BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25437_g2_i3 len=1613 path=[2171:0-292 2464:293-332 2503:333-435
874:436-478 2647:479-527 1794:528-528 2696:529-566 7224:567-569
2736:570-641 443:642-642 444:643-699 2863:700-735 2898:736-738
2090:739-801 1646:802-839 3000:840-924 1242:925-1026 3186:1027-1074
3233:1075-1088 2023:1089-1157 3314:1158-1188 1850:1189-1264
1945:1265-1350 3503:1351-1364 3517:1365-1451 3604:1452-1466
3619:1467-1612]

Length=1613
                                                                      Score     E

gb|AFK79031.1|  cytochrome P450 CYP736A54                               429   1e-164   
gb|AJD25256.1|  cytochrome P450 CYP736A121                              426   7e-161   
emb|CDP18035.1|  unnamed protein product                                415   2e-158   
ref|XP_008234579.1|  PREDICTED: cytochrome P450 CYP736A12-like          398   1e-155   
ref|XP_007208656.1|  hypothetical protein PRUPE_ppa022041mg             396   2e-155   
ref|XP_004236729.1|  PREDICTED: cytochrome P450 CYP736A12-like          410   2e-155   
ref|XP_002280620.1|  PREDICTED: cytochrome P450 CYP736A12               400   1e-154   Vitis vinifera
emb|CDP12853.1|  unnamed protein product                                402   1e-154   
ref|XP_007214404.1|  hypothetical protein PRUPE_ppa026628mg             397   2e-154   
ref|XP_008227122.1|  PREDICTED: cytochrome P450 CYP736A12-like          395   4e-154   
ref|XP_007213194.1|  hypothetical protein PRUPE_ppa026652mg             393   5e-154   
ref|XP_002532045.1|  flavonoid 3-hydroxylase, putative                  400   6e-154   Ricinus communis
ref|XP_008347028.1|  PREDICTED: cytochrome P450 CYP736A12-like          394   1e-153   
ref|XP_009802012.1|  PREDICTED: cytochrome P450 CYP736A12-like          389   6e-153   
ref|XP_004304846.1|  PREDICTED: cytochrome P450 71A1-like               393   3e-152   
ref|XP_002310015.1|  cytochrome P450 family protein                     392   3e-151   Populus trichocarpa [western balsam poplar]
emb|CDP12933.1|  unnamed protein product                                401   3e-151   
ref|XP_006363549.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    388   3e-151   
ref|XP_010099912.1|  Cytochrome P450 71A1                               392   4e-151   
ref|XP_002310014.1|  cytochrome P450 family protein                     389   5e-151   Populus trichocarpa [western balsam poplar]
ref|XP_006428071.1|  hypothetical protein CICLE_v10027549mg             403   6e-151   
ref|XP_008364815.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    393   6e-151   
emb|CDP01387.1|  unnamed protein product                                391   7e-151   
ref|XP_002310011.2|  hypothetical protein POPTR_0007s06310g             389   2e-150   Populus trichocarpa [western balsam poplar]
ref|XP_006380462.1|  hypothetical protein POPTR_0007s06410g             387   2e-150   
ref|XP_002310016.2|  hypothetical protein POPTR_0007s06370g             389   3e-150   Populus trichocarpa [western balsam poplar]
ref|XP_011100884.1|  PREDICTED: cytochrome P450 CYP736A12-like          383   4e-150   
ref|XP_004504031.1|  PREDICTED: cytochrome P450 750A1-like              385   4e-150   
ref|XP_007212357.1|  hypothetical protein PRUPE_ppa014572mg             379   4e-150   
ref|XP_008227118.1|  PREDICTED: cytochrome P450 CYP736A12-like          380   4e-150   
dbj|BAP15886.1|  cytochrome P450 71AU50                                 375   4e-150   
ref|XP_010027875.1|  PREDICTED: cytochrome P450 CYP736A12-like          398   5e-150   
ref|XP_009372714.1|  PREDICTED: cytochrome P450 CYP736A12-like          387   5e-150   
ref|XP_009608339.1|  PREDICTED: cytochrome P450 CYP736A12-like          386   7e-150   
ref|XP_007211842.1|  hypothetical protein PRUPE_ppa004664mg             377   7e-150   
ref|XP_011013422.1|  PREDICTED: cytochrome P450 CYP736A12-like          386   8e-150   
ref|XP_011025622.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    385   8e-150   
ref|XP_009586899.1|  PREDICTED: cytochrome P450 CYP736A12-like          380   1e-149   
ref|XP_009767392.1|  PREDICTED: cytochrome P450 CYP736A12-like          386   3e-149   
ref|XP_008227094.1|  PREDICTED: cytochrome P450 CYP736A12-like          372   4e-149   
ref|XP_002310007.2|  cytochrome P450 family protein                     388   6e-149   Populus trichocarpa [western balsam poplar]
ref|XP_010099909.1|  Flavonoid 3'-monooxygenase                         376   7e-149   
ref|XP_002310008.2|  hypothetical protein POPTR_0007s06270g             385   7e-149   Populus trichocarpa [western balsam poplar]
ref|XP_010030392.1|  PREDICTED: cytochrome P450 CYP736A12-like          389   8e-149   
ref|XP_010027781.1|  PREDICTED: cytochrome P450 CYP736A12-like          393   9e-149   
ref|XP_009615258.1|  PREDICTED: cytochrome P450 CYP736A12-like          391   9e-149   
ref|XP_009770873.1|  PREDICTED: cytochrome P450 CYP736A12-like          379   1e-148   
ref|XP_003524281.2|  PREDICTED: cytochrome P450 71A1-like isoform X1    387   1e-148   
ref|XP_009782203.1|  PREDICTED: cytochrome P450 CYP736A12-like          387   3e-148   
ref|XP_007048087.1|  Cytochrome P450                                    383   3e-148   
ref|XP_002310005.2|  hypothetical protein POPTR_0007s06240g             390   4e-148   Populus trichocarpa [western balsam poplar]
emb|CBI21489.3|  unnamed protein product                                389   4e-148   
ref|XP_009607201.1|  PREDICTED: cytochrome P450 CYP736A12-like          377   4e-148   
ref|XP_006380460.1|  hypothetical protein POPTR_0007s06360g             383   5e-148   
ref|XP_007159747.1|  hypothetical protein PHAVU_002G263700g             377   6e-148   
ref|XP_006428070.1|  hypothetical protein CICLE_v10026966mg             384   7e-148   
gb|KHN38214.1|  Cytochrome P450 71A1                                    383   8e-148   
ref|XP_002276487.1|  PREDICTED: cytochrome P450 CYP736A12               377   8e-148   Vitis vinifera
ref|XP_006365792.1|  PREDICTED: cytochrome P450 71A1-like               381   2e-147   
ref|XP_009629564.1|  PREDICTED: cytochrome P450 CYP736A12-like          388   2e-147   
ref|XP_006354722.1|  PREDICTED: cytochrome P450 71A1-like               394   4e-147   
ref|XP_009378500.1|  PREDICTED: cytochrome P450 CYP736A12-like          380   5e-147   
gb|ACM89788.1|  cytochrome P450 monooxygenase CYP736B                   376   8e-147   Vitis arizonica x Vitis rupestris
ref|XP_011090597.1|  PREDICTED: cytochrome P450 CYP736A12-like          375   9e-147   
gb|ACM89789.1|  cytochrome P450 monooxygenase CYP736B                   375   3e-146   Vitis arizonica x Vitis rupestris
ref|XP_004237505.1|  PREDICTED: cytochrome P450 CYP736A12-like          385   1e-145   
ref|XP_009607200.1|  PREDICTED: cytochrome P450 CYP736A12-like          369   2e-145   
ref|XP_008385983.1|  PREDICTED: cytochrome P450 CYP736A12-like          377   2e-145   
ref|XP_011090598.1|  PREDICTED: cytochrome P450 CYP736A12-like          372   2e-145   
ref|XP_006366158.1|  PREDICTED: cytochrome P450 750A1-like              381   3e-145   
ref|XP_011100886.1|  PREDICTED: cytochrome P450 CYP736A12-like          372   4e-145   
ref|XP_006346716.1|  PREDICTED: cytochrome P450 71A1-like               373   4e-145   
ref|XP_006365795.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    374   5e-145   
ref|XP_003531375.1|  PREDICTED: cytochrome P450 750A1-like isofor...    374   7e-145   
gb|EYU31078.1|  hypothetical protein MIMGU_mgv1a004963mg                372   2e-144   
ref|XP_004237615.1|  PREDICTED: cytochrome P450 CYP736A12-like          388   3e-144   
ref|XP_008440668.1|  PREDICTED: cytochrome P450 CYP736A12-like          370   3e-144   
ref|XP_009600860.1|  PREDICTED: cytochrome P450 CYP736A12-like          370   5e-144   
ref|XP_004143568.1|  PREDICTED: cytochrome P450 71A1-like               372   6e-144   
ref|XP_008440675.1|  PREDICTED: cytochrome P450 CYP736A12-like          370   1e-143   
ref|XP_003630098.1|  Cytochrome P450                                    359   2e-143   
ref|XP_004162327.1|  PREDICTED: cytochrome P450 71A1-like               370   2e-143   
ref|XP_009588170.1|  PREDICTED: cytochrome P450 CYP736A12-like          379   2e-143   
ref|XP_006354708.1|  PREDICTED: flavonoid 3'-monooxygenase-like         360   3e-143   
gb|KHN29102.1|  Cytochrome P450 71A1                                    365   3e-143   
ref|XP_003531374.1|  PREDICTED: cytochrome P450 71A1-like               364   6e-143   
ref|XP_007221131.1|  hypothetical protein PRUPE_ppa019068mg             367   6e-143   
emb|CDP01384.1|  unnamed protein product                                378   6e-143   
ref|XP_010027782.1|  PREDICTED: cytochrome P450 CYP736A12-like          378   7e-143   
ref|XP_011090604.1|  PREDICTED: cytochrome P450 CYP736A12-like          357   8e-143   
ref|XP_004237154.1|  PREDICTED: cytochrome P450 CYP736A12-like          358   1e-142   
ref|XP_006428066.1|  hypothetical protein CICLE_v10025445mg             373   1e-142   
ref|XP_008364814.1|  PREDICTED: cytochrome P450 CYP736A12-like          362   2e-142   
gb|AJD25258.1|  cytochrome P450 CYP736A123                              360   3e-142   
ref|XP_003596030.1|  Cytochrome P450                                    367   4e-142   
ref|XP_006493867.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    371   5e-142   
gb|EYU24037.1|  hypothetical protein MIMGU_mgv1a005167mg                389   1e-141   
ref|XP_004162313.1|  PREDICTED: cytochrome P450 71A1-like               369   1e-141   
ref|XP_006354704.1|  PREDICTED: cytochrome P450 750A1-like              369   1e-141   
ref|XP_009631554.1|  PREDICTED: cytochrome P450 CYP736A12-like          372   2e-141   
ref|XP_003532846.1|  PREDICTED: cytochrome P450 750A1-like              368   2e-141   
ref|XP_009770688.1|  PREDICTED: cytochrome P450 CYP736A12-like          367   3e-141   
ref|XP_004237435.1|  PREDICTED: cytochrome P450 CYP736A12-like          359   9e-141   
gb|EYU24035.1|  hypothetical protein MIMGU_mgv1a020942mg                355   1e-140   
ref|XP_006367702.1|  PREDICTED: cytochrome P450 71A1-like               371   1e-140   
ref|XP_009372721.1|  PREDICTED: cytochrome P450 CYP736A12-like          356   3e-140   
ref|XP_004253509.1|  PREDICTED: cytochrome P450 CYP736A12-like          360   5e-140   
ref|XP_011078642.1|  PREDICTED: cytochrome P450 CYP736A12-like          426   5e-140   
gb|EYU27291.1|  hypothetical protein MIMGU_mgv1a023536mg                370   6e-140   
ref|XP_008440671.1|  PREDICTED: cytochrome P450 CYP736A12-like          361   1e-139   
ref|XP_004488758.1|  PREDICTED: cytochrome P450 71A1-like               359   1e-139   
ref|XP_007159750.1|  hypothetical protein PHAVU_002G263900g             355   4e-139   
ref|XP_006354705.1|  PREDICTED: cytochrome P450 750A1-like              359   4e-139   
ref|XP_006354701.1|  PREDICTED: cytochrome P450 84A1-like               356   5e-139   
gb|EYU24036.1|  hypothetical protein MIMGU_mgv1a005182mg                379   3e-138   
ref|XP_008385982.1|  PREDICTED: cytochrome P450 CYP736A12-like          351   2e-137   
ref|XP_004162326.1|  PREDICTED: cytochrome P450 750A1-like              357   2e-136   
ref|XP_004143566.1|  PREDICTED: cytochrome P450 750A1-like              357   2e-136   
gb|AJD25257.1|  cytochrome P450 CYP736A122                              347   2e-135   
ref|XP_008440670.1|  PREDICTED: cytochrome P450 CYP736A12-like          350   2e-134   
ref|XP_004162312.1|  PREDICTED: cytochrome P450 750A1-like              341   2e-134   
ref|XP_004143494.1|  PREDICTED: cytochrome P450 750A1-like              341   2e-134   
ref|XP_006365796.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    374   2e-134   
ref|XP_009372715.1|  PREDICTED: cytochrome P450 CYP736A12-like          337   2e-133   
ref|XP_009372727.1|  PREDICTED: cytochrome P450 CYP736A12-like          340   3e-133   
ref|XP_008344234.1|  PREDICTED: cytochrome P450 CYP736A12-like          337   5e-133   
ref|XP_006348217.1|  PREDICTED: cytochrome P450 71A1-like               340   6e-133   
ref|XP_009372726.1|  PREDICTED: cytochrome P450 CYP736A12-like          338   1e-132   
ref|XP_004153471.1|  PREDICTED: cytochrome P450 71A1-like               340   1e-132   
gb|EYU31074.1|  hypothetical protein MIMGU_mgv1a005121mg                332   4e-132   
ref|XP_009372725.1|  PREDICTED: cytochrome P450 CYP736A12-like          339   3e-131   
ref|XP_004143571.1|  PREDICTED: cytochrome P450 71A1-like               330   5e-131   
gb|EYU31073.1|  hypothetical protein MIMGU_mgv1a004944mg                340   7e-131   
gb|EYU31075.1|  hypothetical protein MIMGU_mgv1a005090mg                335   2e-130   
ref|XP_004153472.1|  PREDICTED: cytochrome P450 71B13-like              340   3e-130   
gb|EYU24031.1|  hypothetical protein MIMGU_mgv1a004909mg                397   1e-128   
ref|XP_004237617.1|  PREDICTED: cytochrome P450 CYP736A12-like          324   4e-128   
ref|XP_002275826.1|  PREDICTED: cytochrome P450 CYP736A12               325   4e-128   Vitis vinifera
ref|XP_010041191.1|  PREDICTED: cytochrome P450 CYP736A12-like          390   2e-127   
gb|KDP20096.1|  hypothetical protein JCGZ_05865                         315   2e-126   
ref|XP_004143572.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    340   6e-126   
ref|XP_004172515.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    340   7e-126   
ref|XP_009337209.1|  PREDICTED: cytochrome P450 CYP736A12-like          327   4e-125   
gb|KDP35215.1|  hypothetical protein JCGZ_09374                         387   5e-125   
ref|XP_007159748.1|  hypothetical protein PHAVU_002G263800g             383   8e-125   
ref|XP_004143569.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    353   2e-124   
gb|AAL66194.1|AF386512_1  cytochrome P450                               326   5e-124   Pyrus communis
ref|XP_007209911.1|  hypothetical protein PRUPE_ppa004377mg             322   7e-124   
ref|XP_009346975.1|  PREDICTED: cytochrome P450 CYP736A12-like          323   7e-124   
ref|XP_002275714.2|  PREDICTED: cytochrome P450 CYP736A12-like          312   1e-123   Vitis vinifera
ref|XP_009337257.1|  PREDICTED: cytochrome P450 CYP736A12-like          323   3e-123   
ref|XP_010094782.1|  Cytochrome P450 71A1                               320   4e-123   
ref|XP_008441066.1|  PREDICTED: cytochrome P450 CYP736A12-like          347   5e-123   
sp|H2DH18.1|C7A12_PANGI  RecName: Full=Cytochrome P450 CYP736A12        308   6e-123   
ref|XP_008240284.1|  PREDICTED: cytochrome P450 CYP736A12-like          324   9e-123   
ref|XP_004162328.1|  PREDICTED: flavonoid 3'-monooxygenase-like         346   1e-122   
ref|XP_009337201.1|  PREDICTED: cytochrome P450 CYP736A12-like          321   2e-122   
ref|XP_008460602.1|  PREDICTED: cytochrome P450 CYP736A12-like          311   6e-122   
ref|XP_009336569.1|  PREDICTED: cytochrome P450 CYP736A12-like          316   6e-122   
dbj|BAD15331.1|  cytochrome P450                                        306   2e-121   Panax ginseng [Chinese ginseng]
