein [Arabidopsis lyrata subsp. lyrata]
Length=520

 Score =   339 bits (869),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 158/215 (73%), Positives = 182/215 (85%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V+SD ++FYRCS KGYQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  304  FENTAGPHKHQAVALRVSSDLSLFYRCSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AV QNCDIFV++PMDHQ N+ITAQGRDDP+ N+GISI +SR+   PE     G  KS+
Sbjct  364  ATAVFQNCDIFVRRPMDHQGNMITAQGRDDPHSNSGISIQHSRIRAAPEFEAVKGRFKSY  423

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +KTD+D LIDP+GW EWSG +ALSTLYYGE+MNTGAGA T  RVNWP
Sbjct  424  LGRPWKKYSRTVLLKTDIDELIDPRGWREWSGSYALSTLYYGEFMNTGAGAGTSRRVNWP  483

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+LR  +EASPF VS FIQGDSWIP +GVPF +
Sbjct  484  GFHVLRGQEEASPFTVSRFIQGDSWIPITGVPFSA  518



>ref|XP_011090455.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Sesamum indicum]
Length=484

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/217 (73%), Positives = 185/217 (85%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+ V+SD +VFYRCS KGYQDTL +HSLRQFYRDC ++GT+DFIFG+
Sbjct  268  FENTAGPQKHQAVALRVSSDLSVFYRCSFKGYQDTLLLHSLRQFYRDCQVHGTVDFIFGD  327

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAVLQNCDI V++PM HQSN+ITAQGRDDPNENTGISI+NSRV+P  + R   G  +S+
Sbjct  328  AAAVLQNCDIVVRRPMPHQSNMITAQGRDDPNENTGISIMNSRVLPAFDFRDVKGRFRSY  387

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV ++TDLDGL+D KGW EWSGDFALSTLYY EYMNTGAGAST +RV WP
Sbjct  388  LGRPWKKYSRTVVLQTDLDGLVDGKGWKEWSGDFALSTLYYAEYMNTGAGASTADRVKWP  447

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH+LR   EA  F V NFI G+SWIP +GVPF S +
Sbjct  448  GFHVLRDRQEAEQFSVRNFIGGESWIPATGVPFSSAV  484



>ref|XP_007134835.1| hypothetical protein PHAVU_010G080300g [Phaseolus vulgaris]
 gb|ESW06829.1| hypothetical protein PHAVU_010G080300g [Phaseolus vulgaris]
Length=486

 Score =   336 bits (862),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 156/215 (73%), Positives = 182/215 (85%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGPEKHQAVA+ V+SD +VFYRCS KGYQDTLYVHS RQFYRDCHIYGTIDFIFG+
Sbjct  270  FENSAGPEKHQAVALKVSSDLSVFYRCSFKGYQDTLYVHSNRQFYRDCHIYGTIDFIFGD  329

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNCDI V+KPM  Q+N ITAQGRDDPNENTGI+I + RV    E        K+F
Sbjct  330  AAVVLQNCDILVRKPMSQQANFITAQGRDDPNENTGIAIQSCRVRAASEFVALKDSYKTF  389

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRT+F+K++LDGLIDPKGW EWSG+FA+STL+YGEYMNTG+GAST+NRV WP
Sbjct  390  LGRPWKRYSRTLFLKSELDGLIDPKGWGEWSGNFAVSTLFYGEYMNTGSGASTENRVTWP  449

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+LR   EASPF V+ F+QG+ WIP +GVPF S
Sbjct  450  GFHVLRSASEASPFTVNQFLQGERWIPATGVPFSS  484



>gb|AAP04164.1| putative pectinesterase [Arabidopsis thaliana]
 dbj|BAF00482.1| pectinesterase like protein [Arabidopsis thaliana]
Length=519

 Score =   337 bits (864),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 183/215 (85%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V+SD ++FYRCS KGYQDTL+ HSLRQFYRD HIYGTIDFIFG+
Sbjct  303  FENTAGPHKHQAVALRVSSDLSLFYRCSFKGYQDTLFTHSLRQFYRDRHIYGTIDFIFGD  362

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAV QNCDIFV++PMDHQ N+ITAQGRDDP+ N+GISI +SR+   PE     G  KS+
Sbjct  363  AAAVFQNCDIFVRRPMDHQGNMITAQGRDDPHTNSGISIQHSRIRAAPEFEAVKGRFKSY  422

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KTD+D LIDP+GW EWSG +ALSTLYYGE+MNTGAGA T  RVNWP
Sbjct  423  LGRPWKKYSRTVFLKTDIDELIDPRGWREWSGSYALSTLYYGEFMNTGAGAGTGRRVNWP  482

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+LR  +EASPF VS FIQGDSWIP +GVPF +
Sbjct  483  GFHVLRGEEEASPFTVSRFIQGDSWIPITGVPFSA  517



>ref|XP_010413524.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Camelina sativa]
Length=533

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 160/215 (74%), Positives = 181/215 (84%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V SD ++FYRCS KGYQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  317  FENTAGPHKHQAVALRVNSDLSLFYRCSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  376

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAV QNCDIFV++PMDHQ N+ITAQGRDDP+  TGISI +SRV   PE     G  K++
Sbjct  377  AAAVFQNCDIFVRRPMDHQGNMITAQGRDDPHATTGISIQHSRVRAAPEFEAVKGRFKNY  436

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KTDL GLIDP+GW E SG +ALSTLYYGE+MNTGAGA T  RVNWP
Sbjct  437  LGRPWKKYSRTVFLKTDLAGLIDPRGWREGSGSYALSTLYYGEFMNTGAGAGTTRRVNWP  496

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+LR  +EASPF VS FIQGDSWIP +GVPF +
Sbjct  497  GFHVLRGEEEASPFSVSRFIQGDSWIPITGVPFAA  531



>ref|XP_010692199.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Beta vulgaris subsp. vulgaris]
Length=432

 Score =   332 bits (851),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 155/212 (73%), Positives = 178/212 (84%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+ VASDH++FYRCS +GYQDTLY HSLRQFYRDCHIYGT+DFIFGN
Sbjct  216  FENTAGPQKHQAVALMVASDHSLFYRCSFQGYQDTLYAHSLRQFYRDCHIYGTVDFIFGN  275

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNCDIFV+KPM+HQ+N+ITAQGR+ P ENTGISI  SR+ P PE  G    VK+F
Sbjct  276  AAVVLQNCDIFVRKPMNHQANMITAQGRESPYENTGISIHGSRIQPAPEFVGLTQSVKTF  335

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+K+SRT+  K+DLDGLI P+GW  W G+FALSTLYY EYMNTG GAST+ RVNWP
Sbjct  336  LGRPWKKFSRTIIAKSDLDGLIHPRGWTNWEGNFALSTLYYAEYMNTGVGASTRARVNWP  395

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVP  634
            GFH+LR   E  PF V NFIQG+SWI  +GVP
Sbjct  396  GFHVLRDLKEVHPFMVRNFIQGESWILSTGVP  427



>ref|XP_010058465.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Eucalyptus grandis]
Length=507

 Score =   333 bits (853),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 179/217 (82%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V+SD +VFYRCS K YQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  291  FENTAGPHKHQAVALMVSSDQSVFYRCSFKAYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  350

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA + QNCDIFV++PMDHQ+N++TAQGRDD  ENTGISI  SR+ P  +     G  KS+
Sbjct  351  AAVIFQNCDIFVRRPMDHQANMVTAQGRDDKYENTGISIHGSRIAPALDFAPVKGSFKSY  410

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +KT+LDGLIDPKGW EWSG+FAL TL+YGEYMN G G+ST+ RVNWP
Sbjct  411  LGRPWKKYSRTVIMKTNLDGLIDPKGWNEWSGEFALKTLFYGEYMNLGHGSSTERRVNWP  470

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH+L+ P+E  PF V  FIQGD WIP +GVPF  ++
Sbjct  471  GFHVLKSPEEVGPFSVRRFIQGDLWIPRTGVPFSLEI  507



>ref|XP_002511680.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50349.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=472

 Score =   330 bits (847),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 156/213 (73%), Positives = 178/213 (84%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V+SD +VFYRCS K YQDTL+V SLRQFYRDCHIYGTIDFIFG+
Sbjct  256  FENTAGPHKHQAVALRVSSDLSVFYRCSFKAYQDTLFVLSLRQFYRDCHIYGTIDFIFGD  315

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPE-LRGGGGVKSF  358
            A  V QNCDIFV++PMDHQ+N ITAQGRDDPNENTGISI  SRV  +P+ +     ++SF
Sbjct  316  APVVFQNCDIFVRRPMDHQANFITAQGRDDPNENTGISIQRSRVRASPDFMVAKNKIRSF  375

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF++TDLDGLIDP GW  W GDFALSTL+Y EYMNTG GAST  RV WP
Sbjct  376  LGRPWKKYSRTVFMQTDLDGLIDPMGWGAWHGDFALSTLFYAEYMNTGNGASTSRRVKWP  435

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+L  P +ASPF V+ FIQG+SWIP +GVPF
Sbjct  436  GFHVLSSPQQASPFTVTRFIQGESWIPATGVPF  468



>ref|XP_010941122.1| PREDICTED: pectinesterase [Elaeis guineensis]
Length=493

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 157/213 (74%), Positives = 177/213 (83%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN AGPEKHQAVAV + SDH+VFYRCS KGYQDTL+V S RQFYR+C IYGTIDFIFGN
Sbjct  277  FENAAGPEKHQAVAVRMGSDHSVFYRCSFKGYQDTLFVLSQRQFYRECQIYGTIDFIFGN  336

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPEL-RGGGGVKSF  358
            AAAVLQNCDI+V+KPM HQSN+ITAQGRDD N+NTGISI  SRV P P+  R  G  KS+
Sbjct  337  AAAVLQNCDIYVRKPMWHQSNVITAQGRDDKNQNTGISIHASRVRPAPDFERVKGSFKSY  396

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KTDLDG+IDP+GW  W GDFAL TLYY EYMN+G GA    RV WP
Sbjct  397  LGRPWKEYSRTVFLKTDLDGMIDPQGWTRWRGDFALDTLYYAEYMNSGDGAYAGKRVKWP  456

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+L   +EA+PF V NFI+G SWIPESGVPF
Sbjct  457  GFHVLSDSNEAAPFTVENFIEGRSWIPESGVPF  489



>ref|XP_004506985.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Cicer arietinum]
Length=489

 Score =   328 bits (842),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 159/215 (74%), Positives = 178/215 (83%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGPE HQAVA+ V+SD +VFYRCS K YQDTLYVHS RQFYRDCHIYGTIDFIFG+
Sbjct  273  FENTAGPENHQAVALKVSSDLSVFYRCSFKAYQDTLYVHSNRQFYRDCHIYGTIDFIFGD  332

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A  VLQNCDIFV+KPM  Q+N ITAQGRDDPN+ TGISI + RV P+ E       +K+F
Sbjct  333  ATVVLQNCDIFVRKPMSQQTNFITAQGRDDPNKPTGISIQSCRVRPSSEFSMFKDSIKTF  392

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWRKYSRTV++K+DLDGLI PKGW EW G+FALSTLYYGEYMNTG GASTQNRVNWP
Sbjct  393  LGRPWRKYSRTVYLKSDLDGLIHPKGWGEWEGNFALSTLYYGEYMNTGNGASTQNRVNWP  452

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GFH+L   +EAS F VS F+QG+ WI  SGVPF S
Sbjct  453  GFHVLSSANEASHFTVSQFLQGEHWIQASGVPFWS  487



>ref|XP_003553884.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
isoform X1 [Glycine max]
 gb|KHN00029.1| Putative pectinesterase/pectinesterase inhibitor 36 [Glycine 
soja]
Length=468

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 181/215 (84%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP  HQAVA+ V+SD +VFY+CS KGYQDTL VHS RQFYRDCHIYGTIDFIFG+
Sbjct  252  FENTAGPSGHQAVALRVSSDLSVFYKCSFKGYQDTLLVHSNRQFYRDCHIYGTIDFIFGD  311

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A+ V QNCDIF+++PMDHQ+N ITAQGRDDPN+ TGISI + +V P  +       ++S+
Sbjct  312  ASVVFQNCDIFLRRPMDHQTNFITAQGRDDPNKPTGISIQSCQVKPAYDFDSYKDSIRSY  371

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRT+F+KTDLDGLIDPKGW EW+GDFALSTLYYGEYMNTG+GASTQNRV WP
Sbjct  372  LGRPWKQYSRTLFLKTDLDGLIDPKGWGEWNGDFALSTLYYGEYMNTGSGASTQNRVTWP  431

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            GF +L   DEA+PF VS F+QG+ WIP +GVPF S
Sbjct  432  GFRVLNNDDEATPFSVSQFLQGEQWIPATGVPFWS  466



>gb|EYU31970.1| hypothetical protein MIMGU_mgv1a025432mg [Erythranthe guttata]
Length=483

 Score =   324 bits (831),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/216 (72%), Positives = 176/216 (81%), Gaps = 10/216 (5%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V+SD +VFYRCS KGYQDTL VHSLRQFYR+C I+GTIDFIFG+
Sbjct  278  FENTAGPAKHQAVALRVSSDLSVFYRCSFKGYQDTLLVHSLRQFYRECQIHGTIDFIFGD  337

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            A+AV QNCDIFV++PMDHQ+N+ITAQGRDD NENTGISILNSRV+P+            L
Sbjct  338  ASAVFQNCDIFVRRPMDHQANMITAQGRDDVNENTGISILNSRVLPSV----------IL  387

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW+KYSR VF+KTDLDGL+D +GW EWSGDFALSTLYY EYMNTG GA T NRV WPG
Sbjct  388  GRPWKKYSRAVFLKTDLDGLVDGRGWREWSGDFALSTLYYAEYMNTGVGAFTGNRVKWPG  447

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            FH+L    EA+ F V +FI GDSWIP +GVPF   L
Sbjct  448  FHVLSDLSEANRFGVRSFIGGDSWIPATGVPFSGDL  483



>ref|XP_010661658.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Vitis vinifera]
 emb|CBI38889.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   323 bits (829),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 177/213 (83%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN AGP KHQAVA+ V+SD +VFYRCS KGYQDTLYVHS RQF+RDCH+YGTIDFIFGN
Sbjct  269  FENRAGPHKHQAVAMRVSSDLSVFYRCSFKGYQDTLYVHSNRQFFRDCHVYGTIDFIFGN  328

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNCDI+V+KPM+ QSN+ITAQGRD P E TGIS+  SRV+ +PE     G  KSF
Sbjct  329  AAVVFQNCDIYVRKPMNRQSNMITAQGRDIPEEPTGISVQASRVLSSPEFTTVKGSFKSF  388

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF++TDLDGLIDP+GW EWSG++ LSTLYYGEY N+G GAST+ RV WP
Sbjct  389  LGRPWKRYSRTVFLETDLDGLIDPRGWTEWSGNYGLSTLYYGEYNNSGGGASTKERVKWP  448

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+L   ++A PF VS FIQG+ WIP SGVPF
Sbjct  449  GFHVLNGTEDAMPFTVSRFIQGEKWIPASGVPF  481



>ref|XP_007219055.1| hypothetical protein PRUPE_ppa004770mg [Prunus persica]
 gb|EMJ20254.1| hypothetical protein PRUPE_ppa004770mg [Prunus persica]
Length=492

 Score =   323 bits (829),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 175/213 (82%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGPE HQAVA+ V+SD  VFYRCS+KGYQDTLYVH+ RQFYRDC IYGTIDFIFGN
Sbjct  276  FENTAGPEMHQAVALRVSSDITVFYRCSIKGYQDTLYVHANRQFYRDCQIYGTIDFIFGN  335

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPEL-RGGGGVKSF  358
            A AVLQNCDIFV++PM+ QSN+ITAQGRD  +E TGI I   RV P PE  R  G  +S+
Sbjct  336  AIAVLQNCDIFVRRPMNSQSNMITAQGRDKESETTGIVIHGCRVRPAPEFARVKGSFRSY  395

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+++SRTVF+KTDLDGLIDPKGW EW G + LSTL+YGEYMNTG GAST+ RV WP
Sbjct  396  LGRPWKRFSRTVFMKTDLDGLIDPKGWTEWRGSYGLSTLFYGEYMNTGTGASTEQRVKWP  455

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+L  P EASPF V+ FIQG  W+P +GVPF
Sbjct  456  GFHVLNSPQEASPFTVNKFIQGQFWLPATGVPF  488



>emb|CAB82677.1| pectinesterase-like protein [Arabidopsis thaliana]
Length=496

 Score =   322 bits (826),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 175/214 (82%), Gaps = 12/214 (6%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+ V+SD ++FYRCS KGYQDTL+ HSLRQFYRDCHIYGTIDFIFG+
Sbjct  293  FENTAGPHKHQAVALRVSSDLSLFYRCSFKGYQDTLFTHSLRQFYRDCHIYGTIDFIFGD  352

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AAAV QNCDIFV++PMDHQ N+ITAQGRDDP+ N+    +  R             KS+L
Sbjct  353  AAAVFQNCDIFVRRPMDHQGNMITAQGRDDPHTNSEFEAVKGRF------------KSYL  400

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW+KYSRTVF+KTD+D LIDP+GW EWSG +ALSTLYYGE+MNTGAGA T  RVNWPG
Sbjct  401  GRPWKKYSRTVFLKTDIDELIDPRGWREWSGSYALSTLYYGEFMNTGAGAGTGRRVNWPG  460

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            FH+LR  +EASPF VS FIQGDSWIP +GVPF +
Sbjct  461  FHVLRGEEEASPFTVSRFIQGDSWIPITGVPFSA  494



>emb|CAN75818.1| hypothetical protein VITISV_005130 [Vitis vinifera]
Length=485

 Score =   321 bits (822),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 176/213 (83%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN AGP KHQAVA+ V+SD +VFYRCS KGYQDTLYVHS RQF+RDCH+YGTIDFIFGN
Sbjct  269  FENRAGPHKHQAVAMRVSSDLSVFYRCSFKGYQDTLYVHSNRQFFRDCHVYGTIDFIFGN  328

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNCDI+V+KPM+ QSN+ITAQGRD P E TGIS+  SRV+ +P      G  KSF
Sbjct  329  AAVVFQNCDIYVRKPMNRQSNMITAQGRDIPEEPTGISVQXSRVLSSPXFTTVKGSFKSF  388

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF++TDLDGLIDP+GW EWSG++ LSTLYYGEY N+G GAST+ RV WP
Sbjct  389  LGRPWKRYSRTVFLETDLDGLIDPRGWTEWSGNYGLSTLYYGEYNNSGGGASTKERVKWP  448

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+L   ++A PF VS FIQG+ WIP SGVPF
Sbjct  449  GFHVLNGXEDAMPFTVSRFIQGEKWIPASGVPF  481



>ref|XP_008232608.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Prunus mume]
Length=490

 Score =   320 bits (821),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 174/213 (82%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGPE HQAVA+ V+SD  VFYRCS+KGYQDTLYVH+ RQFYRDC IYGTIDFIFGN
Sbjct  274  FENTAGPEMHQAVALRVSSDVTVFYRCSIKGYQDTLYVHANRQFYRDCQIYGTIDFIFGN  333

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPEL-RGGGGVKSF  358
            A AVLQNCDIFV++PM+ QSN+ITAQGRD   E TGI I   RV P PE  R  G  +S+
Sbjct  334  AIAVLQNCDIFVRRPMNSQSNMITAQGRDKELETTGIVIHGCRVRPAPEFARVTGSFRSY  393

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+++SRTVF++TDLDGLIDPKGW EW G + LSTL+YGEYMNTG GAST+ RV WP
Sbjct  394  LGRPWKRFSRTVFMETDLDGLIDPKGWTEWRGSYGLSTLFYGEYMNTGTGASTEQRVKWP  453

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+L  P EASPF V+ FIQG  W+P +GVPF
Sbjct  454  GFHVLNSPQEASPFSVNKFIQGQFWLPATGVPF  486



>ref|XP_010271283.1| PREDICTED: pectinesterase [Nelumbo nucifera]
Length=531

 Score =   320 bits (819),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 174/217 (80%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD +VFYRCS KGYQDTLYV+S RQFYRDC IYGT+DFIFG+
Sbjct  316  FENTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGD  375

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AVLQNC+I+V+KPM  Q N +TAQGR DPNENTGISI NSRV    +LR   G  K++
Sbjct  376  AVAVLQNCNIYVRKPMSGQRNTLTAQGRTDPNENTGISIHNSRVTAASDLRPLQGSFKTY  435

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LD LIDP GW+EWSG FALSTLYYGEYMNTG GAST  RV WP
Sbjct  436  LGRPWQKYSRTVFMKTSLDSLIDPDGWLEWSGSFALSTLYYGEYMNTGVGASTSQRVKWP  495

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH++   D A  F V NF+ GD+WIP +GVPF S +
Sbjct  496  GFHVMSASD-AGKFTVGNFLGGDTWIPATGVPFTSGM  531



>ref|XP_002314796.1| pectin methylesterase 6 family protein [Populus trichocarpa]
 gb|EEF00967.1| pectin methylesterase 6 family protein [Populus trichocarpa]
Length=531

 Score =   320 bits (819),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 177/217 (82%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD +VFY CS KGYQDTLYVHS RQFYRDC IYGT+DFIFG+
Sbjct  315  FENTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVHSQRQFYRDCDIYGTVDFIFGD  374

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A AVLQNC+I+V++PM  Q+N +TAQGR DP+ENTGI I NSRV+  P+LR   G  KS+
Sbjct  375  AVAVLQNCNIYVRRPMSKQTNTVTAQGRTDPDENTGIVIHNSRVMAAPDLRPVQGSFKSY  434

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+K+++DGLIDP GW+ W GDFALSTLYYGEYM+TG+GAST+ RV WP
Sbjct  435  LGRPWKKYSRTVFLKSNIDGLIDPAGWLPWKGDFALSTLYYGEYMSTGSGASTKGRVKWP  494

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H +  P EA  F V NF+ G+SWI  +GVPF S L
Sbjct  495  GYHTITSPLEAGKFTVENFLAGNSWISAAGVPFESGL  531



>ref|XP_010271268.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 174/217 (80%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP+KHQAVA+   SD +VFYRCS KGYQDTLYV+S RQFYRDC IYGT+DFIFG+
Sbjct  314  FQNTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGD  373

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A AVLQNC+I+V+KPM  Q N +TAQGR DPNENTGISI NSRV    +LR   G  K++
Sbjct  374  AVAVLQNCNIYVRKPMSGQKNTVTAQGRKDPNENTGISIHNSRVTAASDLRPVQGSFKTY  433

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LD LIDP GW+EWSG+FALSTLYYGEYMNTGAGAST  RV WP
Sbjct  434  LGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGAGASTSRRVKWP  493

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH++   D A  F V NF+ G SWI  +GVPF S L
Sbjct  494  GFHVMSASD-AGKFTVGNFLGGGSWIAAAGVPFTSGL  529



>ref|XP_002527782.1| Pectinesterase-1 precursor, putative [Ricinus communis]
 gb|EEF34592.1| Pectinesterase-1 precursor, putative [Ricinus communis]
Length=529

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 179/217 (82%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD +VFY CS KGYQDTLYV+S RQFYRDC IYGTIDFIFG+
Sbjct  313  FENTAGPQKHQAVALRSGSDFSVFYGCSFKGYQDTLYVYSQRQFYRDCDIYGTIDFIFGD  372

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A AVLQNC+I+V++PM+ Q N +TAQGR DPNENTGI I NS V+ T ++R   G  K++
Sbjct  373  AVAVLQNCNIYVRRPMNGQKNTVTAQGRKDPNENTGIVIHNSNVMATSDMRPVQGSFKTY  432

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRT+F+K++LDGLIDP GW+ WSG+FALSTLYYGEYMNTG+GAST  RVNWP
Sbjct  433  LGRPWQKYSRTLFMKSNLDGLIDPAGWLPWSGNFALSTLYYGEYMNTGSGASTARRVNWP  492

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++ +  +A  F V NF+ GDSWIP +GVPF S L
Sbjct  493  GYHVITKATDAGKFTVGNFLAGDSWIPGTGVPFDSGL  529



>ref|XP_008794816.1| PREDICTED: pectinesterase [Phoenix dactylifera]
Length=480

 Score =   315 bits (808),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 171/213 (80%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN AGPEK QAVAV V SDH+VFYRCS KGYQDTL+V S RQFYR+C IYGT+DFIFGN
Sbjct  264  FENAAGPEKQQAVAVMVGSDHSVFYRCSFKGYQDTLFVLSQRQFYRECQIYGTVDFIFGN  323

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAVLQ+C+I+V+KPM HQ N+ITAQGRDD N+NTGIS+  SRV P  +     G  +S+
Sbjct  324  AAAVLQDCEIYVRKPMWHQPNVITAQGRDDENQNTGISVHASRVRPAQDFEQVKGSFRSY  383

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LDGLIDP+GW +W GDFAL TLYY EYMNTG GA    RV WP
Sbjct  384  LGRPWKKYSRTVFLKTYLDGLIDPQGWAKWRGDFALDTLYYAEYMNTGDGACAGKRVKWP  443

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH L    EA+PF V NFI+G SWIPESGVPF
Sbjct  444  GFHALSDSSEAAPFTVENFIEGRSWIPESGVPF  476



>gb|KDP28779.1| hypothetical protein JCGZ_14550 [Jatropha curcas]
Length=472

 Score =   315 bits (808),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 148/212 (70%), Positives = 176/212 (83%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN AGP KHQAVA+ V++D +VFYRCS++ YQDTLYVHSLRQFYRDC IYGT+DFIFG+
Sbjct  256  FENIAGPNKHQAVALRVSADRSVFYRCSIQAYQDTLYVHSLRQFYRDCQIYGTVDFIFGD  315

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A+ + QNCDIFVK+PM+ Q+N ITAQGRD+PNE TGISI  SRV P+P+     G  K+F
Sbjct  316  ASVIFQNCDIFVKRPMNGQTNYITAQGRDNPNEITGISIHRSRVRPSPDFVAVKGSFKTF  375

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF++TDLDGLIDP GW +W G+FALSTL+Y EYMNTG GAST  RV WP
Sbjct  376  LGRPWKKYSRTVFMQTDLDGLIDPVGWGKWGGNFALSTLFYAEYMNTGNGASTTRRVKWP  435

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVP  634
            GFH+   P++A PF V+ FIQG+SWIP SGVP
Sbjct  436  GFHVFNSPEQALPFSVNRFIQGESWIPGSGVP  467



>ref|XP_007052105.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
 gb|EOX96262.1| Plant invertase/pectin methylesterase inhibitor superfamily, 
putative [Theobroma cacao]
Length=594

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 175/217 (81%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTA P K QAV + V+SDH+VFYRCS KGYQ+TL+V SLRQFYRDCHI  TIDFIF +
Sbjct  378  FENTAAPNKLQAVVLRVSSDHSVFYRCSFKGYQNTLFVQSLRQFYRDCHIDRTIDFIFSD  437

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGV-KSF  358
            A  VL+NCDIFVK+PM+ Q+N+ITAQGR+D NENTGISI  SRV P  +      + KS+
Sbjct  438  AQVVLKNCDIFVKRPMNQQANMITAQGREDSNENTGISIQGSRVRPAADFDSVKHLFKSY  497

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KTDLDGLIDPK W EWSG FALSTLYY EYMNTG+GAS  +RVNWP
Sbjct  498  LGRPWKRYSRTVFLKTDLDGLIDPKEWTEWSGSFALSTLYYAEYMNTGSGASIAHRVNWP  557

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH+L    EA PF VS  IQG++WIPE+GVPF  Q+
Sbjct  558  GFHVLDSAQEAVPFTVSRLIQGEAWIPETGVPFWPQI  594



>ref|XP_010271269.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   314 bits (804),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 172/217 (79%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAV++   SD +VFYRCS KGYQDTLYV+S RQFYRDC IYGT+DFIFG+
Sbjct  314  FENTAGPQKHQAVSLRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGD  373

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A AVLQNC+I+V+KPM  Q N +TAQGR DPNENTGISI NSRV    +LR   G  K++
Sbjct  374  AVAVLQNCNIYVRKPMSGQQNTVTAQGRTDPNENTGISIHNSRVTAASDLRPVQGSFKTY  433

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LD L+DP GW+EWSG+FALSTLYYGEYMN G GAST  RV WP
Sbjct  434  LGRPWQKYSRTVFMKTSLDSLVDPAGWLEWSGNFALSTLYYGEYMNIGGGASTSRRVKWP  493

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH++   D A  F V NF+ G SWI  +GVPF S L
Sbjct  494  GFHVMSASD-AGKFTVENFLGGGSWIAATGVPFTSGL  529



>ref|XP_004134349.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Cucumis sativus]
Length=490

 Score =   313 bits (801),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 175/213 (82%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP K QAVA+ + SD AV YRC++KGYQDTL++HSLRQFYRDC IYGTIDFIFGN
Sbjct  274  FENTAGPGKQQAVALRLNSDLAVVYRCAIKGYQDTLFLHSLRQFYRDCKIYGTIDFIFGN  333

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            +AAVLQNC+IFV++P+ HQ+N+ITAQGRDDP E TG SILNSRV P PE        +++
Sbjct  334  SAAVLQNCEIFVRQPILHQANMITAQGRDDPAEATGFSILNSRVQPAPEFSPVKAQYRTY  393

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+++SRTV I TDLDGLIDPKGW EW+GDFA+STL+Y E+ N G G+ST+ RVNWP
Sbjct  394  LGRPWKRFSRTVVIATDLDGLIDPKGWGEWTGDFAISTLFYAEFKNRGDGSSTRFRVNWP  453

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+LR  +EA PF V+ F+ G  WIP +GVPF
Sbjct  454  GFHILRSAEEARPFTVAEFLHGGDWIPATGVPF  486



>ref|XP_004168286.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36-like 
[Cucumis sativus]
 gb|KGN56615.1| hypothetical protein Csa_3G126790 [Cucumis sativus]
Length=487

 Score =   312 bits (800),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 175/213 (82%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP K QAVA+ + SD AV YRC++KGYQDTL++HSLRQFYRDC IYGTIDFIFGN
Sbjct  271  FENTAGPGKQQAVALRLNSDLAVVYRCAIKGYQDTLFLHSLRQFYRDCKIYGTIDFIFGN  330

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            +AAVLQNC+IFV++P+ HQ+N+ITAQGRDDP E TG SILNSRV P PE        +++
Sbjct  331  SAAVLQNCEIFVRQPILHQANMITAQGRDDPAEATGFSILNSRVQPAPEFSPVKAQYRTY  390

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+++SRTV I TDLDGLIDPKGW EW+GDFA+STL+Y E+ N G G+ST+ RVNWP
Sbjct  391  LGRPWKRFSRTVVIATDLDGLIDPKGWGEWTGDFAISTLFYAEFKNRGDGSSTRFRVNWP  450

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+LR  +EA PF V+ F+ G  WIP +GVPF
Sbjct  451  GFHILRSAEEARPFTVAEFLHGGDWIPATGVPF  483



>ref|XP_008438191.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
isoform X1 [Cucumis melo]
Length=490

 Score =   312 bits (799),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 176/213 (83%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGPEK QAVA+ + SD AV YRC++KGYQDTL++HSLRQFYRDC IYGTIDFIFGN
Sbjct  274  FENTAGPEKQQAVALRLNSDLAVVYRCAIKGYQDTLFLHSLRQFYRDCKIYGTIDFIFGN  333

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            +AAVLQNC+IFV++P  HQ+N+ITAQGRDDP E TGISILNSRV PTP+        +++
Sbjct  334  SAAVLQNCEIFVRQPRRHQANMITAQGRDDPAEATGISILNSRVQPTPDFAPVKAQYRTY  393

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+++SRTV + TDLDGLIDPKGW EW+G+FA+STL+Y E+ N G G+ST+ RVNWP
Sbjct  394  LGRPWKRFSRTVVMGTDLDGLIDPKGWGEWTGNFAISTLFYAEFKNRGDGSSTRFRVNWP  453

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH+LR  DEA PF V+ F+ G  WIP SGV F
Sbjct  454  GFHVLRSADEARPFTVAEFLHGGDWIPASGVSF  486



>ref|XP_011038599.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=531

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 175/217 (81%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD +VFY CS KGYQDTLYVHS RQFYRDC IYGT+DFIFG+
Sbjct  315  FENTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVHSQRQFYRDCDIYGTVDFIFGD  374

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGV-KSF  358
            A AVLQNC+I+V++PM  Q N +TAQGR DP ENTGI I NSRV+   +LR   G+ KS+
Sbjct  375  AVAVLQNCNIYVRRPMSKQENTVTAQGRTDPGENTGIVIHNSRVMAASDLRPVQGLFKSY  434

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+K+++DGLIDP GW+ W GDFALSTLYYGEYM+TG+GAST+ RV WP
Sbjct  435  LGRPWKKYSRTVFLKSNIDGLIDPAGWLPWKGDFALSTLYYGEYMSTGSGASTKGRVKWP  494

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H +  P EA  F V NF+ G+SWI  +GVPF + L
Sbjct  495  GYHTITSPLEAGKFTVENFLAGNSWISAAGVPFEAGL  531



>ref|XP_010266280.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=529

 Score =   313 bits (801),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 173/217 (80%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD +VFYRCS+KGYQDTLYV+S RQFYRDC IYGT+DFIFG+
Sbjct  314  FENTAGPQKHQAVALRSGSDLSVFYRCSLKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGD  373

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AV+QNC+I+V+KPM  Q N +TAQGR DPNENTGISI NSRV    +LR   G  K++
Sbjct  374  AVAVIQNCNIYVRKPMSGQKNTVTAQGRTDPNENTGISIHNSRVTAASDLRAVQGSFKTY  433

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LD LIDP GW+EWSG FALSTLYYGEYMNTGAGAST  RV W 
Sbjct  434  LGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGSFALSTLYYGEYMNTGAGASTGGRVKWA  493

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++   D A  F V +F+ G SWI  +GVPF S L
Sbjct  494  GYHVMSAAD-AGKFTVGSFLGGGSWIGSAGVPFTSGL  529



>ref|XP_008812473.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 173/217 (80%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP KHQAVA+   SD +VFYRCS +GYQDTLY++S RQFYR+C +YGT+DFIFG+
Sbjct  299  FQNTAGPHKHQAVALRSGSDLSVFYRCSFEGYQDTLYIYSQRQFYRNCDVYGTVDFIFGD  358

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQNC ++V+KPM  Q N +TAQGR DPNENTGISI +S V    EL+   G  K++
Sbjct  359  AAVVLQNCSMYVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASELKPVQGSFKTY  418

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LD LIDP GW+EWSG+FALSTLYYGEYMNTGAGA T  RV WP
Sbjct  419  LGRPWKKYSRTVFMKTSLDCLIDPAGWLEWSGNFALSTLYYGEYMNTGAGADTSQRVKWP  478

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V+NF+ G+SWIP +GV F S L
Sbjct  479  GYHVITSATEASKFTVANFLSGNSWIPATGVAFTSGL  515



>gb|KEH15723.1| pectinesterase [Medicago truncatula]
Length=228

 Score =   302 bits (773),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 172/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   +DH+VFYRC+ KG+QDTLYV++ RQFYRDC+IYGTIDFIFGN
Sbjct  12   FENTAGPQKHQAVALRSGADHSVFYRCAFKGFQDTLYVYANRQFYRDCNIYGTIDFIFGN  71

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A  VLQNC+IFV+KPM +Q N +TAQGR DPNENTGI I N R+  + +L+     VK++
Sbjct  72   AVTVLQNCNIFVRKPMSNQQNTVTAQGRTDPNENTGIVIHNCRITASSDLKAIQNSVKTY  131

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K++LDGLI+ +GW  W G FALSTLYYGEYMN G GA+T  RV WP
Sbjct  132  LGRPWQKYSRTVVMKSNLDGLINSEGWAPWMGGFALSTLYYGEYMNVGGGANTDGRVKWP  191

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH++  P +A  F V NF+ GDSWI  SGVPF + L
Sbjct  192  GFHVITNPSDAVKFSVGNFLAGDSWISGSGVPFDAGL  228



>ref|XP_010654104.1| PREDICTED: pectinesterase [Vitis vinifera]
Length=534

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 174/217 (80%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGPEKHQAVA+  +SD +VFY CS KGYQDTLYVH+ RQFYR C +YGT+DFIFG+
Sbjct  318  FENTAGPEKHQAVALRSSSDGSVFYGCSFKGYQDTLYVHTQRQFYRSCDVYGTVDFIFGD  377

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A AVLQNC+I+V++PM +Q+N+ITAQGR D NENTGISI NSRV+  P+LR      K++
Sbjct  378  AVAVLQNCNIYVRRPMSNQANVITAQGRSDQNENTGISIHNSRVMAAPDLRPVQSRFKTY  437

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWRKYSRTVF+KT LDGLI P+GW  W GDF LSTLYYGEYMNTG+GAST+ RV W 
Sbjct  438  LGRPWRKYSRTVFMKTSLDGLIHPEGWSPWKGDFGLSTLYYGEYMNTGSGASTRGRVKWR  497

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EA  F V  F+ GDSWIP +GVP+ S L
Sbjct  498  GYHVITSAAEADKFTVGRFLVGDSWIPTTGVPYASGL  534



>ref|XP_008372811.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 36 [Malus domestica]
 ref|XP_008356315.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 36 [Malus domestica]
Length=331

 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/214 (69%), Positives = 172/214 (80%), Gaps = 4/214 (2%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+ V+SD AVFYRCS K YQDT+Y HS RQFYRDC +YGTIDFIFG+
Sbjct  116  FENTAGPQKHQAVALRVSSDLAVFYRCSFKAYQDTVYAHSNRQFYRDCQVYGTIDFIFGD  175

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A  V+QNCDIFV++PM  Q+N+ITAQGRD+P EN+GI+I   RV P PE  G  G  +++
Sbjct  176  AYMVMQNCDIFVRRPMKSQANMITAQGRDNPEENSGIAIHGCRVRPAPEFAGVKGSFRNY  235

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWRKYSRTVF+KTDLDGLIDPK W EW G + LSTL+YGEYMNTG GA+T+ RV WP
Sbjct  236  LGRPWRKYSRTVFLKTDLDGLIDPKRWTEWRGSYGLSTLFYGEYMNTGPGAATEKRVKWP  295

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPES-GVPF  637
            GFH    P + SPF V NFIQG +WIP + GVPF
Sbjct  296  GFHX--GPQQVSPFTVGNFIQGQNWIPVTGGVPF  327



>ref|XP_008389982.1| PREDICTED: pectinesterase [Malus domestica]
 ref|XP_008367067.1| PREDICTED: pectinesterase-like [Malus domestica]
Length=537

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 172/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+  +SDH+VFYRCS KGYQDTLYVHS RQFYRDC I+GT+DFI G+
Sbjct  321  FENTAGPQKHQAVALRSSSDHSVFYRCSFKGYQDTLYVHSQRQFYRDCDIHGTVDFICGD  380

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A AVLQNC+I+ +KPM +Q N ITAQ R DPNENTGI I NSR+    +LR   G  K++
Sbjct  381  ATAVLQNCNIYARKPMSNQINTITAQSRTDPNENTGIVIHNSRITAAQDLRPVQGSFKTY  440

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K++LDGLIDP GW  WSG FALSTLYYGEYMN+GAGA T  RVNWP
Sbjct  441  LGRPWKKYSRTVIMKSNLDGLIDPAGWFPWSGSFALSTLYYGEYMNSGAGAGTGGRVNWP  500

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++R   EA  F V N + GDSWIP +GVPF + L
Sbjct  501  GYRVIRSATEAGKFTVGNLLAGDSWIPGTGVPFTTGL  537



>gb|KEH21378.1| pectinesterase [Medicago truncatula]
Length=372

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 172/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   +DH+VFYRC+ KG+QDTLYV++ RQFYRDC+IYGTIDFIFGN
Sbjct  156  FENTAGPQKHQAVALRSGADHSVFYRCAFKGFQDTLYVYANRQFYRDCNIYGTIDFIFGN  215

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A  VLQNC+IFV+KPM +Q N +TAQGR DPNENTGI I N R+  + +L+     VK++
Sbjct  216  AVTVLQNCNIFVRKPMSNQQNTVTAQGRTDPNENTGIVIHNCRITASSDLKAIQNSVKTY  275

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K++LDGLI+ +GW  W G FALSTLYYGEYMN G GA+T  RV WP
Sbjct  276  LGRPWQKYSRTVVMKSNLDGLINSEGWAPWMGGFALSTLYYGEYMNVGGGANTDGRVKWP  335

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH++  P +A  F V NF+ GDSWI  SGVPF + L
Sbjct  336  GFHVITNPSDAVKFSVGNFLAGDSWISGSGVPFDAGL  372



>emb|CDO97715.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   309 bits (792),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 174/212 (82%), Gaps = 1/212 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+K QAVA+ V SD +VFYRCS KGYQDTL VHSLRQFYRDC I+GTIDFIFG+
Sbjct  304  FENTAGPQKMQAVALRVGSDLSVFYRCSFKGYQDTLLVHSLRQFYRDCQIHGTIDFIFGD  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A+AV QNCDIFV++PMD QSN+ITAQGRD P++ TGISI+N RV P+ +     G   S+
Sbjct  364  ASAVFQNCDIFVRRPMDDQSNMITAQGRDHPDQYTGISIINCRVAPSSDFSPFTGRFNSY  423

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KTDL GL+ P+GW EW+G+FALSTLYYGEYMNTG GAST NRV WP
Sbjct  424  LGRPWKQYSRTVFLKTDLGGLVHPRGWSEWAGNFALSTLYYGEYMNTGRGASTANRVKWP  483

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVP  634
            GFH +  P EAS F V NFIQGD W+  +GVP
Sbjct  484  GFHPMYDPREASWFSVRNFIQGDLWLSATGVP  515



>emb|CAN77092.1| hypothetical protein VITISV_026596 [Vitis vinifera]
Length=507

 Score =   308 bits (790),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 145/217 (67%), Positives = 173/217 (80%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+  +SD +VFY CS KGYQDTLYVH+ RQFYR C +YGT+DFIFG+
Sbjct  291  FENTAGPQKHQAVALRSSSDGSVFYGCSFKGYQDTLYVHTQRQFYRSCDVYGTVDFIFGD  350

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A AVLQNC+I+V++PM +Q N+ITAQGR D NENTGISI NSRV+  P+LR      K++
Sbjct  351  AVAVLQNCNIYVRRPMSNQPNVITAQGRSDQNENTGISIHNSRVMAAPDLRPVQSRFKTY  410

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWRKYSRTVF+KT LDGLI P+GW  W GDF LSTLYYGEYMNTG+GAST+ RV W 
Sbjct  411  LGRPWRKYSRTVFMKTSLDGLIHPEGWSPWKGDFGLSTLYYGEYMNTGSGASTRGRVKWR  470

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EA  F V  F+ GDSWIP +GVP+ S L
Sbjct  471  GYHVITSAAEADKFTVGRFLVGDSWIPTTGVPYASGL  507



>ref|XP_003630894.1| Pectinesterase [Medicago truncatula]
Length=326

 Score =   301 bits (770),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 172/216 (80%), Gaps = 1/216 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   +DH+VFYRC+ KG+QDTLYV++ RQFYRDC+IYGTIDFIFGN
Sbjct  93   FENTAGPQKHQAVALRSGADHSVFYRCAFKGFQDTLYVYANRQFYRDCNIYGTIDFIFGN  152

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A  VLQNC+IFV+KPM +Q N +TAQGR DPNENTGI I N R+  + +L+     VK++
Sbjct  153  AVTVLQNCNIFVRKPMSNQQNTVTAQGRTDPNENTGIVIHNCRITASSDLKAIQNSVKTY  212

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K++LDGLI+ +GW  W G FALSTLYYGEYMN G GA+T  RV WP
Sbjct  213  LGRPWQKYSRTVVMKSNLDGLINSEGWAPWMGGFALSTLYYGEYMNVGGGANTDGRVKWP  272

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQ  646
            GFH++  P +A  F V NF+ GDSWI  SGVPF ++
Sbjct  273  GFHVITNPSDAVKFSVGNFLAGDSWISGSGVPFDAE  308



>ref|XP_010101977.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90901.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=514

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 174/217 (80%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+   SDH+VF+RCS KGYQDTLYV+S RQFYRDC++YGT+DFI G+
Sbjct  298  FENTAGPAKHQAVALRSGSDHSVFHRCSFKGYQDTLYVYSQRQFYRDCNVYGTVDFICGD  357

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A A+LQNC+I V+KPM  Q N +T+Q R DPNENTGI I NSR+  + +LR   G  +++
Sbjct  358  AVAILQNCNILVRKPMSDQRNTVTSQARTDPNENTGIIIHNSRITASSDLRPVQGSFETY  417

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K+ LDGLIDPKGW+ WSG+FALSTLYY E+MN+GAGA+T  RV+WP
Sbjct  418  LGRPWQKYSRTVIMKSSLDGLIDPKGWLPWSGNFALSTLYYAEFMNSGAGAATGGRVSWP  477

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H+L    EA  F V NF+ GDSWIP +GVPF + L
Sbjct  478  GYHVLTSAAEAGKFTVGNFLGGDSWIPATGVPFAAGL  514



>gb|KDP38089.1| hypothetical protein JCGZ_04732 [Jatropha curcas]
Length=543

 Score =   307 bits (787),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 144/217 (66%), Positives = 172/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD +VFY CS KGYQDTLYV+S RQFYRDC IYGT+DFIFGN
Sbjct  327  FENTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGN  386

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A  V QNC+I+V+KPM  Q N +TAQ R DPNENTGI I NSRV    +LR   G  KS+
Sbjct  387  AVVVFQNCNIYVRKPMSGQKNTVTAQARTDPNENTGIIIHNSRVTAASDLRPVQGSFKSY  446

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV +K++LDGLIDP GW+ WSG+FALSTLYY EYMN+G+GAST +RV WP
Sbjct  447  LGRPWQEYSRTVILKSNLDGLIDPAGWLPWSGNFALSTLYYAEYMNSGSGASTGDRVKWP  506

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++ +  +A  F V NF+ GDSWIP +GVPF S L
Sbjct  507  GYHVITKVTDAGKFTVGNFLAGDSWIPATGVPFDSGL  543



>ref|XP_010271267.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   306 bits (783),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 145/213 (68%), Positives = 169/213 (79%), Gaps = 2/213 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD +VFY CS KGYQDTLYV+S RQFYRDC IYGT+DFIFG+
Sbjct  311  FENTAGPQKHQAVALRSGSDLSVFYSCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGD  370

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AVLQNC+I+V+KPM  Q N +TAQGR DPNENTGISI NSRV    +LR   G  K++
Sbjct  371  AVAVLQNCNIYVRKPMSGQKNTVTAQGRTDPNENTGISIHNSRVTAASDLRAVQGSFKTY  430

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LD L+D  GW+EWSG FALS+LYYGEYMNTG GAST  RVNW 
Sbjct  431  LGRPWQKYSRTVFMKTSLDSLVDRAGWLEWSGKFALSSLYYGEYMNTGPGASTSGRVNWE  490

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH++   D+A  F V +F+ G SWI  +GVPF
Sbjct  491  GFHVM-SADDAGKFTVGSFLGGGSWIAAAGVPF  522



>ref|XP_004503381.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Cicer arietinum]
Length=546

 Score =   306 bits (784),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 174/217 (80%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+ HQAVA+   +D++VFYRC+ KGYQDTLYV++ RQFYRDC+IYGT+DFIFGN
Sbjct  330  FENTAGPQNHQAVALRSGADYSVFYRCAFKGYQDTLYVYAQRQFYRDCNIYGTVDFIFGN  389

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A  VLQNC+IFV+KPM +Q N +TAQ R DPNENTGI I N R+  + +L+     VK+F
Sbjct  390  AVTVLQNCNIFVRKPMGNQQNTVTAQARTDPNENTGIIIHNCRITASNDLKPVQNSVKTF  449

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K++LDGLI+PKGW  W+G FALSTLYYGEYMN GAGA+T  RV WP
Sbjct  450  LGRPWQKYSRTVVMKSNLDGLINPKGWSVWNGGFALSTLYYGEYMNIGAGANTGGRVQWP  509

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFHL+ Q  EA+ F VSNF+ G SWI  +GVPF + L
Sbjct  510  GFHLITQSSEAAKFSVSNFLAGGSWISSTGVPFDAGL  546



>ref|XP_010271266.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=532

 Score =   305 bits (781),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 144/213 (68%), Positives = 172/213 (81%), Gaps = 2/213 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD +VFYRCS KGYQDTLYVHS RQFYR+C IYGT+DFI+G+
Sbjct  317  FENTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVHSNRQFYRNCDIYGTVDFIWGD  376

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AVLQNC+I+V+KPM  Q N +TAQGR DPNENTGISI NS V  T +L+   G  K++
Sbjct  377  AVAVLQNCNIYVRKPMSGQKNTVTAQGRTDPNENTGISIHNSLVTATSDLKAVQGSFKTY  436

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LD LIDP+GW+EWSG+FALSTLYYGE++NTG GAST  RV W 
Sbjct  437  LGRPWQKYSRTVFMKTSLDSLIDPEGWLEWSGNFALSTLYYGEFLNTGPGASTSGRVKWA  496

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            GFH++ + D A  F V +F+ G SWI  +GVPF
Sbjct  497  GFHVMNKAD-AQKFTVESFLGGSSWIAAAGVPF  528



>ref|XP_008775930.1| PREDICTED: pectinesterase-like [Phoenix dactylifera]
Length=515

 Score =   304 bits (779),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 173/217 (80%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP+K+QAVA   +SD + +Y+CS +GYQDTLYV+S RQFYRDC+IYGT+DFIFG+
Sbjct  299  FQNTAGPQKNQAVAFRSSSDLSAYYQCSFEGYQDTLYVYSQRQFYRDCNIYGTVDFIFGD  358

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA V QNCD++V+KPM  Q N +TAQGR DPNENTGISI +S V    +L+   G  +++
Sbjct  359  AAVVFQNCDMYVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASDLKPVQGSFQTY  418

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV++KT LD LIDP GW+EW+GDFALSTLYYGEYMNTGAGA T  RVNWP
Sbjct  419  LGRPWQKYSRTVYMKTSLDSLIDPAGWLEWNGDFALSTLYYGEYMNTGAGADTSRRVNWP  478

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++     AS F V NF+ G SWIP +GVP+ S L
Sbjct  479  GYHVITSAAVASQFTVGNFLSGGSWIPATGVPYTSDL  515



>ref|XP_009385345.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=522

 Score =   305 bits (780),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/213 (67%), Positives = 167/213 (78%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP+KHQAVA+   SD +VFYRCS KGYQDTLYV+S RQFYR+C IYGT+DFIFG+
Sbjct  306  FQNTAGPQKHQAVALRSGSDLSVFYRCSFKGYQDTLYVYSQRQFYRNCDIYGTVDFIFGD  365

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A  V Q+C+I+V+KPM  Q N +TAQGR D NENTGISI NS V    +LR   G  K++
Sbjct  366  AVVVFQSCNIYVRKPMSGQQNTVTAQGRTDHNENTGISIHNSIVTAASDLRPVQGSFKTY  425

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LD LI+P GW+EWSG F LSTLYY EYMNTGAGA T  RVNWP
Sbjct  426  LGRPWQKYSRTVFMKTSLDSLINPAGWLEWSGSFGLSTLYYAEYMNTGAGADTSKRVNWP  485

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+H++    EAS F V  F+ GDSWIP +GVPF
Sbjct  486  GYHVIASSSEASKFTVGGFLSGDSWIPATGVPF  518



>gb|KEH21379.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=541

 Score =   305 bits (780),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 172/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   +DH+VFYRC+ KG+QDTLYV++ RQFYRDC+IYGTIDFIFGN
Sbjct  325  FENTAGPQKHQAVALRSGADHSVFYRCAFKGFQDTLYVYANRQFYRDCNIYGTIDFIFGN  384

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A  VLQNC+IFV+KPM +Q N +TAQGR DPNENTGI I N R+  + +L+     VK++
Sbjct  385  AVTVLQNCNIFVRKPMSNQKNTVTAQGRTDPNENTGIVIHNCRITASSDLKAIQNSVKTY  444

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K++LDGLI+ +GW  W G FALSTLYYGEYMN G GA+T  RV WP
Sbjct  445  LGRPWQKYSRTVVMKSNLDGLINSEGWAPWMGGFALSTLYYGEYMNVGGGANTDGRVKWP  504

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH++  P +A  F V NF+ GDSWI  SGVPF + L
Sbjct  505  GFHVITNPSDAVKFSVGNFLAGDSWISGSGVPFDAGL  541



>ref|XP_007222925.1| hypothetical protein PRUPE_ppa005208mg [Prunus persica]
 gb|EMJ24124.1| hypothetical protein PRUPE_ppa005208mg [Prunus persica]
Length=472

 Score =   302 bits (774),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 170/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   +DH+VFYRCS KGYQDTLYV+S RQFYR+C +YGTIDFI G+
Sbjct  256  FENTAGPQKHQAVALRSGADHSVFYRCSFKGYQDTLYVYSQRQFYRECDVYGTIDFICGD  315

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AVLQNC+++V+KPM +Q N +TAQ R D NENTGI I +SRV   P+LR   G  +++
Sbjct  316  ATAVLQNCNVYVRKPMSNQVNTVTAQSRTDANENTGIVIHSSRVTAAPDLRAVQGSFRTY  375

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K+DLDGLIDP GW  WSG FALSTLYYGEYMN+GAG +T  RV WP
Sbjct  376  LGRPWKKYSRTVIMKSDLDGLIDPAGWFPWSGSFALSTLYYGEYMNSGAGGATGGRVKWP  435

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EA  F V N + G+SWIP +GVPF + L
Sbjct  436  GYRVITSAVEAGKFTVGNILAGESWIPATGVPFSAGL  472



>ref|XP_004297462.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Fragaria vesca subsp. vesca]
Length=548

 Score =   305 bits (780),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 172/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   +DH+VFYRCS KGYQDTLYV+S RQFYRDC+IYGT+DFIFG+
Sbjct  332  FENTAGPQKHQAVALRSGADHSVFYRCSFKGYQDTLYVYSQRQFYRDCNIYGTVDFIFGD  391

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A+A+LQNC+I+V+KP  +Q N +TAQ R DPNENTGI I N R+   P+LR   G  +++
Sbjct  392  ASAILQNCNIYVRKPSSNQINTVTAQSRRDPNENTGIIIHNCRITAAPDLRAVQGSFRTY  451

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSR V +K++LDGLI+P+GW  WSG F L TLYYGEYMNTGAGA+T  RV WP
Sbjct  452  LGRPWQKYSRVVIMKSNLDGLIEPQGWFPWSGSFGLDTLYYGEYMNTGAGAATGGRVKWP  511

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF ++    EA  F V NF+ GD+W+P +GVPF + L
Sbjct  512  GFRVITSATEAGKFTVGNFLAGDAWLPGTGVPFEAGL  548



>ref|XP_010910186.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=516

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 171/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+K QAVA+   SD +VFY+CS KGYQDTLYV+S RQFYR+C IYGT+DFIFG+
Sbjct  300  FENTAGPQKQQAVALRSGSDLSVFYQCSFKGYQDTLYVYSQRQFYRNCDIYGTVDFIFGD  359

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQNC++ V+KPM  Q N +TAQGR DPNENTGISI +S V    +L+   G  +++
Sbjct  360  AAVVLQNCNMHVRKPMSGQKNTVTAQGRTDPNENTGISIHDSAVTAASDLKPVQGSFETY  419

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LIDP GW+EWSG+FALSTLYYGEYMNTG GA T  RV WP
Sbjct  420  LGRPWQEYSRTVFMKTSLDSLIDPAGWLEWSGNFALSTLYYGEYMNTGPGADTSQRVKWP  479

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V NF+ G+SWIP + VPF S L
Sbjct  480  GYHVITSAAEASKFTVGNFLSGNSWIPATEVPFTSGL  516



>ref|XP_006826911.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
 gb|ERM94148.1| hypothetical protein AMTR_s00010p00161740 [Amborella trichopoda]
Length=515

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 173/217 (80%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA    SD +V YRCS KGYQDTLY +S RQFYR+C IYGT+DFIFGN
Sbjct  300  FENTAGPQKHQAVAFRSGSDLSVLYRCSFKGYQDTLYTYSQRQFYRECDIYGTVDFIFGN  359

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAVLQNC+I+V+KPM  Q N ITAQGR DPN+NTG+SI +S+V  + +L+      K++
Sbjct  360  AAAVLQNCNIYVRKPMSSQKNTITAQGRTDPNQNTGLSIHDSKVSASSDLKAVQNSFKTY  419

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LIDP GW++WSG+FAL TLYYGEYMN+GAGA T++RV W 
Sbjct  420  LGRPWKEYSRTVFMKTALDNLIDPSGWLQWSGNFALRTLYYGEYMNSGAGAVTKSRVKWS  479

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH++    EA+ F V +FI G SWIP +G+P+ S L
Sbjct  480  GFHVM-SASEAAKFTVGSFISGGSWIPNTGLPYTSGL  515



>ref|XP_010101979.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
 gb|EXB90903.1| putative pectinesterase/pectinesterase inhibitor 6 [Morus notabilis]
Length=463

 Score =   299 bits (765),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 172/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP K+QAVA+   SDH+VFYRCS KGYQDTLYV+S RQFYRDC++YGT+DFIFG+
Sbjct  247  FENTAGPAKYQAVALRSGSDHSVFYRCSFKGYQDTLYVYSQRQFYRDCNVYGTVDFIFGD  306

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A A+LQNC+I V+KP+  Q N++T Q R DPNENTGI I NSR+  + +LR   G  +++
Sbjct  307  AVAILQNCNILVRKPISGQENVVTCQTRTDPNENTGIIIQNSRITASSDLRPVQGSFETY  366

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRP +KYSRTV + + LDGLIDPKGW+  SG+FALSTLYY EYMN+GAGA+T  RV+WP
Sbjct  367  LGRPLQKYSRTVIMTSSLDGLIDPKGWLPGSGNFALSTLYYAEYMNSGAGAATGGRVSWP  426

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H+L    EA  F V NF+ GDSWIP +GVPF + L
Sbjct  427  GYHVLTSAAEAGKFTVGNFLGGDSWIPATGVPFAAGL  463



>ref|XP_008221458.1| PREDICTED: pectinesterase [Prunus mume]
Length=520

 Score =   299 bits (766),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 172/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   +DH+VFYRCS KGYQDTLYV++ RQFYR+C +YGT+DFI G+
Sbjct  304  FENTAGPQKHQAVALRSGADHSVFYRCSFKGYQDTLYVYAQRQFYRECDVYGTVDFICGD  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AVLQNC+++V+KPM +Q N +TAQ R D NENTGI I +SRV   P+LR   G  +++
Sbjct  364  ATAVLQNCNMYVRKPMSNQVNTVTAQSRTDANENTGIVIHSSRVTAAPDLRAVQGSFRTY  423

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K+DLDGLIDP GW  W+G+FALSTLYYGEYMN+GAGA+T  RV WP
Sbjct  424  LGRPWQKYSRTVIMKSDLDGLIDPAGWFPWNGNFALSTLYYGEYMNSGAGAATGGRVKWP  483

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EA  F V N + G+SWIP +GVPF + L
Sbjct  484  GYRVITSAVEAGKFTVGNILAGESWIPATGVPFSAGL  520



>ref|XP_011017534.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 36 
[Populus euphratica]
Length=389