ref|XP_008374738.1|  PREDICTED: cytochrome P450 CYP736A12-like          315   2e-120   
ref|XP_009337234.1|  PREDICTED: cytochrome P450 CYP736A12-like          317   2e-120   
ref|XP_003627829.1|  Cytochrome P450                                    283   2e-120   
ref|XP_003630097.1|  Cytochrome P450                                    282   3e-120   
ref|XP_007036492.1|  Cytochrome P450 superfamily protein                301   6e-120   
ref|XP_008360900.1|  PREDICTED: cytochrome P450 CYP736A12-like          314   1e-119   
ref|XP_002511968.1|  flavonoid 3-hydroxylase, putative                  308   1e-119   Ricinus communis
ref|XP_007159749.1|  hypothetical protein PHAVU_002G263800g             373   1e-119   
ref|XP_009337244.1|  PREDICTED: cytochrome P450 CYP736A12-like          308   1e-118   
ref|XP_009337218.1|  PREDICTED: cytochrome P450 CYP736A12-like          308   2e-118   
ref|XP_003530005.1|  PREDICTED: cytochrome P450 71A1-like               302   3e-118   
gb|KEH15707.1|  cytochrome P450 family 71 protein                       290   3e-118   
ref|XP_004299223.1|  PREDICTED: cytochrome P450 71A1-like               294   6e-118   
ref|XP_004252295.1|  PREDICTED: cytochrome P450 CYP736A12-like          369   1e-117   
ref|XP_006354707.1|  PREDICTED: cytochrome P450 71A1-like               285   1e-117   
ref|XP_008374739.1|  PREDICTED: cytochrome P450 CYP736A12-like          304   3e-117   
ref|XP_010045641.1|  PREDICTED: cytochrome P450 CYP736A12-like          291   3e-117   
ref|XP_002514610.1|  flavonoid 3-hydroxylase, putative                  311   3e-117   Ricinus communis
ref|XP_004169555.1|  PREDICTED: cytochrome P450 71A1-like               308   4e-117   
ref|XP_004301061.1|  PREDICTED: cytochrome P450 71A1-like               290   7e-117   
ref|XP_006346619.1|  PREDICTED: cytochrome P450 71A1-like               365   2e-116   
emb|CAN69566.1|  hypothetical protein VITISV_033535                     303   3e-116   Vitis vinifera
ref|XP_010094781.1|  Cytochrome P450 71D8                               293   6e-116   
gb|KCW83844.1|  hypothetical protein EUGRSUZ_B00712                     286   7e-116   
ref|XP_007036495.1|  Cytochrome P450 superfamily protein, putativ...    294   8e-116   
ref|XP_003528941.2|  PREDICTED: cytochrome P450 750A1-like              293   1e-115   
gb|KHN20715.1|  Cytochrome P450 71A1                                    293   2e-115   
ref|XP_008393300.1|  PREDICTED: cytochrome P450 CYP736A12-like          303   2e-115   
ref|XP_003534173.2|  PREDICTED: cytochrome P450 750A1-like              299   3e-115   
ref|XP_007036496.1|  Cytochrome P450 superfamily protein, putativ...    292   5e-115   
gb|KHN32024.1|  Cytochrome P450 71A1                                    298   7e-115   
ref|XP_002275691.1|  PREDICTED: cytochrome P450 CYP736A12 isoform X1    283   9e-115   Vitis vinifera
emb|CAN69565.1|  hypothetical protein VITISV_033534                     283   1e-114   Vitis vinifera
ref|XP_008385725.1|  PREDICTED: cytochrome P450 CYP736A12-like          299   4e-114   
emb|CDP12931.1|  unnamed protein product                                266   6e-114   
ref|XP_009617817.1|  PREDICTED: cytochrome P450 CYP736A12-like          289   6e-114   
ref|XP_004291274.1|  PREDICTED: cytochrome P450 71A1-like               278   1e-113   
ref|XP_010541895.1|  PREDICTED: cytochrome P450 CYP736A12-like          293   3e-113   
ref|XP_010663579.1|  PREDICTED: cytochrome P450 CYP736A12-like          288   4e-113   
gb|KHN20714.1|  Cytochrome P450 71D10                                   280   2e-112   
gb|KEH27058.1|  cytochrome P450 family 71 protein                       285   2e-112   
ref|XP_007152789.1|  hypothetical protein PHAVU_004G159800g             287   3e-112   
ref|XP_007152787.1|  hypothetical protein PHAVU_004G159600g             280   4e-112   
emb|CBI21487.3|  unnamed protein product                                255   5e-112   
ref|XP_004512940.1|  PREDICTED: cytochrome P450 71A1-like               281   7e-112   
ref|XP_010045642.1|  PREDICTED: cytochrome P450 CYP736A12-like          277   1e-111   
ref|XP_007152790.1|  hypothetical protein PHAVU_004G159900g             287   1e-111   
ref|XP_003534174.2|  PREDICTED: cytochrome P450 750A1-like              285   1e-111   
ref|XP_004252382.1|  PREDICTED: cytochrome P450 CYP736A12               352   3e-111   
ref|XP_004490599.1|  PREDICTED: uncharacterized protein LOC101502297    286   5e-111   
ref|XP_008449122.1|  PREDICTED: cytochrome P450 CYP736A12-like          292   5e-110   
ref|XP_007036499.1|  Cytochrome P450, putative                          268   3e-109   
gb|AFK79030.1|  cytochrome P450 CYP736A53                               271   3e-109   
ref|XP_004301062.1|  PREDICTED: cytochrome P450 71A1-like               274   6e-109   
ref|XP_007152786.1|  hypothetical protein PHAVU_004G159500g             273   8e-109   
gb|KHN32022.1|  Cytochrome P450 71A1                                    275   1e-108   
ref|XP_010537441.1|  PREDICTED: cytochrome P450 CYP736A12-like          271   2e-108   
ref|XP_003615667.1|  Cytochrome P450                                    277   5e-108   
ref|XP_004490596.1|  PREDICTED: uncharacterized protein LOC101501242    279   6e-108   
ref|XP_003525259.2|  PREDICTED: cytochrome P450 750A1-like              276   1e-107   
gb|AES98625.2|  cytochrome P450 family 71 protein                       276   1e-107   
gb|KHF97324.1|  Cytochrome P450                                         272   1e-107   
ref|XP_003615678.1|  Cytochrome P450                                    276   3e-107   
gb|KHG07950.1|  Cytochrome P450                                         273   1e-106   
emb|CBI15434.3|  unnamed protein product                                271   2e-106   
gb|KCW79058.1|  hypothetical protein EUGRSUZ_C00484                     270   2e-106   
ref|XP_010047217.1|  PREDICTED: cytochrome P450 CYP736A12-like          270   2e-106   
ref|XP_006350392.1|  PREDICTED: cytochrome P450 71A1-like               266   3e-106   
ref|XP_007160365.1|  hypothetical protein PHAVU_002G315400g             272   3e-105   
ref|XP_010694276.1|  PREDICTED: cytochrome P450 CYP736A12-like          269   5e-105   
ref|XP_004308347.1|  PREDICTED: cytochrome P450 71A1-like               261   1e-104   
ref|XP_003615666.1|  Cytochrome P450                                    265   6e-104   
ref|XP_007152783.1|  hypothetical protein PHAVU_004G159300g             258   6e-104   
ref|XP_007211074.1|  hypothetical protein PRUPE_ppa017688mg             281   1e-103   
gb|KHG22812.1|  Cytochrome P450                                         256   2e-102   
ref|XP_010036876.1|  PREDICTED: cytochrome P450 CYP736A12-like          255   3e-102   
gb|KCW48536.1|  hypothetical protein EUGRSUZ_K02211                     255   3e-102   
ref|XP_008346791.1|  PREDICTED: cytochrome P450 CYP736A12-like is...    260   3e-102   
ref|XP_008346790.1|  PREDICTED: cytochrome P450 CYP736A12-like is...    259   4e-102   
ref|XP_002310009.2|  hypothetical protein POPTR_0007s06300g             239   4e-102   Populus trichocarpa [western balsam poplar]
ref|XP_010537440.1|  PREDICTED: cytochrome P450 CYP736A12-like          261   2e-101   
ref|XP_010036875.1|  PREDICTED: cytochrome P450 CYP736A12-like          258   5e-101   
ref|XP_004237368.1|  PREDICTED: cytochrome P450 CYP736A12-like          256   1e-100   
ref|XP_006427642.1|  hypothetical protein CICLE_v10025377mg             268   3e-100   
gb|ABR18406.1|  unknown                                                 280   3e-100   Picea sitchensis
ref|XP_010537439.1|  PREDICTED: cytochrome P450 CYP736A12-like          266   4e-100   
ref|XP_003615665.1|  Cytochrome P450                                    253   4e-100   
ref|XP_010537437.1|  PREDICTED: cytochrome P450 CYP736A12-like          280   5e-100   
gb|ABR18060.1|  unknown                                                 279   5e-100   Picea sitchensis
ref|XP_003615674.1|  Cytochrome P450                                    261   1e-99    
gb|AES98632.2|  cytochrome P450 family 71 protein                       260   2e-99    
ref|XP_006493371.1|  PREDICTED: cytochrome P450 71A1-like               266   4e-99    
gb|ABR16640.1|  unknown                                                 283   2e-98    Picea sitchensis
gb|KHG22550.1|  Cytochrome P450                                         243   2e-98    
ref|XP_010663583.1|  PREDICTED: cytochrome P450 CYP736A12 isoform X2    228   2e-98    
gb|KCW78883.1|  hypothetical protein EUGRSUZ_C00326                     265   2e-98    
ref|XP_009341741.1|  PREDICTED: cytochrome P450 71A1-like               264   7e-98    
gb|ACN40174.1|  unknown                                                 251   1e-97    Picea sitchensis
ref|XP_008342571.1|  PREDICTED: cytochrome P450 71A1-like               263   1e-97    
ref|XP_007214078.1|  hypothetical protein PRUPE_ppa017849mg             258   2e-97    
emb|CDP12934.1|  unnamed protein product                                312   4e-97    
ref|XP_004303698.1|  PREDICTED: flavonoid 3'-monooxygenase-like         258   4e-97    
ref|XP_004303697.1|  PREDICTED: flavonoid 3'-monooxygenase-like         258   7e-97    
ref|XP_008228182.1|  PREDICTED: cytochrome P450 71A1-like               258   1e-96    
ref|XP_008463992.1|  PREDICTED: cytochrome P450 71A1-like               271   4e-96    
ref|XP_006493374.1|  PREDICTED: cytochrome P450 71A1-like               256   6e-96    
ref|XP_006436412.1|  hypothetical protein CICLE_v10031266mg             246   2e-95    
ref|XP_007215252.1|  hypothetical protein PRUPE_ppa004436mg             256   2e-95    
ref|XP_004144428.1|  PREDICTED: flavonoid 3'-monooxygenase-like         257   3e-95    
ref|XP_006427644.1|  hypothetical protein CICLE_v10025378mg             254   3e-95    
ref|XP_007024645.1|  Cytochrome P450 superfamily protein                258   4e-95    
ref|XP_008460308.1|  PREDICTED: cytochrome P450 71A1-like               256   4e-95    
gb|AET01782.2|  cytochrome P450 family protein                          254   4e-95    
emb|CBI15435.3|  unnamed protein product                                216   4e-95    
ref|XP_003627306.1|  Flavonoid 3',5'-hydroxylase                        254   5e-95    
gb|ABK25581.1|  unknown                                                 271   5e-95    Picea sitchensis
ref|XP_002273390.1|  PREDICTED: cytochrome P450 71A1-like               256   5e-95    Vitis vinifera
ref|XP_010086796.1|  Cytochrome P450 71A1                               251   7e-95    
ref|XP_010033730.1|  PREDICTED: cytochrome P450 71A1-like               259   7e-95    
gb|AGI98132.1|  cytochrome P450                                         259   9e-95    
gb|KDO48981.1|  hypothetical protein CISIN_1g010365mg                   244   1e-94    
ref|XP_008463991.1|  PREDICTED: cytochrome P450 71A1-like               256   1e-94    
gb|AGI98131.1|  cytochrome P450 CYP92                                   258   2e-94    
ref|XP_006426680.1|  hypothetical protein CICLE_v10025391mg             254   2e-94    
ref|XP_004168558.1|  PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'...    257   2e-94    
gb|KDP40690.1|  hypothetical protein JCGZ_24689                         253   2e-94    
dbj|BAD36162.1|  putative elicitor-inducible cytochrome P450            254   3e-94    
gb|KEH15895.1|  cytochrome P450 family 71 protein                       201   3e-94    
ref|XP_009375474.1|  PREDICTED: cytochrome P450 71A1-like               254   3e-94    
ref|XP_010917481.1|  PREDICTED: cytochrome P450 71A1-like               251   4e-94    
gb|KHG07602.1|  Cytochrome P450                                         234   4e-94    
ref|XP_004143567.1|  PREDICTED: cytochrome P450 71A1-like               206   5e-94    
ref|XP_006354724.1|  PREDICTED: cytochrome P450 750A1-like              303   5e-94    
gb|EAZ09260.1|  hypothetical protein OsI_31533                          253   1e-93    
ref|XP_011079634.1|  PREDICTED: cytochrome P450 71A1-like               249   1e-93    
gb|AGI97940.1|  flavonoid 3'-monooxygenase-like protein                 258   1e-93    
ref|XP_006468115.1|  PREDICTED: flavonoid 3'-monooxygenase-like         241   2e-93    
gb|KHG15722.1|  Cytochrome P450                                         253   2e-93    
emb|CBI14925.3|  unnamed protein product                                259   2e-93    
ref|XP_010273844.1|  PREDICTED: cytochrome P450 71A1-like               263   2e-93    
gb|KHF98693.1|  Cytochrome P450                                         228   3e-93    
gb|ABA01477.1|  cytochrome P450 DDWF1                                   252   3e-93    
ref|XP_006465906.1|  PREDICTED: cytochrome P450 71A1-like               253   4e-93    
gb|AJD25214.1|  cytochrome P450 CYP92A73                                248   4e-93    
gb|KDO65002.1|  hypothetical protein CISIN_1g010388mg                   253   4e-93    
ref|XP_010663080.1|  PREDICTED: cytochrome P450 71A25                   258   4e-93    
ref|XP_011036442.1|  PREDICTED: cytochrome P450 71A1-like               248   5e-93    
ref|XP_010933756.1|  PREDICTED: cytochrome P450 84A1-like               233   6e-93    
ref|XP_006369135.1|  hypothetical protein POPTR_0001s16800g             248   6e-93    
ref|XP_009401319.1|  PREDICTED: cytochrome P450 71A1-like               246   7e-93    
dbj|BAI47545.1|  coniferaldehyde 5-hydroxylase                          234   1e-92    
ref|XP_004148565.1|  PREDICTED: flavonoid 3'-monooxygenase-like         256   1e-92    
emb|CAN67678.1|  hypothetical protein VITISV_035274                     258   1e-92    
ref|XP_004956937.1|  PREDICTED: cytochrome P450 71A1-like               248   1e-92    
ref|XP_008678485.1|  PREDICTED: flavonoid 3'-monooxygenase-like         246   1e-92    
gb|ADC34701.1|  flavonoid 3' hydroxylase                                248   1e-92    
ref|XP_010932407.1|  PREDICTED: cytochrome P450 71A1-like               247   2e-92    
gb|AFW61881.1|  putative cytochrome P450 superfamily protein            246   2e-92    
ref|XP_004956938.1|  PREDICTED: cytochrome P450 71A1-like               249   2e-92    
gb|EMT12959.1|  Flavonoid 3'-monooxygenase                              251   2e-92    
ref|XP_006492016.1|  PREDICTED: cytochrome P450 71A1-like               239   2e-92    
ref|XP_006665049.1|  PREDICTED: flavonoid 3'-monooxygenase-like         250   2e-92    
ref|XP_008783087.1|  PREDICTED: cytochrome P450 93A3                    265   2e-92    
ref|XP_002303241.1|  hypothetical protein POPTR_0003s06460g             247   2e-92    
ref|XP_011071969.1|  PREDICTED: flavonoid 3'-monooxygenase-like         249   3e-92    
gb|ACU45738.1|  ferulate 5-hydroxylase                                  233   3e-92    
gb|KDO48980.1|  hypothetical protein CISIN_1g010365mg                   235   3e-92    
ref|XP_010033459.1|  PREDICTED: cytochrome P450 84A1-like               234   4e-92    
dbj|BAI47544.1|  coniferaldehyde 5-hydroxylase                          233   4e-92    