 Score =   295 bits (754),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 137/212 (65%), Positives = 165/212 (78%), Gaps = 0/212 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+  QAVA+ V+S+H+V YRCS KGYQ+TLYV S RQFYRDCHIYGTIDFIFGN
Sbjct  174  FENTAGPDGSQAVALMVSSEHSVVYRCSFKGYQNTLYVRSKRQFYRDCHIYGTIDFIFGN  233

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQNCDIFV+KP D+Q N+I AQGR  P+ENTGISI  SR+ P P+  G   + +FL
Sbjct  234  AAVVLQNCDIFVRKPNDNQKNVIVAQGRKSPDENTGISIQGSRIRPAPDFIGVKNIPTFL  293

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPWRKYSRTV  +TD+DG IDP GW+ W G   L+TL+Y EY N G GAST++R  WPG
Sbjct  294  GRPWRKYSRTVIFETDIDGFIDPAGWLPWDGSVHLNTLFYAEYNNIGCGASTEHRAKWPG  353

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            FH+ +   EASPF V+ FI+G SWI ++GV +
Sbjct  354  FHVFKSWKEASPFTVNKFIKGSSWISQTGVSY  385



>ref|XP_007045218.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
 gb|EOY01050.1| Plant invertase/pectin methylesterase inhibitor superfamily [Theobroma 
cacao]
Length=520

 Score =   299 bits (765),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 171/217 (79%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+N+AGP+KHQAVA    SDH+V YRCS KGYQDTLYV+S RQFYRDC IYGT+DFIFG+
Sbjct  305  FDNSAGPQKHQAVAFRSGSDHSVIYRCSFKGYQDTLYVYSQRQFYRDCDIYGTLDFIFGD  364

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AVLQNC+I+++KPM +Q N +TAQGR D NENTGI I NSRV  + +LRG  G  KS+
Sbjct  365  AVAVLQNCNIYIRKPMSNQRNTVTAQGRTDANENTGIIIHNSRVTASSDLRGVQGSFKSY  424

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+K+ LDG+I  +GW+ WSG FALSTLYY E+MNTGAGA T  RV W 
Sbjct  425  LGRPWQKYSRTVFMKSVLDGVITAEGWLPWSGSFALSTLYYAEHMNTGAGADTSGRVKWG  484

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EA  F V NF+ GD+WIP +GVPF + L
Sbjct  485  GYHVISAA-EAGKFTVGNFLAGDAWIPGTGVPFDAGL  520



>ref|XP_006367816.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Solanum tuberosum]
Length=474

 Score =   297 bits (761),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  258  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  317

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC IF ++PMD Q   ITAQGR DPN+NTGISI NSRV+   +LR   G  K+F
Sbjct  318  AAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPVLGTFKTF  377

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD L+DP GW+EW GDFALSTLYYGEY N G GAST +RV W 
Sbjct  378  LGRPWKQYSRTVFMKTYLDSLVDPAGWLEWDGDFALSTLYYGEYRNAGPGASTSSRVKWS  437

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++   +EA+ F V NFI G SW+P + VPF + L
Sbjct  438  GYRVITNSNEAARFSVENFIAGRSWLPATNVPFRAGL  474



>gb|KHN35618.1| Pectinesterase 2 [Glycine soja]
Length=359

 Score =   293 bits (751),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 172/217 (79%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG + HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  144  FRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGN  203

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+IF + P  ++ N ITAQGR DPN+NTGISI NSRV    +LR     V+++
Sbjct  204  AAVVLQNCNIFARNP-PNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQNSVRTY  262

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LDGLI+P GWMEWSG+FAL+TLYYGEYMNTG G+ST  RV WP
Sbjct  263  LGRPWKQYSRTVFMKTYLDGLINPSGWMEWSGNFALNTLYYGEYMNTGPGSSTGRRVKWP  322

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++ +  EAS F V+NFI G++W+P + VP+   L
Sbjct  323  GYRVITRASEASKFSVANFIAGNAWLPATKVPYTPSL  359



>emb|CBI38888.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 168/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
              NTAG   HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  44   IRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGN  103

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+I+ + P  +++N ITAQGR DPN+NTGISI N +V    +L+     VK++
Sbjct  104  AAVVLQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTY  162

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P GWMEWSG+FAL TLYYGEYMNTG G+ST NRVNW 
Sbjct  163  LGRPWKEYSRTVFMKTYLDSLINPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVNWA  222

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V NFI G+SW+P + VPF S L
Sbjct  223  GYHVITSSSEASKFTVGNFIAGNSWLPATNVPFTSGL  259



>ref|XP_010684811.1| PREDICTED: pectinesterase-like [Beta vulgaris subsp. vulgaris]
Length=537

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 170/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD+++FYRCS KGYQDTLYV+S RQFY++C IYGTIDFIFGN
Sbjct  321  FENTAGPQKHQAVALRSGSDYSIFYRCSFKGYQDTLYVYSKRQFYKECDIYGTIDFIFGN  380

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AAA+LQ+C+I+V+KPM++Q N ITAQGR DPNENTGI I +S +    +L+   G  ++F
Sbjct  381  AAAILQSCNIYVRKPMNNQMNTITAQGRSDPNENTGIVIHDSIIKAAQDLKPVQGSFQTF  440

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR YSRT+ +K+ +DGL+D  GW  WSGDFAL TLYYGEYMN G GA T  RV WP
Sbjct  441  LGRPWRMYSRTMIMKSHIDGLVDIAGWAPWSGDFALKTLYYGEYMNYGPGADTHGRVKWP  500

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H ++ P +A  F V NF+ GD WIP +GVPF S L
Sbjct  501  GYHAIKSPVDAEKFTVRNFLTGDEWIPGTGVPFTSGL  537



>emb|CDO97717.1| unnamed protein product [Coffea canephora]
Length=259

 Score =   289 bits (739),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 169/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG + HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  44   FRNTAGAQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGN  103

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V Q+C+I+ + P  +++N ITAQGR DPN+NTGISILNSRV    +L+     VK++
Sbjct  104  AAVVFQSCNIYARNP-PNKTNTITAQGRTDPNQNTGISILNSRVTAASDLKPVQSSVKTY  162

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LDGLI+P GWM WSG+FAL+TLYYGEY NTG G+ST  RVNW 
Sbjct  163  LGRPWKEYSRTVFMKTFLDGLINPAGWMPWSGNFALNTLYYGEYANTGPGSSTAKRVNWK  222

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V NFI G SW+P + VPF S L
Sbjct  223  GYHVITSATEASKFTVGNFIAGSSWLPATNVPFTSGL  259



>gb|KHN35620.1| Pectinesterase 2 [Glycine soja]
Length=355

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 170/216 (79%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA+   SD +VFYRCS +GYQDTLYV+S RQFYR+C IYGT+DFIFGN
Sbjct  144  FRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGN  203

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA V QNC+I+ + P  ++ N ITAQGR DPN+NTGISI NS+V    +L G   V+++L
Sbjct  204  AAVVFQNCNIYARNP-PNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMG---VRTYL  259

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW++YSRTVF+KT LD LI+P+GW+EWSG+FALSTLYYGEYMNTG G+ST NRVNW G
Sbjct  260  GRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGPGSSTANRVNWLG  319

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H++    EAS F V NFI G+SW+P + VPF S L
Sbjct  320  YHVITSASEASKFTVGNFIAGNSWLPATSVPFTSGL  355



>ref|XP_004514851.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=515

 Score =   297 bits (761),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 171/217 (79%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA+   SD +VFYRCS +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  300  FRNTAGANNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSDRQFYKECNIYGTVDFIFGN  359

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AAAV QNC+IF + P  ++ N ITAQGR DPN+NTGISI NSRV    +L+     VK++
Sbjct  360  AAAVFQNCNIFARNP-PNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQNSVKTY  418

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI P GW+EWSG+FALSTLYYGEYMNTG G+ST+NRV W 
Sbjct  419  LGRPWKQYSRTVFMKTSLDSLIHPAGWLEWSGNFALSTLYYGEYMNTGLGSSTRNRVKWQ  478

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++ +  EAS F V NFI G+SW+P + VPF S L
Sbjct  479  GYHVITRASEASKFTVGNFIAGNSWLPSTSVPFTSTL  515



>gb|KDO64577.1| hypothetical protein CISIN_1g047288mg [Citrus sinensis]
Length=508

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 168/216 (78%), Gaps = 3/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP  HQAVA+   SD +VFY CS KGYQDTLYV+S RQFYR+C IYGT DFIFG+
Sbjct  296  FENTAGPANHQAVALRSGSDFSVFYSCSFKGYQDTLYVYSQRQFYRNCDIYGTQDFIFGD  355

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQ+C+I+++KP   Q N +TAQGR DPNENTGI + NSRV  T E  G G  KS+L
Sbjct  356  AAVVLQSCNIYIRKPTGGQKNTVTAQGRKDPNENTGIIVHNSRV--TAE-SGQGSFKSYL  412

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW++YSRTVF+K ++DG+IDP GW+ WSG FALSTLYYGEYMN G GAST  RV W G
Sbjct  413  GRPWKQYSRTVFMKCNIDGVIDPAGWLPWSGSFALSTLYYGEYMNIGTGASTSGRVKWSG  472

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H++R P EA  F V NF+ G+SWIP +GVPF S L
Sbjct  473  YHVIRSPVEAGKFTVGNFLAGNSWIPATGVPFDSGL  508



>gb|KDP28780.1| hypothetical protein JCGZ_14551 [Jatropha curcas]
Length=514

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 173/217 (80%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   +D +VFY+CS +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  299  FRNTAGPQNHQAVALRSGADLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGN  358

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+I+ + P  +++N +TAQGR DPN+NTGISI NSRV    +L    G V+++
Sbjct  359  AAVVLQNCNIYPRNP-PNKTNTLTAQGRTDPNQNTGISIHNSRVTAASDLTPVQGSVRTY  417

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P GWMEWSG+FAL TLYYGEYMNTG G+ST NRVNW 
Sbjct  418  LGRPWKQYSRTVFMKTYLDSLINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTANRVNWK  477

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++  P EAS F V NFI G+SW+P + VPF S L
Sbjct  478  GYHVITSPTEASQFTVGNFISGNSWLPGTNVPFTSGL  514



>ref|XP_006469215.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Citrus sinensis]
Length=525

 Score =   297 bits (760),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 168/216 (78%), Gaps = 3/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP  HQAVA+   SD +VFY CS KGYQDTLYV+S RQFYR+C IYGT DFIFG+
Sbjct  313  FENTAGPANHQAVALRSGSDFSVFYSCSFKGYQDTLYVYSQRQFYRNCDIYGTQDFIFGD  372

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQ+C+I+++KP   Q N +TAQGR DPNENTGI + NSRV  T E  G G  KS+L
Sbjct  373  AAVVLQSCNIYIRKPTGGQKNTVTAQGRKDPNENTGIIVHNSRV--TAE-SGQGSFKSYL  429

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW++YSRTVF+K ++DG+IDP GW+ WSG FALSTLYYGEYMN G GAST  RV W G
Sbjct  430  GRPWKQYSRTVFMKCNIDGVIDPAGWLPWSGSFALSTLYYGEYMNIGTGASTSGRVKWSG  489

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H++R P EA  F V NF+ G+SWIP +GVPF S L
Sbjct  490  YHVIRSPVEAGKFTVGNFLAGNSWIPATGVPFDSGL  525



>ref|XP_010271372.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=526

 Score =   297 bits (760),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 142/217 (65%), Positives = 167/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGP+ HQAVA+   SD +V Y CS KGYQDTLYVHS RQFYRDC IYGT DFI GN
Sbjct  311  FENSAGPQNHQAVALRSGSDLSVLYGCSFKGYQDTLYVHSQRQFYRDCDIYGTQDFICGN  370

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAV QNC+I+V+KP+  Q N +TAQ R DPN+NTGISI NSRV    +LR   G  K++
Sbjct  371  AAAVFQNCNIYVRKPLSGQKNTVTAQARTDPNQNTGISIHNSRVTAASDLRAVQGSFKTY  430

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LD LIDP GW+EWSG FALSTLYYGE+MN+GAGAST  RV WP
Sbjct  431  LGRPWQKYSRTVFMKTSLDSLIDPAGWLEWSGSFALSTLYYGEFMNSGAGASTSGRVTWP  490

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++   +EA  F V +F+ G SWI  +GVPF S L
Sbjct  491  GYRVM-SSEEAGEFTVGSFLGGGSWIAAAGVPFTSGL  526



>gb|EYU24929.1| hypothetical protein MIMGU_mgv1a025888mg, partial [Erythranthe 
guttata]
Length=486

 Score =   296 bits (757),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 139/214 (65%), Positives = 168/214 (79%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD +VFYRCS KGYQDTLYV+S RQFYR+C IYGTIDFIFG+
Sbjct  274  FENTAGPQKHQAVALRSGSDFSVFYRCSFKGYQDTLYVYSQRQFYRNCDIYGTIDFIFGD  333

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            + +V+QN +I+++KPM +Q N +TAQGR DPNENTGI I NSRV       G G   S+L
Sbjct  334  SVSVIQNSNIYIRKPMSNQKNTVTAQGRKDPNENTGIVIHNSRVTSAS---GSGPGPSYL  390

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW++YSRTVF+K  +DG+I+P GW+ WSG FALSTLYYGEYMNTG+GAST  RV WPG
Sbjct  391  GRPWQQYSRTVFMKCAIDGIIEPAGWLPWSGSFALSTLYYGEYMNTGSGASTGGRVKWPG  450

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            FH++    EA  F V NF+ G SWIP +GVP+ S
Sbjct  451  FHVITSAAEAGKFSVGNFLAGGSWIPATGVPYTS  484



>gb|KHN25547.1| Pectinesterase 2 [Glycine soja]
Length=359

 Score =   291 bits (746),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 169/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG + HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  144  FRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGN  203

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+IF + P  ++ N ITAQGR DPN+NTGISI NSRV    +LR     V+++
Sbjct  204  AAVVLQNCNIFARNP-PNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQNSVRTY  262

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LDGLI+P GWMEWSG+FAL TLYYGEYMNTG G+ST  RV W 
Sbjct  263  LGRPWKQYSRTVFMKTYLDGLINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTARRVKWS  322

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V+NFI G++W+P + VPF   L
Sbjct  323  GYRVITSASEASKFSVANFIAGNAWLPSTKVPFTPSL  359



>gb|KHN16553.1| Pectinesterase 2 [Glycine soja]
Length=415

 Score =   293 bits (750),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 168/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   +DH+VFYRCS +GYQDTLYV++ RQFYRDC IYGT+DFIFG+
Sbjct  200  FENTAGPQKHQAVALRSGADHSVFYRCSFRGYQDTLYVYANRQFYRDCDIYGTVDFIFGD  259

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AVLQNC+I+V+KPM +Q N +TAQGR DPNENTGI I N R+    +L+   G  ++F
Sbjct  260  AVAVLQNCNIYVRKPMSNQQNTVTAQGRTDPNENTGIIIHNCRITAAGDLKAVQGSFRTF  319

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K+ LDGLI P GW  WSG+FALSTLYY E+ NTGAGAST  RV+W 
Sbjct  320  LGRPWQKYSRTVVMKSALDGLISPAGWFPWSGNFALSTLYYAEHANTGAGASTGGRVDWA  379

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF ++    EA  F V NF+ G SWIP SGVPF   L
Sbjct  380  GFRVI-SSTEAVKFTVGNFLAGGSWIPGSGVPFDEGL  415



>gb|KHG13344.1| Uncharacterized protein F383_18528 [Gossypium arboreum]
Length=522

 Score =   296 bits (758),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 171/217 (79%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD +VFYRCS KGYQDTLYV+S RQFYRDC IYGT+DFIFG+
Sbjct  307  FENTAGPQKHQAVALRSGSDFSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFIFGD  366

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AV QNC+I++++PM  Q N +TAQ R DPNENTGI I NSRV+   +LR   G  K++
Sbjct  367  AIAVFQNCNIYIRRPMSGQMNTVTAQARTDPNENTGIIIHNSRVMAASDLRAVQGSFKNY  426

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LDGLID +GW+ WSG+FALS+LYY E+MNTG GAST  RV W 
Sbjct  427  LGRPWQKYSRTVFMKTGLDGLIDAEGWLPWSGNFALSSLYYAEHMNTGTGASTGGRVKWG  486

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EA  F V NF+ G++WIPESGVPF + L
Sbjct  487  GYRVI-DATEAGKFTVGNFLTGNAWIPESGVPFDAGL  522



>ref|XP_010264199.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   296 bits (759),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 171/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   SD +VFYRC  +GYQDTLYVHS RQ Y++C+IYGT+DFIFGN
Sbjct  311  FRNTAGPENHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQLYKECYIYGTVDFIFGN  370

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC IF ++PMD+Q+N++TAQGR DPN+NTGISI NSR++ + +L       K+F
Sbjct  371  AAVVLQNCMIFARRPMDNQNNVVTAQGRTDPNQNTGISIHNSRIMASSDLVPVLSSFKTF  430

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV++ + +D L+DP GWMEWSG+FAL TLYYGEY N G G+ST NRVNW 
Sbjct  431  LGRPWKQYSRTVYLTSYIDTLVDPAGWMEWSGNFALDTLYYGEYKNYGPGSSTANRVNWG  490

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++ +  EAS F V  FI GDSW+P +GVPF S L
Sbjct  491  GYRVITKSSEASQFTVGKFISGDSWLPATGVPFKSGL  527



>ref|XP_006448208.1| hypothetical protein CICLE_v10014888mg [Citrus clementina]
 gb|ESR61448.1| hypothetical protein CICLE_v10014888mg [Citrus clementina]
Length=525

 Score =   296 bits (758),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/216 (65%), Positives = 168/216 (78%), Gaps = 3/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP  HQAVA+   SD +VFY CS KGYQDTLYV+S RQFYR+C IYGT DFIFG+
Sbjct  313  FENTAGPANHQAVALRSGSDFSVFYSCSFKGYQDTLYVYSQRQFYRNCDIYGTQDFIFGD  372

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQ+C+I+++KP+  Q N +TAQGR DPNENTGI + NSRV  T E  G G  KS+L
Sbjct  373  AAVVLQSCNIYIRKPIGGQKNTVTAQGRKDPNENTGIIVHNSRV--TAE-SGQGSFKSYL  429

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW++YSRTVF+K ++DG+IDP GW+ WSG FALSTLYY EYMN G GAST  RV W G
Sbjct  430  GRPWKQYSRTVFMKCNIDGVIDPAGWLPWSGSFALSTLYYAEYMNIGTGASTSGRVKWSG  489

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H++R P EA  F V NF+ G+SWIP +GVPF S L
Sbjct  490  YHVIRSPVEAGKFTVGNFLAGNSWIPATGVPFDSGL  525



>ref|XP_006445298.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
 gb|ESR58538.1| hypothetical protein CICLE_v10019773mg [Citrus clementina]
Length=510

 Score =   295 bits (756),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 168/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
              NTAGP  HQAVA+   SD +VFYRCS +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  295  IRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGN  354

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+IF +KP  +++N +TAQGR DPN+NTGI I N RV    +L+     VK+F
Sbjct  355  AAVVLQNCNIFARKP-PNRTNTLTAQGRTDPNQNTGIIIHNCRVTAASDLKPVQSSVKTF  413

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+IKT LD LI+P GWMEWSGDFAL+TLYY EYMNTG G+ST NRV W 
Sbjct  414  LGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTANRVKWR  473

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H+L  P + S F V NFI G+SW+P + VPF S L
Sbjct  474  GYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>ref|XP_009351519.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=537

 Score =   296 bits (758),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SDH+VFYRCS KGYQDTLYV+S RQFYRDC IYGT+DFI G+
Sbjct  321  FENTAGPQKHQAVALRSGSDHSVFYRCSFKGYQDTLYVYSQRQFYRDCDIYGTVDFICGD  380

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A  VLQNC+I+ +KPM +Q N +TAQ R DPNENTGI I NSR+    +LR   G  K++
Sbjct  381  ATVVLQNCNIYARKPMSNQVNTVTAQSRTDPNENTGIVIHNSRITAAQDLRPVQGSFKTY  440

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            +GRPW++YSRTV +K++LDGLI P GW  WSG  ALSTLYYGEYMN+GAGA T  RVNWP
Sbjct  441  MGRPWKQYSRTVIMKSNLDGLITPAGWYPWSGSLALSTLYYGEYMNSGAGAGTGGRVNWP  500

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++ +  EA  F V NF+ GDSWI  +GVPF + L
Sbjct  501  GYRVITRAVEAGKFTVGNFLAGDSWIRGTGVPFTAGL  537



>emb|CDY18942.1| BnaC04g04080D [Brassica napus]
Length=258

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 166/217 (76%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYRDC +YGT+DFIFGN
Sbjct  44   FRNTAGASNEQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGN  103

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR D N+NTGI I NSRV    +LR   G  K++
Sbjct  104  AAAVLQNCNIFARRPRS-KTNTITAQGRSDRNQNTGIIIHNSRVTAASDLRPILGSTKTY  162

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP+GW+EW+G+FALSTL+Y E+ NTG GAST  RV WP
Sbjct  163  LGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALSTLFYAEFQNTGPGASTSGRVKWP  222

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +LR   EAS F V +FI G SWIP S VPF S L
Sbjct  223  GFRVLRSASEASRFTVGSFIAGSSWIPSS-VPFTSGL  258



>ref|XP_002301275.2| hypothetical protein POPTR_0002s14660g [Populus trichocarpa]
 gb|EEE80548.2| hypothetical protein POPTR_0002s14660g [Populus trichocarpa]
Length=389

 Score =   291 bits (744),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 135/212 (64%), Positives = 164/212 (77%), Gaps = 0/212 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+  QAVA+ V+S+ +V YRCS KGYQ+TLYV S RQFYRDCHIYGTIDFIFGN
Sbjct  174  FENTAGPDGRQAVALMVSSEQSVVYRCSFKGYQNTLYVRSKRQFYRDCHIYGTIDFIFGN  233

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQNCDIFV+KP ++Q N+I AQGR  P+ENTGISI  SR+ P P+  G   + +FL
Sbjct  234  AAVVLQNCDIFVRKPNENQKNVIVAQGRKGPDENTGISIQGSRIRPAPDFIGVKNIPTFL  293

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPWRKYSRTV  +TD+DG IDP GW+ W G   L+TL+Y EY N G GAST++R  WPG
Sbjct  294  GRPWRKYSRTVIFETDIDGFIDPAGWLPWDGSVHLNTLFYAEYNNIGCGASTEHRAKWPG  353

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            FH+ +   EASPF V+ FI+G SWI ++GV +
Sbjct  354  FHVFKSWKEASPFTVNKFIKGSSWISQTGVSY  385



>emb|CBI24582.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  44   FRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  103

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PMD Q N++TAQGR DPN+NTGISI NSRV+   +L+      K++
Sbjct  104  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAATDLKPVLSSFKTY  163

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV++ T LD L+D  GW+EW G+FAL+TLYYGEY N G G+ST  RV W 
Sbjct  164  LGRPWKEYSRTVYLGTYLDTLVDSAGWLEWDGNFALNTLYYGEYKNFGPGSSTSGRVKWR  223

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V+NFI G SW+P +GVPF S L
Sbjct  224  GYRVITSATEASKFSVANFIAGQSWLPATGVPFRSGL  260



>emb|CDP20891.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   295 bits (754),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 169/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VF+RC  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  307  FRNTAGPQNHQAVALRSGSDLSVFHRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  366

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PMD Q N ITAQGR DPN+NTGISI NSRV+   +LR      K++
Sbjct  367  AAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASDLRPVLSSFKTY  426

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVFI+T LD L+DP GW+EW G+FA +TLYYGEY N+G G+ST  RV W 
Sbjct  427  LGRPWKQYSRTVFIQTYLDSLVDPAGWLEWDGNFAFNTLYYGEYKNSGPGSSTSRRVKWR  486

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++  P EAS F V+NFI G SW+P + VPF + L
Sbjct  487  GYHVITNPTEASRFTVANFIAGRSWLPATNVPFAAGL  523



>ref|XP_002510940.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF51542.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=455

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 167/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFYRC  +GYQDTLY+HS RQFY++C+IYGT+DFIFGN
Sbjct  239  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYIHSQRQFYKECYIYGTVDFIFGN  298

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PMD Q N ITAQGR DPN+NTGISI NSRV+   +L+      K+F
Sbjct  299  AAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMAASDLKPVLSSFKTF  358

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF++T LD L+DP GW+EW G+FAL+TLYYGEY N G  +ST  RV W 
Sbjct  359  LGRPWKQYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNMGPASSTSGRVKWR  418

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V+NFI G SW+P +GVPF S L
Sbjct  419  GYRVITSATEASQFTVANFIAGRSWLPATGVPFSSGL  455



>ref|XP_004234932.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Solanum lycopersicum]
Length=523

 Score =   294 bits (752),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 167/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  307  FRNTAGPENHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  366

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQNC IF ++PMD Q   ITAQGR DPN+NTGISI NSRV+   +LR   G  K++
Sbjct  367  AAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPVVGTFKTY  426

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV +KT LD L+DP GW+EW GDFAL+TLYYGEY N G GAST +RV WP
Sbjct  427  LGRPWKQYSRTVIMKTYLDSLVDPAGWLEWDGDFALNTLYYGEYRNNGPGASTSSRVKWP  486

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++   +EA+ F V N I G SW+P + VPF + L
Sbjct  487  GYRVITNSNEAARFSVENLIAGGSWLPATNVPFRAGL  523



>sp|O04887.1|PME2_CITSI RecName: Full=Pectinesterase 2; Short=PE 2; AltName: Full=Pectin 
methylesterase; Flags: Precursor [Citrus sinensis]
 gb|AAB57669.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 168/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
              NTAGP  HQAVA+   SD +VFYRCS +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  295  IRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGN  354

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+IF +KP  +++N +TAQGR DPN++TGI I N RV    +L+     VK+F
Sbjct  355  AAVVLQNCNIFARKP-PNRTNTLTAQGRTDPNQSTGIIIHNCRVTAASDLKPVQSSVKTF  413

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+IKT LD LI+P GWMEWSGDFAL+TLYY EYMNTG G+ST NRV W 
Sbjct  414  LGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTANRVKWR  473

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H+L  P + S F V NFI G+SW+P + VPF S L
Sbjct  474  GYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>ref|XP_009351517.1| PREDICTED: pectinesterase-like [Pyrus x bretschneideri]
Length=537

 Score =   294 bits (753),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 167/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+K+QAVA+   SDH+VFYRCS KGYQDTLYV+S RQFYRDC +YGTIDFI G+
Sbjct  321  FENTAGPQKYQAVALRSGSDHSVFYRCSFKGYQDTLYVYSQRQFYRDCDVYGTIDFICGD  380

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A  VLQNC+I+ +KPM +Q N +TAQ R DPNENTGI I NSR+    +LR   G  K++
Sbjct  381  ATVVLQNCNIYARKPMSNQVNTVTAQSRTDPNENTGIVIHNSRITAAQDLRPVQGSFKTY  440

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW KYSRTV +K++LDGLI P GW  WSG  ALSTLYYGEYMN+GAGA T  RVNWP
Sbjct  441  LGRPWEKYSRTVIMKSNLDGLITPAGWYPWSGSLALSTLYYGEYMNSGAGAGTGGRVNWP  500

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++ +  EA  F V NF+ GDSWI  +GVPF + L
Sbjct  501  GYRVITRAVEAGKFTVGNFLAGDSWIRGTGVPFTAGL  537



>gb|KDO85751.1| hypothetical protein CISIN_1g010441mg [Citrus sinensis]
Length=510

 Score =   293 bits (751),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 168/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
              NTAGP  HQAVA+   SD +VFYRCS +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  295  IRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGN  354

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+IF +KP  +++N +TAQGR DPN++TGI I N RV    +L+     VK+F
Sbjct  355  AAVVLQNCNIFARKP-PNRTNTLTAQGRTDPNQSTGIIIHNCRVTAASDLKPVQSSVKTF  413

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+IKT LD LI+P GWMEWSGDFAL+TLYY EYMNTG G+ST NRV W 
Sbjct  414  LGRPWKQYSRTVYIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTANRVKWR  473

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H+L  P + S F V NFI G+SW+P + VPF S L
Sbjct  474  GYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>ref|XP_002322401.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06528.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=517

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 170/213 (80%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  301  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  360

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA +LQNC I+ ++PMD Q N++TAQGR DPN+NTGISI NSRV+ + +LR      K++
Sbjct  361  AAVILQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASSDLRPVLSSFKTY  420

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF++T LD L+DP GW+EW G+FAL+TLYYGEY N+G GAST+ RV W 
Sbjct  421  LGRPWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGPGASTRGRVKWR  480

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+ ++    EAS F V+NFI G SW+P +GVPF
Sbjct  481  GYRVITSSTEASRFTVANFIAGRSWLPATGVPF  513



>gb|ABQ42392.1| pectin methylesterase-like protein [Taiwania cryptomerioides]
Length=595

 Score =   295 bits (756),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 169/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP  HQAVA+ V SD +VFYRCS KGYQDTLYVHSLRQF+RDC IYGT+DFIFGN
Sbjct  378  FENTAGPSNHQAVALRVGSDFSVFYRCSFKGYQDTLYVHSLRQFFRDCDIYGTVDFIFGN  437

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNC+++ +KP+++Q  + TAQGR DPN+NTGISI N RV    ++       K++
Sbjct  438  AAVVFQNCNLYARKPLENQQIMYTAQGRQDPNQNTGISIHNCRVTADSDMAAVKSSFKTY  497

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ LD LI P GW+EW+  FALSTLYYGEYMNTG GA T NRVNWP
Sbjct  498  LGRPWKEYSRTVFLQSYLDDLIHPAGWLEWNETFALSTLYYGEYMNTGPGAGTANRVNWP  557

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V+ FI+GD+W+P +GV + S L
Sbjct  558  GYRVITSATEASQFTVNQFIEGDTWLPSTGVEYSSGL  594



>ref|XP_009627969.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Nicotiana tomentosiformis]
Length=521

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  305  FRNTAGPQNHQAVALRSGSDQSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  364

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC IF ++PMD Q   ITAQGR DPN+NTGISI NSRV+   +LR      K++
Sbjct  365  AAVVLQNCMIFARQPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPVLNTFKTY  424

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD L+DP GW+EW G+FAL+TLYYGEY N+GAGAST  RV W 
Sbjct  425  LGRPWKQYSRTVFMKTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNSGAGASTSRRVRWR  484

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++   +EA+ F V NFI G SW+P + VPF + L
Sbjct  485  GYRVITNSNEAAKFSVENFIAGRSWLPATNVPFRAGL  521



>gb|EYU33116.1| hypothetical protein MIMGU_mgv1a022674mg [Erythranthe guttata]
Length=521

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 166/214 (78%), Gaps = 3/214 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD +VFYRCS KGYQDTLYV+S RQFYRDC +YGTIDFIFG+
Sbjct  309  FENTAGPQKHQAVALRSGSDFSVFYRCSFKGYQDTLYVYSQRQFYRDCDVYGTIDFIFGD  368

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            A +V+QN +I+++KPM +Q N +TAQGR DPNENTGI I NSRV             S+L
Sbjct  369  AVSVIQNSNIYIRKPMSNQKNTVTAQGRKDPNENTGIVIHNSRVTSASGSG---SGPSYL  425

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW++YSRTVF+K  +DG+I+P GW+ WSG FALSTLYYGEYMNTG+GAST  RV WPG
Sbjct  426  GRPWQQYSRTVFMKCAIDGIIEPAGWLPWSGSFALSTLYYGEYMNTGSGASTGGRVKWPG  485

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            FH++    EA  F V NF+ G SWIP +GVP+ S
Sbjct  486  FHVITSAAEAGKFSVGNFLAGGSWIPATGVPYTS  519



>ref|XP_010259035.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=528

 Score =   293 bits (750),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 169/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  312  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYRECYIYGTVDFIFGN  371

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC I  ++PMD QSN++TAQGR DPN+NTGISI N RV+ + +L+      K+F
Sbjct  372  AAVVLQNCMILPRRPMDGQSNVVTAQGRTDPNQNTGISIHNCRVMASSDLKPVQSSFKTF  431

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+++T LD L+DP GWMEWSG+FAL+TLYYGEY N G  +ST  RV W 
Sbjct  432  LGRPWKEYSRTVYLQTYLDTLVDPAGWMEWSGNFALNTLYYGEYRNFGPASSTARRVKWR  491

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++  P EAS F V NFI G SW+P +GVPF S L
Sbjct  492  GYRVITNPSEASRFTVGNFISGGSWLPATGVPFNSGL  528



>gb|KEH29121.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=513

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 170/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG + HQAVA+   SD +VFYRCS +G+QDTLYVHS RQFY+ C+IYGT+DFIFGN
Sbjct  298  FRNTAGGKNHQAVALRSGSDLSVFYRCSFEGFQDTLYVHSDRQFYKQCNIYGTVDFIFGN  357

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAV QNC+IF + P  ++ N ITAQGR DPN+NTGISI NSRV    +L+     VK++
Sbjct  358  AAAVFQNCNIFPRNP-PNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQNSVKTY  416

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSR VF+KT LD LI P GW+EWSG+FALSTLYYGEYMNTG G+ST+NRV W 
Sbjct  417  LGRPWKQYSRAVFMKTSLDSLIHPSGWLEWSGNFALSTLYYGEYMNTGLGSSTRNRVKWQ  476

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH++    EAS F VSNFI G++W+P + VPF S L
Sbjct  477  GFHVITSASEASKFTVSNFIAGNAWLPATKVPFTSTL  513



>gb|KDP22414.1| hypothetical protein JCGZ_26245 [Jatropha curcas]
Length=523

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 169/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  307  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  366

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PMD Q N++TAQGR DPN+NTGISI NSRV+ +P+L+      K++
Sbjct  367  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASPDLKPVLSSFKTY  426

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+++T LD L+DP GW+EW GDFAL+TLYYGEY N G  AST  RV W 
Sbjct  427  LGRPWKQYSRTVYLQTYLDSLVDPAGWLEWDGDFALNTLYYGEYKNVGPSASTSGRVTWR  486

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EA+ F V+NFI G SW+P S VPF S L
Sbjct  487  GYRVITSSTEANRFTVANFIAGGSWLPASSVPFTSGL  523



>ref|XP_007160398.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
 gb|ESW32392.1| hypothetical protein PHAVU_002G318500g [Phaseolus vulgaris]
Length=517

 Score =   293 bits (749),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 169/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   +DH+VFYRCS KGYQDTLYV++ RQFYRDC IYGT+DFIFG+
Sbjct  302  FENTAGPQKHQAVALRSGADHSVFYRCSFKGYQDTLYVYANRQFYRDCDIYGTVDFIFGD  361

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A +VLQNC+I+V+KPM +Q N +TAQGR DPNENTGI I N  +    +L+   G  +++
Sbjct  362  AVSVLQNCNIYVRKPMSNQQNSVTAQGRTDPNENTGIIIHNCVITAAGDLKAVQGSFRTY  421

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K+ LDGLI+P GW EWSG+FALSTLYYGEY NTGAGAST  RV W 
Sbjct  422  LGRPWQKYSRTVVMKSALDGLINPAGWSEWSGNFALSTLYYGEYANTGAGASTGGRVKWG  481

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF ++   D A  F V  F+ G SWIP SGVPF + L
Sbjct  482  GFRVMSSSD-AVKFTVGEFLAGGSWIPGSGVPFDAGL  517



>ref|XP_009370475.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFY CS +GYQDTLY HS RQFY+DC++YGT+DFIFGN
Sbjct  303  FRNTAGPENHQAVALRSGADLSVFYHCSFEGYQDTLYTHSQRQFYKDCYVYGTVDFIFGN  362

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ +KPM  Q N ITAQGR DPN+NTGISI +SRV+  P+ +   G VK+F
Sbjct  363  AAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRVMAAPDFKSSVGSVKTF  422

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ LD L+DP GW+EWSG+FAL TLYYGEY N G GA T  RV W 
Sbjct  423  LGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGAPTSRRVKWG  482

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V+NFI G SW+P + VPF + L
Sbjct  483  GYRVITSSSEASKFTVNNFIAGSSWLPATNVPFTAGL  519



>ref|XP_010269596.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=561

 Score =   293 bits (751),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 171/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGP KHQAVA+   SD + FYRCS  GYQDTLYVHSLRQFYRDC IYGT+DFIFGN
Sbjct  344  FENSAGPNKHQAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRDCDIYGTVDFIFGN  403

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNC+++ ++P D+Q N+ TAQGR DPN+NT ISIL+S+V    +L       K++
Sbjct  404  AAVVFQNCNLYARRPNDNQKNIFTAQGRQDPNQNTXISILDSKVTAASDLIPVKSSFKTY  463

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ LD LIDP GW+EWSGDFAL+TLYYGEYMN G GA+T +RV+WP
Sbjct  464  LGRPWKEYSRTVFLRSFLDDLIDPAGWLEWSGDFALTTLYYGEYMNRGPGANTSSRVSWP  523

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V++FIQG+ W+  +GVP+ S L
Sbjct  524  GYRVINSSTEASQFTVASFIQGNEWLSSTGVPYFSGL  560



>ref|XP_011076334.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Sesamum indicum]
Length=475

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 169/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFY++C+++GT+DFIFGN
Sbjct  259  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYVFGTVDFIFGN  318

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PMD Q N ITAQGR DPN+NTGISI NSRV+ + +L    G  +SF
Sbjct  319  AAVVLQNCMIYARRPMDKQKNTITAQGRTDPNQNTGISIHNSRVMASADLVPVLGSFRSF  378

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF++T LD L+DP GW+EW G+FAL+TLYYGEY NTG G+ST  RV W 
Sbjct  379  LGRPWKEYSRTVFMQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNTGPGSSTSRRVRWR  438

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EA  F V+NFI G SW+P +GVPF + L
Sbjct  439  GYRVITSAAEAGRFTVANFIAGQSWLPATGVPFTAGL  475



>ref|XP_003530788.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=526

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 168/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   +DH+VFYRCS +GYQDTLYV++ RQFYRDC IYGT+DFIFG+
Sbjct  311  FENTAGPQKHQAVALRSGADHSVFYRCSFRGYQDTLYVYANRQFYRDCDIYGTVDFIFGD  370

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AVLQNC+I+V+KPM +Q N +TAQGR DPNENTGI I N R+    +L+   G  ++F
Sbjct  371  AVAVLQNCNIYVRKPMSNQQNTVTAQGRTDPNENTGIIIHNCRITAAGDLKAVQGSFRTF  430

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K+ LDGLI P GW  WSG+FALSTLYY E+ NTGAGAST  RV+W 
Sbjct  431  LGRPWQKYSRTVVMKSALDGLISPAGWFPWSGNFALSTLYYAEHANTGAGASTGGRVDWA  490

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF ++    EA  F V NF+ G SWIP SGVPF   L
Sbjct  491  GFRVI-SSTEAVKFTVGNFLAGGSWIPGSGVPFDEGL  526



>ref|XP_009372890.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=519

 Score =   292 bits (748),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFY CS +GYQDTLY HS RQFY+DC++YGT+DFIFGN
Sbjct  303  FRNTAGPENHQAVALRSGADLSVFYHCSFEGYQDTLYTHSQRQFYKDCYVYGTVDFIFGN  362

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ +KPM  Q N ITAQGR DPN+NTGISI +SRV+  P+ +   G VK+F
Sbjct  363  AAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRVMAAPDFKSSVGSVKTF  422

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ LD L+DP GW+EWSG+FAL TLYYGEY N G GA T  RV W 
Sbjct  423  LGRPWKEYSRTVFMQSFLDTLVDPAGWLEWSGNFALKTLYYGEYKNIGPGAPTSGRVKWG  482

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V+NFI G SW+P + VPF + L
Sbjct  483  GYRVITSSSEASKFTVNNFIAGSSWLPATNVPFTAGL  519



>ref|XP_007220109.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
 gb|EMJ21308.1| hypothetical protein PRUPE_ppa021446mg, partial [Prunus persica]
Length=482

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 169/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFYRC  +GYQDTLYVHS RQFY++C++YGT+DFIFGN
Sbjct  266  FRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYVYGTVDFIFGN  325

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PM+ Q N ITAQGR DPN+NTGISI +SRV+   +L+     VK++
Sbjct  326  AAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSDLKPVLSSVKTY  385

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ LD L+DP GW+EW G+FAL TLYYGEY NTG G+ST  RVNW 
Sbjct  386  LGRPWKEYSRTVFLQSYLDTLVDPAGWLEWDGNFALKTLYYGEYKNTGPGSSTSGRVNWG  445

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V NFI G SW+P + VPF + L
Sbjct  446  GYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  482



>ref|XP_010062184.1| PREDICTED: pectinesterase-like [Eucalyptus grandis]
Length=519

 Score =   292 bits (747),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 165/213 (77%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  303  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYKECYIYGTVDFIFGN  362

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PM  Q N ITAQGR DPN+NTGISI NSRV+  P+L+      KS+
Sbjct  363  AAVVLQNCMIYARRPMSGQKNTITAQGRTDPNQNTGISIHNSRVMAAPDLKPVLSSFKSY  422

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+++T LD LIDP GW+EW G+FALSTLYYGEY N G  A T  RV WP
Sbjct  423  LGRPWKQYSRTVYLQTYLDTLIDPAGWLEWDGNFALSTLYYGEYKNLGPAAWTSGRVKWP  482

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+ ++    EAS F V+NFI G SW+P +GVPF
Sbjct  483  GYRVITSSSEASKFTVANFIAGQSWLPSTGVPF  515



>ref|NP_001275775.1| pectinesterase 2 precursor [Citrus sinensis]
 gb|AAB57671.1| pectinesterase [Citrus sinensis]
Length=510

 Score =   291 bits (746),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 166/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
              NTAGP  HQAVA+   SD +VFYRCS +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  295  IRNTAGPNNHQAVALRSGSDLSVFYRCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGN  354

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+IF + P  +++N +TAQGR DPN+NTGI I N RV    +L+     VK+F
Sbjct  355  AAVVLQNCNIFARXP-PNRTNTLTAQGRTDPNQNTGIIIHNCRVTAASDLKPVQSSVKTF  413

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV IKT LD LI+P GWMEWSGDFAL+TLYY EYMNTG G+ST NRV W 
Sbjct  414  LGRPWKQYSRTVXIKTFLDSLINPAGWMEWSGDFALNTLYYAEYMNTGPGSSTANRVKWR  473

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H+L  P + S F V NFI G+SW+P + VPF S L
Sbjct  474  GYHVLTSPSQVSQFTVGNFIAGNSWLPATNVPFTSGL  510



>ref|XP_007038413.1| Pectinesterase [Theobroma cacao]
 gb|EOY22914.1| Pectinesterase [Theobroma cacao]
Length=516

 Score =   291 bits (745),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 167/220 (76%), Gaps = 7/220 (3%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  300  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  359

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIP----TPELRGGGGV  349
            AA VLQNC I+ ++PMD Q N++TAQGR DPN+NTGISI NSRV+     TP L      
Sbjct  360  AAVVLQNCMIYARRPMDKQKNIVTAQGRTDPNQNTGISIHNSRVMAANDLTPVL---SSF  416

Query  350  KSFLGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRV  529
            K+FLGRPW++YSRTVF++T LD L+DP GW EW GDFAL+TLYYGEY N G  A T  RV
Sbjct  417  KTFLGRPWKEYSRTVFMQTYLDSLVDPAGWFEWDGDFALNTLYYGEYKNIGPAAPTSRRV  476

Query  530  NWPGFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
             W G+ ++    EAS F V+NFI G SW+P++G+PF S L
Sbjct  477  TWKGYRVITSATEASKFTVTNFIAGRSWLPDTGIPFTSGL  516



>ref|XP_004148139.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=526

 Score =   291 bits (745),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 167/213 (78%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFYRC+ +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  310  FRNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  369

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQNC I+ +KPM+ Q N +TAQGR DPN+NTGISI NSRV+ T +L+     VK++
Sbjct  370  AAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTY  429

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT +D L+DP GW+EW GDFAL+TLYYGEY N G G+    RV W 
Sbjct  430  LGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWK  489

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+H++    EAS F V NFI G SW+P++ VPF
Sbjct  490  GYHVITNLTEASEFTVQNFIAGQSWLPDTEVPF  522



>ref|XP_008439095.1| PREDICTED: pectinesterase-like [Cucumis melo]
Length=571

 Score =   292 bits (748),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 167/213 (78%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGPE HQAVA+   +D +VFYRC+ +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  355  FQNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  414

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQNC I+ +KPM+ Q N +TAQGR DPN+NTGISI NSRV+ T +L+     VK++
Sbjct  415  AAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTY  474

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT +D L+DP GW+EW GDFAL+TLYYGEY N G G+    RV W 
Sbjct  475  LGRPWKEYSRTVFMKTYIDSLVDPTGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWK  534

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+H++    EAS F V NFI G SW+P + VPF
Sbjct  535  GYHVISNSTEASEFTVQNFIAGQSWLPNTEVPF  567



>ref|XP_010552690.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6 
[Tarenaya hassleriana]
Length=543

 Score =   291 bits (746),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/212 (65%), Positives = 163/212 (77%), Gaps = 4/212 (2%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP KHQAVA+   SD +VFYRCS KGYQDTLY+HS RQFYR+C IYGTIDFIFG+
Sbjct  332  FENTAGPTKHQAVALRSGSDFSVFYRCSFKGYQDTLYIHSNRQFYRNCDIYGTIDFIFGD  391

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AAAVLQ C+IFV++PM  Q N +TA  R DPNENTGI I +S V    +    G  +++L
Sbjct  392  AAAVLQRCNIFVRRPMSGQKNTVTAHARKDPNENTGIVIHDSIVTAAED----GTAETYL  447

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPWR YSRTVF+K  L G++ P GW+EWSGDFALSTLYYGEYMN+G GA+  +RV WPG
Sbjct  448  GRPWRMYSRTVFMKCFLGGVVSPVGWLEWSGDFALSTLYYGEYMNSGPGANISDRVKWPG  507

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            F +L    EAS F V NF+ G+SWIP +GVPF
Sbjct  508  FQVLMTASEASKFTVGNFLAGNSWIPAAGVPF  539



>ref|XP_003521940.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=511

 Score =   290 bits (743),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 170/216 (79%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA+   SD +VFYRCS +GYQDTLYV+S RQFYR+C IYGT+DFIFGN
Sbjct  300  FRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGN  359

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA V QNC+I+ + P  ++ N ITAQGR DPN+NTGISI NS+V    +L G   V+++L
Sbjct  360  AAVVFQNCNIYARNP-PNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMG---VRTYL  415

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW++YSRTVF+KT LD LI+P+GW+EWSG+FALSTLYYGEYMNTG G+ST NRVNW G
Sbjct  416  GRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGPGSSTANRVNWLG  475

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H++    EAS F V NFI G+SW+P + VPF S L
Sbjct  476  YHVITSASEASKFTVGNFIAGNSWLPATSVPFTSGL  511



>ref|XP_006576427.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=299

 Score =   283 bits (725),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 161/216 (75%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA    SD +VFYRCS +G+QDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  86   FRNTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYRECDIYGTVDFIFGN  145

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AAAVLQNC+I+ + P   ++  +TAQGR DPN+NTGI I NS+V           VKS+L
Sbjct  146  AAAVLQNCNIYARTP-PQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPSS-VKSYL  203

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW+KYSRTVF+KT LD LI+P GWMEW G+FAL TLYY EY NTG G++T NRV W G
Sbjct  204  GRPWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWKG  263

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H+L    EASPF V NFI G +WIP SGVPF S L
Sbjct  264  YHVLTSASEASPFTVGNFIAGSNWIPSSGVPFTSGL  299



>ref|XP_007052106.1| Pectinesterase 2 [Theobroma cacao]
 gb|EOX96263.1| Pectinesterase 2 [Theobroma cacao]
Length=517

 Score =   291 bits (744),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 169/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
              NTAGP+ HQAV++   SD +VFYRCS +GYQDTLYVHS RQFYR+C IYGT+D IFGN
Sbjct  302  IRNTAGPQNHQAVSLRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDIYGTVDVIFGN  361

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+I+ ++P  +++N +TAQ R DPN+NTGI I NSRV    +L+     VK++
Sbjct  362  AAVVLQNCNIYARRP-PNKTNTVTAQSRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTY  420

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P GWMEW G+FAL+TLYY EYMNTG G+ST NRV W 
Sbjct  421  LGRPWKQYSRTVFMKTFLDSLINPAGWMEWDGNFALNTLYYAEYMNTGTGSSTSNRVKWR  480

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H+L    EAS F VSNF+ G+SW+P +GVPF S L
Sbjct  481  GYHVLTSASEASKFTVSNFLAGNSWLPATGVPFTSGL  517



>ref|XP_002280446.1| PREDICTED: pectinesterase 2 [Vitis vinifera]
Length=513

 Score =   290 bits (743),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 168/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
              NTAG   HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  298  IRNTAGAANHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGN  357

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+I+ + P  +++N ITAQGR DPN+NTGISI N +V    +L+     VK++
Sbjct  358  AAVVLQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTY  416

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P GWMEWSG+FAL TLYYGEYMNTG G+ST NRVNW 
Sbjct  417  LGRPWKEYSRTVFMKTYLDSLINPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVNWA  476

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V NFI G+SW+P + VPF S L
Sbjct  477  GYHVITSSSEASKFTVGNFIAGNSWLPATNVPFTSGL  513



>ref|XP_010417837.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20 
[Camelina sativa]
Length=362

 Score =   286 bits (731),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 165/214 (77%), Gaps = 2/214 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
              NTAGP KHQAVAV  ++D + FY+CS +GYQDTLYVHSLRQFYR+C IYGT+DFIFGN
Sbjct  146  MRNTAGPNKHQAVAVRNSADMSAFYKCSFEGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  205

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGG-GVKSF  358
            AA VLQNC+I  + P+  Q N ITAQGR DPN+NTGISI N R+ P+ EL      VK++
Sbjct  206  AATVLQNCNIIPRLPVQGQFNAITAQGRSDPNQNTGISIQNCRITPSAELVTSNFSVKTY  265

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+++  +DG ID KGW EW GDFALSTLYY E+ NTG G+ T NRVNWP
Sbjct  266  LGRPWKEYSRTVYLQNFMDGFIDGKGWNEWMGDFALSTLYYAEFKNTGPGSETANRVNWP  325

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFG  640
            G+H++ +  EA  F VSNFI GDSW+P  GVP+ 
Sbjct  326  GYHVINE-SEAVWFTVSNFIVGDSWLPNMGVPYA  358



>ref|XP_003517029.1| PREDICTED: pectinesterase 2-like [Glycine max]
 ref|XP_003517030.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=515

 Score =   290 bits (743),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 169/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG + HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  300  FRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGN  359

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+IF + P  ++ N ITAQGR DPN+NTGISI NSRV    +LR     V+++
Sbjct  360  AAVVLQNCNIFARNP-PNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQNSVRTY  418

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LDGLI+P GWMEWSG+FAL TLYYGEYMNTG G+ST  RV W 
Sbjct  419  LGRPWKQYSRTVFMKTYLDGLINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTARRVKWS  478

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V+NFI G++W+P + VPF   L
Sbjct  479  GYRVITSASEASKFSVANFIAGNAWLPSTKVPFTPSL  515



>ref|XP_003521947.1| PREDICTED: pectinesterase 2-like, partial [Glycine max]
Length=506

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 170/216 (79%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA+   SD +VFYRCS +GYQDTLYV+S RQFYR+C IYGT+DFIFGN
Sbjct  295  FRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGN  354

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA V QNC+I+ + P  ++ N ITAQGR DPN+NTGISI NS+V    +L G   V+++L
Sbjct  355  AAVVFQNCNIYARNP-PNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMG---VRTYL  410

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW++YSRTVF+KT LD LI+P+GW+EWSG+FALSTLYYGEYMNTG G+ST NRVNW G
Sbjct  411  GRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGPGSSTANRVNWLG  470

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H++    EAS F V NFI G+SW+P + VPF S L
Sbjct  471  YHVITSASEASKFTVGNFIAGNSWLPATSVPFTSGL  506



>ref|XP_010910881.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=515

 Score =   290 bits (743),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 167/213 (78%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGPEK+QAVA   +SD +V+Y+CS +GYQDTLYVHS +QFYR+C+IYGTIDFIFG+
Sbjct  299  FQNTAGPEKYQAVAFRSSSDLSVYYQCSFEGYQDTLYVHSKQQFYRNCNIYGTIDFIFGD  358

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A  V QNC+I+V+KPM  Q N +TAQGR D   +TGISI +S V   P+L+      +++
Sbjct  359  ATVVFQNCNIYVRKPMTGQKNTVTAQGRTDERTDTGISIHDSVVTAAPDLKPVQSSFQTY  418

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV++KT LD LIDP GW+EW GDFAL TLYYGEYMNTGAGA T  RV WP
Sbjct  419  LGRPWKKYSRTVYMKTFLDSLIDPAGWLEWDGDFALKTLYYGEYMNTGAGADTSQRVTWP  478

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+H++    EAS F V NF+ G+SWIP +GVP+
Sbjct  479  GYHVITSAAEASQFTVGNFLSGNSWIPATGVPY  511



>ref|XP_011070723.1| PREDICTED: LOW QUALITY PROTEIN: pectinesterase [Sesamum indicum]
Length=511

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 165/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAG  KHQAVA+  +SD ++FYRCS KGYQDTLYVHS RQFYRDC IYGTIDFIFG+
Sbjct  296  FENTAGAHKHQAVALRSSSDFSIFYRCSFKGYQDTLYVHSQRQFYRDCDIYGTIDFIFGD  355

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A AVLQNC+I+V+KPM +Q N +TAQGR DPNENTGI I NS V    +LR      +S+
Sbjct  356  AVAVLQNCNIYVRKPMPNQKNTVTAQGRSDPNENTGIIIHNSHVRAFSDLRPVQDSYRSY  415

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWRKYSRTVF+K  ++GLIDP GW+ WSG F LSTLYYGEYMNTG+GA T  RV WP
Sbjct  416  LGRPWRKYSRTVFMKCTIEGLIDPAGWLPWSGAFGLSTLYYGEYMNTGSGARTNGRVKWP  475

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH++  P EA  F    F+ G+  I  +GVPF + L
Sbjct  476  GFHVITSPAEAGKFSAGKFLAGEX-ITAAGVPFTAGL  511



>ref|XP_006580436.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Glycine max]
Length=521

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP++HQAVA+   +DH+VFYRCS  GYQDTLYV++ RQFYRDC IYGTIDFIFG+
Sbjct  306  FENTAGPQQHQAVALRSGADHSVFYRCSFMGYQDTLYVYANRQFYRDCDIYGTIDFIFGD  365

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A  VLQNC+I+V+KPM +Q N +TAQ R DPNENTGI I N R+    +L    G  K+F
Sbjct  366  AVTVLQNCNIYVRKPMSNQQNTVTAQARTDPNENTGIIIHNCRITAAGDLIAVQGSFKTF  425

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K+ LDGLIDP GW  WSG+F LS+LYY EY NTGAGAST  RV WP
Sbjct  426  LGRPWQKYSRTVVMKSALDGLIDPAGWSPWSGNFGLSSLYYAEYANTGAGASTAGRVKWP  485

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF L+    EA  F V NF+ G SWI  SGVPF + L
Sbjct  486  GFRLI-SSSEAVKFTVGNFLAGGSWISGSGVPFDAGL  521



>gb|KHN21591.1| Putative pectinesterase/pectinesterase inhibitor 6 [Glycine soja]
Length=521

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP++HQAVA+   +DH+VFYRCS  GYQDTLYV++ RQFYRDC IYGTIDFIFG+
Sbjct  306  FENTAGPQQHQAVALRSGADHSVFYRCSFMGYQDTLYVYANRQFYRDCDIYGTIDFIFGD  365

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A  VLQNC+I+V+KPM +Q N +TAQ R DPNENTGI I N R+    +L    G  K+F
Sbjct  366  AVTVLQNCNIYVRKPMSNQQNTVTAQARTDPNENTGIIIHNCRITAAGDLIAVQGSFKTF  425

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV +K+ LDGLIDP GW  WSG+F LS+LYY EY NTGAGAST  RV WP
Sbjct  426  LGRPWQKYSRTVVMKSALDGLIDPAGWSPWSGNFGLSSLYYAEYANTGAGASTAGRVKWP  485

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF L+    EA  F V NF+ G SWI  SGVPF + L
Sbjct  486  GFRLI-SSSEAVKFTVGNFLAGGSWISGSGVPFDAGL  521



>ref|XP_011029953.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=519

 Score =   290 bits (742),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 167/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   +D +VFYRC  +GYQDTLYVHS RQFY++C IYGT+DFIFGN
Sbjct  303  FRNTAGPQNHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECDIYGTVDFIFGN  362

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PMD Q N++TAQGR DPN+NTGISI NSRV+ + +LR      K+F
Sbjct  363  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMASSDLRPVLSSFKTF  422

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ YSRTVF++T LD L+D  GW+EW G+FAL+TLYYGEY N+G GAST  RV W 
Sbjct  423  LGRPWKAYSRTVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGPGASTSGRVKWR  482

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F  +NFI G SW+P +GVPF S L
Sbjct  483  GYRVITSATEASRFTAANFIAGRSWLPATGVPFSSGL  519



>emb|CDP00815.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   290 bits (743),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP+KHQAVA+   SD +VFYRCS KGYQDTLYV++ RQFYRDC +YGT DF+FG+
Sbjct  315  FENTAGPQKHQAVALRSGSDFSVFYRCSFKGYQDTLYVYAQRQFYRDCDVYGTQDFVFGD  374

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A  V QNC+  +++P+ +Q N +TAQ R DPNENTGI I NSR+    +L+   G +KS+
Sbjct  375  AIVVFQNCNFNLRRPLGNQMNTLTAQARTDPNENTGIIIHNSRITAASDLKSVQGSIKSY  434

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV + T +D +IDP GW+ WSG+FALSTLYY EYMN+G GA+T  RV W 
Sbjct  435  LGRPWQKYSRTVIMTTSIDNVIDPAGWLPWSGNFALSTLYYAEYMNSGPGAATGGRVKWG  494

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH+L  P EA  F V NF+ G+SWIP +GVPF S L
Sbjct  495  GFHILTSPAEAGKFSVGNFLAGNSWIPGTGVPFTSGL  531



>gb|KGN57272.1| hypothetical protein Csa_3G175720 [Cucumis sativus]
Length=571

 Score =   291 bits (745),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 167/213 (78%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFYRC+ +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  355  FRNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  414

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQNC I+ +KPM+ Q N +TAQGR DPN+NTGISI NSRV+ T +L+     VK++
Sbjct  415  AAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTY  474

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT +D L+DP GW+EW GDFAL+TLYYGEY N G G+    RV W 
Sbjct  475  LGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWK  534

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+H++    EAS F V NFI G SW+P++ VPF
Sbjct  535  GYHVITNLTEASEFTVQNFIAGQSWLPDTEVPF  567



>ref|XP_008232606.1| PREDICTED: pectinesterase 2 [Prunus mume]
Length=511

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 167/217 (77%), Gaps = 4/217 (2%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP   QAVA+   SD +VFY+C  +G QDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  298  FQNTAGPTSGQAVALRSGSDLSVFYKCGFEGNQDTLYVHSDRQFYRECDIYGTVDFIFGN  357

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+I+V    +H++N +TAQGR DPN+NTGISI N +V    +L+     VK++
Sbjct  358  AAVVLQNCNIYVH---NHKTNTVTAQGRSDPNQNTGISIHNCKVTAASDLKSVQSSVKTY  414