ref|XP_002460274.1|  hypothetical protein SORBIDRAFT_02g025840          249   4e-92    
ref|XP_009413866.1|  PREDICTED: cytochrome P450 71A1-like               243   4e-92    
ref|XP_002462455.1|  hypothetical protein SORBIDRAFT_02g025850          248   5e-92    
ref|XP_010928984.1|  PREDICTED: cytochrome P450 93A3                    261   5e-92    
ref|XP_011035728.1|  PREDICTED: cytochrome P450 71A1-like isoform X1    246   6e-92    
ref|XP_006492022.1|  PREDICTED: flavonoid 3'-monooxygenase-like         234   7e-92    
ref|XP_008652774.1|  PREDICTED: cytochrome P450 71A1-like               248   8e-92    
ref|XP_003627305.1|  Flavonoid 3',5'-hydroxylase                        251   9e-92    
ref|XP_002521317.1|  flavonoid 3-hydroxylase, putative                  243   1e-91    
gb|EAZ09259.1|  hypothetical protein OsI_31532                          248   1e-91    
ref|NP_001063285.1|  Os09g0441400                                       248   1e-91    
ref|XP_003578185.1|  PREDICTED: cytochrome P450 71A1-like               246   1e-91    
ref|XP_008784472.1|  PREDICTED: cytochrome P450 71A2-like               245   1e-91    
ref|XP_004510480.1|  PREDICTED: flavonoid 3'-monooxygenase-like         250   1e-91    
gb|AED99875.1|  cytochrome P450                                         244   1e-91    
ref|XP_011035730.1|  PREDICTED: cytochrome P450 71A1-like isoform X2    244   2e-91    
ref|XP_006848945.1|  hypothetical protein AMTR_s00166p00047590          235   2e-91    
ref|XP_006477116.1|  PREDICTED: flavonoid 3'-monooxygenase-like         233   2e-91    
gb|ABR17359.1|  unknown                                                 267   2e-91    
gb|EYU21317.1|  hypothetical protein MIMGU_mgv1a004638mg                239   2e-91    
ref|XP_008792870.1|  PREDICTED: cytochrome P450 71A1-like               246   2e-91    
sp|P24465.2|C71A1_PERAE  RecName: Full=Cytochrome P450 71A1; AltN...    247   2e-91    
ref|XP_006841358.1|  hypothetical protein AMTR_s00181p00020940          243   2e-91    
ref|XP_008242319.1|  PREDICTED: flavonoid 3'-monooxygenase-like         244   2e-91    
ref|NP_001147572.1|  flavonoid 3-monooxygenase                          247   3e-91    
gb|ABR16325.1|  unknown                                                 261   4e-91    
ref|XP_006665048.1|  PREDICTED: cytochrome P450 71A1-like               247   4e-91    
gb|AAG44132.1|AF218296_1  cytochrome P450                               250   4e-91    
gb|AAK62346.1|  elicitor-inducible cytochrome P450                      246   6e-91    
ref|NP_001063284.1|  Os09g0441100                                       242   6e-91    
gb|AGT17103.1|  flavonoid 3-monooxygenase                               248   7e-91    
gb|AFK47419.1|  unknown                                                 251   8e-91    
ref|XP_007135432.1|  hypothetical protein PHAVU_010G128900g             255   9e-91    
gb|AES98630.2|  cytochrome P450 family 71 protein                       217   1e-90    
ref|XP_004955501.1|  PREDICTED: flavonoid 3'-monooxygenase-like         251   1e-90    
ref|XP_006452560.1|  hypothetical protein CICLE_v10008075mg             235   1e-90    
gb|AGV54723.1|  flavonoid 3'-monooxygenase-like protein                 254   1e-90    
ref|XP_003615672.1|  Cytochrome P450                                    217   2e-90    
gb|ACN40749.1|  unknown                                                 264   2e-90    
ref|XP_009607330.1|  PREDICTED: cytochrome P450 71A1-like               244   2e-90    
gb|KEH34014.1|  cytochrome P450 family 71 protein                       219   3e-90    
ref|XP_008779328.1|  PREDICTED: cytochrome P450 71A1-like               242   3e-90    
emb|CDP17539.1|  unnamed protein product                                233   3e-90    
ref|XP_010919382.1|  PREDICTED: cytochrome P450 84A1                    228   4e-90    
ref|XP_010911323.1|  PREDICTED: cytochrome P450 71A1-like               236   4e-90    
emb|CAN77776.1|  hypothetical protein VITISV_021888                     240   4e-90    
ref|XP_006426678.1|  hypothetical protein CICLE_v10025392mg             234   6e-90    
gb|ABR16821.1|  unknown                                                 231   6e-90    
gb|KDO37182.1|  hypothetical protein CISIN_1g010699mg                   233   6e-90    
ref|XP_006856442.1|  hypothetical protein AMTR_s00047p00229040          242   7e-90    
ref|XP_006342921.1|  PREDICTED: cytochrome P450 71A1-like               241   1e-89    
ref|XP_007204134.1|  hypothetical protein PRUPE_ppa023335mg             242   1e-89    
ref|XP_006465907.1|  PREDICTED: cytochrome P450 71A1-like               234   1e-89    
ref|XP_006452553.1|  hypothetical protein CICLE_v10008076mg             229   1e-89    
ref|XP_006477121.1|  PREDICTED: flavonoid 3'-monooxygenase-like         229   1e-89    
ref|XP_004165407.1|  PREDICTED: flavonoid 3'-monooxygenase-like         245   1e-89    
ref|XP_002514665.1|  flavonoid 3-hydroxylase, putative                  224   2e-89    
ref|XP_004235547.1|  PREDICTED: cytochrome P450 71A1-like               246   2e-89    
gb|ABC69383.1|  CYP92A2v4                                               243   2e-89    
ref|XP_008240968.1|  PREDICTED: cytochrome P450 93A3-like               251   2e-89    
ref|XP_006465159.1|  PREDICTED: flavonoid 3'-monooxygenase-like         228   2e-89    
ref|XP_009771565.1|  PREDICTED: cytochrome P450 71A1-like               242   2e-89    
ref|XP_008246192.1|  PREDICTED: cytochrome P450 CYP736A12-like          288   2e-89    
ref|XP_004515856.1|  PREDICTED: cytochrome P450 71A26-like              247   2e-89    
ref|XP_004955502.1|  PREDICTED: flavonoid 3'-monooxygenase-like         251   2e-89    
ref|XP_007203366.1|  hypothetical protein PRUPE_ppa020637mg             251   3e-89    
ref|XP_010491421.1|  PREDICTED: flavonoid 3'-monooxygenase-like         241   3e-89    
ref|XP_010271496.1|  PREDICTED: cytochrome P450 84A1-like               226   4e-89    
ref|XP_010929928.1|  PREDICTED: cytochrome P450 71A1-like               227   4e-89    
ref|XP_003547756.2|  PREDICTED: flavonoid 3'-monooxygenase-like         246   4e-89    
ref|XP_008796879.1|  PREDICTED: cytochrome P450 84A1-like               223   4e-89    
gb|ABC69381.1|  CYP92A2v2                                               242   4e-89    
ref|XP_006427648.1|  hypothetical protein CICLE_v10025417mg             233   4e-89    
emb|CCP37679.1|  cytochrome P450                                        246   4e-89    
ref|XP_006287545.1|  hypothetical protein CARUB_v10000754mg             240   4e-89    
gb|ACN40196.1|  unknown                                                 244   5e-89    
ref|XP_007146291.1|  hypothetical protein PHAVU_006G028100g             225   5e-89    
ref|NP_001062713.1|  Os09g0264400                                       235   5e-89    
ref|XP_011071968.1|  PREDICTED: cytochrome P450 71A1                    246   6e-89    
gb|ADZ54783.1|  flavonoid 3'-monooxygenase                              237   6e-89    
emb|CAN60733.1|  hypothetical protein VITISV_023587                     230   7e-89    
emb|CDX69984.1|  BnaA10g23330D                                          239   7e-89    
gb|ABG74350.1|  cytochrome P450                                         242   7e-89    
ref|XP_002523235.1|  cytochrome P450, putative                          233   8e-89    
gb|ABR17846.1|  unknown                                                 261   8e-89    
gb|KDP30978.1|  hypothetical protein JCGZ_11354                         228   9e-89    
ref|XP_004235548.1|  PREDICTED: cytochrome P450 71A1-like               241   9e-89    
ref|XP_010423152.1|  PREDICTED: flavonoid 3'-monooxygenase-like         238   1e-88    
gb|ADE80941.1|  flavonoid 3'-hydroxylase                                235   1e-88    
gb|ABY89687.1|  flavonoid 3` hydroxylase 1 protein                      240   1e-88    
gb|ABC69382.1|  CYP92A2v2                                               239   1e-88    
ref|XP_006383141.1|  cytochrome P450 family protein                     222   1e-88    
ref|XP_008799325.1|  PREDICTED: cytochrome P450 71A1-like               237   2e-88    
gb|ACC63881.1|  coniferyl aldehyde 5-hydroxylase                        221   2e-88    
ref|XP_006493375.1|  PREDICTED: cytochrome P450 71A1-like               234   2e-88    
gb|ABC58722.1|  flavonoid 3'-hydroxylase                                239   2e-88    
ref|XP_007037782.1|  Cytochrome P450 71A1                               222   2e-88    
dbj|BAJ96250.1|  predicted protein                                      243   2e-88    
ref|XP_009338655.1|  PREDICTED: cytochrome P450 84A1-like               224   2e-88    
emb|CAB65335.1|  ferulate-5-hydroxylase                                 221   2e-88    
ref|XP_004287841.1|  PREDICTED: cytochrome P450 84A1-like               225   3e-88    
gb|ADO16185.1|  cytochrome P450 mono-oxygenase                          241   3e-88    
ref|XP_009773047.1|  PREDICTED: cytochrome P450 93A3-like               244   3e-88    
ref|XP_003611883.1|  Cytochrome P450                                    214   3e-88    
ref|XP_010239382.1|  PREDICTED: cytochrome P450 71A1-like               233   3e-88    
gb|AJD25152.1|  cytochrome P450 CYP71AP14                               228   4e-88    
ref|XP_010113394.1|  Cytochrome P450 84A1                               224   4e-88    
gb|ACC63880.1|  coniferyl aldehyde 5-hydroxylase                        219   4e-88    
ref|XP_008337913.1|  PREDICTED: cytochrome P450 84A1-like               221   4e-88    
ref|XP_010685305.1|  PREDICTED: cytochrome P450 71A1-like               240   5e-88    
ref|XP_007204846.1|  hypothetical protein PRUPE_ppa026438mg             235   5e-88    
ref|XP_009122411.1|  PREDICTED: flavonoid 3'-monooxygenase              238   5e-88    
gb|KHF98582.1|  Flavonoid 3',5'-hydroxylase                             237   5e-88    
ref|XP_002285456.1|  PREDICTED: cytochrome P450 71B34-like              228   6e-88    
ref|XP_002310288.1|  cytochrome P450 family protein                     219   6e-88    
ref|XP_003537457.1|  PREDICTED: cytochrome P450 71D8-like               217   6e-88    
ref|XP_002523238.1|  cytochrome P450, putative                          230   6e-88    
gb|KDP34534.1|  hypothetical protein JCGZ_11084                         217   6e-88    
ref|XP_011100951.1|  PREDICTED: cytochrome P450 84A1-like               226   6e-88    
ref|XP_006426677.1|  hypothetical protein CICLE_v10025396mg             228   7e-88    
ref|XP_009378215.1|  PREDICTED: cytochrome P450 84A1-like               222   7e-88    
ref|XP_010452770.1|  PREDICTED: flavonoid 3'-monooxygenase              236   7e-88    
ref|XP_010027084.1|  PREDICTED: cytochrome P450 71A1-like               231   7e-88    
gb|AGT50325.1|  flavonoid 3'-hydroxylase                                229   9e-88    
ref|XP_008241781.1|  PREDICTED: cytochrome P450 84A1                    223   1e-87    
ref|XP_006437055.1|  hypothetical protein CICLE_v10033811mg             247   1e-87    
ref|XP_004511997.1|  PREDICTED: cytochrome P450 71D8-like               216   1e-87    
ref|XP_006829159.1|  hypothetical protein AMTR_s00001p00269980          225   1e-87    
gb|ABR17055.1|  unknown                                                 242   1e-87    
ref|XP_009344942.1|  PREDICTED: premnaspirodiene oxygenase-like         221   1e-87    
ref|XP_010916488.1|  PREDICTED: cytochrome P450 71A1-like               235   1e-87    
gb|EMS57898.1|  Flavonoid 3'-monooxygenase                              244   1e-87    
ref|XP_004307498.1|  PREDICTED: cytochrome P450 71A25-like              236   1e-87    
ref|XP_007020554.1|  Cytochrome P450 71D10, putative                    223   2e-87    
ref|XP_011075268.1|  PREDICTED: cytochrome P450 93A3-like               253   2e-87    
gb|KDP39254.1|  hypothetical protein JCGZ_01011                         224   2e-87    
ref|XP_007046764.1|  Ferulic acid 5-hydroxylase 1                       218   2e-87    
gb|AGC29948.1|  CYP75B65                                                233   2e-87    
ref|XP_006435134.1|  hypothetical protein CICLE_v10000924mg             217   2e-87    
ref|XP_008239349.1|  PREDICTED: cytochrome P450 71A1-like               234   2e-87    
emb|CAN83446.1|  hypothetical protein VITISV_019663                     227   2e-87    
emb|CDP13734.1|  unnamed protein product                                232   2e-87    
ref|XP_011028697.1|  PREDICTED: cytochrome P450 84A1-like               218   3e-87    
ref|XP_008241038.1|  PREDICTED: cytochrome P450 93A3-like               244   3e-87    
gb|ABS53040.1|  Cald5H                                                  216   3e-87    
ref|XP_004956936.1|  PREDICTED: flavonoid 3'-monooxygenase-like         231   3e-87    
ref|XP_002445595.1|  hypothetical protein SORBIDRAFT_07g022320          232   3e-87    
ref|XP_004299092.1|  PREDICTED: cytochrome P450 93A1-like               241   3e-87    
dbj|BAB87839.1|  flavonoid 3'-hydroxalase                               226   4e-87    
gb|KDO40461.1|  hypothetical protein CISIN_1g048667mg                   231   4e-87    
gb|ABK24689.1|  unknown                                                 248   4e-87    
ref|XP_011082249.1|  PREDICTED: premnaspirodiene oxygenase-like         220   4e-87    
ref|XP_006427734.1|  hypothetical protein CICLE_v10025408mg             217   4e-87    
gb|ACN40130.1|  unknown                                                 254   4e-87    
dbj|BAD91808.1|  flavonoid 3'-hydroxylase                               226   5e-87    
ref|XP_004288989.1|  PREDICTED: flavonoid 3'-monooxygenase-like         231   5e-87    
ref|XP_009771564.1|  PREDICTED: flavonoid 3'-monooxygenase-like         232   5e-87    
gb|KEH31755.1|  cytochrome P450 family 71 protein                       238   5e-87    
ref|XP_006841372.1|  hypothetical protein AMTR_s00181p00038960          236   5e-87    
ref|XP_010263873.1|  PREDICTED: cytochrome P450 84A1-like               217   6e-87    
gb|AGT50313.1|  flavonoid 3'-hydroxylase                                226   6e-87    
ref|XP_006841383.1|  hypothetical protein AMTR_s00181p00054110          234   7e-87    
ref|XP_008446152.1|  PREDICTED: uncharacterized protein LOC103488960    214   7e-87    
ref|XP_007203643.1|  hypothetical protein PRUPE_ppa004260mg             222   7e-87    
ref|XP_008392101.1|  PREDICTED: cytochrome P450 93A3                    243   7e-87    
gb|AGT50323.1|  flavonoid 3'-hydroxylase                                226   7e-87    
ref|XP_008351758.1|  PREDICTED: cytochrome P450 71A1-like               231   7e-87    
ref|XP_006465908.1|  PREDICTED: cytochrome P450 71A1-like               226   8e-87    
ref|XP_009129560.1|  PREDICTED: cytochrome P450 71B23-like              226   8e-87    
ref|XP_008392880.1|  PREDICTED: cytochrome P450 71A1-like               231   8e-87    
ref|XP_010111422.1|  Cytochrome P450 93A1                               250   8e-87    