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP GWMEWSG+FAL TLYYGEYMNTG G+ST NRV W 
Sbjct  415  LGRPWREYSRTVFMKTYLDSLIDPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVKWA  474

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V NFI G+SW+P + VPF S L
Sbjct  475  GYHVITSASEASKFTVGNFIAGNSWLPATNVPFTSGL  511



>gb|EYU24970.1| hypothetical protein MIMGU_mgv1a022192mg [Erythranthe guttata]
Length=530

 Score =   290 bits (742),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
              NTAGPE HQAVA+   +D +VFYRCS + YQDTLYVHS RQFY++C IYGTIDFIFGN
Sbjct  314  IRNTAGPENHQAVALRSGADLSVFYRCSFEAYQDTLYVHSQRQFYKECDIYGTIDFIFGN  373

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAVLQ+C I+ ++PM  Q N++TAQGR DPN+NTGISI NSRV+ +P+L    G  +SF
Sbjct  374  AAAVLQDCKIYARRPMVKQKNVVTAQGRTDPNQNTGISIHNSRVMASPDLVPVLGSFRSF  433

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ YSRTV+++T +D LIDP GW+EW G FAL TLYYGEY N+G G++T  RVNW 
Sbjct  434  LGRPWKLYSRTVYMQTYIDSLIDPVGWLEWDGSFALDTLYYGEYRNSGPGSNTTRRVNWS  493

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V+NFI G SW+P +GVPF + L
Sbjct  494  GYRVITNASEASTFTVANFIAGQSWLPATGVPFTAGL  530



>ref|XP_002318285.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEE96505.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=520

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   +D +VFYRC  +GYQDTLYVHS RQFY++C IYGT+DFIFGN
Sbjct  304  FRNTAGPQNHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECDIYGTVDFIFGN  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PMD Q N++TAQGR D N+NTGISI NSRV+ + +LR      K+F
Sbjct  364  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDANQNTGISIHNSRVMASSDLRPVLSSFKTF  423

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF++T LD L+D  GW+EW G+FAL+TLYYGEY N+G GAST  RV W 
Sbjct  424  LGRPWKEYSRTVFLQTYLDSLVDAAGWLEWDGNFALNTLYYGEYRNSGPGASTSGRVKWR  483

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V+NFI G SW+P +GVPF S L
Sbjct  484  GYRVITSATEASRFTVANFIAGRSWLPATGVPFSSGL  520



>ref|XP_006576426.1| PREDICTED: pectinesterase 2-like [Glycine max]
Length=517

 Score =   290 bits (741),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 171/217 (79%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG + HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  302  FRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGN  361

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+IF + P  ++ N ITAQGR DPN+NTGISI NSRV    +LR     V+++
Sbjct  362  AAVVLQNCNIFARNP-PNKVNTITAQGRTDPNQNTGISIHNSRVTAASDLRPVQNSVRTY  420

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LDGLI+P GWMEWSG+FAL+TLYY EYMNTG G+ST  RV WP
Sbjct  421  LGRPWKQYSRTVFMKTYLDGLINPSGWMEWSGNFALNTLYYREYMNTGPGSSTGRRVKWP  480

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++ +  EAS F V+NFI G++W+P + VP+   L
Sbjct  481  GYRVMTRASEASKFSVANFIAGNAWLPATKVPYTPSL  517



>ref|XP_011010931.1| PREDICTED: pectinesterase 2-like [Populus euphratica]
Length=517

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 168/213 (79%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  301  FRNTAGPQNHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  360

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PMD Q N++TAQGR DPN+NT ISI NSRV+ + +LR      K++
Sbjct  361  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTPISIHNSRVMASSDLRPVLSSFKTY  420

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF++T LD L+DP GW+EW G+FAL+TLYYGEY N G GAST+ RV W 
Sbjct  421  LGRPWKEYSRTVFLQTYLDSLVDPAGWLEWDGNFALNTLYYGEYRNFGPGASTRGRVKWR  480

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+ ++    EAS F V+NFI G SW+P +GVPF
Sbjct  481  GYRVITSSTEASRFTVANFIAGRSWLPATGVPF  513



>ref|XP_006490097.1| PREDICTED: pectinesterase 2-like [Citrus sinensis]
Length=518

 Score =   289 bits (740),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 169/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFY+C  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  302  FRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  361

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PMD Q N++TAQGR DPN+NTGISI NSRV+  P+L       K+F
Sbjct  362  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSKFKTF  421

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+++T LD L+DP GW+EWSG+FAL+TL+YGEY N G  AST  RV W 
Sbjct  422  LGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWR  481

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V +FI G+SW+P +GVPF S L
Sbjct  482  GYRVITSATEASKFTVGSFIAGNSWLPATGVPFRSGL  518



>gb|KDO65446.1| hypothetical protein CISIN_1g010103mg [Citrus sinensis]
Length=518

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 169/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFY+C  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  302  FRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  361

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PMD Q N++TAQGR DPN+NTGISI NSRV+  P+L       K+F
Sbjct  362  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSKFKTF  421

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+++T LD L+DP GW+EWSG+FAL+TL+YGEY N G  AST  RV W 
Sbjct  422  LGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWR  481

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V +FI G+SW+P +GVPF S L
Sbjct  482  GYRVITSATEASKFTVGSFITGNSWLPATGVPFRSGL  518



>ref|XP_008234391.1| PREDICTED: pectinesterase 2-like [Prunus mume]
Length=517

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 169/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFYRC  +GYQDTLYVHS RQFY++C++YGT+DFIFGN
Sbjct  301  FRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYVYGTVDFIFGN  360

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PM+ Q N ITAQGR DPN+NTGISI +SRV+   +L+     VK++
Sbjct  361  AAVVLQNCMIYARRPMNGQKNTITAQGRTDPNQNTGISIHDSRVMAGSDLKPVLSSVKTY  420

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ LD L+D  GW+EW G+FAL TLYYGEY NTG G+ST+ RVNW 
Sbjct  421  LGRPWKEYSRTVFLQSYLDTLVDSAGWLEWDGNFALKTLYYGEYKNTGPGSSTRGRVNWG  480

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V NFI G SW+P + VPF + L
Sbjct  481  GYHVITSSSEASKFTVGNFIAGSSWLPATNVPFTAGL  517



>ref|XP_006421695.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
 gb|ESR34935.1| hypothetical protein CICLE_v10004742mg [Citrus clementina]
Length=518

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 169/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFY+C  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  302  FRNTAGPQNHQAVALRAGSDLSVFYQCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  361

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PMD Q N++TAQGR DPN+NTGISI NSRV+  P+L       K+F
Sbjct  362  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAAPDLVPVLSKFKTF  421

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+++T LD L+DP GW+EWSG+FAL+TL+YGEY N G  AST  RV W 
Sbjct  422  LGRPWKEYSRTVYMQTYLDSLVDPAGWLEWSGNFALNTLFYGEYKNIGPAASTSGRVKWR  481

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V +FI G+SW+P +GVPF S L
Sbjct  482  GYRVITSATEASKFTVGSFIAGNSWLPATGVPFRSGL  518



>gb|KHN35616.1| Pectinesterase 2 [Glycine soja]
Length=358

 Score =   284 bits (726),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 161/216 (75%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA    SD +VFYRCS +G+QDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  145  FRNTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYRECDIYGTVDFIFGN  204

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AAAVLQNC+I+ + P   ++  +TAQGR DPN+NTGI I NS+V           VKS+L
Sbjct  205  AAAVLQNCNIYARTP-PQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPSS-VKSYL  262

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW+KYSRTVF+KT LD LI+P GWMEW G+FAL TLYY EY NTG G++T NRV W G
Sbjct  263  GRPWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWKG  322

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H+L    EASPF V NFI G +WIP SGVPF S L
Sbjct  323  YHVLTSASEASPFTVGNFIAGSNWIPSSGVPFTSGL  358



>gb|AFW03479.1| pectin methylesterase 5 [Gossypium barbadense]
Length=519

 Score =   289 bits (739),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 167/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP  HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C IYGT+D+IFGN
Sbjct  304  FRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGN  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNC+I+ + P  +++N +TAQGR DPN+NTGI I NSRV    +L+     VK++
Sbjct  364  AAVVFQNCNIYARNP-PNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTY  422

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P GWMEW GDFAL TLYY EYMNTG G+ST NRV W 
Sbjct  423  LGRPWKQYSRTVFMKTYLDSLINPAGWMEWDGDFALKTLYYAEYMNTGPGSSTSNRVKWG  482

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H+L+   E S F V NF+ G+SW+P +GVPF S L
Sbjct  483  GYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>ref|XP_010058467.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=438

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 168/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  223  FRNTAGAANHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGN  282

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPEL-RGGGGVKSF  358
            AA V QNC+I+ + P  +++N ITAQGR DPN+NTGISI N RV    EL R    VK++
Sbjct  283  AAVVFQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGISIHNCRVTAASELKRVQSSVKTY  341

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P GWMEW+G+FAL TLYYGEYMNTG G+ST+NRV W 
Sbjct  342  LGRPWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALKTLYYGEYMNTGPGSSTKNRVKWG  401

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V + I G+SW+P +GVPF S L
Sbjct  402  GYRVITSASEASKFTVGSLIAGNSWLPATGVPFTSGL  438



>ref|XP_002511679.1| Pectinesterase-2 precursor, putative [Ricinus communis]
 gb|EEF50348.1| Pectinesterase-2 precursor, putative [Ricinus communis]
Length=514

 Score =   288 bits (738),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/213 (64%), Positives = 167/213 (78%), Gaps = 2/213 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFY+CS +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  299  FRNTAGPENHQAVALRSGADLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGN  358

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+IF + P  +++N +TAQGR DPN+NTGISI NSRV    +L      V+++
Sbjct  359  AAVVLQNCNIFARNP-PNRTNTLTAQGRTDPNQNTGISIHNSRVTAASDLSPVQSSVRTY  417

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P GWMEWSG+FAL TLYYGEYMNTG G+ST NRV W 
Sbjct  418  LGRPWKEYSRTVFMKTFLDSLINPAGWMEWSGNFALDTLYYGEYMNTGPGSSTANRVTWK  477

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+ ++    EAS F V NFI G+SW+P + VPF
Sbjct  478  GYRVITSAAEASQFTVQNFISGNSWLPGTNVPF  510



>ref|XP_010101099.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
 gb|EXC45243.1| putative pectinesterase/pectinesterase inhibitor 17 [Morus notabilis]
Length=523

 Score =   288 bits (738),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFYRC  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  307  FRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  366

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAVLQNC I+ ++PM  Q N ITAQGR DPN+NTGISI NSRV+   +L+      K++
Sbjct  367  AAAVLQNCMIYARRPMSKQKNTITAQGRTDPNQNTGISIHNSRVMAAADLKPVLSSFKTY  426

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF++T LD L+DP GW+EW GDFAL+TLYYGEY N G  AST  RV W 
Sbjct  427  LGRPWKQYSRTVFMQTYLDSLVDPAGWLEWDGDFALNTLYYGEYRNLGPAASTSRRVKWS  486

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V+NFI G SW+P +GV F + L
Sbjct  487  GYRVITSSSEASQFTVANFIAGQSWLPATGVRFTAGL  523



>ref|XP_009773838.1| PREDICTED: pectinesterase 2-like [Nicotiana sylvestris]
Length=524

 Score =   288 bits (738),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  308  FRNTAGPQNHQAVALRSGSDRSVFYRCGFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  367

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC IF ++PMD Q   ITAQGR DPN+NTGISI NSRV+   +LR      K+F
Sbjct  368  AAVVLQNCMIFARRPMDKQKITITAQGRTDPNQNTGISIHNSRVMAASDLRPVLSTFKTF  427

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT L  L+DP GW+EW G+FAL+TLYYGEY N+G GAST  RV W 
Sbjct  428  LGRPWKQYSRTVFMKTYLHSLVDPAGWLEWDGNFALNTLYYGEYRNSGPGASTSRRVRWR  487

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++   +EA+ F V NFI G SW+P + VPF + L
Sbjct  488  GYRVITNSNEAAKFSVENFIGGRSWLPATNVPFRAGL  524



>gb|AAN84553.1| methyl pectinesterase [Lolium perenne]
Length=226

 Score =   278 bits (712),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
             EN+AGP KHQAVA+ V +D + FYRCS  GYQDTLYVHSLRQF+R+C IYGTIDF+FGN
Sbjct  10   IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGTIDFVFGN  69

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            +A VLQ+C+++ ++P+  QSN+ TAQGR DPN+NTGISI   +V    +L       +++
Sbjct  70   SAVVLQSCNLYARRPLASQSNIYTAQGRTDPNQNTGISIQKCKVAAASDLAAVQTSFRTY  129

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+++++LD ++DPKGW+EW G FAL TLYYGEY NTGAGAST NRV W 
Sbjct  130  LGRPWKQYSRTVYLQSELDSVVDPKGWLEWDGTFALDTLYYGEYQNTGAGASTSNRVKWK  189

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V +FI GD W+  + +PF + L
Sbjct  190  GYRVISSSSEASTFTVGSFIDGDVWLAGTSIPFSTGL  226



>ref|XP_006838619.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
 gb|ERN01188.1| hypothetical protein AMTR_s00002p00230630 [Amborella trichopoda]
Length=520

 Score =   288 bits (737),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+ V+SD A FYRCS+ GYQDTL+  +LRQFYR+C IYGT+DFIFGN
Sbjct  304  FRNTAGPENHQAVALRVSSDFAAFYRCSIDGYQDTLHADTLRQFYRECDIYGTVDFIFGN  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A AV QNC+IFV++PM  Q N ITAQGR DPN+NTGISI NSR+   P+L    G   ++
Sbjct  364  AIAVFQNCNIFVRRPMSQQKNTITAQGRSDPNQNTGISIHNSRISAAPDLSPVQGSFATY  423

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+K++RT+F+K  LD LI+P GW+EWS +FALSTLYYGEY NTG G++T  RV W 
Sbjct  424  LGRPWQKHARTIFLKCFLDDLINPAGWLEWSENFALSTLYYGEYRNTGPGSNTGKRVKWN  483

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H +  P EAS F V +F+ G SWIP +GVPF   L
Sbjct  484  GYHFITSPSEASKFSVGSFLDGGSWIPATGVPFTLDL  520



>ref|XP_010544633.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   288 bits (736),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 169/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP   QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  298  FRNTAGPNNGQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRECNIYGTVDFIFGN  357

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAV QNC+IF ++P + ++N +TAQGR DPN+NTGI I NSR+    +LR   G VK++
Sbjct  358  AAAVFQNCNIFARRPQN-KTNTVTAQGRSDPNQNTGIVIHNSRITAGSDLRPVLGSVKTY  416

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTV +KT LDGLIDP+GW+EW+G+FAL TL+Y EY NTG  +ST  RV WP
Sbjct  417  LGRPWRQYSRTVVMKTFLDGLIDPRGWLEWNGNFALRTLFYAEYQNTGPSSSTGGRVTWP  476

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +LR   EAS F V NFI G+SWIP + VPF S L
Sbjct  477  GFRVLRTASEASRFTVGNFIAGNSWIPATNVPFTSGL  513



>ref|XP_011010930.1| PREDICTED: pectinesterase-like [Populus euphratica]
Length=516

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 167/216 (77%), Gaps = 3/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP+ HQAVA+  +SD++VFYRC  +GYQDTLYVHS RQFYR+C IYGTIDFIFG+
Sbjct  304  FQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGTIDFIFGD  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQNC I+V++P   Q+N+ITAQGR  P  NTGI I NS+V    +L   G  K++L
Sbjct  364  AAVVLQNCMIYVRRPFGSQNNVITAQGRSCPYTNTGIVIHNSQVFSAEDL---GSSKTYL  420

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPWRKYSRTVF+ T LD L+DP GW+EW G+FAL+TLYYGEY NTG GAST  RV WPG
Sbjct  421  GRPWRKYSRTVFLSTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNTGPGASTSGRVKWPG  480

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            + ++   +EAS F V+NFI G SW+P +GV F + L
Sbjct  481  YKVITSAEEASKFTVANFIGGRSWLPATGVQFAAGL  516



>ref|XP_009378667.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
 ref|XP_009339421.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=510

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 168/217 (77%), Gaps = 4/217 (2%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGP   QAVA+   SD +VFY+CS +G QDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  297  FENTAGPTSGQAVALRSGSDLSVFYKCSFEGNQDTLYVHSERQFYRECDIYGTVDFIFGN  356

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V+QN +I+V    +H++N ITAQGR DPN+NTGISI N +V    +L+     VK++
Sbjct  357  AAVVIQNSNIYVH---NHKTNTITAQGRTDPNQNTGISIHNCKVTAASDLKPVQSSVKTY  413

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P GWMEWSGDFAL TLYYGEYMNTG GAST+NRV+W 
Sbjct  414  LGRPWKQYSRTVFMKTYLDSLINPAGWMEWSGDFALKTLYYGEYMNTGPGASTKNRVSWA  473

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V NFI G SW+P + VPF S L
Sbjct  474  GYHVITSASEASKFSVGNFIAGGSWLPATNVPFTSGL  510



>ref|XP_004160886.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=742

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/213 (63%), Positives = 167/213 (78%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFYRC+ +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  526  FRNTAGPENHQAVALRSGADLSVFYRCAFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  585

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQNC I+ +KPM+ Q N +TAQGR DPN+NTGISI NSRV+ T +L+     VK++
Sbjct  586  AAVVLQNCMIYARKPMNGQKNAVTAQGRTDPNQNTGISIHNSRVMATDDLKPVESTVKTY  645

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT +D L+DP GW+EW GDFAL+TLYYGEY N G G+    RV W 
Sbjct  646  LGRPWKEYSRTVFMKTYIDSLVDPAGWLEWDGDFALNTLYYGEYNNIGPGSPISQRVKWK  705

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+H++    EAS F V NFI G SW+P++ VPF
Sbjct  706  GYHVITNLTEASEFTVQNFIAGQSWLPDTEVPF  738



>ref|XP_011010924.1| PREDICTED: pectinesterase-like isoform X1 [Populus euphratica]
Length=516

 Score =   287 bits (735),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 167/216 (77%), Gaps = 3/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP+ HQAVA+  +SD++VFYRC  +GYQDTLYVHS RQFYR+C IYGTIDFIFG+
Sbjct  304  FQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGTIDFIFGD  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQNC I+V++P   Q+N+ITAQGR  P  NTGI I NS+V    +L   G  K++L
Sbjct  364  AAVVLQNCMIYVRRPFGSQNNVITAQGRSCPYTNTGIVIHNSQVFSAEDL---GSSKTYL  420

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPWRKYSRTVF+ T LD L+DP GW+EW G+FAL+TLYYGEY NTG GAST  RV WPG
Sbjct  421  GRPWRKYSRTVFLSTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNTGPGASTSGRVKWPG  480

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            + ++   +EAS F V+NFI G SW+P +GV F + L
Sbjct  481  YKVITSAEEASEFTVANFIGGRSWLPATGVQFAAGL  516



>ref|XP_002884520.1| hypothetical protein ARALYDRAFT_896648 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60779.1| hypothetical protein ARALYDRAFT_896648 [Arabidopsis lyrata subsp. 
lyrata]
Length=558

 Score =   288 bits (738),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 166/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
              NTAGP KHQAVAV  ++D + FY+CS +GYQDTLYVHSLRQFYR+C IYGT+DFIFGN
Sbjct  342  LRNTAGPNKHQAVAVRNSADMSAFYKCSFEGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  401

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGG-GVKSF  358
            AA VLQNC++  + P+  Q N ITAQGR DPN+NTGISI N R+ P+ EL      VK++
Sbjct  402  AATVLQNCNLIPRLPLQGQFNAITAQGRSDPNQNTGISIQNCRITPSAELVSSSFSVKTY  461

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+++  LDG ID KGW+EW GDFAL TLYY E+ NTG G+ T NRVNWP
Sbjct  462  LGRPWKEYSRTVYLQNFLDGFIDSKGWIEWMGDFALQTLYYAEFKNTGPGSETVNRVNWP  521

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++ +  EA  F VSNFI GDSW+P  GVP+   L
Sbjct  522  GYHVINK-TEAVWFTVSNFIVGDSWLPNMGVPYAGGL  557



>ref|XP_007220661.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
 gb|EMJ21860.1| hypothetical protein PRUPE_ppa004413mg [Prunus persica]
Length=511

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 166/217 (76%), Gaps = 4/217 (2%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP   QAVA+   SD +VFY+C  +G QDTLYV+S RQFYR+C IYGT+DFIFGN
Sbjct  298  FQNTAGPTSGQAVALRSGSDLSVFYKCGFEGNQDTLYVYSDRQFYRECDIYGTVDFIFGN  357

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNC+I+V    +H++N ITAQGR DPN+NTGISI N RV    +L+     VK++
Sbjct  358  AAVVFQNCNIYVH---NHKTNTITAQGRSDPNQNTGISIHNCRVTAASDLKSVQSSVKTY  414

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP GWMEWSG+FAL TLYYGEYMNTG G+ST NRV W 
Sbjct  415  LGRPWREYSRTVFMKTYLDSLIDPAGWMEWSGNFALKTLYYGEYMNTGPGSSTSNRVKWA  474

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V NFI G+SW+P + VPF S L
Sbjct  475  GYHVITSASEASKFTVGNFIAGNSWLPATNVPFTSGL  511



>ref|XP_011010925.1| PREDICTED: pectinesterase-like isoform X2 [Populus euphratica]
Length=518

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 167/216 (77%), Gaps = 3/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP+ HQAVA+  +SD++VFYRC  +GYQDTLYVHS RQFYR+C IYGTIDFIFG+
Sbjct  306  FQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGTIDFIFGD  365

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQNC I+V++P   Q+N+ITAQGR  P  NTGI I NS+V    +L   G  K++L
Sbjct  366  AAVVLQNCMIYVRRPFGSQNNVITAQGRSCPYTNTGIVIHNSQVFSAEDL---GSSKTYL  422

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPWRKYSRTVF+ T LD L+DP GW+EW G+FAL+TLYYGEY NTG GAST  RV WPG
Sbjct  423  GRPWRKYSRTVFLSTYLDSLVDPAGWLEWDGNFALNTLYYGEYKNTGPGASTSGRVKWPG  482

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            + ++   +EAS F V+NFI G SW+P +GV F + L
Sbjct  483  YKVITSAEEASEFTVANFIGGRSWLPATGVQFAAGL  518



>ref|XP_008467117.1| PREDICTED: pectinesterase [Cucumis melo]
Length=534

 Score =   288 bits (736),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 164/213 (77%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGPEKHQAVA+   +D ++FYRCS KGYQDTLY HS RQFYR+CHIYGT+DFIFG+
Sbjct  318  FENTAGPEKHQAVALRSNADRSIFYRCSFKGYQDTLYAHSNRQFYRECHIYGTVDFIFGD  377

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGV-KSF  358
             A V QNC+IFV+KPM +Q N ITAQGR DPNENTG  I NS +   P+L+   G+  ++
Sbjct  378  GAVVFQNCNIFVRKPMMNQKNTITAQGRSDPNENTGFVIHNSVIKAAPDLKPVQGLYGTY  437

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ YSRTV +K+ LDGLI+P GW+ W+GDF L T+YYGE+MN G GA+T+ RV WP
Sbjct  438  LGRPWKAYSRTVIMKSYLDGLIEPAGWLPWAGDFGLRTIYYGEFMNIGGGANTKGRVRWP  497

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+H++    EA  F V +F+ G  WIP +GVPF
Sbjct  498  GYHVMTSATEAEGFTVESFLGGRGWIPTTGVPF  530



>gb|KHN35617.1| Pectinesterase 2 [Glycine soja]
Length=511

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 169/216 (78%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA+   SD +VFYRCS +GYQDTLYV+S RQFYR+C IYGT+DFIFGN
Sbjct  300  FRNTAGATNHQAVALRSGSDLSVFYRCSFEGYQDTLYVYSDRQFYRECDIYGTVDFIFGN  359

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA V QNC+I+ + P  ++ N ITAQGR DPN+NTGISI NS+V    +L G   V+++L
Sbjct  360  AAVVFQNCNIYARNP-PNKVNTITAQGRTDPNQNTGISIHNSKVTAASDLMG---VRTYL  415

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW++YSRTVF+KT LD LI+P+GW+EWSG+FALSTLYYGEYMNTG G+ST NRVNW G
Sbjct  416  GRPWQQYSRTVFMKTYLDSLINPEGWLEWSGNFALSTLYYGEYMNTGPGSSTANRVNWLG  475

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H++    EAS F V NFI G+SW+  + VPF S L
Sbjct  476  YHVITSASEASKFTVGNFIAGNSWLLATSVPFTSGL  511



>ref|XP_008377824.1| PREDICTED: pectinesterase 2-like [Malus domestica]
Length=518

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 162/217 (75%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFYRC  +GYQDTLY HS RQFYR+C++YGT+DFIFGN
Sbjct  302  FRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYTHSQRQFYRECYVYGTVDFIFGN  361

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA V QNC I+ +KPM  Q N ITAQGR DPN+NTGISI +SRV+   +L    G VK+F
Sbjct  362  AAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNTGISIHDSRVMAALDLESSVGSVKTF  421

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ LD L+DP GW++WSGDFAL TLYYGEY N G GA T  RV W 
Sbjct  422  LGRPWKEYSRTVFMQSFLDTLVDPAGWLQWSGDFALKTLYYGEYKNIGPGAPTTGRVKWG  481

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V NFI G SW+P +  PF + L
Sbjct  482  GYRIITSSSEASKFTVDNFIAGSSWLPATNXPFTAXL  518



>ref|XP_010692197.1| PREDICTED: pectinesterase 2 [Beta vulgaris subsp. vulgaris]
Length=527

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 170/217 (78%), Gaps = 6/217 (3%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP  HQAVA+   SD +VFY+CS +GYQDTLYV S RQFYR+C IYGT+DFIFGN
Sbjct  316  FRNTAGPSNHQAVALRSNSDLSVFYKCSFEGYQDTLYVFSNRQFYRECDIYGTVDFIFGN  375

Query  182  AAAVLQNCDIFVK-KPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSF  358
            AAAV+QNC+I+ +  P   ++  ITAQGR DPNENTGISI NSRV  + +L+G    K++
Sbjct  376  AAAVIQNCNIYARFGP--SRTVAITAQGRSDPNENTGISIHNSRVSASEDLKGS---KTY  430

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT L G++DPKGW+EW+GDFALSTLYYGEY NTG G+ST NRV W 
Sbjct  431  LGRPWKKYSRTVFMKTYLSGIVDPKGWLEWNGDFALSTLYYGEYANTGPGSSTSNRVKWS  490

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EA  F V NFI G++W+P +GVPF S L
Sbjct  491  GYHVITSSAEAGKFNVGNFIAGNNWLPSTGVPFKSGL  527



>emb|CDX74715.1| BnaA05g04610D [Brassica napus]
Length=445

 Score =   285 bits (728),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 166/217 (76%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYRDC IYGT+DFIFGN
Sbjct  231  FRNTAGASNEQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDIYGTVDFIFGN  290

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR D N+NTGI I NSRV    +LR   G  K++
Sbjct  291  AAAVLQNCNIFARRPR-SKTNTITAQGRSDQNQNTGIIIHNSRVTAASDLRPILGSTKTY  349

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP+GW+EW+G+FALSTL+Y E+ NTG GAST  RV WP
Sbjct  350  LGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALSTLFYAEFQNTGPGASTSGRVKWP  409

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +L+   EAS F V +FI G SWIP S VPF S L
Sbjct  410  GFRVLQSASEASRFTVGSFIAGSSWIPSS-VPFTSGL  445



>gb|KHG19575.1| Uncharacterized protein F383_07269 [Gossypium arboreum]
Length=519

 Score =   287 bits (734),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 167/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP  HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C IYGT+D+IFGN
Sbjct  304  FRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGN  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V Q+C+I+ + P  +++N +TAQGR DPN+NTGI I NSRV    +L+     VK++
Sbjct  364  AAVVFQDCNIYARNP-PNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTY  422

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P GWMEW GDFAL TLYY EYMNTG G+ST NRV W 
Sbjct  423  LGRPWKQYSRTVFMKTYLDSLINPAGWMEWDGDFALKTLYYAEYMNTGPGSSTSNRVKWG  482

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H+L+   E S F V NF+ G+SW+P +GVPF S L
Sbjct  483  GYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>ref|XP_010056337.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 168/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  300  FRNTAGAANHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGN  359

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPEL-RGGGGVKSF  358
            AA V QNC+I+ + P  +++N ITAQGR DPN+NTGISI N RV    EL R    VK++
Sbjct  360  AAVVFQNCNIYPRNP-PNKTNTITAQGRTDPNQNTGISIHNCRVTAASELKRVQSSVKTY  418

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P GWMEW+G+FAL TLYYGEYMNTG G+ST+NRV W 
Sbjct  419  LGRPWKEYSRTVFMKTYLDSLINPAGWMEWNGNFALKTLYYGEYMNTGPGSSTKNRVKWG  478

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V + I G+SW+P +GVPF S L
Sbjct  479  GYRVITSASEASKFTVGSLIAGNSWLPATGVPFTSGL  515



>ref|XP_004971511.1| PREDICTED: pectinesterase 1-like [Setaria italica]
Length=428

 Score =   284 bits (726),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
             EN+AGP KHQAVA+ V +D + FYRCS  GYQDTLYVHSLRQF+RDC IYGTIDFIFGN
Sbjct  212  IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRDCDIYGTIDFIFGN  271

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA V Q+C+++ +KP+ +QSN+ TAQGR+DPN+NTGISI   +V    +L G     K++
Sbjct  272  AAVVFQSCNLYARKPLPNQSNIFTAQGREDPNQNTGISIQRCKVAAASDLAGQESSTKTY  331

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF++++LD LIDP GW+EW+G FAL TLYYGEYMNTGAGA T  RV W 
Sbjct  332  LGRPWKQYSRTVFLQSELDSLIDPAGWLEWNGSFALDTLYYGEYMNTGAGAGTAGRVKWK  391