>gb|AFK79031.1| cytochrome P450 CYP736A54 [Bupleurum chinense]
Length=497

 Score =   429 bits (1103),  Expect(2) = 1e-164, Method: Compositional matrix adjust.
 Identities = 205/325 (63%), Positives = 260/325 (80%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +RFG    I+ SSP+AA+ FLKTHDL FA RP  EAAKYISY Q NLS   YGPYW
Sbjct  63    PIMSMRFGFVPNIIVSSPEAAKQFLKTHDLNFAGRPSLEAAKYISYEQRNLSFSTYGPYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLSNLKINSFQAMR++E+  +++ ++QAA +RVAVD+S ++S + +DISC
Sbjct  123   RNMRKLCTLELLSNLKINSFQAMRKKEIANVVDIIEQAAQERVAVDISQRISSMNSDISC  182

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +MVFGKK+E K+ DERGF+GV++  M +    NLGDYFP+L  LDLQGL +RMKA+AK +
Sbjct  183   QMVFGKKFEDKEFDERGFKGVIQVGMQMAVAFNLGDYFPYLGALDLQGLNKRMKAIAKVW  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F E+ILDDH+QS + G   QTKDFVDTML IMKSGE+EF+F+R H+K TL D+F AS 
Sbjct  243   DQFLEKILDDHDQSKEPG---QTKDFVDTMLDIMKSGESEFEFDRSHVKATLMDMFAASA  299

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  IEW +SELLRHP +M KVQ+EL+  +G++RMVEESDLE L+YL MV+KE++RLH
Sbjct  300   DTSSTTIEWTLSELLRHPRVMNKVQKELEQVVGMNRMVEESDLESLEYLGMVIKETMRLH  359

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+ A EDC ++GF IPK 
Sbjct  360   PVAPLLLPHLAIEDCTVDGFFIPKN  384


 Score =   180 bits (457),  Expect(2) = 1e-164, Method: Compositional matrix adjust.
 Identities = 81/117 (69%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+++NVWAI  D NVW++ EKF+PERF GSNID RGR FEL+PFGSGRR CPG
Sbjct  379  FFIPKNSRVVVNVWAIGRDSNVWSDAEKFLPERFIGSNIDLRGRDFELLPFGSGRRGCPG  438

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRLVVAQLLHCFDW+ PN M   ELDMTE+FGLLV RA HL+ IP  RL 
Sbjct  439  MQLGLTVVRLVVAQLLHCFDWDLPNGMQPSELDMTEEFGLLVGRAKHLMAIPTCRLQ  495



>gb|AJD25256.1| cytochrome P450 CYP736A121 [Salvia miltiorrhiza]
Length=496

 Score =   426 bits (1094),  Expect(2) = 7e-161, Method: Compositional matrix adjust.
 Identities = 208/325 (64%), Positives = 260/325 (80%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM+++FG    IV SSP+AAELFLKTHDLVFASRPP +AAKYIS+ Q NLS   YGPYW
Sbjct  63    PIMYMQFGFVPNIVVSSPEAAELFLKTHDLVFASRPPHQAAKYISWDQRNLSFGAYGPYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLS LKINSFQ MRREEL   +ESLK AA +RVAVDLS KV+ L A++SC
Sbjct  123   RNMRKLCTLELLSTLKINSFQPMRREELRLFVESLKGAAGERVAVDLSDKVASLTAEMSC  182

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY+ +D+DERGF+ V++E M L    NLGDYFPFL  LDLQGLTR+MKALAK +
Sbjct  183   RMVFGKKYDDQDIDERGFKKVIQEGMKLAAVPNLGDYFPFLGVLDLQGLTRKMKALAKVF  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FFE++++DH  +G  G   +TKD VDTM+SIM+SGE EFQF+R H+K  + D+  AS 
Sbjct  243   DDFFEKVIEDHVGAGDHG---ETKDIVDTMMSIMQSGECEFQFDRRHVKAIMLDMLAASM  299

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     ++WI+SELLR+P +M+KV++EL+  +GL RMVEESDL+ L+YL MVVKE+ RLH
Sbjct  300   DTAAASVDWILSELLRNPAVMEKVKKELEQVVGLKRMVEESDLDRLEYLNMVVKETYRLH  359

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP LIP+ ARE+  ++G++IPK+
Sbjct  360   PVAPLLIPHYAREESTVDGYNIPKE  384


 Score =   171 bits (433),  Expect(2) = 7e-161, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            +   K+SRII+N +AI  DPN WT+PEKF+PERF GS+ID RG+HF+L+PFGSGRR CPG
Sbjct  379  YNIPKESRIIVNTYAIGRDPNAWTDPEKFLPERFVGSDIDVRGQHFQLLPFGSGRRGCPG  438

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+  VRL+V+QL+HCFDW+ PN MP +EL+M E F L+V+RAN L+ IP++RL 
Sbjct  439  IQLGLIQVRLIVSQLVHCFDWQLPNDMPPKELNMDEDFSLVVTRANPLMAIPSFRLQ  495



>emb|CDP18035.1| unnamed protein product [Coffea canephora]
Length=498

 Score =   415 bits (1066),  Expect(2) = 2e-158, Method: Compositional matrix adjust.
 Identities = 207/324 (64%), Positives = 257/324 (79%), Gaps = 4/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLRFG  + I+ SSP AAE FLKT+DLVFASRPP EAAKYIS+GQ NLS   YGPYW
Sbjct  64    PIMHLRFGFVSNIIVSSPHAAEQFLKTYDLVFASRPPHEAAKYISFGQRNLSFGQYGPYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTL LLSNLKINSFQ+MR +EL  L+ESLKQAA +   VD+S++V+ L A++SC
Sbjct  124   RNMRKLCTLNLLSNLKINSFQSMRMQELELLLESLKQAARNCDVVDISAEVAALNANMSC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MV GKKY  K+ DERGF+ V+KE M L    NLGDY+P+L  LD+QGLTRRMKA+ K +
Sbjct  184   LMVLGKKYADKEFDERGFKAVIKEGMQLSATPNLGDYYPYLGVLDIQGLTRRMKAIGKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D+FFE+I+D+HEQ   +  +    DFV TML++MKSGE EFQF+R HIK  L D+  G+ 
Sbjct  244   DEFFEKIIDEHEQ--YANQTRHVDDFVYTMLALMKSGETEFQFDRRHIKAVLLDMLAGSM  301

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +    ++EWIM+ELL++  +MKKVQ+EL  K+GLDRMVEESDL++L+YL+MVVKE+LRLH
Sbjct  302   DTSATVVEWIMAELLKNSRVMKKVQQELDEKVGLDRMVEESDLDNLRYLDMVVKEALRLH  361

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP LIP+ A EDC ++GFHIPK
Sbjct  362   PVAPLLIPHAAIEDCTVDGFHIPK  385


 Score =   174 bits (441),  Expect(2) = 2e-158, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+IINVWAI  DPN W++P+ FIPERF G++ID RG  F+L+PFGSGRR CPG
Sbjct  381  FHIPKDSRVIINVWAIGRDPNAWSDPDMFIPERFSGNSIDIRGHDFQLLPFGSGRRGCPG  440

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QLG+T+VRL+VAQL+HCF WE PN M   ELDMTE+FGL+V+RA HL+ +P YRL
Sbjct  441  IQLGLTVVRLLVAQLVHCFTWELPNGMLPSELDMTEEFGLVVTRAKHLMAVPTYRL  496



>ref|XP_008234579.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=498

 Score =   398 bits (1022),  Expect(2) = 1e-155, Method: Compositional matrix adjust.
 Identities = 194/324 (60%), Positives = 251/324 (77%), Gaps = 5/324 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM+LR GLA ++VASSPQAAELFLKTHDLVFASRPP +AA++ISYGQ NLS   YG YWR
Sbjct  65    IMYLRLGLAPVVVASSPQAAELFLKTHDLVFASRPPLQAAEHISYGQRNLSFGAYGSYWR  124

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
              MRK+CTLELLS+ KINSF+ MR+EEL  L + +++AA DRV VDLS KV+ L AD+SC 
Sbjct  125   TMRKMCTLELLSSHKINSFKPMRKEELSILTKFIQEAACDRVTVDLSGKVASLTADMSCL  184

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MVFGKKY  K+ DERGF+ V++E M L    N GD+ PF++ LDLQGLT+RMK ++K +D
Sbjct  185   MVFGKKYMDKEFDERGFKAVIQEGMHLAATPNFGDFIPFIAPLDLQGLTKRMKGVSKVFD  244

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GASE  893
              FFE+I+D+H    QS   ++TKDFVD ML  M S E+E++  R +IK  + D+  GA +
Sbjct  245   AFFEKIIDEHI---QSKDQERTKDFVDVMLGFMGSEESEYRIERSNIKAIILDMLAGAMD  301

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
                  IEW +SEL++HP +MKKVQ+EL++ +G++R VEESDLE L+YL+MVVKE++RLHP
Sbjct  302   TTATAIEWTLSELIKHPRVMKKVQKELENVVGMEREVEESDLEKLEYLDMVVKETMRLHP  361

Query  712   VAP-LIPNEAREDCMIEGFHIPKK  644
             VAP L+P+ A EDC + GFHIP+K
Sbjct  362   VAPLLLPHAAIEDCNVSGFHIPRK  385


 Score =   181 bits (460),  Expect(2) = 1e-155, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +KSR++IN++AI  DP++WT+ EKFIPERF+GSNID+RGR F+ IPFGSGRR CPG
Sbjct  380  FHIPRKSRVMINIFAIGRDPSIWTDAEKFIPERFDGSNIDFRGRDFQFIPFGSGRRGCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLGIT+V+LVVAQL+HCFDWE PN+M   ELDMTE+FGL V RA HL+ +P YRL 
Sbjct  440  MQLGITMVQLVVAQLVHCFDWELPNNMLPSELDMTEEFGLTVPRAKHLLAVPTYRLQ  496



>ref|XP_007208656.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
 gb|EMJ09855.1| hypothetical protein PRUPE_ppa022041mg [Prunus persica]
Length=498

 Score =   396 bits (1017),  Expect(2) = 2e-155, Method: Compositional matrix adjust.
 Identities = 192/324 (59%), Positives = 250/324 (77%), Gaps = 5/324 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM++R GLA ++VASSPQAAELFLKTHDLVFASRPP +AA++ISYGQ NLS   YG YWR
Sbjct  65    IMYMRLGLAPVVVASSPQAAELFLKTHDLVFASRPPLQAAEHISYGQRNLSFGAYGSYWR  124

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
              MRK+CTLELLS+ K NSF+ MR+EEL  L + +++AA DRV VDLS KV+ L AD+SC 
Sbjct  125   TMRKMCTLELLSSHKTNSFKPMRKEELALLTKFIQEAASDRVTVDLSGKVASLTADMSCL  184

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MVFGKKY  K+ DERGF+ V++E M L    N GD+ PF++ LDLQGLT+RMK ++K +D
Sbjct  185   MVFGKKYMDKEFDERGFKAVIQEGMHLAATPNFGDFIPFIAPLDLQGLTKRMKGVSKVFD  244

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GASE  893
              FFE+I+D+H    QS   ++TKDFVD ML  M S E+E++  R +IK  + D+  GA +
Sbjct  245   AFFEKIIDEHI---QSTDQERTKDFVDVMLGFMGSEESEYRIERSNIKAIILDMLAGAMD  301

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
                  IEW +SEL++HP +MKKVQ+EL++ +G++R VEESDLE L+YL+MVVKE++RLHP
Sbjct  302   TTATAIEWTLSELIKHPRVMKKVQKELENVVGMEREVEESDLEKLEYLDMVVKETMRLHP  361

Query  712   VAP-LIPNEAREDCMIEGFHIPKK  644
             VAP L+P+ A EDC + GFHIP+K
Sbjct  362   VAPLLLPHAAIEDCNVNGFHIPRK  385


 Score =   182 bits (463),  Expect(2) = 2e-155, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 98/117 (84%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +KSR+IIN++AI  DP++WT+ EKFIPERF+GSNID+RGR F+ IPFGSGRR CPG
Sbjct  380  FHIPRKSRVIINIFAIGRDPSIWTDAEKFIPERFDGSNIDFRGRDFQFIPFGSGRRGCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLGIT+V+LVVAQL+HCFDWE PN+M   ELDMTE+FGL V RA HL+ +P YRL 
Sbjct  440  MQLGITMVQLVVAQLVHCFDWELPNNMLPSELDMTEEFGLTVPRAKHLLAVPTYRLQ  496



>ref|XP_004236729.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=501

 Score =   410 bits (1055),  Expect(2) = 2e-155, Method: Compositional matrix adjust.
 Identities = 200/325 (62%), Positives = 250/325 (77%), Gaps = 2/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM+L+ G  + I+ASSP  AE FLKT+D  FASRPP EAAKYISY Q NL+   YGPYW
Sbjct  64    PIMYLKLGFVDNIIASSPHVAEQFLKTYDQNFASRPPHEAAKYISYDQKNLTFGTYGPYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLS LKINSFQ+MRREEL  LIE+LK+ + +++ VDLS  V+ L  DISC
Sbjct  124   RNMRKLCTLELLSTLKINSFQSMRREELNLLIETLKKKSHEKIVVDLSEIVTRLSVDISC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+FGKKY+ ++   +GF+ V+ E + L    NLGD+FPFL  LDLQGLTRRMKA++K +
Sbjct  184   RMIFGKKYKDEEFGCKGFKSVVNEGLQLAAAPNLGDFFPFLGKLDLQGLTRRMKAVSKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D F E+I+D+HE+S + G     KDFVDTML+IMKSGE EFQF+R H+K  L D+  AS 
Sbjct  244   DNFLEKIIDEHEESDKKGQHQNNKDFVDTMLNIMKSGETEFQFDRGHVKAILLDMLIASM  303