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V +FI GD W+  + +PF + L
Sbjct  392  GYRVITSAAEASAFTVGSFIDGDVWLAGTSIPFTTGL  428



>ref|XP_003634048.1| PREDICTED: pectinesterase 2-like [Vitis vinifera]
Length=520

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  304  FRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYKECYIYGTVDFIFGN  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ ++PMD Q N++TAQGR DPN+NTGISI NSRV+   +L+      K++
Sbjct  364  AAVVLQNCMIYARRPMDKQKNVVTAQGRTDPNQNTGISIHNSRVMAATDLKPVLSSFKTY  423

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV++ T LD L+D  GW+EW G+FAL+TLYYGEY N G G+ST  RV W 
Sbjct  424  LGRPWKEYSRTVYLGTYLDTLVDSAGWLEWDGNFALNTLYYGEYKNFGPGSSTSGRVKWR  483

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V+NFI G SW+P +GVPF S L
Sbjct  484  GYRVITSATEASKFSVANFIAGQSWLPATGVPFRSGL  520



>ref|XP_004307817.1| PREDICTED: pectinesterase 2-like [Fragaria vesca subsp. vesca]
Length=459

 Score =   285 bits (728),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 162/217 (75%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   +D +VFYRCS +GYQDTLY HS RQFY++C+IYGT+DFIFGN
Sbjct  243  FRNTAGPQNHQAVALRSGADLSVFYRCSFEGYQDTLYTHSQRQFYKECYIYGTVDFIFGN  302

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ +KPM  Q N ITAQGR DPN+NTGISI +SR++   +L      VK+F
Sbjct  303  AAVVLQNCMIYARKPMSGQKNTITAQGRTDPNQNTGISIHDSRIMAAADLAPVIKSVKTF  362

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ YSRTVF+++ LD L+DP GW+EW G+FAL TLYYGEY N G G+ T  RV W 
Sbjct  363  LGRPWKTYSRTVFLQSYLDSLVDPAGWLEWDGNFALKTLYYGEYKNKGPGSGTSGRVKWG  422

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V N I G SW+P +GVPF S L
Sbjct  423  GYRVITSSSEASKFTVGNLIAGSSWLPATGVPFTSGL  459



>ref|XP_010524372.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Tarenaya hassleriana]
Length=513

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 170/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP   QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  298  FRNTAGPSNGQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRECDIYGTVDFIFGN  357

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAV QNC+IF ++P + ++N +TAQGR DPN+NTGI I NSRV    +L+   G VK++
Sbjct  358  AAAVFQNCNIFARRPRN-KTNTVTAQGRSDPNQNTGIVIHNSRVTAGSDLQPVLGSVKTY  416

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LDGLIDP+GW+EW+G+FALSTL+Y EY NTG G+ST  RV WP
Sbjct  417  LGRPWRQYSRTVFMKTFLDGLIDPRGWLEWNGNFALSTLFYAEYQNTGPGSSTSGRVTWP  476

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +L    +AS F V +FI G+SWIP + VPF S L
Sbjct  477  GFRVLTAASDASRFTVGSFIAGNSWIPATNVPFTSGL  513



>ref|XP_006397702.1| hypothetical protein EUTSA_v10001409mg [Eutrema salsugineum]
 gb|ESQ39155.1| hypothetical protein EUTSA_v10001409mg [Eutrema salsugineum]
Length=511

 Score =   286 bits (732),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 166/217 (76%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYRDC +YGT+DFIFGN
Sbjct  297  FRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGN  356

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR DPN+NTGI I NSRV    +LR   G  K++
Sbjct  357  AAAVLQNCNIFARRPRS-RTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPILGSTKTY  415

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LDGLIDP+GW+EW G+FAL TL+Y E+ NTG GAST  RV WP
Sbjct  416  LGRPWRQYSRTVFMKTFLDGLIDPRGWLEWDGNFALRTLFYAEFQNTGRGASTSGRVKWP  475

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +LR   EAS F V NF+ G SWIP S +PF S L
Sbjct  476  GFRVLRSASEASRFTVGNFLAGGSWIPSS-IPFTSGL  511



>gb|KFK37970.1| hypothetical protein AALP_AA3G053400 [Arabis alpina]
Length=554

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 166/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  8    NTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGNAA  187
            NTAGP KHQAVAV  ++D + FY+CS + YQDTLYVHSLRQFYR+C IYGT+DFIFGNAA
Sbjct  340  NTAGPSKHQAVAVRNSADMSAFYKCSFEAYQDTLYVHSLRQFYRECDIYGTVDFIFGNAA  399

Query  188  AVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGG-GVKSFLG  364
             V+QNC+I  + P+  Q N ITAQGR DPN+NTGISI N RVIP+ EL      VK++LG
Sbjct  400  TVIQNCNIIPRLPLQGQFNAITAQGRSDPNQNTGISIQNCRVIPSAELVSSNFSVKTYLG  459

Query  365  RPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPGF  544
            RPW++YSRTV+++  +DG ID KGW EW GDFAL TLYY E+ NTG G+ T NRVNWPG+
Sbjct  460  RPWKEYSRTVYLQNFMDGFIDAKGWNEWMGDFALKTLYYAEFKNTGPGSETVNRVNWPGY  519

Query  545  HLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            H++ + +EA  F VSNFI GDSW+P  GVP+   L
Sbjct  520  HVINE-NEALWFTVSNFIAGDSWLPNMGVPYAGGL  553



>ref|XP_004514850.1| PREDICTED: pectinesterase 2-like [Cicer arietinum]
Length=511

 Score =   286 bits (731),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 165/216 (76%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA    SD +VFY+CS +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  298  FRNTAGAANHQAVAFRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGN  357

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQNC+IF + P   ++  +TAQGR DPN+NTGI I NS+V P  +L     VKS+L
Sbjct  358  AAVVLQNCNIFARNP-PQKTITVTAQGRTDPNQNTGIIIHNSKVSPASDLNPSS-VKSYL  415

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW+KYSRTVF+ T LD  I+P GW+EW G+FAL TLYY EY NTG+G+ST NRV W G
Sbjct  416  GRPWQKYSRTVFMDTVLDSFINPAGWLEWDGNFALDTLYYAEYANTGSGSSTSNRVKWKG  475

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H+L    +ASPF V NFI G+SW+P++GVPF S L
Sbjct  476  YHVLTSASQASPFTVGNFIAGNSWLPKTGVPFTSGL  511



>ref|XP_002320714.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
 gb|EEE99029.1| putative pectin methylesterase LuPME1 family protein [Populus 
trichocarpa]
Length=514

 Score =   286 bits (731),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 169/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG + HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  299  FRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSQRQFYRECNIYGTVDFIFGN  358

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNC+I+ + P  +++N ITAQGR DPN+NTGISI N +V    +L+     VK++
Sbjct  359  AAVVFQNCNIYARNP-PNKTNTITAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTY  417

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KTDLD LI+  GWM WSG+FAL TLYYGEYMNTG G+ST NRVNW 
Sbjct  418  LGRPWQKYSRTVFMKTDLDSLINSAGWMPWSGNFALDTLYYGEYMNTGPGSSTANRVNWK  477

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++     AS F V++FI G++W+P + VPF + L
Sbjct  478  GYHVITSASVASQFTVASFISGNNWLPATNVPFTAGL  514



>ref|XP_009143104.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score =   285 bits (730),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 141/217 (65%), Positives = 167/217 (77%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYRDC IYGT+DFIFGN
Sbjct  296  FRNTAGASNEQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDIYGTVDFIFGN  355

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR D N+NTGI I NSRV    +LR   G  K++
Sbjct  356  AAAVLQNCNIFARRPRS-KTNTITAQGRSDQNQNTGIIIHNSRVTAASDLRPILGSTKTY  414

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP+GW+EW+G+FALSTL+Y E+ NTG+GAST  RV WP
Sbjct  415  LGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALSTLFYAEFQNTGSGASTSGRVKWP  474

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +L+   EAS F V +FI G SWIP S VPF S L
Sbjct  475  GFRVLQSASEASRFTVGSFIAGSSWIPSS-VPFTSGL  510



>ref|XP_010486017.1| PREDICTED: pectinesterase-like [Camelina sativa]
Length=558

 Score =   286 bits (733),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 166/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  8    NTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGNAA  187
            NTAGP KHQAVAV  ++D + FY+CS +GYQDTLYVHSLRQFYR+C IYGT+DFIFGNAA
Sbjct  344  NTAGPNKHQAVAVRNSADMSAFYKCSFEGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAA  403

Query  188  AVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGG-GVKSFLG  364
             VLQNC+I  + P+  Q N ITAQGR DPN+NTGISI N R+ P+ EL      VK++LG
Sbjct  404  TVLQNCNIIPRLPVQGQFNAITAQGRSDPNQNTGISIQNCRITPSAELVTSNFSVKTYLG  463

Query  365  RPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPGF  544
            RPW++YSRTV+++  +DG ID KGW+EW GDFALSTLYY E+ NTG G+ T NRV WPG+
Sbjct  464  RPWKEYSRTVYLQNFMDGFIDGKGWIEWIGDFALSTLYYAEFKNTGPGSETANRVKWPGY  523

Query  545  HLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            H++ +  EA  F VSNF+ GDSW+P  GVP+   L
Sbjct  524  HVISE-TEAVSFTVSNFLVGDSWLPNMGVPYAGGL  557



>emb|CDX83392.1| BnaA03g21140D [Brassica napus]
Length=445

 Score =   283 bits (724),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 165/217 (76%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYRDC +YGT+DFIFGN
Sbjct  231  FRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGN  290

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR DPN+NTGI I NSRV    +LR   G  K++
Sbjct  291  AAAVLQNCNIFARRPR-SRTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTY  349

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP+GW+EW G+FALSTL+Y E+ NTG GAST  RV WP
Sbjct  350  LGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALSTLFYAEFQNTGPGASTSGRVTWP  409

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +L    EAS F V +F+ G SWIP S VPF S L
Sbjct  410  GFRVLSSTSEASRFTVGSFLAGSSWIP-SDVPFTSGL  445



>ref|XP_006841486.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
 gb|ERN03161.1| hypothetical protein AMTR_s00003p00120050 [Amborella trichopoda]
Length=540

 Score =   286 bits (731),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 164/213 (77%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGP KHQAVA+   +D + FYRCS  GYQDTLYVHSLRQFYR+C +YGT+DFIFGN
Sbjct  323  FENSAGPSKHQAVALRSGADLSAFYRCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGN  382

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQ+C+++ ++P  +Q NL TAQGR DPN+NTGISI N +V    +L       K++
Sbjct  383  AAVVLQDCNLYARRPNPNQRNLFTAQGRVDPNQNTGISIQNCKVAAAADLIPVQSSFKNY  442

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRT+F+++D+  LIDP GW EWSGDFALSTLYYGEYMN G GA T NRV WP
Sbjct  443  LGRPWKQYSRTIFMQSDIGDLIDPAGWFEWSGDFALSTLYYGEYMNRGPGADTSNRVKWP  502

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+ ++    EAS F V++FIQG+ W+P S V F
Sbjct  503  GYRVINSSSEASQFTVASFIQGNEWLPASNVAF  535



>ref|XP_010508199.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Camelina sativa]
Length=510

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 164/217 (76%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYRDC +YGT+DFIFGN
Sbjct  296  FRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGN  355

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR DPN+NTGI I NSRV    +LR   G  K++
Sbjct  356  AAAVLQNCNIFARRPR-SKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTY  414

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP+GW+EW G+FAL TL+Y E+ NTG GAST  RV WP
Sbjct  415  LGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTSGRVTWP  474

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +LR   EAS F V  F+ G SWIP S VPF S L
Sbjct  475  GFRVLRSASEASKFTVGTFLAGSSWIPSS-VPFTSGL  510



>ref|XP_010518135.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
isoform X1 [Camelina sativa]
 ref|XP_010518136.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
isoform X2 [Camelina sativa]
Length=510

 Score =   285 bits (729),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 164/217 (76%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYRDC +YGT+DFIFGN
Sbjct  296  FRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGN  355

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR DPN+NTGI I NSRV    +LR   G  K++
Sbjct  356  AAAVLQNCNIFARRPR-SKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTY  414

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP+GW+EW G+FAL TL+Y E+ NTG GAST  RV WP
Sbjct  415  LGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTSARVTWP  474

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +LR   EAS F V  F+ G SWIP S VPF S L
Sbjct  475  GFRVLRSASEASKFTVGTFLAGSSWIPSS-VPFTSGL  510



>ref|XP_010321856.1| PREDICTED: pectinesterase [Solanum lycopersicum]
Length=564

 Score =   286 bits (733),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN AGP KHQAVA+   SD + FY+CS   YQDTLYVHSLRQFYRDC +YGT+DFIFGN
Sbjct  345  FENYAGPSKHQAVALRSGSDLSAFYQCSFIAYQDTLYVHSLRQFYRDCDVYGTVDFIFGN  404

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQNC+++ +KP  +Q N+ TAQGR+DPN+NTGISILN +V    +L       K++
Sbjct  405  AAVVLQNCNLYARKPNPNQKNMFTAQGREDPNQNTGISILNCKVEAASDLVPVVSSFKNY  464

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV + +++  LIDP GW+EWSGDFAL+TLYYGEY+N G G++T  RV WP
Sbjct  465  LGRPWKQYSRTVILISNIGSLIDPAGWLEWSGDFALNTLYYGEYLNRGPGSNTSARVKWP  524

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V NFIQG  WIP +GVPF S L
Sbjct  525  GYRVINSSSEASQFTVGNFIQGSEWIPATGVPFYSGL  561



>ref|XP_009147300.1| PREDICTED: pectinesterase-like [Brassica rapa]
Length=559

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  8    NTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGNAA  187
            NTAGP KHQAVAV  ++D + FY+CS +GYQDTLYVHSLRQFYR+C IYGT+DFIFGNAA
Sbjct  345  NTAGPTKHQAVAVRNSADMSAFYKCSFEGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAA  404

Query  188  AVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGG-GVKSFLG  364
             VLQNC++  + P+  Q N ITAQGR DPN+NTGISI N R+ P+ EL      VK++LG
Sbjct  405  TVLQNCNLIPRLPLQGQFNAITAQGRSDPNQNTGISIQNCRITPSAELVSSNFSVKTYLG  464

Query  365  RPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPGF  544
            RPW++YSRTV+++  +DG ID KGW EW GDFAL TLYY E+MNTG G+ T NRVNWPG+
Sbjct  465  RPWKEYSRTVYLQNFMDGFIDAKGWNEWMGDFALQTLYYAEFMNTGPGSETANRVNWPGY  524

Query  545  HLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            H++ +  EA  F VSNFI GD W+P  GVP+   L
Sbjct  525  HVINE-TEAVWFTVSNFIVGDYWLPSMGVPYAGGL  558



>ref|XP_004174049.1| PREDICTED: pectinesterase 2-like, partial [Cucumis sativus]
Length=431

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 172/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   +D +VF+RC  +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  215  FRNTAGPQNHQAVALRSGADLSVFFRCGFEGYQDTLYVHSQRQFYRECYIYGTVDFIFGN  274

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            +A VLQNC I+ +KPM  Q  ++TAQGR DPN+NTGISI NSRV+ T +L+     V+++
Sbjct  275  SAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGISIHNSRVMATDDLKPVIKSVRTY  334

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV++++ +D L++P GW+EWSG+FAL+TLYYGE+ N+G G+ST NRV W 
Sbjct  335  LGRPWKEYSRTVYLQSFMDSLVNPAGWLEWSGNFALNTLYYGEFKNSGLGSSTANRVKWK  394

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EA+ F V +FI G+SW+P +GVPF + L
Sbjct  395  GYRVITSASEAAKFTVGSFISGNSWLPGTGVPFTAGL  431



>ref|XP_009340592.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 161/217 (74%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFYRC  +GYQDTLY HS RQFYR+C++YGT+DFIFGN
Sbjct  302  FRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYTHSQRQFYRECYVYGTVDFIFGN  361

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA V QNC I+ +KPM  Q N ITAQGR DPN+NTGISI +SRV+   +     G VK+F
Sbjct  362  AAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNTGISIHDSRVMAALDFESSVGSVKTF  421

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ LD L+DP GW++WSGDFAL TLYYGEY N G GA T  RV W 
Sbjct  422  LGRPWKEYSRTVFMQSFLDTLVDPAGWLKWSGDFALKTLYYGEYKNIGPGAPTTGRVKWG  481

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V NFI G SW+P + V F + L
Sbjct  482  GYRIITSSSEASKFTVDNFIAGSSWLPATNVAFAAGL  518



>ref|XP_009374493.1| PREDICTED: pectinesterase 2-like [Pyrus x bretschneideri]
Length=518

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 161/217 (74%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFYRC  +GYQDTLY HS RQFYR+C++YGT+DFIFGN
Sbjct  302  FRNTAGPENHQAVALRSGADLSVFYRCGFEGYQDTLYTHSQRQFYRECYVYGTVDFIFGN  361

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA V QNC I+ +KPM  Q N ITAQGR DPN+NTGISI +SRV+   +     G VK+F
Sbjct  362  AAVVFQNCMIYARKPMSGQQNTITAQGRTDPNQNTGISIHDSRVMAALDFESSVGSVKTF  421

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ LD L+DP GW++WSGDFAL TLYYGEY N G GA T  RV W 
Sbjct  422  LGRPWKEYSRTVFMQSFLDTLVDPAGWLKWSGDFALKTLYYGEYKNIGPGAPTTGRVKWG  481

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V NFI G SW+P + V F + L
Sbjct  482  GYRIITSSSEASKFTVDNFIAGSSWLPATNVAFAAGL  518



>ref|XP_002322399.1| putative pectin methylesterase family protein [Populus trichocarpa]
 gb|EEF06526.1| putative pectin methylesterase family protein [Populus trichocarpa]
Length=516

 Score =   285 bits (728),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 167/216 (77%), Gaps = 3/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP+ HQAVA+  +SD++VFYRC  +GYQDTLYVHS RQFYR+C IYGTIDFIFG+
Sbjct  304  FQNTAGPQNHQAVALRSSSDYSVFYRCGFEGYQDTLYVHSKRQFYRECSIYGTIDFIFGD  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQNC I+V++P+  Q+N+ITAQGR  P  NTGI I NS+V    +L   G  K++L
Sbjct  364  AAVVLQNCMIYVRRPIGSQNNVITAQGRSCPYTNTGIVIHNSQVFAAEDL---GSSKTYL  420

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPWRKYSRTVF+ T LD  +DP GW+EW+G FAL+TLYYGEY NTG GAST  RV WPG
Sbjct  421  GRPWRKYSRTVFLSTYLDSSVDPAGWLEWNGSFALNTLYYGEYKNTGPGASTSGRVKWPG  480

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            + ++   +EAS F V+NFI G SW+P +GV F + L
Sbjct  481  YKVITSAEEASEFTVANFIGGRSWLPATGVQFAAGL  516



>gb|KDP28190.1| hypothetical protein JCGZ_13961 [Jatropha curcas]
Length=430

 Score =   281 bits (720),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 163/213 (77%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGP  HQAVA+   SD + FY+CS  GYQDTLYVHSLRQFYR+C +YGTIDFIFGN
Sbjct  213  FENSAGPSMHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGN  272

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA V QNC+++ ++P ++Q N++TAQGR+DPN+NTGISILN +V    +L       K++
Sbjct  273  AAVVFQNCNLYARQPNENQKNIVTAQGREDPNQNTGISILNCKVAAAADLIPVKSSFKTY  332

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+I + +D LIDP GW+EW+GDFAL TLYYGEYMN G G++T  RV WP
Sbjct  333  LGRPWKEYSRTVYITSYIDDLIDPAGWLEWNGDFALKTLYYGEYMNRGPGSNTSGRVTWP  392

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+ ++    EAS F V  FIQG  W+  +GVPF
Sbjct  393  GYRVINNSAEASQFAVEPFIQGSEWLNATGVPF  425



>gb|KHN42767.1| Pectinesterase 2 [Glycine soja]
Length=444

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 161/213 (76%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFYRC+ +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  226  FRNTAGPENHQAVALRCGADLSVFYRCAFEGYQDTLYVHSQRQFYKECNIYGTVDFIFGN  285

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA V Q+C+I+ ++PM  Q N ITAQGR DPN+NTGI I NSRV+   +L       K+F
Sbjct  286  AAVVFQSCNIYARRPMQKQKNAITAQGRTDPNQNTGICIQNSRVMAAEDLVPVLSSFKTF  345

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF++T LD L+DP GW+EW GDFAL TLYYGEY N G   ST+ RV W 
Sbjct  346  LGRPWREYSRTVFLQTYLDLLVDPAGWLEWKGDFALHTLYYGEYKNLGPRGSTRGRVKWG  405

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+H +    EAS F V NFI G SW+P +G+PF
Sbjct  406  GYHAITSATEASKFTVENFIAGKSWLPATGIPF  438



>gb|AFW03484.1| pectin methylesterase 5 [Gossypium hirsutum]
Length=519

 Score =   284 bits (727),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 166/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP  HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C IYGT+D+IFGN
Sbjct  304  FRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGN  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNC+I+ + P  +++N +TAQGR DPN+NTGI I NSRV    +L+     VK++
Sbjct  364  AAVVFQNCNIYARNP-PNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTY  422

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P  WMEW G+FAL TLYY EYMNTG G+ST NRV W 
Sbjct  423  LGRPWKQYSRTVFMKTYLDSLINPADWMEWDGNFALKTLYYAEYMNTGPGSSTSNRVKWG  482

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H+L+   E S F V NF+ G+SW+P +GVPF S L
Sbjct  483  GYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>emb|CDP20872.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/217 (63%), Positives = 168/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFY +C +YGT+D+IFGN
Sbjct  303  FRNTAGPQNHQAVALRSGSDLSVFYQCSFEGYQDTLYVHSQRQFYSECDVYGTVDYIFGN  362

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNC+++ + P  ++ N ITAQGR DPN+NTGISI NSRV    +L+     VK++
Sbjct  363  AAVVFQNCNLYSRNP-PNKINTITAQGRTDPNQNTGISIHNSRVTAASDLKPVQSSVKTY  421

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LDGLIDP GW+ WSG+FAL TLYYGEY NTG G+ST NRV+W 
Sbjct  422  LGRPWQQYSRTVFMKTFLDGLIDPAGWLPWSGNFALDTLYYGEYANTGPGSSTANRVSWK  481

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+HL+    EAS F V NFI G+SW+P + VPF S L
Sbjct  482  GYHLITSATEASKFTVGNFIAGNSWLPATNVPFTSGL  518



>ref|XP_009133718.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Brassica rapa]
Length=510

 Score =   283 bits (725),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 165/217 (76%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYRDC +YGT+DFIFGN
Sbjct  296  FRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGN  355

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR DPN+NTGI I NSRV    +LR   G  K++
Sbjct  356  AAAVLQNCNIFARRPR-SRTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTY  414

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP+GW+EW G+FALSTL+Y E+ NTG GAST  RV WP
Sbjct  415  LGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALSTLFYAEFQNTGPGASTSGRVTWP  474

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +L    EAS F V +F+ G SWIP S VPF S L
Sbjct  475  GFRVLSSTSEASRFTVGSFLAGSSWIP-SDVPFTSGL  510



>ref|XP_004150118.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 6-like 
[Cucumis sativus]
 gb|KGN51481.1| hypothetical protein Csa_5G568300 [Cucumis sativus]
Length=539

 Score =   284 bits (727),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGPEKHQAVA+   +D ++FYRCS KGYQDTLY HS RQFYR+CHIYGT+DFIFG+
Sbjct  323  FENTAGPEKHQAVALRSNADRSIFYRCSFKGYQDTLYAHSNRQFYRECHIYGTVDFIFGD  382

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGV-KSF  358
               V QNC+IFV+KPM +Q N ITAQ R DPNEN+G  I NS +   P+L+   G+  ++
Sbjct  383  GVVVFQNCNIFVRKPMLNQKNTITAQARSDPNENSGFVIHNSVIGAAPDLKPVQGLYGTY  442

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ YSRTV +K+ +DGLI+P GW+ W+GDF L T+YYGE+MNTG GA+T+ RV WP
Sbjct  443  LGRPWKAYSRTVIMKSYMDGLIEPAGWLPWAGDFGLRTVYYGEFMNTGDGANTKGRVEWP  502

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EA  F V +F++G  WIP +GVPF + L
Sbjct  503  GYHVMTSAVEAERFTVESFLEGGGWIPATGVPFVNGL  539



>emb|CDX95641.1| BnaC03g25220D [Brassica napus]
Length=445

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 164/217 (76%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYRDC +YGT+DFIFGN
Sbjct  231  FRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGN  290

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR DPN+NTGI I NSRV    +LR   G  K++
Sbjct  291  AAAVLQNCNIFARRPR-SRTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTY  349

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP+GW+EW G+FAL TL+Y E+ NTG GAST  RV WP
Sbjct  350  LGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTSGRVTWP  409

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +L    EAS F V +F+ G SWIP S VPF S L
Sbjct  410  GFRVLSSTSEASRFTVGSFLAGSSWIP-SDVPFTSGL  445



>gb|KEH29125.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=509

 Score =   283 bits (724),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 163/216 (75%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA    SD +VFY+CS +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  296  FRNTAGAANHQAVAFRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECNIYGTVDFIFGN  355

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQNC+IF + P   ++  +TAQGR DPN+NTGI I NSRV    +L     VKS+L
Sbjct  356  AAVVLQNCNIFARNP-PAKTITVTAQGRTDPNQNTGIIIHNSRVSAQSDLNPSS-VKSYL  413

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW+KYSRTVF+KT LDG I+P GW+ W G+FAL TLYY EY NTG+G+ST NRV W G
Sbjct  414  GRPWQKYSRTVFMKTVLDGFINPAGWLPWDGNFALDTLYYAEYANTGSGSSTSNRVTWKG  473

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H+L    +ASPF V NFI G+SWI  +GVPF S L
Sbjct  474  YHVLTSASQASPFTVGNFIAGNSWIGNTGVPFTSGL  509



>ref|XP_006355816.1| PREDICTED: pectinesterase-like [Solanum tuberosum]
Length=479

 Score =   282 bits (721),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 164/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN AGP KHQAVA+   SD + FY+CS   YQDTLYVHSLRQFYR+C +YGT+DFIFGN
Sbjct  260  FENYAGPSKHQAVALRSGSDLSAFYQCSFVAYQDTLYVHSLRQFYRNCDVYGTVDFIFGN  319

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC+++ +KP  +Q NL TAQGR+DPN+NTGISILN +V    +L       K++
Sbjct  320  AAVVLQNCNLYARKPNPNQKNLFTAQGREDPNQNTGISILNCKVEAASDLVPVLSSFKNY  379

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV + +++  LIDP GW+EWSGDFAL+TLYYGEY+N G G++T  RV WP
Sbjct  380  LGRPWKQYSRTVILFSNIGSLIDPAGWLEWSGDFALNTLYYGEYLNRGPGSNTSARVKWP  439

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V NFIQG  WIP + VPF S L
Sbjct  440  GYRVINSSTEASQFTVGNFIQGSEWIPATEVPFYSGL  476



>ref|XP_010548770.1| PREDICTED: pectinesterase-like [Tarenaya hassleriana]
Length=572

 Score =   285 bits (728),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/211 (62%), Positives = 164/211 (78%), Gaps = 1/211 (0%)
 Frame = +2

Query  8    NTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGNAA  187
            NTAG  KHQAVAV  ++D + F+RCS + YQDTLYVHSLRQFY++C I+GT+DF+FGNAA
Sbjct  356  NTAGAAKHQAVAVRTSADMSAFFRCSFEAYQDTLYVHSLRQFYKECEIFGTVDFVFGNAA  415

Query  188  AVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGG-GVKSFLG  364
            AV Q+C+IF + P+  Q N ITAQGR DPN+NTGISI N  + P+ EL  G   V+++LG
Sbjct  416  AVFQSCNIFPRLPLQGQFNAITAQGRTDPNQNTGISIQNCTIKPSTELVSGNFPVQTYLG  475

Query  365  RPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPGF  544
            RPW++YSRTV+++  +DGLIDPKGW EW GDFAL TLYY E+ NTG G+ T NRV WPG+
Sbjct  476  RPWKEYSRTVYLQNFMDGLIDPKGWTEWMGDFALKTLYYAEFKNTGPGSDTTNRVTWPGY  535

Query  545  HLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            H++   DEA  F VS FI GDSW+P +GVPF
Sbjct  536  HVIVNEDEAESFTVSKFIVGDSWLPVTGVPF  566



>ref|XP_008343201.1| PREDICTED: pectinesterase 2 [Malus domestica]
Length=511

 Score =   283 bits (723),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 167/217 (77%), Gaps = 4/217 (2%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAG    QAVA+   SD +VFY+CS +G QDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  298  FENTAGLTSGQAVALRSGSDLSVFYKCSFEGNQDTLYVHSERQFYRECDIYGTVDFIFGN  357

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V+QN +I+V    +H++N +TAQGR DPN+NTGISI N +V    +L+     VK++
Sbjct  358  AAVVIQNSNIYVH---NHKTNTVTAQGRTDPNQNTGISIHNCKVTAASDLKPVQSSVKTY  414

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P GWMEWSGDFAL TLYYGEYMNTG GAST+NRV+W 
Sbjct  415  LGRPWKQYSRTVFMKTYLDSLINPAGWMEWSGDFALKTLYYGEYMNTGPGASTKNRVSWA  474

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V NFI G SW+P + VPF S L
Sbjct  475  GYHVITSASEASEFSVGNFIAGGSWLPATNVPFTSGL  511



>ref|XP_010464090.1| PREDICTED: pectinesterase-like [Camelina sativa]
Length=558

 Score =   284 bits (727),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 165/215 (77%), Gaps = 2/215 (1%)
 Frame = +2