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     I+WI+SELLR P IMKK+Q+E + KIG+ RMVEE DLE L+YL MV+KESLRLH
Sbjct  304   DTSATTIDWILSELLRQPNIMKKLQKEFEEKIGMKRMVEELDLEKLEYLNMVIKESLRLH  363

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+++ EDC I+G+ IPKK
Sbjct  364   PVAPLLLPHQSIEDCTIDGYFIPKK  388


 Score =   168 bits (426),  Expect(2) = 2e-155, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 94/115 (82%), Gaps = 1/115 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVW-TNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSRI++N +AI  DP VW  NP++FIPERF GS+ID RG  FEL+PFGSGRR CPGLQL
Sbjct  387  KKSRILVNTYAIGRDPKVWPNNPDEFIPERFVGSSIDLRGHDFELLPFGSGRRRCPGLQL  446

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            G+ ++RL+VAQL+HCFDWE PN M   +LDM E+FGL+VSRA H++ IPNYRL +
Sbjct  447  GLIIIRLIVAQLVHCFDWELPNGMLPNDLDMGEEFGLVVSRAKHVMAIPNYRLSM  501



>ref|XP_002280620.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=498

 Score =   400 bits (1028),  Expect(2) = 1e-154, Method: Compositional matrix adjust.
 Identities = 196/325 (60%), Positives = 247/325 (76%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++RF L   IV SSPQAAE FLKT+DLVFA RPP E ++ +SY +  +S   YGPYW
Sbjct  64    PIMYMRFALVPTIVVSSPQAAEQFLKTNDLVFAGRPPHEGSRIVSYDRKGISFTDYGPYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTL LLSNL+I+SFQ +RREEL  LI+SLK+AAL R AVDLS+K+S L AD+SC
Sbjct  124   RNMRKLCTLGLLSNLRISSFQPLRREELDLLIKSLKEAALARTAVDLSAKISSLSADMSC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+FGKKY  KD+DERGF+ V++E M L G  N+GDY PF++ LDLQGL RRMKA++K +
Sbjct  184   RMIFGKKYMDKDIDERGFKAVIQEGMQLAGAPNIGDYIPFVAPLDLQGLARRMKAISKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FFE+I+DDH    +     Q KD +D ML  M S E EFQ  R +IK  + D+  G+ 
Sbjct  244   DAFFEKIIDDHIH--EPKEEGQPKDLIDVMLGYMGSKENEFQIERSNIKALVLDMLAGSM  301

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW ++ELL++P IMKKVQEEL+  +G++R VEESDLE L+YL+MVVKE+LRLH
Sbjct  302   DTSATAIEWALAELLKNPRIMKKVQEELEKVVGMERKVEESDLESLEYLDMVVKETLRLH  361

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP LIP+E+ EDC + GFHIP+K
Sbjct  362   PVAPLLIPHESLEDCTVNGFHIPQK  386


 Score =   176 bits (446),  Expect(2) = 1e-154, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +KSR+++N +AI  DPNVWT+ EKF+PERF GS+ID RGR F+LIPFGSGRR CPG
Sbjct  381  FHIPQKSRVMVNTYAIGRDPNVWTDAEKFLPERFIGSSIDLRGRDFQLIPFGSGRRGCPG  440

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QLG+T+VRLV+AQL+HCFDWE PN M   ELDMTE+FGL V RA H++ +P YRL
Sbjct  441  MQLGLTVVRLVLAQLVHCFDWELPNGMMPSELDMTEEFGLTVPRAKHILAVPTYRL  496



>emb|CDP12853.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   402 bits (1032),  Expect(2) = 1e-154, Method: Compositional matrix adjust.
 Identities = 194/322 (60%), Positives = 250/322 (78%), Gaps = 4/322 (1%)
 Frame = -2

Query  1606  MHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWRN  1427
             MHLRFG  + I+ SSP AAE FLKT+DLVFASRPP EAAKY+ +GQ +L+   YGPYWRN
Sbjct  1     MHLRFGFISNIIVSSPHAAEQFLKTYDLVFASRPPHEAAKYLMFGQRSLAFGKYGPYWRN  60

Query  1426  MRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCRM  1247
             MRKLCTL LLSNLKI SFQ++R+EEL   +ESLKQAAL++  VD+ ++V+ L A+++C M
Sbjct  61    MRKLCTLNLLSNLKIGSFQSVRKEELGLFVESLKQAALNQDVVDIGAEVAALSANMTCLM  120

Query  1246  VFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYDK  1067
             VFGKKY  K+ DERGF+ V+KE M L    NLGDY+PFL  LDL+GLTRRMK + K +D+
Sbjct  121   VFGKKYADKEFDERGFKAVIKEAMQLMATPNLGDYYPFLKVLDLRGLTRRMKTVGKIFDE  180

Query  1066  FFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GASEA  890
             F E+I+D+HEQS  +  +    DFV T+L++MKS E EF+F+R HIK  L DL   A + 
Sbjct  181   FLEKIIDEHEQS--ANQARHADDFVYTILALMKSKETEFEFDRRHIKAVLVDLLTAAMDT  238

Query  889   ITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHPV  710
                 +EWI++ELL++P +MKKVQ+EL  K+GL RMVEES+LE+L YL+MVVKE+LRLHPV
Sbjct  239   TATTVEWILAELLKNPRVMKKVQQELDEKVGLHRMVEESELENLTYLDMVVKEALRLHPV  298

Query  709   AP-LIPNEAREDCMIEGFHIPK  647
              P L+P+ A EDC+++GFHIPK
Sbjct  299   VPLLLPHAALEDCIVDGFHIPK  320


 Score =   174 bits (441),  Expect(2) = 1e-154, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+ IN W I  DPN W++PEKF PERF GSNID RG  F+LIPFGSGRRICPG
Sbjct  316  FHIPKDSRVTINAWTIGRDPNAWSDPEKFTPERFIGSNIDVRGHDFQLIPFGSGRRICPG  375

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QLG+T+VRL++A+++HCF+WE PN M   ELDMTE+FGL+++RA HL+ IP YRL
Sbjct  376  MQLGLTVVRLMLARMVHCFNWELPNGMLPSELDMTEEFGLVMTRAKHLMAIPTYRL  431



>ref|XP_007214404.1| hypothetical protein PRUPE_ppa026628mg [Prunus persica]
 gb|EMJ15603.1| hypothetical protein PRUPE_ppa026628mg [Prunus persica]
Length=496

 Score =   397 bits (1021),  Expect(2) = 2e-154, Method: Compositional matrix adjust.
 Identities = 195/325 (60%), Positives = 247/325 (76%), Gaps = 6/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM++R GL   IV SSPQAA+LFLKTHDLVFASRPP E AK+IS+GQ NLS   YGPYWR
Sbjct  63    IMYMRLGLMPTIVVSSPQAAKLFLKTHDLVFASRPPHEGAKHISFGQRNLSFAEYGPYWR  122

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAAL-DRVAVDLSSKVSELIADISC  1253
             +MRK+CTLELLSN KINSF++MRREE+   +ES++ AA   RVAVDLS  VS L  D+SC
Sbjct  123   DMRKMCTLELLSNHKINSFKSMRREEVALCVESIRDAAYKGRVAVDLSDIVSSLSVDMSC  182

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  +D D RGFR V+KE + L G  NL DY PF++ LDLQG T+RMK++ K +
Sbjct  183   RMVLGKKYRDEDFDARGFRSVIKEGIQLAGASNLADYIPFIAPLDLQGFTKRMKSVNKAF  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FFE+I+++H QS      ++TKDFVD M+  M S E+E+Q  R HIK  + D+  AS 
Sbjct  243   DVFFEKIIEEHLQSND---GERTKDFVDVMVGFMGSVESEYQIERPHIKAIIMDMLVASM  299

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  ++W +SEL+RHP+ MK+VQ+EL+  +GL+RMVEESDLE L YL MVVKE+LRLH
Sbjct  300   DTSSTTVDWALSELMRHPKAMKEVQKELEDVVGLERMVEESDLEKLDYLSMVVKETLRLH  359

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+ A EDC++ G+HIPKK
Sbjct  360   PVAPLLVPHAATEDCIVNGYHIPKK  384


 Score =   177 bits (450),  Expect(2) = 2e-154, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+IIN WAI  DP+ WT+ E+FIPERFEGS++D RG HF+LIPFGSGRR CPG+QLG
Sbjct  383  KKSRVIINAWAIGRDPSAWTDAEEFIPERFEGSDVDVRGNHFQLIPFGSGRRRCPGIQLG  442

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +T+V+L++AQL+HCFDWE PN+M  EELDM+E FG+ V R   LI IP+YRLH
Sbjct  443  LTVVQLMLAQLVHCFDWELPNNMLPEELDMSESFGITVERVKRLIAIPSYRLH  495



>ref|XP_008227122.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=496

 Score =   395 bits (1015),  Expect(2) = 4e-154, Method: Compositional matrix adjust.
 Identities = 193/325 (59%), Positives = 245/325 (75%), Gaps = 6/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             +M++R GL   IV SSPQAA+LFLKTHDLVFASRPP E AK+IS+GQ NLS   YGPYWR
Sbjct  63    VMYMRLGLMPTIVVSSPQAAKLFLKTHDLVFASRPPHEGAKHISFGQRNLSFAEYGPYWR  122

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAAL-DRVAVDLSSKVSELIADISC  1253
             +MRK+CTLELLSN KINSF++MRREE+   +ES++ AA    VAVDLS  VS L  D+SC
Sbjct  123   DMRKMCTLELLSNHKINSFKSMRREEVALCVESIRDAAYKGHVAVDLSDIVSSLSVDMSC  182

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  +D D RGFR V+KE + L G  NL DY PF++ LDLQG T+RMK++ K +
Sbjct  183   RMVLGKKYRDEDFDTRGFRSVIKEGLQLAGASNLADYIPFIAPLDLQGFTKRMKSVNKAF  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FFE+I+++H QS      ++TKDFVD M+  M S E+E+Q  R HIK  + D+  AS 
Sbjct  243   DTFFEKIIEEHLQSND---GERTKDFVDVMVGFMGSEESEYQIERPHIKAIIMDMLVASM  299

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  ++W +SEL+RHP+ MK+VQ+EL+  +GL+RMVEESDLE L YL MVVKE+LRLH
Sbjct  300   DTSSTTVDWALSELMRHPKAMKQVQKELEDVVGLERMVEESDLEKLDYLSMVVKETLRLH  359

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+ A EDC + G+HIPKK
Sbjct  360   PVAPLLVPHAATEDCTVNGYHIPKK  384


 Score =   179 bits (454),  Expect(2) = 4e-154, Method: Compositional matrix adjust.
 Identities = 78/113 (69%), Positives = 97/113 (86%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+IIN WAI  DP+ WT+ E+FIPERFEGS++D RG HF+LIPFGSGRR CPG+QLG
Sbjct  383  KKSRVIINAWAIGRDPSAWTDAEEFIPERFEGSDVDVRGNHFQLIPFGSGRRRCPGIQLG  442

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +T+V+L++AQL+HCFDWE PN+M  EELDM+E FG+ V+RA  LI IP+YRLH
Sbjct  443  LTVVQLMLAQLVHCFDWELPNNMLPEELDMSEVFGITVARAKRLIAIPSYRLH  495



>ref|XP_007213194.1| hypothetical protein PRUPE_ppa026652mg [Prunus persica]
 gb|EMJ14393.1| hypothetical protein PRUPE_ppa026652mg [Prunus persica]
Length=494

 Score =   393 bits (1010),  Expect(2) = 5e-154, Method: Compositional matrix adjust.
 Identities = 192/324 (59%), Positives = 250/324 (77%), Gaps = 6/324 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IMH+R GL   IV SSPQAAELFLKTHDLVFA+RPP E AK++S+GQ NLS   YG YWR
Sbjct  61    IMHMRLGLVPTIVVSSPQAAELFLKTHDLVFATRPPHEGAKHLSFGQRNLSFVEYGSYWR  120

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALD-RVAVDLSSKVSELIADISC  1253
             ++RK+CTLELLSN KINSF++MR+EE+   IES+++AA +  VA+DLS +VS L  D+SC
Sbjct  121   DIRKMCTLELLSNHKINSFKSMRKEEVALFIESIQEAANNGHVAIDLSDRVSSLSVDMSC  180

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  ++LDERGF+ ++KE M L    NLGDY P ++ LDLQG T+RMKA+ K +
Sbjct  181   RMVLGKKYRDEELDERGFKSLIKEGMQLAAAPNLGDYIPCIAQLDLQGFTKRMKAINKAF  240

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FFE+I+D+H QS       +TKDFVD M+ IM S E++++  R +IK  + D+  AS 
Sbjct  241   DNFFEKIIDEHLQSKDEY---RTKDFVDVMVGIMGSAESQYRIERSNIKAIILDMLVASM  297

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  IEW++SEL+RHP +MKKV++EL+  +GL+RMVEESDLE L+YL++VVKE+LRLH
Sbjct  298   DTSSTTIEWVLSELMRHPHVMKKVRKELEDVVGLERMVEESDLEKLEYLDIVVKETLRLH  357

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP LIP+ A EDC + GFHIPK
Sbjct  358   PVAPLLIPHAAIEDCTVNGFHIPK  381


 Score =   181 bits (458),  Expect(2) = 5e-154, Method: Compositional matrix adjust.
 Identities = 82/117 (70%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+IINVW+I  DP+ WT+ EKFIPERF GSNID RG HFELIPFGSGRR CPG
Sbjct  377  FHIPKASRVIINVWSIGRDPSAWTDAEKFIPERFVGSNIDVRGNHFELIPFGSGRRRCPG  436

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QL +T+V+L+VAQL+HCFDWE PNSM   ELDM+E+FGL V RA HL+ IP+YRLH
Sbjct  437  IQLRLTMVQLMVAQLVHCFDWELPNSMLPNELDMSEEFGLTVPRAKHLLAIPSYRLH  493



>ref|XP_002532045.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF30335.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=505

 Score =   400 bits (1029),  Expect(2) = 6e-154, Method: Compositional matrix adjust.
 Identities = 195/325 (60%), Positives = 252/325 (78%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL + IV SSPQAAE FLKTHDL FASRPP +AAK+ISY Q NLS  PYG YW
Sbjct  72    PIMHLRLGLVSTIVVSSPQAAESFLKTHDLAFASRPPHQAAKFISYEQKNLSFAPYGSYW  131

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN+K+NSF++MR+EEL  LI+ +K A+  RVAVDLS+KV+ L AD+SC
Sbjct  132   RNVRKMCTLELLSNVKVNSFKSMRKEELDLLIDCIKNASCQRVAVDLSAKVASLSADMSC  191

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  K+ DERGF+ V++E M L    NLG+Y P ++ LDLQGLT+RMKA++K +
Sbjct  192   RMVFGKKYMDKEFDERGFKAVIQEGMHLGAAPNLGNYIPQIAGLDLQGLTKRMKAVSKVF  251

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FFE+I+D+H    +    ++TKDFVD ML  M S  +E+   R++IK  + D+  G+ 
Sbjct  252   DSFFEKIIDEHM---EFKDENRTKDFVDVMLGFMGSEVSEYHIGRDNIKAIILDMLAGSM  308

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +    +IEW +SELL+HP +MKKVQ+EL+ K+G+ RMVEESD+E L+YLEMV+KE+ RLH
Sbjct  309   DTSAAVIEWALSELLKHPGVMKKVQKELEEKVGMTRMVEESDVEKLEYLEMVIKETFRLH  368

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+EA ED  I+G+ IPKK
Sbjct  369   PVAPLLLPHEAAEDTTIDGYLIPKK  393


 Score =   173 bits (439),  Expect(2) = 6e-154, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKS IIIN +AI  DP+ WT  EKF+PERF G NID RGR F+L+PFG+GRR CPG+QLG
Sbjct  392  KKSHIIINTFAIGRDPSAWTEAEKFLPERFLGRNIDIRGRDFQLLPFGAGRRGCPGIQLG  451

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            +T+VRLVVAQL+HCFDWE PN M   ELDMTE+F L+  RA HL  IPNYRLHI
Sbjct  452  MTVVRLVVAQLVHCFDWELPNGMLPTELDMTEEFSLVTPRAKHLEAIPNYRLHI  505



>ref|XP_008347028.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
 ref|XP_008356594.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   394 bits (1011),  Expect(2) = 1e-153, Method: Compositional matrix adjust.
 Identities = 195/324 (60%), Positives = 250/324 (77%), Gaps = 5/324 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM+LR GLA +I+ASSPQAAELFLKTHDL FASRPP EAAK+IS+GQ NLS   YG YWR
Sbjct  64    IMYLRLGLAPVIIASSPQAAELFLKTHDLNFASRPPLEAAKHISWGQRNLSFGEYGSYWR  123

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
              MRK+CTLELLS  KINSF++ R+EEL  LI  +++AA DRV V+LS+KVS L ADISC 
Sbjct  124   TMRKMCTLELLSAHKINSFKSTRKEELALLINFIQEAARDRVTVNLSAKVSSLSADISCL  183

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MVFGKKY+ K+LDE+GF+ V++E M L    N GDY PFL+ LDLQGLT+RMK + K +D
Sbjct  184   MVFGKKYKDKELDEKGFKAVVQEGMHLAATPNFGDYIPFLAPLDLQGLTKRMKVVHKVFD  243

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GASE  893
              FFE+I+D+H    QS S ++ KDFVD ML  M S E+E++  R +IK  + D+  G+ +
Sbjct  244   DFFEKIIDEHL---QSTSEERPKDFVDVMLGFMGSVESEYRIERSNIKAIMLDMLSGSMD  300

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
                   EW +SELL+HP++MKKVQ+E+++ +G++RMVEESDLE L+YL+ VVKE++RLHP
Sbjct  301   TTATSTEWTLSELLKHPQVMKKVQKEIENVVGMERMVEESDLEKLEYLDKVVKETMRLHP  360

Query  712   VAP-LIPNEAREDCMIEGFHIPKK  644
             VAP L+P+ A EDC + GFHIP K
Sbjct  361   VAPLLLPHAAIEDCNVNGFHIPGK  384


 Score =   179 bits (454),  Expect(2) = 1e-153, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  645  KSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLGI  466
            KSRI+IN+WAI  +P+VWT+ +KFIPERF+GSNID+RGR F+ IPFGSGRR CPG+QLGI
Sbjct  384  KSRIMINIWAIGRNPSVWTDADKFIPERFDGSNIDFRGRDFQFIPFGSGRRGCPGMQLGI  443

Query  465  TLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            T+V L+VAQL+HCFDWE PN+M   ELDMTE+FGL V RANHL+ +P YRL
Sbjct  444  TMVLLLVAQLVHCFDWELPNNMLPTELDMTEEFGLTVPRANHLLALPTYRL  494



>ref|XP_009802012.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=500

 Score =   389 bits (998),  Expect(2) = 6e-153, Method: Compositional matrix adjust.
 Identities = 188/324 (58%), Positives = 244/324 (75%), Gaps = 3/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +RFGL  +IVASSP AAELFLK HDLVFASRP   AA+YI Y Q NL+   YGPYW
Sbjct  65    PIMSMRFGLVPIIVASSPHAAELFLKKHDLVFASRPYNTAAQYIGYNQRNLTFGKYGPYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLS+LKINSFQAMR++E+   +  L +AA + + VD+S+K++ L A+++C
Sbjct  125   RNMRKLCTLELLSSLKINSFQAMRKQEIGNFVTFLNRAASNGIEVDISAKLASLSANMAC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  ++ DERGF+ V++E + +    N+G++FPFL   DLQG   RMK LAK +
Sbjct  185   LMVFGKKYMDEEFDERGFKDVIQETLVITATPNIGEFFPFLDRFDLQGFVPRMKKLAKIF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FFE+I+D+H Q  +   + Q KD VDTM++IM+SGEAEF+F+R HIK  L D+  AS 
Sbjct  245   DDFFEKIIDEHVQDSKR-ENKQAKDIVDTMMAIMQSGEAEFEFDRRHIKAVLLDMLIASM  303

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  I+W  +ELLRHP +MKK+Q EL+  +G +RMVEESDLE L YL+MVVKE  RLH
Sbjct  304   DTASTAIDWTFTELLRHPNVMKKLQNELEQVVGTNRMVEESDLEKLDYLDMVVKEGFRLH  363

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP L+P E+ EDC+++GF IPK
Sbjct  364   PVAPLLLPRESIEDCIVDGFDIPK  387


 Score =   182 bits (461),  Expect(2) = 6e-153, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SRI++N WAI  DP  W  PEKF PERF GSNID RGR F+L+PFGSGRR CPG
Sbjct  383  FDIPKGSRILVNTWAIGRDPEAWPEPEKFKPERFVGSNIDLRGRDFQLLPFGSGRRSCPG  442

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LQLG+T+VRLV+AQL+HCFDWE PN M  E+LDMTE+FGL+ +RA HL+ IP Y+LH+
Sbjct  443  LQLGLTIVRLVLAQLVHCFDWELPNGMAPEDLDMTEKFGLVTARAQHLVAIPTYQLHV  500



>ref|XP_004304846.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=499

 Score =   393 bits (1009),  Expect(2) = 3e-152, Method: Compositional matrix adjust.
 Identities = 194/324 (60%), Positives = 242/324 (75%), Gaps = 4/324 (1%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM+LR GL   IV SSPQAAELFLKTHD  FA+RPP EAAK+ISYGQ NLS   YGPYWR
Sbjct  65    IMYLRLGLVPTIVVSSPQAAELFLKTHDHSFATRPPHEAAKHISYGQRNLSYAEYGPYWR  124

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
              +RK+CTLELLSN KINS + MR+EEL   +  +++A  DR AVDLS+KVS L  D++CR
Sbjct  125   TIRKMCTLELLSNHKINSLKPMRKEELDLFMNFIQEACRDRAAVDLSAKVSSLNTDMTCR  184

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             +VFGKKY  K+ DE+GF+  + E M L G  N GDY PFL+  DLQGLT+RMKA+ K +D
Sbjct  185   LVFGKKYMDKEFDEKGFQAWIVEGMHLAGTPNFGDYLPFLAPFDLQGLTKRMKAVRKVFD  244

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GASE  893
              FFE+I+D+H +S      ++TKDFVD ML  M S E+E++  R +IK  + D+  GA +
Sbjct  245   DFFEKIIDEHIKS--QDDQERTKDFVDVMLCFMGSKESEYKIERSNIKAIILDMVAGAMD  302

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
                  IEW +SEL+RHP +MKKVQ+EL+  +G+DRMV+ESDLE L+YL MVVKE+LRLHP
Sbjct  303   TSATAIEWTLSELMRHPRVMKKVQKELEDVVGMDRMVDESDLEKLEYLNMVVKENLRLHP  362

Query  712   VAP-LIPNEAREDCMIEGFHIPKK  644
             VAP LIP+ A EDC + GFHIPKK
Sbjct  363   VAPLLIPHAAIEDCTVNGFHIPKK  386


 Score =   175 bits (444),  Expect(2) = 3e-152, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+++NVWA+  DP+ WT+P+KFIPERF GSNID RGR F+L+PFGSGRR CPG
Sbjct  381  FHIPKKSRVMVNVWAVGRDPSAWTDPDKFIPERFVGSNIDLRGRDFQLLPFGSGRRGCPG  440

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            + LG+T+V LVVAQL+HCFDWE P+++   ELDMTE+FGL V RA HL+ IP+YRL
Sbjct  441  MHLGLTVVHLVVAQLVHCFDWELPDNILPTELDMTEEFGLTVPRAKHLLAIPSYRL  496



>ref|XP_002310015.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90465.1| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   392 bits (1007),  Expect(2) = 3e-151, Method: Compositional matrix adjust.
 Identities = 194/325 (60%), Positives = 248/325 (76%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   +V SSP+AAEL LKT+DLVFA+RPP EAAK+I+Y Q NLS  PYG YW
Sbjct  64    PIMYMRLGLVPTVVVSSPRAAELILKTNDLVFANRPPNEAAKHITYEQKNLSFAPYGSYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF + R+EEL  LI+ +K A+ +RVAVDLS+KVS L ADISC
Sbjct  124   RNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDASRERVAVDLSAKVSSLSADISC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  K+ DE+GF+ +  E M L    NLGDY P ++ LDLQGLT+RMKA+ K +
Sbjct  184   RMVFGKKYLEKEFDEKGFKPLTHEAMRLTASFNLGDYIPPIAPLDLQGLTKRMKAVGKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D FFE+I+D+H Q       ++TKDFVD ML  + S E E++  R++IK  + D L G+ 
Sbjct  244   DDFFEKIIDEHIQIKD---ENRTKDFVDVMLDFLGSEETEYRIGRDNIKAIILDMLVGSM  300

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SEL++HP +MKKVQ+EL+ KIG+DRMVEESDLE L+YL MV+KE+ RLH
Sbjct  301   DTSAAAIEWTLSELIKHPRVMKKVQKELEEKIGMDRMVEESDLEGLEYLHMVIKEAFRLH  360

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+E+ EDC I+GF IP+K
Sbjct  361   PVAPLLVPHESMEDCTIDGFLIPQK  385


 Score =   172 bits (437),  Expect(2) = 3e-151, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +K+R+I+NVWAI  D + WT+  KFIPERF GSNID RGR F+L+PFGSGRR CPG
Sbjct  380  FLIPQKTRVIVNVWAIGRDQSAWTDANKFIPERFAGSNIDVRGRDFQLLPFGSGRRSCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            + LG+T+VR +VAQL+HCF+WE PN+M  EELDMTE F L+  RANHL   P YRLH+
Sbjct  440  MHLGLTMVRQIVAQLVHCFEWELPNNMLPEELDMTEAFSLVTPRANHLCATPTYRLHL  497



>emb|CDP12933.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   401 bits (1030),  Expect(2) = 3e-151, Method: Compositional matrix adjust.
 Identities = 198/325 (61%), Positives = 252/325 (78%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH+RFG    I+ SSP+AAE FLKT+D VFASRP  E++ Y+SY Q NL+   YGPYW
Sbjct  64    PIMHMRFGYVPAIIVSSPEAAEKFLKTYDQVFASRPYHESSWYVSYEQRNLTFGQYGPYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLC L+LLS+ KINSF  MRREE+  L++SLKQAA D  AVDLS+ +S L A++SC
Sbjct  124   RNMRKLCILQLLSSHKINSFLPMRREEVGTLVKSLKQAASDGAAVDLSASISSLGANMSC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FGKKY  KD D+RGFR V++E + +    NLGDYFP L  LDLQGLTRR K LAK +
Sbjct  184   LMIFGKKYMDKDFDDRGFRDVIQEGLHVAAMPNLGDYFPLLGVLDLQGLTRRFKDLAKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGASE  893
             DKFFE+I+D+H QS +     QTKDFVD M+ IM+SGEAEF+F+R H+K  L DL  AS 
Sbjct  244   DKFFEKIIDEHLQSQE---HKQTKDFVDIMMGIMQSGEAEFEFDRRHVKAILLDLLVASM  300

Query  892   AITIL-IEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
               ++  +EW +SELLRHPE M+K+Q+EL+ K+GL+R+VEESD+E L+YL+MV+KES+RLH
Sbjct  301   DTSVTAVEWAISELLRHPEAMRKLQKELEEKVGLERIVEESDIEGLEYLDMVIKESMRLH  360

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+E+ EDC ++ FHI KK
Sbjct  361   PVAPLLLPHESMEDCTVDDFHIQKK  385


 Score =   163 bits (413),  Expect(2) = 3e-151, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QKKSRIIIN++ I  DPNVW +PE F PERF+ SNID RG+ F LIPFGSGRR CPG
Sbjct  380  FHIQKKSRIIINIYTIGRDPNVWPDPETFNPERFKDSNIDLRGQDFRLIPFGSGRRSCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LQLG+ LVR V+AQL+HCF+WE  +++   +LDM+E FG++ SRA HL VIP YRL
Sbjct  440  LQLGLLLVRFVLAQLVHCFNWELADNIRPTDLDMSEAFGIVTSRATHLRVIPTYRL  495



>ref|XP_006363549.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Solanum tuberosum]
 ref|XP_006363550.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Solanum tuberosum]
Length=499

 Score =   388 bits (996),  Expect(2) = 3e-151, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 247/324 (76%), Gaps = 4/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +RFG   +IVASSP AAE FLK HDL+FASRP   AAK+I+Y Q NL+   YGPYW
Sbjct  65    PIMSMRFGFVPVIVASSPHAAEQFLKNHDLIFASRPNNIAAKFIAYDQRNLTFGKYGPYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLS LKINSFQAMR++E+   +  +  AA   V +D+S+K++ L  +++C
Sbjct  125   RNMRKLCTLELLSTLKINSFQAMRKQEVTNFVTFINGAASSGVEIDISAKLATLNTNMTC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY   + DERGF+ V++E + L    N+G++FPFL+  DLQG+ RRMK L+K +
Sbjct  185   LMVFGKKYMDDEFDERGFKYVIQETLVLTATPNIGEFFPFLNVFDLQGVVRRMKELSKIF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+FFERI+D+H Q   S    QTKD VDTM++IM+SGE+EF+F+R H+K  L D+  AS 
Sbjct  245   DEFFERIIDEHVQD--SKKEKQTKDIVDTMMNIMQSGESEFEFDRRHVKAILLDMLIASM  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  I+WI +ELLRHP+++KK+Q+EL+  +G++RMVEESDLE L+YL+MV+KE  RLH
Sbjct  303   DTSSTAIDWIFTELLRHPKVIKKLQKELEQIVGMNRMVEESDLEKLEYLDMVIKEGFRLH  362

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP LIP+E+ EDC I+GF IPK
Sbjct  363   PVAPLLIPHESIEDCTIDGFDIPK  386


 Score =   177 bits (448),  Expect(2) = 3e-151, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+++N WAI  DP +W+ PEKF+PERF GSNID RG +F+L+PFGSGRR CPG
Sbjct  382  FDIPKGSRLLVNTWAIGRDPEIWSEPEKFMPERFVGSNIDLRGNNFQLLPFGSGRRSCPG  441

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LQLG+T VRLV+AQ++HCFDW+ PN M   +LDMTE+FGL+++RA HL+VIP YRL++
Sbjct  442  LQLGLTTVRLVLAQMVHCFDWKLPNGMMPNDLDMTEKFGLVMTRAQHLMVIPTYRLNV  499



>ref|XP_010099912.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB80841.1| Cytochrome P450 71A1 [Morus notabilis]
Length=500

 Score =   392 bits (1006),  Expect(2) = 4e-151, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 254/325 (78%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH+R GL   ++ SSP+AAELFLKTHDLVFA+RPP EAAK+IS+ Q NLS  PYG YW
Sbjct  65    PIMHMRLGLIPTVIVSSPEAAELFLKTHDLVFATRPPHEAAKHISWEQRNLSFAPYGSYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RK+CTLELLS+ KI++F  MR+EE+   I+S+++AALD VAVDLS++++ L AD++C
Sbjct  125   RDIRKMCTLELLSSHKISTFSEMRKEEIGLSIKSIREAALDHVAVDLSARITCLNADMTC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  ++ DERGF+ V++E M L    NLGDY PF++ LDLQG T+RMK + + +
Sbjct  185   RMVFGKKYSDEEFDERGFKAVVQEGMHLAATPNLGDYIPFIAPLDLQGFTKRMKKVRRVF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D+FFE+I+D+H QS     + +TKDFVD MLS M S E+E++  R +IK  + D+  G+ 
Sbjct  245   DEFFEKIIDEHIQS--KDDAGKTKDFVDVMLSFMGSKESEYRIERTNIKAIILDMVAGSM  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +   EW +SEL+++P ++KKVQ+EL++ +G+DR VEESDLE L+YL+MVVKE+LRLH
Sbjct  303   DTSSTATEWAISELIKNPRVLKKVQKELETVVGMDRTVEESDLERLEYLDMVVKETLRLH  362