Query  8    NTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGNAA  187
            NTAGP KHQAVAV  ++D + FY+CS +GYQDTLYVHSLRQFYR+C IYGT+DFIFGNAA
Sbjct  344  NTAGPNKHQAVAVRNSADMSAFYKCSFEGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAA  403

Query  188  AVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGG-GVKSFLG  364
             VLQNC+I  + P+  Q N ITAQGR DPN+NTGISI N R+ P+ EL      VK++LG
Sbjct  404  TVLQNCNIIPRLPVQGQFNAITAQGRSDPNQNTGISIQNCRITPSAELVTSNFSVKTYLG  463

Query  365  RPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPGF  544
            RPW++YSRTV+++  +DG ID KGW EW GDFALSTLYY E+ NTG G+ T NRVNWPG+
Sbjct  464  RPWKEYSRTVYLQNFMDGFIDGKGWNEWMGDFALSTLYYAEFKNTGPGSETANRVNWPGY  523

Query  545  HLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            H++ +  EA  F VS FI GDSW+P  GVP+   L
Sbjct  524  HVITE-TEAVWFTVSKFIVGDSWLPNMGVPYAGGL  557



>ref|XP_006293950.1| hypothetical protein CARUB_v10022941mg, partial [Capsella rubella]
 gb|EOA26848.1| hypothetical protein CARUB_v10022941mg, partial [Capsella rubella]
Length=546

 Score =   284 bits (726),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 165/217 (76%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYRDC IYGT+DFIFGN
Sbjct  332  FRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDIYGTVDFIFGN  391

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR DPN+NTGI I NSRV    +LR   G  K++
Sbjct  392  AAAVLQNCNIFARRPRS-KTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTY  450

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP+GW+EW+G+FAL TL+Y E+ NTG GAST +RV WP
Sbjct  451  LGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALKTLFYAEFQNTGPGASTSSRVTWP  510

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +L    EAS F V  F+ G SWIP S VPF S L
Sbjct  511  GFRVLGSASEASKFTVGTFLAGGSWIPSS-VPFTSGL  546



>gb|KHN43496.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=481

 Score =   282 bits (721),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 165/215 (77%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGP KHQAVA+   SD + FY+CS   YQDTLYVHSLRQFYRDC +YGT+DFIFGN
Sbjct  264  FENSAGPSKHQAVALRSGSDFSAFYKCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGN  323

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQNC+++ +KP ++Q NL TAQGR+DPN+NTGISILN +V    +L       K++
Sbjct  324  AATVLQNCNLYARKPNENQRNLFTAQGREDPNQNTGISILNCKVAAAADLIPVKSQFKNY  383

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV++ + ++ LIDPKGW+EW+G FAL TLYYGEY N G G++T  RV WP
Sbjct  384  LGRPWKKYSRTVYLNSYMEDLIDPKGWLEWNGTFALDTLYYGEYNNRGPGSNTSARVTWP  443

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            G+ +++   EA+ F V NFIQG+ W+  + +PF S
Sbjct  444  GYRVIKNATEANQFTVRNFIQGNEWLSSTDIPFFS  478



>ref|XP_011034009.1| PREDICTED: pectinesterase 2 [Populus euphratica]
Length=514

 Score =   283 bits (723),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 133/217 (61%), Positives = 167/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG + HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  299  FRNTAGAKNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSQRQFYRECDIYGTVDFIFGN  358

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNC+I+ + P  +++N +TAQGR DPN+NTGISI N +V    +L+     VK++
Sbjct  359  AAVVFQNCNIYARNP-PNKTNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTY  417

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LD LI+  GWM WSG+FAL TLYYGEYMNTG G+ST NRVNW 
Sbjct  418  LGRPWQKYSRTVFMKTYLDSLINSAGWMPWSGNFALDTLYYGEYMNTGPGSSTANRVNWK  477

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++     AS F V+NFI G++W+P + VPF + L
Sbjct  478  GYHVITSASVASQFTVANFISGNNWLPATKVPFTAGL  514



>ref|XP_010257625.1| PREDICTED: pectinesterase 2-like [Nelumbo nucifera]
Length=527

 Score =   283 bits (724),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 166/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP   QAVA+   SD +VFYRC   GYQDTLYVHS RQFY+ C+IYGTIDFIFGN
Sbjct  312  FRNTAGPLS-QAVALVSGSDLSVFYRCGFIGYQDTLYVHSQRQFYKQCYIYGTIDFIFGN  370

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I  ++P+  Q+N+ITAQGR DP++NTGISI  SRVI + +LR     VK+F
Sbjct  371  AAVVLQNCMIVARRPLHGQANVITAQGRSDPHQNTGISIHKSRVIASSDLRPVLSSVKTF  430

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV+++T LDGL+DP GW+EW G FAL+TLYYGEY N G G+ST  RV W 
Sbjct  431  LGRPWQQYSRTVYLQTYLDGLVDPAGWLEWGGSFALNTLYYGEYKNIGPGSSTARRVKWR  490

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++R P EAS F V NFI G SW+P +GVPF S L
Sbjct  491  GYRVIRNPSEASLFTVGNFISGRSWLPGTGVPFTSGL  527



>ref|XP_004155863.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
Length=227

 Score =   273 bits (698),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 160/216 (74%), Gaps = 4/216 (2%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG + HQAVA+   SD +VFYRC  +GYQDTLYV++ RQFY+ C IYGT+DFIFGN
Sbjct  16   FRNTAGAKNHQAVALRSGSDLSVFYRCGFEGYQDTLYVYAERQFYKQCDIYGTVDFIFGN  75

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQ+C+I  + P +    L TAQGR DPN+NTGISI N R+  +  L G   VK++L
Sbjct  76   AAVVLQDCNIIARDPPNKTITL-TAQGRSDPNQNTGISIHNCRITSSGGLSG---VKAYL  131

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPWR+YSRTV +K+ + G I P GWM WSG+FAL+TLYY EYMNTG GAST NRVNW G
Sbjct  132  GRPWRQYSRTVVMKSSIGGFISPAGWMPWSGNFALNTLYYAEYMNTGPGASTANRVNWKG  191

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H++    EAS F V NFI G SW+P +GVPF S L
Sbjct  192  YHVITSASEASKFTVGNFIAGGSWLPSTGVPFTSGL  227



>gb|AER38244.1| PME5 [Gossypium barbadense]
Length=519

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/217 (62%), Positives = 165/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP  HQAVA+   SD +VFY+CS +GYQDTLYVHS RQFYR+C IYGT+D+IFGN
Sbjct  304  FRNTAGPTNHQAVALRSGSDLSVFYKCSFEGYQDTLYVHSERQFYRECDIYGTVDWIFGN  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNC+I+ + P  +++N +TAQGR DPN+NTGI I NSRV    +L+     VK++
Sbjct  364  AAVVFQNCNIYARNP-PNKTNTVTAQGRTDPNQNTGIIIHNSRVTAASDLKPVQSSVKTY  422

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+P GWMEW  DFA  TLYY EYMNTG G+ST NRV W 
Sbjct  423  LGRPWKQYSRTVFMKTYLDSLINPAGWMEWDDDFAPKTLYYAEYMNTGPGSSTSNRVKWG  482

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H+L+   E S F V NF+ G+SW+P +GVPF S L
Sbjct  483  GYHVLKSASEVSKFTVGNFLAGNSWLPSTGVPFTSGL  519



>ref|XP_009599511.1| PREDICTED: pectinesterase 2-like [Nicotiana tomentosiformis]
Length=522

 Score =   283 bits (723),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/217 (62%), Positives = 166/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+  QAVA+   SD +VFY+CS +GYQDTL  HS RQFYRDC IYGT+DFIFGN
Sbjct  307  FRNTAGPKNGQAVALRSGSDLSVFYQCSFEGYQDTLCAHSQRQFYRDCDIYGTVDFIFGN  366

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+IF + P   + N +TAQGR DPN+NTGISI N RV P+ +L+     VK++
Sbjct  367  AAVVLQNCNIFARNP-PSRINTVTAQGRSDPNQNTGISIHNCRVTPSSDLKPYQNSVKTY  425

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV +KT LD LIDP GWM W+G FAL TLYYGEY+N+G+G+ST NRVNWP
Sbjct  426  LGRPWQQYSRTVIMKTFLDSLIDPAGWMPWTGTFALKTLYYGEYLNSGSGSSTANRVNWP  485

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F  +NFI G+SW+P + VPF S L
Sbjct  486  GYRVIYSAAEASKFTPANFIAGNSWLPATNVPFKSNL  522



>ref|XP_009388374.1| PREDICTED: pectinesterase-like, partial [Musa acuminata subsp. 
malaccensis]
Length=239

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
             EN AGP K QAVA+ V +D + FY+CS  GYQDTLYVHSLRQFYR+C +YGTIDFIFG+
Sbjct  22   IENAAGPSKLQAVALRVGADLSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTIDFIFGD  81

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQNC+++ +KPM +Q N+ TAQGR+DPN+NTGISI   +V    +L        ++
Sbjct  82   AAVVLQNCNLYARKPMSNQQNVFTAQGREDPNQNTGISIHKCKVAAAADLIPVQSNFSTY  141

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+++SRTVF+++ LD LIDP GW+EW+GDFAL+TLYYGEYMN G G++T  RV WP
Sbjct  142  LGRPWKEFSRTVFMQSYLDNLIDPAGWLEWNGDFALNTLYYGEYMNRGPGSNTTGRVKWP  201

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V++FIQGD W+  + VPF S L
Sbjct  202  GYRVINSTAEASNFTVTSFIQGDQWLGSTSVPFTSGL  238



>ref|XP_010044212.1| PREDICTED: pectinesterase [Eucalyptus grandis]
Length=552

 Score =   283 bits (724),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP+KHQAVA+   SD +VFY CS KGYQDTLYV++ RQFYRDC IYGT DFIFG+
Sbjct  336  FQNTAGPQKHQAVALRSGSDFSVFYSCSFKGYQDTLYVYAQRQFYRDCDIYGTQDFIFGD  395

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            A  VLQNC+I+++KP+  Q N +TAQGR DPNENTGI + NSRV  + +++   G  K++
Sbjct  396  AVTVLQNCNIYIRKPISGQINTVTAQGRSDPNENTGIIVHNSRVTASSDMKPVQGSFKNY  455

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF++T LD LI P+GW  WSG FALSTLYYGEYMNTG GA T  RVNWP
Sbjct  456  LGRPWQKYSRTVFMRTFLDSLIAPQGWYPWSGSFALSTLYYGEYMNTGGGAGTGGRVNWP  515

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H      EA+ F V NF+ G+SW+P +GVPF + L
Sbjct  516  GYHATMSATEAAKFTVGNFLAGNSWLPATGVPFSAGL  552



>ref|XP_011090444.1| PREDICTED: pectinesterase 2 [Sesamum indicum]
Length=531

 Score =   282 bits (722),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 165/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG + HQAVA    SD +VFY+CS +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  316  FRNTAGAQNHQAVAFRSGSDLSVFYQCSFEGYQDTLYVHSERQFYRECDIYGTVDFIFGN  375

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNC+I+ + P  +++N +TAQGR DPN+NTGISI N RV   P+LR   G VK++
Sbjct  376  AAVVFQNCNIYPRNP-PNKTNTLTAQGRTDPNQNTGISIHNCRVTAAPDLRPVQGSVKTY  434

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTVF+KT LD LI+P GWM WSG+FAL TLYYGEY NTG G+ST NRV W 
Sbjct  435  LGRPWQKYSRTVFMKTFLDSLINPAGWMPWSGNFALDTLYYGEYANTGPGSSTANRVKWK  494

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F   +FI  +SWIP + VPF S L
Sbjct  495  GYHVITSASEASRFTPGSFIAANSWIPATNVPFTSGL  531



>ref|XP_010506460.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17 
[Camelina sativa]
Length=510

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 163/217 (75%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS +GYQDTLYVHS RQFYRDC +YGT+DFIFGN
Sbjct  296  FRNTAGANNAQAVALRSGSDLSVFYQCSFEGYQDTLYVHSNRQFYRDCDVYGTVDFIFGN  355

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR DPN+NTGI I NSRV    +LR   G  K++
Sbjct  356  AAAVLQNCNIFARRPR-SKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTY  414

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP+GW+EW G+FAL TL+Y E+ NTG GAST  RV WP
Sbjct  415  LGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALRTLFYAEFQNTGPGASTSGRVTWP  474

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +L    EAS F V  F+ G SWIP S VPF S L
Sbjct  475  GFRVLGSASEASKFTVGTFLAGSSWIPSS-VPFTSGL  510



>ref|XP_006396440.1| hypothetical protein EUTSA_v10028546mg [Eutrema salsugineum]
 gb|ESQ37893.1| hypothetical protein EUTSA_v10028546mg [Eutrema salsugineum]
Length=566

 Score =   283 bits (725),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 171/217 (79%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPEKHQAVA+  ++D ++FY CS + YQDTLY HSLRQFYR+C IYGT+DFIFGN
Sbjct  349  FRNTAGPEKHQAVALRSSADLSIFYSCSFEAYQDTLYTHSLRQFYRECDIYGTVDFIFGN  408

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGG-GVKSF  358
            AA VLQNC+++ ++P+ +Q N ITAQGR DPN+NTG SI N  + P  +L      VK++
Sbjct  409  AAVVLQNCNLYPRQPLQNQFNAITAQGRTDPNQNTGTSIHNCTIRPAGDLVSSNYTVKTY  468

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ +DG ++P GW EW+GDFALSTLYYGEY NTG+G++T NRV WP
Sbjct  469  LGRPWKEYSRTVFMQSYMDGFVEPVGWREWNGDFALSTLYYGEYNNTGSGSNTTNRVVWP  528

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++   D AS F VSNF+ GD W+ +SGVP+ + L
Sbjct  529  GYHVINSTD-ASNFTVSNFLFGDEWMVQSGVPYLAGL  564



>ref|XP_004143735.1| PREDICTED: pectinesterase 2-like [Cucumis sativus]
 gb|KGN50327.1| hypothetical protein Csa_5G167190 [Cucumis sativus]
Length=520

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 172/217 (79%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   +D +VF+RC  +GYQDTLYVHS RQFYR+C+IYGT+DFIFGN
Sbjct  304  FRNTAGPQNHQAVALRSGADLSVFFRCGFEGYQDTLYVHSQRQFYRECYIYGTVDFIFGN  363

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            +A VLQNC I+ +KPM  Q  ++TAQGR DPN+NTGISI NSRV+ T +L+     V+++
Sbjct  364  SAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGISIHNSRVMATDDLKPVIKSVRTY  423

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV++++ +D L++P GW+EWSG+FAL+TLYYGE+ N+G G+ST NRV W 
Sbjct  424  LGRPWKEYSRTVYLQSFMDSLVNPAGWLEWSGNFALNTLYYGEFKNSGPGSSTANRVKWK  483

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EA+ F V +FI G+SW+P +GVPF + L
Sbjct  484  GYRVITSASEAAKFTVGSFIAGNSWLPGTGVPFTAGL  520



>gb|ACN40984.1| unknown [Picea sitchensis]
Length=601

 Score =   284 bits (727),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 166/215 (77%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAG  KHQAVA+ V SD + FYRCS +GYQDTLYVHSLRQFYR+C++YGT+DFIFGN
Sbjct  384  FENTAGAAKHQAVALRVGSDFSAFYRCSFQGYQDTLYVHSLRQFYRECNVYGTVDFIFGN  443

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQNC++F +KP+ +Q  + TAQGR DPNENTGISI N +VI   +L        ++
Sbjct  444  AAVVLQNCNLFARKPLANQQIVYTAQGRQDPNENTGISIQNCQVIAASDLIPVKRSFPAY  503

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+++ L  LI P GW+EW+G+FAL+TLYYGE+MN G GA   NRV WP
Sbjct  504  LGRPWRQYSRTVFMQSYLGDLIQPAGWLEWNGNFALNTLYYGEFMNRGPGAGVANRVRWP  563

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            G+  +R  +EA  F VS FI+GDSW+P +GV + S
Sbjct  564  GYRAIRSSNEAKQFTVSQFIKGDSWLPSTGVKYVS  598



>emb|CDY68840.1| BnaCnng60750D, partial [Brassica napus]
Length=435

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 169/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPEKHQAVA+  ++D ++FY CS + YQDTLY HSLRQFYR+C IYGT+DFIFGN
Sbjct  218  FRNTAGPEKHQAVALRSSADLSIFYSCSFEAYQDTLYTHSLRQFYRECDIYGTVDFIFGN  277

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGG-GVKSF  358
            AA VLQNC+++ ++P+ +Q N ITAQGR DPN+NTG SI N  + P  +L      VK++
Sbjct  278  AAVVLQNCNLYPRQPLPNQFNAITAQGRTDPNQNTGTSIHNCTIRPADDLASSNYTVKTY  337

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ +DG I+P GW EW+GDFALSTLYY EY NTG G+ST NRV WP
Sbjct  338  LGRPWKEYSRTVFMQSYMDGFIEPVGWREWNGDFALSTLYYAEYNNTGPGSSTTNRVVWP  397

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++   D A+ F VSNF+ GD W+ +SGVP+ + L
Sbjct  398  GYHVINSTD-ANNFTVSNFLFGDEWMVQSGVPYMAGL  433



>ref|XP_003526378.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 17-like 
[Glycine max]
Length=528

 Score =   282 bits (721),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 161/213 (76%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPE HQAVA+   +D +VFYRC+ +GYQDTLYVHS RQFY++C+IYGT+DFIFGN
Sbjct  310  FRNTAGPENHQAVALRCGADLSVFYRCAFEGYQDTLYVHSQRQFYKECNIYGTVDFIFGN  369

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA V Q+C+I+ ++PM  Q N ITAQGR DPN+NTGI I NSRV+   +L       K+F
Sbjct  370  AAVVFQSCNIYARRPMQKQKNAITAQGRTDPNQNTGICIQNSRVMAAEDLVPVLSSFKTF  429

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF++T LD L+DP GW+EW GDFAL TLYYGEY N G   ST+ RV W 
Sbjct  430  LGRPWREYSRTVFLQTYLDLLVDPAGWLEWKGDFALHTLYYGEYKNLGPRGSTRGRVKWG  489

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+H +    EAS F V NFI G SW+P +G+PF
Sbjct  490  GYHAITSATEASKFTVENFIAGKSWLPATGIPF  522



>ref|XP_003591484.1| Pectinesterase [Medicago truncatula]
 ref|XP_003591505.1| Pectinesterase [Medicago truncatula]
 gb|AES61735.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
 gb|KEH15892.1| pectinesterase/pectinesterase inhibitor [Medicago truncatula]
Length=315

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 165/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP KHQAVA+   +D + FY CS +GYQDTLY HSLRQFYR+C IYGT+DFIFGN
Sbjct  99   FRNTAGPSKHQAVALRSGADMSTFYSCSFEGYQDTLYTHSLRQFYRECDIYGTVDFIFGN  158

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
             A VLQNC+I+ + P+  Q N ITAQGR DPN+NTG SI N+ +    +L    G V+++
Sbjct  159  GAVVLQNCNIYPRLPLSGQFNSITAQGRTDPNQNTGTSIQNATIKAADDLAPKVGTVQTY  218

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ +D  I+P GW EW+GDFAL+TLYY EY N GAG+ST NRV WP
Sbjct  219  LGRPWKEYSRTVFMQSFMDSFINPAGWHEWNGDFALNTLYYAEYSNRGAGSSTVNRVTWP  278

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++   D A+ F VSNF+ GD WIP++GVP+ S L
Sbjct  279  GYHVIGATDAAN-FTVSNFLSGDDWIPQTGVPYSSGL  314



>ref|XP_006287360.1| hypothetical protein CARUB_v10000558mg [Capsella rubella]
 gb|EOA20258.1| hypothetical protein CARUB_v10000558mg [Capsella rubella]
Length=582

 Score =   283 bits (725),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 170/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGPEKHQAVA+  ++D ++FY CS + YQDTLY HSLRQFYR+C IYGT+DFIFGN
Sbjct  365  FRNTAGPEKHQAVALRSSADLSIFYSCSFEAYQDTLYTHSLRQFYRECDIYGTVDFIFGN  424

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGG-GVKSF  358
            AA V QNC+++ ++PM +Q N ITAQGR DPN+NTGISI N  + P  +L      VK++
Sbjct  425  AAVVFQNCNLYPRQPMQNQFNAITAQGRTDPNQNTGISIHNCTIRPADDLVSSNYTVKTY  484

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ +DG ++P GW EW+GDFALSTLYY EY NTG+G++T +RV WP
Sbjct  485  LGRPWKEYSRTVFMQSYMDGFVEPVGWREWNGDFALSTLYYAEYNNTGSGSNTTDRVVWP  544

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GFH++   D A+ F VSNF+ GD W+ +SGVP+ S L
Sbjct  545  GFHVINSTD-ANNFTVSNFLLGDGWMVQSGVPYLSGL  580



>emb|CBI24284.3| unnamed protein product [Vitis vinifera]
Length=259

 Score =   273 bits (698),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQ+VA+   SD +V+Y+CS +GYQDTLY +S RQFYR C IYGT+DFIFGN
Sbjct  44   FRNTAGASNHQSVALRSGSDLSVYYQCSFEGYQDTLYTYSERQFYRGCDIYGTVDFIFGN  103

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA V QNC+I+ + P  ++ N +TAQGR DPN+NTGISI + +V    +L+   G VK++
Sbjct  104  AAVVFQNCNIYARNP-PNKINTVTAQGRTDPNQNTGISIHDCKVTAASDLKPVQGSVKTY  162

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+  GW+EWSG+FAL+TLYYGEYMNTG G+ST  RV W 
Sbjct  163  LGRPWKEYSRTVFLKTYLDSLINSAGWLEWSGNFALNTLYYGEYMNTGDGSSTSGRVKWA  222

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EA+ F V NFI G+SW+P + VPF S L
Sbjct  223  GYHVITSSTEAAKFTVGNFISGNSWLPSTNVPFTSGL  259



>ref|XP_008386773.1| PREDICTED: pectinesterase-like, partial [Malus domestica]
Length=238

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 162/213 (76%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN AGP KHQAVA+   +D + FY+CS  GYQDTLYVHSLRQFYR+C +YGT+DFIFGN
Sbjct  20   FENGAGPSKHQAVALRSGADFSAFYKCSFVGYQDTLYVHSLRQFYRECDVYGTVDFIFGN  79

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQNC+++ +KP ++Q N+ TAQGR+DPN+NTGISILN +V    +L        ++
Sbjct  80   AAVVLQNCNLYARKPNENQKNIFTAQGREDPNQNTGISILNCKVTAGSDLIPVKSNFTTY  139

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV++K+ +D L+DP GW+EW+G FALSTLYYGEY+N G G++T  RV WP
Sbjct  140  LGRPWKEYSRTVYLKSYIDDLVDPAGWLEWNGSFALSTLYYGEYLNRGPGSNTSARVTWP  199

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+ ++    EAS F V  FIQG  W+  + +P+
Sbjct  200  GYRVINSSVEASQFTVGEFIQGSDWLNSTNIPY  232



>ref|XP_010921648.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=240

 Score =   272 bits (695),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 162/217 (75%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
             EN+AGP KHQAVA+ V +D + FYRCS  GYQDTLYVHSLRQFYRDC +YGT+DFIFG+
Sbjct  23   IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFYRDCDVYGTVDFIFGD  82

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA V QNC+++ +KP  +Q N+ TAQGR+DPN+NTGISI   +V    +L        ++
Sbjct  83   AAVVFQNCNLYARKPDPNQKNIFTAQGREDPNQNTGISIQKCKVAAASDLIPVQSNFSTY  142

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++ L  LI+P GW+EW GDFALSTLYYGEYMN G G++T  RV WP
Sbjct  143  LGRPWKQYSRTVFMQSYLGSLINPAGWLEWDGDFALSTLYYGEYMNLGPGSNTSRRVTWP  202

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V +FIQGD W+  + VPF S L
Sbjct  203  GYRVITSAAEASNFTVQSFIQGDQWLGATSVPFTSGL  239



>ref|XP_006604725.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 7-like 
[Glycine max]
 gb|KHN43497.1| Putative pectinesterase/pectinesterase inhibitor 7 [Glycine soja]
Length=562

 Score =   282 bits (722),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 167/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP KHQAVAV   +D + FY CS +GYQDTLY HSLRQFYR+C IYGT+DFIFGN
Sbjct  346  FRNTAGPSKHQAVAVRNGADMSTFYSCSFEGYQDTLYTHSLRQFYRECDIYGTVDFIFGN  405

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGG-VKSF  358
            AA VLQ C+++ + PM  Q N ITAQGR DPN+NTG SI N+ + P  +L    G VK++
Sbjct  406  AAVVLQTCNLYPRLPMSGQFNAITAQGRTDPNQNTGTSIHNATIKPAADLAPSVGIVKTY  465

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV++++ +D  I+P GW EWSGDFALSTLYY EY NTG G++T NRV WP
Sbjct  466  LGRPWKEYSRTVYMQSFMDSFINPSGWREWSGDFALSTLYYAEYNNTGPGSNTTNRVTWP  525

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++   D A+ F VSNF+ GD+W+P++GVP+ S L
Sbjct  526  GYHVINATDAAN-FTVSNFLDGDNWLPQTGVPYISGL  561



>ref|XP_004167644.1| PREDICTED: LOW QUALITY PROTEIN: probable pectinesterase/pectinesterase 
inhibitor 6-like [Cucumis sativus]
Length=539

 Score =   281 bits (720),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 164/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FENTAGPEKHQAVA+   +D ++FYRCS KGYQDTLY HS RQFYR+CHIYGT+DFIFG+
Sbjct  323  FENTAGPEKHQAVALRSNADRSIFYRCSFKGYQDTLYAHSNRQFYRECHIYGTVDFIFGD  382

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGV-KSF  358
               V QNC+IFV+KPM    N ITAQ R DPNEN+G  I NS +   P+L+   G+  ++
Sbjct  383  GVVVFQNCNIFVRKPMXEPKNTITAQARSDPNENSGFVIHNSVIGAAPDLKPVQGLYGTY  442

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ YSRTV +K+ +DGLI+P GW+ W+GDF L T+YYGE+MNTG GA+T+ RV WP
Sbjct  443  LGRPWKAYSRTVIMKSYMDGLIEPAGWLPWAGDFGLRTVYYGEFMNTGDGANTKGRVEWP  502

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EA  F V +F++G  WIP +GVPF + L
Sbjct  503  GYHVMTSAVEAERFTVESFLEGGGWIPATGVPFVNGL  539



>gb|KCW73020.1| hypothetical protein EUGRSUZ_E01454 [Eucalyptus grandis]
Length=480

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  265  FRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGN  324

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+I+ + P  ++ N +TAQGR DPN+NTGISI N +V    +L+     VK++
Sbjct  325  AAVVLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTY  383

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+  GWMEW G+FAL TLYYGEY+NTG G+ST +RV W 
Sbjct  384  LGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGPGSSTASRVTWA  443

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V +FI G SW+P +GVP+ S L
Sbjct  444  GYHVITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  480



>ref|XP_004290811.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 40-like 
[Fragaria vesca subsp. vesca]
Length=567

 Score =   282 bits (721),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 125/213 (59%), Positives = 163/213 (77%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGP KHQAVA+   SD + FY+CS  GYQDTLYVHSLRQFYR+C IYGT+DFIFGN
Sbjct  350  FENSAGPSKHQAVALRSGSDLSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  409

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA V QNC+++ +KP D Q N+ TAQGR+DPN+NTGISILN +V    +L       K++
Sbjct  410  AAVVFQNCNLYARKPNDGQKNIFTAQGREDPNQNTGISILNCKVTAASDLIPVKSTFKTY  469

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV++++++D  +DP GW+EW+G FALSTLYYGEY+N G G+ T  RV WP
Sbjct  470  LGRPWKEYSRTVYLRSNIDDTVDPAGWLEWNGTFALSTLYYGEYLNRGNGSGTTARVTWP  529

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+ ++    EAS F V  FIQG+ W+  +G+P+
Sbjct  530  GYRVINNSTEASQFTVGAFIQGNEWLNSTGIPY  562



>gb|KHN24739.1| Putative pectinesterase/pectinesterase inhibitor 7, partial [Glycine 
soja]
Length=501

 Score =   280 bits (716),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 168/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP KHQAVAV   +D + FY CS +GYQDTLY HSLRQFYR+C IYGT+DFIFGN
Sbjct  285  FQNTAGPSKHQAVAVRNGADMSTFYSCSFEGYQDTLYTHSLRQFYRECDIYGTVDFIFGN  344

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQ C+++ + PM  Q N ITAQGR DPN+NTG SI N+ + P  +L    G V+++
Sbjct  345  AAVVLQTCNLYPRLPMSGQFNAITAQGRTDPNQNTGTSIHNATIKPADDLAPSVGTVQTY  404

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV++++ ++  I+P GW EWSGDFALSTLYY EY NTG G++T NRV WP
Sbjct  405  LGRPWKEYSRTVYMQSFMNSFINPSGWHEWSGDFALSTLYYAEYNNTGPGSNTANRVTWP  464

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++   D A+ F VSNF+ GDSW+P++GVP+ + L
Sbjct  465  GYHVINATDAAN-FTVSNFLDGDSWLPQTGVPYVTGL  500



>gb|KHN08672.1| Putative pectinesterase/pectinesterase inhibitor 40 [Glycine 
soja]
Length=471

 Score =   279 bits (714),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 164/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGP+KHQAVA+   +D + FY+CS  GYQDTLYVHSLRQFYR+C IYGT+DFIFGN
Sbjct  254  FENSAGPDKHQAVALRSGADFSAFYQCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  313

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA V QNC+++ +KP ++Q NL TAQGR+DPN+NTGISILN ++    +L       KS+
Sbjct  314  AAVVFQNCNLYARKPNENQKNLFTAQGREDPNQNTGISILNCKIAAAADLIPVKSSFKSY  373