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP LIP+ A EDC++ GFHIP K
Sbjct  363   PVAPLLIPHAAMEDCIVNGFHIPNK  387


 Score =   172 bits (437),  Expect(2) = 4e-151, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F    KSR++INV+AI  DPN WT+PEKF PERF GS++D RGR F+LIPFGSGRR CPG
Sbjct  382  FHIPNKSRVMINVYAIGRDPNSWTDPEKFFPERFVGSSVDLRGRDFQLIPFGSGRRGCPG  441

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRL+VAQL+HCFDWE PN M   ELDM E+FGL   RANHL+ IP  RL 
Sbjct  442  MQLGLTVVRLLVAQLVHCFDWELPNGMLPAELDMEEEFGLTTPRANHLMAIPTCRLQ  498



>ref|XP_002310014.1| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90464.1| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   389 bits (999),  Expect(2) = 5e-151, Method: Compositional matrix adjust.
 Identities = 196/325 (60%), Positives = 245/325 (75%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   +V SSP+AAEL LKT+DLVFASRP  EAAK+ISY Q NLS  PYG YW
Sbjct  64    PIMYMRLGLVPTVVVSSPRAAELILKTNDLVFASRPRNEAAKHISYEQKNLSFAPYGSYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF + R+EEL  LI+ +K A+ +RVAVDL +KVS L ADISC
Sbjct  124   RNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDASRERVAVDLGAKVSSLSADISC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  K+ DE+GF+ V  E M L    NLGDY P ++ LDLQGLT+RMKA+ K +
Sbjct  184   RMVFGKKYLEKEFDEKGFKPVTHELMRLAASFNLGDYIPPIAPLDLQGLTKRMKAVGKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D FFE+I+D+H Q       ++TKDFVD ML  + S E E+   R++IK  + D L G+ 
Sbjct  244   DDFFEKIIDEHIQFKD---ENRTKDFVDVMLDFLGSEETEYSIGRDNIKAIILDMLVGSM  300

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SEL+RHP +MKKVQ+EL+ KIG+DRMVEESDLE L+YL MV+KE+ RLH
Sbjct  301   DTSATAIEWTLSELIRHPRVMKKVQKELEEKIGMDRMVEESDLEGLEYLHMVIKEAFRLH  360

Query  715   PVAPLI-PNEAREDCMIEGFHIPKK  644
             PVAPL+ P+E+ EDC I+GF IP+K
Sbjct  361   PVAPLLGPHESMEDCTIDGFLIPQK  385


 Score =   175 bits (443),  Expect(2) = 5e-151, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +K+R+I+NVWAI  D + WT+  KFIPERF GSNID RGR F+L+PFG+GRR CPG
Sbjct  380  FLIPQKTRVIVNVWAIGRDQSAWTDANKFIPERFAGSNIDVRGRDFQLLPFGAGRRGCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            + LG+T+VR +VAQL+HCFDWE PN+M  EELDMTE FGL+  RANHL   P YRLH+
Sbjct  440  MHLGLTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRLHL  497



>ref|XP_006428071.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
 ref|XP_006464323.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41311.1| hypothetical protein CICLE_v10027549mg [Citrus clementina]
Length=498

 Score =   403 bits (1035),  Expect(2) = 6e-151, Method: Compositional matrix adjust.
 Identities = 198/324 (61%), Positives = 251/324 (77%), Gaps = 5/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSPQAAELFLKTHDL+FASRPP +AAK+ISY Q  L+  PYG YW
Sbjct  65    PIMHLRLGLTPTIVVSSPQAAELFLKTHDLIFASRPPLKAAKHISYEQKGLALSPYGSYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R +RK+CTLELLS+ KINSFQAMR+EEL  LI S+K+AA  R  VDLS+KVS + AD++C
Sbjct  125   RTIRKICTLELLSSFKINSFQAMRKEELDLLIASIKEAACARCVVDLSTKVSAMSADMTC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY   + DERGF+ V++E M+L  K NLGDY P ++ LDLQGLT+RMK++AK +
Sbjct  185   RMVFGKKYSDDEFDERGFKTVIQEGMELAAKPNLGDYIPQIAGLDLQGLTKRMKSVAKVF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D F E+I+D+H QS      ++TKDFVD MLS   S E E +  REHIK  + D+  A+ 
Sbjct  245   DGFLEKIIDEHVQSKD---ENRTKDFVDVMLSFEGSEETEHKIEREHIKAIILDMLSAAM  301

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     +EW +SEL++HP++MKK+Q+EL+  +GL RMVEESDLE+L+YL+MVVKE+LRLH
Sbjct  302   DTSATAVEWALSELIKHPKVMKKLQKELEKIVGLCRMVEESDLENLEYLDMVVKETLRLH  361

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP LIP+E+ EDC + GF+IPK
Sbjct  362   PVAPLLIPHESTEDCTVNGFYIPK  385


 Score =   161 bits (407),  Expect(2) = 6e-151, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 90/118 (76%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+I+NVWAI  D   W++PE F PERF GS+ID RG  F+L+PFGSGRR CPG
Sbjct  381  FYIPKNSRVIVNVWAIGRDTESWSDPEIFFPERFVGSSIDLRGHDFQLLPFGSGRRGCPG  440

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            +QLG+T+V+ V+AQL+HCFDWE P  M   ELD+TE+F L+  +A HL+ IP+YRL+I
Sbjct  441  MQLGLTIVKQVIAQLVHCFDWELPGGMLPTELDLTEEFSLVTPKAKHLLAIPSYRLNI  498



>ref|XP_008364815.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Malus domestica]
Length=499

 Score =   393 bits (1009),  Expect(2) = 6e-151, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 256/325 (79%), Gaps = 6/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM+LR GL   +V SSP+AAELFLKTHDLVFASRPP E +K+IS+GQ NLS   YG YWR
Sbjct  66    IMYLRLGLVPTVVVSSPRAAELFLKTHDLVFASRPPHEGSKHISFGQRNLSFAEYGSYWR  125

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQ-AALDRVAVDLSSKVSELIADISC  1253
             ++RK+CTLELLSN KINSF++MRREE+  LI+S+++ A   RVA+DLS KVS L  D++C
Sbjct  126   DIRKMCTLELLSNHKINSFKSMRREEVALLIQSVEEDANXGRVAIDLSVKVSSLSVDMTC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY+ ++ DERGF  V+KE + L    NLGDY P ++ LDLQG T++MKA+ K +
Sbjct  186   RMVFGKKYKDEEFDERGFTAVMKEGLKLSAGPNLGDYIPCIAPLDLQGFTKKMKAINKAF  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D+FFE+I+D H    QS   ++TKDFVD M++ M S +++++  R +IK  + D+F G+ 
Sbjct  246   DEFFEKIIDXHL---QSKDEERTKDFVDVMVAFMGSEDSDYRIERTNIKAIMLDMFAGSM  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  +EW +SEL+RHP++MKKVQ+EL++ +GL+RMVEESDLE L+YL+MVVKE+LRLH
Sbjct  303   DTTSTTVEWALSELMRHPQVMKKVQKELENVVGLNRMVEESDLEKLEYLDMVVKETLRLH  362

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+ A EDC+++G+H+PKK
Sbjct  363   PVAPLLVPHAAIEDCIVDGYHVPKK  387


 Score =   171 bits (432),  Expect(2) = 6e-151, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKS +IIN WAI  D + W + EKF+PERFEG+N+D RG HF+LIPFGSGRR CPG+QLG
Sbjct  386  KKSLVIINAWAIGRDQSAWEDAEKFVPERFEGNNVDVRGNHFQLIPFGSGRRRCPGIQLG  445

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +T+V+ V+AQL+HCFDWE P++M   +LDMTE FGL VSRA HL+ IP+YRL 
Sbjct  446  LTVVQFVLAQLVHCFDWELPDNMLPNDLDMTEDFGLTVSRAKHLLAIPSYRLQ  498



>emb|CDP01387.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   391 bits (1004),  Expect(2) = 7e-151, Method: Compositional matrix adjust.
 Identities = 194/325 (60%), Positives = 249/325 (77%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M++RFG    I+ SSP+AAE FLKT+D VFASRP  E++ ++SY Q NLS   YGPYW
Sbjct  64    PLMYMRFGYVPAIIVSSPEAAEKFLKTYDQVFASRPYHESSWHVSYEQRNLSFAQYGPYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLC L+LLS+ KINSF  MRREE+  L++SLKQAA D  AVDLS+ +S L A++SC
Sbjct  124   RNMRKLCILQLLSSHKINSFLPMRREEVGTLVKSLKQAASDGAAVDLSAAISSLGANMSC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FGKKY  KD D+RGFR V++E + L    NLGDYFP L  LDLQGLTRR K LAK +
Sbjct  184   LMIFGKKYMDKDFDDRGFRDVIQEALRLGATPNLGDYFPLLGVLDLQGLTRRFKDLAKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGASE  893
             DKFFE+I+D+H QS +     QTKD VD M+ IM+SGEAEF+F+R H+K  L DL  AS 
Sbjct  244   DKFFEKIIDEHLQSQE---HKQTKDVVDIMMGIMQSGEAEFEFDRRHVKAVLLDLLVASM  300

Query  892   AITIL-IEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
               ++  +EW +SELLR PE M+K+Q+EL+ K+GL+R VEESD+E L+YL+MV+KE++RLH
Sbjct  301   DTSVTAVEWAISELLRRPEAMRKLQKELEDKVGLERTVEESDVEGLEYLDMVIKETMRLH  360

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+E+ EDC ++ FHI KK
Sbjct  361   PVAPLLLPHESMEDCAVDDFHIQKK  385


 Score =   172 bits (436),  Expect(2) = 7e-151, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QKKSRIIINV+AI HDPNVW +PE FIPERF+ SNID RG+ F+LIPFGSGRR CPG
Sbjct  380  FHIQKKSRIIINVYAIGHDPNVWPDPETFIPERFKDSNIDLRGQDFQLIPFGSGRRGCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            LQLGI LVR V+AQL+HCF+WE  +++   +LDM+E FGL+++RA HL V+P YRL 
Sbjct  440  LQLGILLVRFVLAQLVHCFNWEPADNIKPTDLDMSETFGLVLARAKHLKVVPTYRLQ  496



>ref|XP_002310011.2| hypothetical protein POPTR_0007s06310g [Populus trichocarpa]
 gb|EEE90461.2| hypothetical protein POPTR_0007s06310g [Populus trichocarpa]
Length=493

 Score =   389 bits (999),  Expect(2) = 2e-150, Method: Compositional matrix adjust.
 Identities = 193/325 (59%), Positives = 248/325 (76%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSP+AAELFLKTHDLVFA RPP E+A+YISYGQ +++   YG YW
Sbjct  60    PIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPHESARYISYGQKSVTFSQYGSYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CT+ELLS+LKI SF++ R EEL  LI+ +++AA +RVAVDLS+KVS L AD+SC
Sbjct  120   RNMRKMCTVELLSSLKITSFKSTRMEELDLLIKYIQEAAQERVAVDLSAKVSSLSADMSC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  +DLDERGF+ V++E M L    NLGDY P +  LDLQGLT+RMKA++K  
Sbjct  180   RMVFGKKYLDEDLDERGFKSVMQEVMHLSAAPNLGDYIPQIGALDLQGLTKRMKAISKVL  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D F  +I+D+H Q  + G   + KDFVD MLS MKS E E+  ++  +K  + D+  G+ 
Sbjct  240   DLFVSKIIDEHAQYQEKG---KNKDFVDVMLSCMKSEENEYLVDQGCMKAIMLDMLAGSM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  + +I+W  SEL+++P +MKKVQ+EL+  +G  RMVEESDLE L+YL+MVVKE+ RLH
Sbjct  297   DTSSTVIDWAFSELIKNPRVMKKVQKELEEVVGKQRMVEESDLESLEYLDMVVKETFRLH  356

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PV P LIP+EA EDC++ GFHIPKK
Sbjct  357   PVGPLLIPHEAMEDCIVNGFHIPKK  381


 Score =   173 bits (438),  Expect(2) = 2e-150, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKS +IINVWAI  DP  WT+ E F PERF GS+ID RGR+F+LIPFG+GRR CPG
Sbjct  376  FHIPKKSHVIINVWAIGRDPKAWTDAENFYPERFVGSDIDVRGRNFQLIPFGAGRRSCPG  435

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRLV+AQL+HCFDWE PN +   E+DMTE+FGL++ R+ HL+ IP YRL+
Sbjct  436  MQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVICRSKHLVAIPTYRLN  492



>ref|XP_006380462.1| hypothetical protein POPTR_0007s06410g [Populus trichocarpa]
 gb|ERP58259.1| hypothetical protein POPTR_0007s06410g [Populus trichocarpa]
Length=497

 Score =   387 bits (994),  Expect(2) = 2e-150, Method: Compositional matrix adjust.
 Identities = 195/325 (60%), Positives = 244/325 (75%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   +V SSP+AAEL LKT+DLVFASRP  EAAK+ISY Q NLS  PYG YW
Sbjct  64    PIMYMRLGLVPTVVVSSPRAAELILKTNDLVFASRPRNEAAKHISYEQKNLSFAPYGSYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KIN F + R+EEL  LI+ +K A+ DRVAVDL +KVS L ADISC
Sbjct  124   RNVRKMCTLELLSNHKINFFMSTRKEELDLLIDYIKDASRDRVAVDLGAKVSSLSADISC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  K+ DE+GF+ V  E M L    NLGDY P ++ LDLQGLT+RMK + K +
Sbjct  184   RMVFGKKYLEKEFDEKGFKPVTHELMRLAASFNLGDYIPPIAPLDLQGLTKRMKVVGKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D FFE+I+D+H Q       ++TKDFVD ML  + S E E++  R++IK  + D L G+ 
Sbjct  244   DDFFEKIIDEHIQFKD---ENRTKDFVDVMLDFLGSEETEYRIGRDNIKAIILDMLVGSM  300

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SEL+RHP +MKKVQ+EL+ KIG+DRMVEESDLE L+YL MV+KE+ RLH
Sbjct  301   DTSATAIEWTLSELIRHPRVMKKVQKELEEKIGMDRMVEESDLEGLEYLHMVIKEAFRLH  360

Query  715   PVAPLI-PNEAREDCMIEGFHIPKK  644
             PVAPL+ P+E+ EDC I+GF IP+K
Sbjct  361   PVAPLLGPHESMEDCTIDGFLIPQK  385


 Score =   175 bits (443),  Expect(2) = 2e-150, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +K+R+I+NVWAI  D + WT+  KFIPERF GSNID RGR F+L+PFG+GRR CPG
Sbjct  380  FLIPQKTRVIVNVWAIGRDQSAWTDANKFIPERFAGSNIDVRGRDFQLLPFGAGRRGCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            + LG+T+VR +VAQL+HCFDWE PN+M  EELDMTE FGL+  RANHL   P YRLH+
Sbjct  440  MHLGLTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRLHL  497



>ref|XP_002310016.2| hypothetical protein POPTR_0007s06370g [Populus trichocarpa]
 gb|EEE90466.2| hypothetical protein POPTR_0007s06370g [Populus trichocarpa]
Length=497