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ YSRTV +K+ ++ LIDP GW+EW+  FAL TLYYGEYMN G GA+T  RV WP
Sbjct  374  LGRPWKMYSRTVVLKSFVEDLIDPAGWLEWNETFALDTLYYGEYMNRGPGANTNGRVTWP  433

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EA+ F V  FIQG+ W+  +G+PF S L
Sbjct  434  GYRVINSSTEATQFTVGQFIQGNDWLNSTGIPFFSGL  470



>ref|XP_006433466.1| hypothetical protein CICLE_v10003641mg [Citrus clementina]
 ref|XP_006472136.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 41-like 
[Citrus sinensis]
 gb|ESR46706.1| hypothetical protein CICLE_v10003641mg [Citrus clementina]
 gb|KDO81782.1| hypothetical protein CISIN_1g008293mg [Citrus sinensis]
Length=571

 Score =   282 bits (721),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/217 (60%), Positives = 165/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP KHQAVAV   +D + FY CS +GYQDTLY HSLRQFYRDC IYGTIDFIFGN
Sbjct  354  FRNTAGPTKHQAVAVRNGADKSTFYSCSFEGYQDTLYAHSLRQFYRDCDIYGTIDFIFGN  413

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA V QNC+++ ++P+D+Q N ITAQGR DPN+NTGISI N  +    +L       +++
Sbjct  414  AAVVFQNCNMYPRRPLDNQFNAITAQGRTDPNQNTGISIHNCTIKAADDLANSINATQTY  473

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV++++ +D LIDP GW EWSGDFAL+T YY E+ NTG G+ T NRV WP
Sbjct  474  LGRPWKEYSRTVYMQSFMDSLIDPAGWKEWSGDFALNTTYYAEFSNTGPGSDTTNRVTWP  533

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++   D A  F VS+FI+GD+W+PE+GVPF   L
Sbjct  534  GYHVINDTD-AECFTVSSFIEGDAWLPETGVPFDGDL  569



>emb|CDX68522.1| BnaC01g26000D [Brassica napus]
Length=250

 Score =   271 bits (694),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN AGP KHQAVA+ + +DHAV YRC++ GYQDTLYVHS RQF+R+C IYGT+DFIFGN
Sbjct  32   FENWAGPAKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGN  91

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC I+ +KPMD Q N ITAQ R DPN+NTGISI  SRV+ TP+L+   G ++++
Sbjct  92   AAVVLQNCSIYARKPMDLQKNTITAQNRKDPNQNTGISIHASRVLATPDLQATNGTIQTY  151

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ +SRTV++ T +   +  +GW+EW+  FAL TLYYGEY+N+G G++   RVNWP
Sbjct  152  LGRPWKLFSRTVYMLTYIGSHVHTRGWLEWNTTFALDTLYYGEYLNSGPGSNLSQRVNWP  211

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EA+ F V+ FI G SW+P +GV F + L
Sbjct  212  GYRVINSTAEANRFTVTEFIYGSSWLPSTGVSFLAGL  248



>emb|CDX83076.1| BnaA01g20760D [Brassica napus]
Length=250

 Score =   271 bits (694),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN AGP KHQAVA+ + +DHAV YRC++ GYQDTLYVHS RQF+R+C IYGT+DFIFGN
Sbjct  32   FENWAGPAKHQAVALRIGADHAVIYRCNIIGYQDTLYVHSNRQFFRECDIYGTVDFIFGN  91

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC I+ +KPMD Q N ITAQ R DPN+NTGISI  SRV+ TP+L+   G ++++
Sbjct  92   AAVVLQNCSIYARKPMDLQKNTITAQNRKDPNQNTGISIHASRVLATPDLQATNGTIQTY  151

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ +SRTV++ T +   +  +GW+EW+  FAL TLYYGEY+N+G G++   RVNWP
Sbjct  152  LGRPWKLFSRTVYMLTYIGSHVHTRGWLEWNTTFALDTLYYGEYLNSGPGSNLSQRVNWP  211

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EA+ F V+ FI G SW+P +GV F + L
Sbjct  212  GYRVINSTAEANRFTVTEFIYGSSWLPSTGVSFLAGL  248



>ref|XP_003591498.1| Pectinesterase [Medicago truncatula]
Length=335

 Score =   275 bits (702),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP KHQAVA+   +D + FY CS +GYQDTLY HSLRQFYR+C IYGT+DFIFGN
Sbjct  119  FRNTAGPSKHQAVALRSGADMSTFYSCSFEGYQDTLYTHSLRQFYRECDIYGTVDFIFGN  178

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
             A VLQNC+I+ + P+  Q N ITAQGR DPN+NTG SI N+ +    +L    G V+++
Sbjct  179  GAVVLQNCNIYPRLPLSGQFNSITAQGRTDPNQNTGTSIQNATIKAADDLAPKVGTVQTY  238

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+++  D  I+P GW EW+GDFAL+TLYY EY N GAG+ST NRV WP
Sbjct  239  LGRPWKEYSRTVFMQSFTDSFINPAGWHEWNGDFALNTLYYAEYGNRGAGSSTVNRVTWP  298

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++   D A+ F VSNF+ GD WIP++GVP+ S L
Sbjct  299  GYHVIGATDAAN-FTVSNFLSGDDWIPQTGVPYSSGL  334



>ref|NP_001042866.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAD45460.1| putative pectinesterase [Oryza sativa Japonica Group]
 dbj|BAF04780.1| Os01g0312500 [Oryza sativa Japonica Group]
 dbj|BAG97493.1| unnamed protein product [Oryza sativa Japonica Group]
Length=426

 Score =   278 bits (710),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 126/213 (59%), Positives = 164/213 (77%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
             EN+AGP KHQAVA+ V +D + FYRCS  GYQDTLYVHSLRQF+R+C IYGTIDFIFGN
Sbjct  210  IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYVHSLRQFFRECDIYGTIDFIFGN  269

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            +A V Q+C+++ ++P+ +QSN+ TAQGR+DPN+NTGISI   +V    +L       K++
Sbjct  270  SAVVFQSCNLYARRPLPNQSNVYTAQGREDPNQNTGISIQKCKVAAASDLLAVQSSFKTY  329

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF++++LD +++P GW+EWSG+FAL TLYYGEY NTG GAST NRV W 
Sbjct  330  LGRPWKQYSRTVFMQSELDSVVNPAGWLEWSGNFALDTLYYGEYQNTGPGASTSNRVKWK  389

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+ ++    EAS F V NFI GD W+  + VPF
Sbjct  390  GYRVITSASEASTFTVGNFIDGDVWLAGTSVPF  422



>ref|NP_566038.1| putative pectinesterase/pectinesterase inhibitor 17 [Arabidopsis 
thaliana]
 sp|O22149.2|PME17_ARATH RecName: Full=Probable pectinesterase/pectinesterase inhibitor 
17; Includes: RecName: Full=Pectinesterase inhibitor 17; AltName: 
Full=Pectin methylesterase inhibitor 17; Includes: RecName: 
Full=Pectinesterase 17; Short=PE 17; AltName: Full=Pectin 
methylesterase 17; Short=AtPME17; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK32841.1|AF361829_1 At2g45220/F4L23.27 [Arabidopsis thaliana]
 gb|AAB82640.2| putative pectinesterase [Arabidopsis thaliana]
 gb|AEC10527.1| putative pectinesterase/pectinesterase inhibitor 17 [Arabidopsis 
thaliana]
Length=511

 Score =   280 bits (716),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 162/217 (75%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS + YQDTLYVHS RQFYRDC +YGT+DFIFGN
Sbjct  297  FRNTAGASNEQAVALRSGSDLSVFYQCSFEAYQDTLYVHSNRQFYRDCDVYGTVDFIFGN  356

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR DPN+NTGI I NSRV    +LR   G  K++
Sbjct  357  AAAVLQNCNIFARRPR-SKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTY  415

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP+GW+EW G+FAL TL+Y E+ NTG GAST  RV WP
Sbjct  416  LGRPWRQYSRTVFMKTSLDSLIDPRGWLEWDGNFALKTLFYAEFQNTGPGASTSGRVTWP  475

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +L    EAS F V  F+ G SWIP S VPF S L
Sbjct  476  GFRVLGSASEASKFTVGTFLAGGSWIPSS-VPFTSGL  511



>ref|XP_007134831.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
 gb|ESW06825.1| hypothetical protein PHAVU_010G079900g [Phaseolus vulgaris]
Length=520

 Score =   280 bits (717),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 161/216 (75%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA    SD +VFYRCS +GYQDTLYVHS RQFYR+C +YGT+DFIFGN
Sbjct  307  FRNTAGAANHQAVAFRSGSDLSVFYRCSFEGYQDTLYVHSERQFYRECDVYGTVDFIFGN  366

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AA VLQNC+I+ + P   ++  +TAQGR DPN+NTGI I NS+V           VKS+L
Sbjct  367  AAVVLQNCNIYARTP-PQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPSS-VKSYL  424

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW+KYSRTVF+KT+LD LI+P GWMEW G+FAL TLYY EY NTG G++T NRV W G
Sbjct  425  GRPWQKYSRTVFMKTNLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWKG  484

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H L    +A+PF V+NFI G+SWIP + VPF S L
Sbjct  485  YHALTAASQATPFTVANFIAGNSWIPSTSVPFTSGL  520



>ref|XP_002882002.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58261.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   280 bits (716),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 163/217 (75%), Gaps = 3/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG    QAVA+   SD +VFY+CS + YQDTLYVHS RQFYRDC +YGT+DFIFGN
Sbjct  297  FRNTAGANNAQAVALRSGSDLSVFYQCSFEAYQDTLYVHSNRQFYRDCDVYGTVDFIFGN  356

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AAAVLQNC+IF ++P   ++N ITAQGR DPN+NTGI I NSRV    +LR   G  K++
Sbjct  357  AAAVLQNCNIFARRPR-SKTNTITAQGRSDPNQNTGIIIHNSRVTAASDLRPVLGSTKTY  415

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPWR+YSRTVF+KT LD LIDP+GW+EW+G+FAL TL+Y E+ NTG GAST  RV WP
Sbjct  416  LGRPWRQYSRTVFMKTSLDSLIDPRGWLEWNGNFALKTLFYAEFQNTGPGASTSGRVTWP  475

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            GF +L    EAS F V  F+ G SWIP S VPF S L
Sbjct  476  GFRVLGSASEASKFTVGTFLAGSSWIP-STVPFTSGL  511



>emb|CDY27750.1| BnaA05g31590D [Brassica napus]
Length=551

 Score =   281 bits (719),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 163/214 (76%), Gaps = 8/214 (4%)
 Frame = +2

Query  8    NTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGNAA  187
            NTAGP KHQAVAV  ++D + FY+CS +GYQDTLYVHSLRQFYR+C IYGT+DFIFGNAA
Sbjct  345  NTAGPTKHQAVAVRNSADMSAFYKCSFEGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAA  404

Query  188  AVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFLGR  367
             VLQNC++  + P+  Q N ITAQGR DPN+NTGISI N R+ P+ EL       ++LGR
Sbjct  405  TVLQNCNLIPRLPLQGQFNAITAQGRSDPNQNTGISIQNCRITPSAEL-------TYLGR  457

Query  368  PWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPGFH  547
            PW++YSRTV+++  +DG ID KGW EW GDFAL TLYY E+MNTG G+ T NRVNWPG+H
Sbjct  458  PWKEYSRTVYLQNFMDGFIDAKGWNEWMGDFALQTLYYAEFMNTGPGSETANRVNWPGYH  517

Query  548  LLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            ++ +  EA  F VSNFI GD W+P  GVP+   L
Sbjct  518  VINE-TEAVWFTVSNFIVGDYWLPSMGVPYAGGL  550



>gb|KHN47891.1| Pectinesterase 2 [Glycine soja]
Length=513

 Score =   280 bits (716),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 137/216 (63%), Positives = 160/216 (74%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA    SD +VFYRCS +G+QDTLYVHS RQFY+ C IYGT+DFIFGN
Sbjct  300  FRNTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYKACDIYGTVDFIFGN  359

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AAAVLQNC+I+ + P   ++  +TAQGR DPN+NTGI I NS+V           VKS+L
Sbjct  360  AAAVLQNCNIYARTP-PQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPSS-VKSYL  417

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW+KYSRTVF+KT LD LI+P GWMEW G+FAL TLYY EY NTG G++T NRV W G
Sbjct  418  GRPWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWKG  477

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H+L    EASPF V NFI G +WIP SGVPF S L
Sbjct  478  YHVLTSASEASPFTVGNFIAGSNWIPSSGVPFTSGL  513



>gb|AAF35897.1|AF229849_1 pectin methylesterase isoform alpha [Vigna radiata]
Length=277

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 163/217 (75%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGP KHQAVA+   +D + FY+CS   YQDTLYVHSLRQFYR+C +YGT+DFIFGN
Sbjct  60   FENSAGPSKHQAVALRNGADFSAFYQCSFVAYQDTLYVHSLRQFYRECDVYGTVDFIFGN  119

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AAAVLQNC+++ +KP  +Q NL TAQGR+DPN++TGISI+N +V    +L       +++
Sbjct  120  AAAVLQNCNLYARKPNKNQRNLFTAQGREDPNQSTGISIINCKVAAAADLIPVKSEFRNY  179

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ YSRTVF+ + ++ LI+P GW+EW+G FAL TLYYGEY N G GA+T  RV WP
Sbjct  180  LGRPWKMYSRTVFLNSLMEDLIEPAGWLEWNGTFALDTLYYGEYNNRGPGANTSGRVTWP  239

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V NFIQG+ W+   G+PF S L
Sbjct  240  GYRVITNSTEASQFTVQNFIQGNEWLNSYGIPFFSGL  276



>ref|XP_007145198.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
 gb|ESW17192.1| hypothetical protein PHAVU_007G218500g [Phaseolus vulgaris]
Length=553

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGPEKHQAVA+   +D + F+RCS  GYQDTLYVHSLRQFYR+C IYGT+DFIFGN
Sbjct  336  FENSAGPEKHQAVALRSGADFSAFFRCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  395

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA V QNC+++ ++P ++Q NL TAQGR+DPN+NTGISI N ++    +L       KS+
Sbjct  396  AAVVFQNCNLYARRPNENQKNLFTAQGREDPNQNTGISIFNCKIAAASDLIPVKSSFKSY  455

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ YSRTV++K+ ++ LIDP GW+EW+  FAL TLYYGEYMN G G++T  RV WP
Sbjct  456  LGRPWKTYSRTVYLKSYIEDLIDPAGWLEWNDTFALDTLYYGEYMNRGPGSNTSARVTWP  515

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V+ FIQG+ W+  +G+PF S L
Sbjct  516  GYRIINSSTEASQFTVAQFIQGNDWLNTTGIPFLSGL  552



>ref|XP_008436965.1| PREDICTED: pectinesterase 2-like [Cucumis melo]
Length=519

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 170/217 (78%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP+ HQAVA+   +D +VF+RC  +GYQDTLY HS RQFYR+C+IYGTIDFIFGN
Sbjct  303  FRNTAGPQNHQAVALRSGADLSVFFRCGFEGYQDTLYAHSQRQFYRECYIYGTIDFIFGN  362

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQNC I+ +KPM  Q  ++TAQGR DPN+NTGISI NSRV+   +L+     V+++
Sbjct  363  AAVVLQNCMIYARKPMQGQQCVVTAQGRTDPNQNTGISIHNSRVMAADDLKPVIKSVRTY  422

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV++++ ++ L++P GW+EWSG+FAL+TLYYGE+ N G G+ST NRV W 
Sbjct  423  LGRPWKEYSRTVYLQSFMESLVNPAGWLEWSGNFALNTLYYGEFKNYGPGSSTANRVKWK  482

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++   +EA+ F V NFI G+SW+P +GVPF + L
Sbjct  483  GYRVITSANEAAKFTVGNFIAGNSWLPGTGVPFTAGL  519



>ref|XP_010259481.1| PREDICTED: pectinesterase-like [Nelumbo nucifera]
Length=583

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 163/217 (75%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
             EN AGP KHQAVA+   SD + FYRCS  GYQDTLYVHSLRQFYR+C IYGT+DFIFGN
Sbjct  366  IENAAGPSKHQAVALRSGSDLSAFYRCSFVGYQDTLYVHSLRQFYRECDIYGTVDFIFGN  425

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA V QNC+++ ++P  +Q N+ TAQGR+DPN+NTGISILN +V    +L        ++
Sbjct  426  AAVVFQNCNLYARRPNANQKNIFTAQGREDPNQNTGISILNCKVTLAADLSPVKSSFHTY  485

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVFI + LD LI+P GW+EWSG+F LSTLYYGEYMN G G+ T NRV WP
Sbjct  486  LGRPWKEYSRTVFIGSYLDDLINPAGWLEWSGNFGLSTLYYGEYMNKGPGSDTTNRVKWP  545

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EA+ F V++FIQG  W+  +G+P+ + L
Sbjct  546  GYRVINSSTEATQFTVASFIQGGGWLSSTGIPYSAGL  582



>ref|XP_010930858.1| PREDICTED: pectinesterase-like [Elaeis guineensis]
Length=472

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 161/217 (74%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAGP KHQAVA+  +SD +VFY+CS +GYQDTLY HSLRQFYR+C IYGT+DFIFGN
Sbjct  256  FRNTAGPAKHQAVALRSSSDLSVFYQCSFQGYQDTLYAHSLRQFYRECKIYGTVDFIFGN  315

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA V QNC+I+V++PM  Q N ITAQGR DPN+NTGISI N RV    +LR      ++F
Sbjct  316  AAVVFQNCNIYVRRPMSQQKNTITAQGRTDPNQNTGISIQNCRVTAAKDLRPVRSSFQTF  375

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRP ++YSRTV+++T +D LI P GW+EWSGDFAL TL+YGE+ NTG G++T  RV W 
Sbjct  376  LGRPLKEYSRTVYMETYMDDLISPAGWLEWSGDFALETLFYGEFRNTGPGSNTSKRVKWG  435

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++  P  A  F     I G+ W+P SG+PF   L
Sbjct  436  GYHIITDPSTALEFTARILIAGEMWLPSSGLPFKLDL  472



>gb|AGG23325.1| pectin methylesterase 1 [Musa acuminata AAA Group]
Length=566

 Score =   281 bits (719),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 164/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
             EN+AGP KHQAVA+ V +D + FYRCS  GYQDTLY HSLRQFYR+C +YGTIDFIFGN
Sbjct  349  IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGN  408

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A  VLQNC+++ +KP+ +Q N+ TAQGR+DPN+NTGISI N +V    +L        ++
Sbjct  409  AGVVLQNCNLYARKPLSNQKNIFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTY  468

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ YSRTV++++ LD LI+P GW+EW GDFALSTLYYGEYMN G G+ST NRV WP
Sbjct  469  LGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWP  528

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V +FI+GD W+  + VPF + L
Sbjct  529  GYRVINSSAEASMFTVESFIEGDQWLGSTSVPFTAGL  565



>ref|XP_010056335.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
Length=515

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  300  FRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGN  359

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+I+ + P  ++ N +TAQGR DPN+NTGISI N +V    +L+     VK++
Sbjct  360  AAVVLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTY  418

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+  GWMEW G+FAL TLYYGEY+NTG G+ST +RV W 
Sbjct  419  LGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGPGSSTASRVTWA  478

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V +FI G SW+P +GVP+ S L
Sbjct  479  GYHVITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  515



>ref|XP_008347782.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20 
[Malus domestica]
Length=564

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 165/212 (78%), Gaps = 2/212 (1%)
 Frame = +2

Query  5    ENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGNA  184
             NTAGP K QAVA+   +D +VFY CS +GYQDTLY HSLRQFYR+C IYGT+DFIFGNA
Sbjct  349  RNTAGPSKGQAVALRSGADFSVFYSCSFEGYQDTLYTHSLRQFYRECDIYGTVDFIFGNA  408

Query  185  AAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGG-GVKSFL  361
            A VLQNC+I+ ++P   QSN ITAQGR DPN+NTG SI N  + PTP+L      VK++L
Sbjct  409  AVVLQNCNIYPRQPNQGQSNPITAQGRTDPNQNTGTSIHNCTITPTPDLASSNYTVKTYL  468

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW++YSRTV+++T +  LIDP GW+ WSGDFALSTLYY EY NTG G+ST NRV WPG
Sbjct  469  GRPWKEYSRTVYMQTFMGSLIDPAGWLAWSGDFALSTLYYAEYNNTGPGSSTTNRVTWPG  528

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            +H++     A+ F VSNF+ GD+W+P++GVP+
Sbjct  529  YHVINA-TVAANFTVSNFLLGDNWLPDTGVPY  559



>ref|XP_003553658.2| PREDICTED: probable pectinesterase/pectinesterase inhibitor 39-like 
[Glycine max]
Length=615

 Score =   282 bits (722),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 165/215 (77%), Gaps = 1/215 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN+AGP KHQAVA+   SD + FY+CS   YQDTLYVHSLRQFYRDC +YGT+DFIFGN
Sbjct  398  FENSAGPSKHQAVALRSGSDFSAFYKCSFVAYQDTLYVHSLRQFYRDCDVYGTVDFIFGN  457

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+++ +KP ++Q NL TAQGR+DPN+NTGISILN +V    +L       K++
Sbjct  458  AATVLQNCNLYARKPNENQRNLFTAQGREDPNQNTGISILNCKVAAAADLIPVKSQFKNY  517

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+KYSRTV++ + ++ LIDPKGW+EW+G FAL TLYYGEY N G G++T  RV WP
Sbjct  518  LGRPWKKYSRTVYLNSYMEDLIDPKGWLEWNGTFALDTLYYGEYNNRGPGSNTSARVTWP  577

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGS  643
            G+ +++   EA+ F V NFIQG+ W+  + +PF S
Sbjct  578  GYRVIKNATEANQFTVRNFIQGNEWLSSTDIPFFS  612



>dbj|BAF42040.1| pectin methylesterase 3 [Pyrus communis]
Length=564

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 166/216 (77%), Gaps = 2/216 (1%)
 Frame = +2

Query  5    ENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGNA  184
             NTAGP K QAVA+   +D +VFY CS +GYQDTLY HSLRQFYR+C IYGT+DFIFGNA
Sbjct  349  RNTAGPSKGQAVALRSGADFSVFYSCSFEGYQDTLYTHSLRQFYRECDIYGTVDFIFGNA  408

Query  185  AAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGG-GVKSFL  361
            A VLQNC+I+ ++P   QSN ITAQGR DPN+NTG SI N  + PTP+L      VK++L
Sbjct  409  AVVLQNCNIYPRQPNQGQSNPITAQGRTDPNQNTGTSIHNCTITPTPDLASSNYTVKTYL  468

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW++YSRTV+++T +  LIDP GW+ WSGDFALSTLYY EY NTG G++T NRV WPG
Sbjct  469  GRPWKEYSRTVYMQTFMGSLIDPAGWLAWSGDFALSTLYYAEYNNTGPGSNTTNRVTWPG  528

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H++     A+ F VSNF+ GD+W+P++GVP+   L
Sbjct  529  YHVINA-TVAANFTVSNFLLGDNWLPDTGVPYTGSL  563



>gb|KDO36280.1| hypothetical protein CISIN_1g027636mg [Citrus sinensis]
Length=221

 Score =   270 bits (689),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 159/213 (75%), Gaps = 1/213 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            FEN AGP KHQAVA+ V +DHAV YRC++ GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  3    FENFAGPAKHQAVALRVGADHAVVYRCNVIGYQDTLYVHSNRQFYRECDIYGTVDFIFGN  62

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGG-GGVKSF  358
            AA VLQ C I+ +KPM  Q N ITAQ R DPN+NTGISI +  +   P+L+   G + ++
Sbjct  63   AAVVLQKCAIYARKPMAMQKNTITAQNRKDPNQNTGISIHDCSLYAAPDLQASKGSIPTY  122

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ YSR V++ T +   I P+GW+EW+GDFAL TLYYGEYMN+G G++  +RV WP
Sbjct  123  LGRPWKLYSRVVYMLTYMGDHIQPRGWLEWNGDFALDTLYYGEYMNSGPGSAVGHRVRWP  182

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPF  637
            G+ ++    EAS F VS FI G SW+P +GV F
Sbjct  183  GYRVITSATEASKFTVSQFIYGSSWLPSTGVAF  215



>gb|KHN47892.1| Pectinesterase 2 [Glycine soja]
Length=507

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 161/216 (75%), Gaps = 2/216 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA    SD +VFYRCS +G+QDTLYVHS RQFY+ C IYGT+DFIFGN
Sbjct  294  FRNTAGAANHQAVAFRSGSDLSVFYRCSFEGFQDTLYVHSERQFYKACDIYGTVDFIFGN  353

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRGGGGVKSFL  361
            AAAVLQNC+I+ + P   ++  +TAQGR DPN+NTGI I NS+V           VKS+L
Sbjct  354  AAAVLQNCNIYARTP-PQRTITVTAQGRTDPNQNTGIIIHNSKVTGASGFNPSS-VKSYL  411

Query  362  GRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWPG  541
            GRPW+KYSRTVF+KT LD LI+P GWMEW G+FAL TLYY EY NTG G++T NRV W G
Sbjct  412  GRPWQKYSRTVFMKTYLDSLINPAGWMEWDGNFALDTLYYAEYANTGPGSNTANRVTWKG  471

Query  542  FHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            +H+L    +ASPF V NFI G++WIP SGVPF S L
Sbjct  472  YHVLTSASQASPFTVGNFIAGNNWIPSSGVPFTSGL  507



>ref|XP_006577155.1| PREDICTED: probable pectinesterase/pectinesterase inhibitor 20-like 
[Glycine max]
 gb|KHN20387.1| Putative pectinesterase/pectinesterase inhibitor 7 [Glycine soja]
Length=562

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 168/217 (77%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F+NTAGP KHQAVAV   +D + FY CS +GYQDTLY HSLRQFYR+C IYGT+DFIFGN
Sbjct  346  FQNTAGPSKHQAVAVRNGADMSTFYSCSFEGYQDTLYTHSLRQFYRECDIYGTVDFIFGN  405

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELR-GGGGVKSF  358
            AA VLQ C+++ + PM  Q N ITAQGR DPN+NTG SI N+ + P  +L    G V+++
Sbjct  406  AAVVLQTCNLYPRLPMSGQFNAITAQGRTDPNQNTGTSIHNATIKPADDLAPSVGTVQTY  465

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTV++++ ++  I+P GW EWSGDFALSTLYY EY NTG G++T NRV WP
Sbjct  466  LGRPWKEYSRTVYMQSFMNSFINPSGWHEWSGDFALSTLYYAEYNNTGPGSNTANRVTWP  525

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++   D A+ F VSNF+ GDSW+P++GVP+ + L
Sbjct  526  GYHVINATDAAN-FTVSNFLDGDSWLPQTGVPYVTGL  561



>ref|XP_010056339.1| PREDICTED: pectinesterase 2-like [Eucalyptus grandis]
 gb|KCW73022.1| hypothetical protein EUGRSUZ_E01463 [Eucalyptus grandis]
Length=515

 Score =   279 bits (714),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 164/217 (76%), Gaps = 2/217 (1%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
            F NTAG   HQAVA+   SD +VFYRC  +GYQDTLYVHS RQFYR+C IYGT+DFIFGN
Sbjct  300  FRNTAGAANHQAVALRSGSDLSVFYRCGFEGYQDTLYVHSERQFYRECDIYGTVDFIFGN  359

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            AA VLQNC+I+ + P  ++ N +TAQGR DPN+NTGISI N +V    +L+     VK++
Sbjct  360  AAVVLQNCNIYARNP-PNKVNTVTAQGRTDPNQNTGISIHNCKVTAASDLKSVQSSVKTY  418

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW++YSRTVF+KT LD LI+  GWMEW G+FAL TLYYGEY+NTG G+ST +RV W 
Sbjct  419  LGRPWQEYSRTVFMKTYLDSLINSAGWMEWDGNFALDTLYYGEYLNTGPGSSTASRVTWA  478

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+H++    EAS F V +FI G SW+P +GVP+ S L
Sbjct  479  GYHVITSATEASKFTVGSFIAGGSWLPATGVPYTSGL  515



>ref|XP_009382521.1| PREDICTED: pectinesterase-like [Musa acuminata subsp. malaccensis]
Length=566

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 164/217 (76%), Gaps = 1/217 (0%)
 Frame = +2

Query  2    FENTAGPEKHQavavavaSDHAVFYRCSMKGYQDTLYVHSLRQFYRDCHIYGTIDFIFGN  181
             EN+AGP KHQAVA+ V +D + FYRCS  GYQDTLY HSLRQFYR+C +YGTIDFIFGN
Sbjct  349  IENSAGPSKHQAVALRVGADLSAFYRCSFVGYQDTLYAHSLRQFYRECDVYGTIDFIFGN  408

Query  182  AAAVLQNCDIFVKKPMDHQSNLITAQGRDDPNENTGISILNSRVIPTPELRG-GGGVKSF  358
            A  VLQNC+++ +KP+ +Q N+ TAQGR+DPN+NTGISI N +V    +L        ++
Sbjct  409  AGVVLQNCNLYARKPLSNQKNVFTAQGREDPNQNTGISIQNCKVAAASDLAPVQSNFSTY  468

Query  359  LGRPWRKYSRTVFIKTDLDGLIDPKGWMEWSGDFALSTLYYGEYMNTGAGASTQNRVNWP  538
            LGRPW+ YSRTV++++ LD LI+P GW+EW GDFALSTLYYGEYMN G G+ST NRV WP
Sbjct  469  LGRPWKAYSRTVYMQSLLDSLINPAGWLEWDGDFALSTLYYGEYMNRGPGSSTANRVKWP  528

Query  539  GFHLLRQPDEASPFCVSNFIQGDSWIPESGVPFGSQL  649
            G+ ++    EAS F V +FI+GD W+  + VPF + L
Sbjct  529  GYRVINSSAEASMFTVESFIEGDQWLGSTSVPFTAGL  565



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1766010528465