 Score =   389 bits (1000),  Expect(2) = 3e-150, Method: Compositional matrix adjust.
 Identities = 196/325 (60%), Positives = 246/325 (76%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   +V SSP+AAEL LKT+DLVFASRP  EAAK+ISY Q NLS  PYG YW
Sbjct  64    PIMYMRLGLVPTVVVSSPRAAELILKTNDLVFASRPRNEAAKHISYEQKNLSFAPYGSYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF + R+EEL  LI+ +K A+ +RVAVDL +KVS L ADISC
Sbjct  124   RNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDASRERVAVDLGAKVSSLSADISC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  K+ DE+GF+ V  E M L    NLGDY P ++ LDLQGLT+RMKA+ K +
Sbjct  184   RMVFGKKYLEKEFDEKGFKPVTHELMRLAASFNLGDYIPPIAPLDLQGLTKRMKAVGKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D FFE+I+D+H Q       ++TKDFVD ML  + S E E++  R++IK  + D L G+ 
Sbjct  244   DDFFEKIIDEHIQFKD---ENRTKDFVDVMLDFLGSEETEYRIGRDNIKAIILDMLVGSM  300

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SEL+RHP +MKKVQ+EL+ KIG+DRMVEESDLE L+YL MV+KE+ RLH
Sbjct  301   DTSATAIEWTLSELIRHPRVMKKVQKELEEKIGMDRMVEESDLEGLEYLHMVIKEAFRLH  360

Query  715   PVAPLI-PNEAREDCMIEGFHIPKK  644
             PVAPL+ P+E+ EDC I+GF IP+K
Sbjct  361   PVAPLLGPHESMEDCTIDGFLIPQK  385


 Score =   172 bits (436),  Expect(2) = 3e-150, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +K+R+I+NVWAI  D + WT+  +FIPERF GSNID RGR F+L+PFG+GRR CPG
Sbjct  380  FLIPQKTRVIVNVWAIGRDQSAWTDANRFIPERFAGSNIDVRGRDFQLLPFGAGRRGCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            + LG T+VR +VAQL+HCFDWE PN+M  EELDMTE FGL+  RANHL   P YRLH+
Sbjct  440  MHLGQTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRLHL  497



>ref|XP_011100884.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=496

 Score =   383 bits (984),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 187/324 (58%), Positives = 242/324 (75%), Gaps = 4/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    +V SSP  AEL LKTHDLVFASRPP EAAKYI Y Q +L   PYGPYW
Sbjct  62    PIMSLRLGFVPAVVVSSPAGAELVLKTHDLVFASRPPHEAAKYIGYEQRDLVFLPYGPYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLSNL+I+ F+AMR+ EL  L+ SLKQA+     VDLS++VS L  D+ C
Sbjct  122   RNMRKLCTLELLSNLRIDQFRAMRKAELSLLVSSLKQASELGEIVDLSARVSGLSGDMIC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FG+KY  +DLDE+GF+ V+ E + +  K NL DYFP +  LDLQG+ R MK L+K +
Sbjct  182   LMIFGRKYADRDLDEKGFKAVISETVAIAAKFNLADYFPGIGVLDLQGMNRNMKRLSKIF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D F E+I+DDH Q+ Q     +T+DFVD M++IM+SGEAEF+F+R ++K  L DL  A  
Sbjct  242   DGFLEKIIDDHVQNKQ--EKKETEDFVDIMMAIMESGEAEFEFDRRNVKAVLLDLLIAGM  299

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +      EW  SEL+RHP++MKK+Q EL++ +GL++MVEES L+ L+YL+ VVKE+LRLH
Sbjct  300   DTSAAATEWAFSELIRHPQVMKKLQNELETVVGLEQMVEESHLDRLEYLDFVVKETLRLH  359

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP L+P+E+ +DC+I+GFHIPK
Sbjct  360   PVAPLLVPHESMQDCVIDGFHIPK  383


 Score =   177 bits (450),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR ++N+WAI  DPNVW +PE F PERF GSNID RGR F LIPFGSGRR CPG
Sbjct  379  FHIPKGSRTMVNIWAIGRDPNVWPDPEAFKPERFIGSNIDIRGRDFRLIPFGSGRRGCPG  438

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            LQLG+T+VRL+VAQL+HCFDWE PN M   +LDM+E FGL+ SRA HL+ IP YRLH
Sbjct  439  LQLGLTMVRLLVAQLVHCFDWELPNCMLPSDLDMSEHFGLVTSRAKHLMAIPRYRLH  495



>ref|XP_004504031.1| PREDICTED: cytochrome P450 750A1-like [Cicer arietinum]
Length=502

 Score =   385 bits (989),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 193/326 (59%), Positives = 246/326 (75%), Gaps = 5/326 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSPQAAELFLKTHDLVFASRPP EAAK+IS+ Q N+S   YG YW
Sbjct  64    PIMHLRLGLVPTIVVSSPQAAELFLKTHDLVFASRPPTEAAKHISWEQRNMSFGEYGSYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALD-RVAVDLSSKVSELIADIS  1256
             RNMRK+CTLELLS+ KINSF++MR EEL  LI  +++ A D    VD+S+KVS L AD+S
Sbjct  124   RNMRKMCTLELLSHTKINSFRSMREEELDILINFIREVANDGTTTVDISAKVSTLSADMS  183

Query  1255  CRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             CRMVFGKKY  KDLDE+GF+ V++E M L    N+GDY P+++ LDLQGLTRRMK + K 
Sbjct  184   CRMVFGKKYMDKDLDEKGFKSVIQEGMHLAATPNIGDYIPYIAPLDLQGLTRRMKTIGKI  243

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GA  899
             +D FFE+I+D+H QS      D+TKDFVD ML  + + E+E++  R +IK  + D+  G+
Sbjct  244   FDDFFEKIIDEHIQS--DNKDDKTKDFVDVMLGFVGTQESEYRIERPNIKAIMLDMLAGS  301

Query  898   SEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
              +     +EW +SELLR+P +MKKVQ+EL+  +GL R V ESDL+ L+YL+MV+KE+ RL
Sbjct  302   MDTSATSVEWAISELLRNPRVMKKVQKELEIVVGLKRKVVESDLDKLEYLDMVIKENFRL  361

Query  718   HPVAP-LIPNEAREDCMIEGFHIPKK  644
             HPVAP LIP+++ EDCM+E F IPKK
Sbjct  362   HPVAPLLIPHQSLEDCMVEDFFIPKK  387


 Score =   176 bits (445),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+I+N W++  DPN WT+PEKF PERFEGSNID +GR F+ IPFGSGRR CPG
Sbjct  382  FFIPKKSRVIVNAWSVMRDPNAWTDPEKFWPERFEGSNIDVKGRDFQFIPFGSGRRGCPG  441

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRLVVAQL+HCFDW   N M   +LDM E+FGL + RANHLI IP YRL+
Sbjct  442  IQLGLTVVRLVVAQLVHCFDWRLCNHMLPSDLDMEEEFGLTMPRANHLIAIPTYRLY  498



>ref|XP_007212357.1| hypothetical protein PRUPE_ppa014572mg [Prunus persica]
 gb|EMJ13556.1| hypothetical protein PRUPE_ppa014572mg [Prunus persica]
Length=497

 Score =   379 bits (974),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 243/325 (75%), Gaps = 6/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM++R GL   IV SSP+AAELFLKTHDLVFASRPP E +K+IS+GQ NL    YG YWR
Sbjct  62    IMYMRLGLMPTIVISSPEAAELFLKTHDLVFASRPPHEGSKHISFGQKNLIFSEYGVYWR  121

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDR-VAVDLSSKVSELIADISC  1253
             + RK+CT+ELLSN KINSF++MRREE+   +ES++ AA  R VAVDLS KVS L  D+SC
Sbjct  122   DTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAAANKRGVAVDLSDKVSSLSVDMSC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  ++ DERGF+ V++E + L    NLGDY PF++ LDLQG T+RMK++ K +
Sbjct  182   RMVLGKKYRDEEFDERGFKSVVREGIQLASAPNLGDYIPFIAPLDLQGFTKRMKSVNKAF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D  FE+I+++H Q       ++TKDFVD M+  M S E+E++  R HIK  + D+  AS 
Sbjct  242   DNLFEKIIEEHLQPND---GERTKDFVDVMVGFMGSEESEYRIERPHIKAIMLDMLVASM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  IEW +SEL+RHP+ MKKVQ+EL++ +GLD+MVEESDLE L YL MVVKE+ RLH
Sbjct  299   DTSSTTIEWALSELMRHPKAMKKVQKELENVVGLDKMVEESDLEKLDYLNMVVKETFRLH  358

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+ + EDC + G+HIPKK
Sbjct  359   PVAPLLVPHASIEDCTVNGYHIPKK  383


 Score =   181 bits (460),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR++INVWAI  DPN WT+ EKFIPERFEGS++D RG HF+LIPFGSGRR CPG+QLG
Sbjct  382  KKSRVLINVWAIGRDPNAWTDAEKFIPERFEGSSVDVRGNHFQLIPFGSGRRRCPGIQLG  441

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +T+V+LV+AQL+HCFDWE PN+M  + LDMTE+FGL V RA HL+ IP+YRL
Sbjct  442  LTVVQLVLAQLVHCFDWELPNNMLPDGLDMTEEFGLTVPRAKHLLAIPSYRL  493



>ref|XP_008227118.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=497

 Score =   380 bits (975),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 246/325 (76%), Gaps = 6/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM++R GL + IV SSP+AAELFLKTHDLVFASRPP E++K+IS+GQ NL    YG YWR
Sbjct  62    IMYMRLGLMHTIVISSPEAAELFLKTHDLVFASRPPHESSKHISFGQKNLIFSEYGVYWR  121

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDR-VAVDLSSKVSELIADISC  1253
             + RK+CT+ELLSN KINSF++MRREE+   +ES++ AA +R VAVDLS KVS L  D+SC
Sbjct  122   DTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAAANNRGVAVDLSDKVSSLSVDMSC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY+ ++ DERGF+ V++E + L    NLGDY PF++ LDLQG T+RMK++ K +
Sbjct  182   RMVLGKKYKDEEFDERGFKSVVREGIQLASAPNLGDYIPFIAPLDLQGFTKRMKSVNKAF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D  FE+I+++H +       ++TKDFVD M+  M S E+E++  R HIK  + D+  AS 
Sbjct  242   DNLFEKIIEEHLKPND---GERTKDFVDVMVGFMGSEESEYRIERPHIKAIMLDMLVASM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  IEW +SEL+RHP+ MKKVQ+EL++ +GLD+MVEESDL  L YL MVVKE+ RLH
Sbjct  299   DTSSTTIEWALSELMRHPKAMKKVQKELENVVGLDKMVEESDLGKLDYLNMVVKETFRLH  358

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+ + EDC + G+HIPKK
Sbjct  359   PVAPLLVPHASTEDCTVNGYHIPKK  383


 Score =   181 bits (459),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR++INVWA   DPN WT+ EKFIPERFEGS++D  G HF+LIPFGSGRR CPG+QLG
Sbjct  382  KKSRVLINVWATGRDPNAWTDAEKFIPERFEGSSVDVTGNHFQLIPFGSGRRRCPGIQLG  441

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +T+V+LV+AQL+HCFDWE PN+M  EELDMTE+FGL V RA HL+ IP+YRL
Sbjct  442  LTVVQLVLAQLVHCFDWELPNNMLPEELDMTEEFGLTVPRAKHLLAIPSYRL  493



>dbj|BAP15886.1| cytochrome P450 71AU50 [Prunus mume]
Length=497

 Score =   375 bits (964),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 241/325 (74%), Gaps = 6/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM++R GL   IV SSP+AAELFLKTHDLVFASRPP E +K+IS+GQ NL    YG YWR
Sbjct  62    IMYMRLGLMPTIVISSPEAAELFLKTHDLVFASRPPHEGSKHISFGQKNLIFSEYGAYWR  121

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDR-VAVDLSSKVSELIADISC  1253
             + RK+CT+ELLSN KINSF++MRREE+   +ES++ AA +R VAVDLS KVS L  D+SC
Sbjct  122   DTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAAANNRGVAVDLSDKVSSLSVDMSC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  ++ DERGF+ V++E + L    NLGDY  F++ LDLQG T+RMK++ K +
Sbjct  182   RMVLGKKYRDEEFDERGFKSVVREAIQLASAPNLGDYIRFIAPLDLQGFTKRMKSVNKAF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D  FE+I+++H Q       ++T DFVD M+  M S E+E++  R HIK  + D+  AS 
Sbjct  242   DNLFEKIIEEHLQPND---GERTMDFVDVMVGFMGSEESEYRIERPHIKAIMLDMLVASM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SEL+RHP+ MKKVQ+EL++ +GLD+MVEESDLE L YL MVVKE+ RLH
Sbjct  299   DTSATTIEWALSELMRHPKAMKKVQKELENVVGLDKMVEESDLEKLDYLNMVVKETFRLH  358

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP LIP+ + EDC + G+HIPKK
Sbjct  359   PVAPLLIPHASIEDCTVNGYHIPKK  383


 Score =   185 bits (470),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR++INVWAI  DPN WT+ EKFIPERFEGS++D RG HF+LIPFGSGRR CPG+QLG
Sbjct  382  KKSRVLINVWAIGRDPNAWTDAEKFIPERFEGSSVDVRGNHFQLIPFGSGRRRCPGIQLG  441

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +T+V+LV+AQL+HCFDWE PN+M  EELDMTE+FGL V RA HL+ IP+YRL
Sbjct  442  LTVVQLVLAQLVHCFDWELPNNMLPEELDMTEEFGLTVPRAKHLLAIPSYRL  493



>ref|XP_010027875.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54512.1| hypothetical protein EUGRSUZ_I00454 [Eucalyptus grandis]
Length=500

 Score =   398 bits (1023),  Expect(2) = 5e-150, Method: Compositional matrix adjust.
 Identities = 190/325 (58%), Positives = 246/325 (76%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M+LR G  + IV SSP+ AE FLKTHDLVFASRPP EA+K+ISY Q +L+  PYGPYW
Sbjct  64    PLMYLRLGFVHTIVVSSPEVAEQFLKTHDLVFASRPPHEASKHISYEQRSLAFAPYGPYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF++MRREE+  L+  LK AA D  A+DLSSK+S L AD+SC
Sbjct  124   RNIRKMCTLELLSNAKINSFKSMRREEVGLLVNFLKDAAHDHTAIDLSSKISSLSADMSC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  K+ DERGF+ V++E M L    N+GDY P+L+  DLQGLT+RMKA++K +
Sbjct  184   RMVFGKKYMDKEFDERGFKAVIQEFMVLGATPNIGDYVPYLARFDLQGLTKRMKAVSKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D FFE+I+D+H +S +     ++KDFVD ML  M   E E+  +R HIK  + D L G+ 
Sbjct  244   DAFFEKIIDEHMKSKK--EEGESKDFVDVMLGFMGLNEGEYHIDRPHIKAIILDMLLGSM  301

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     I+W M+EL+RHP  MKKVQ+EL+  +G++R VEESDLE L YL+MV+KE++RLH
Sbjct  302   DTSATAIDWAMTELVRHPSAMKKVQDELEKAVGMNRAVEESDLEGLHYLDMVIKETMRLH  361

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+EA EDC + GFH+P K
Sbjct  362   PVAPLLLPHEATEDCTVNGFHMPLK  386


 Score =   162 bits (411),  Expect(2) = 5e-150, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 91/113 (81%), Gaps = 2/113 (2%)
 Frame = -3

Query  645  KSRIIINVWAITHDPNVWT--NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KSR+I+NVW+I  DP VWT  NPE+FIPERF G ++D +GR F+L+PFG+GRR CPG+QL
Sbjct  386  KSRVIVNVWSIGRDPKVWTTHNPEEFIPERFLGLSMDVKGRDFQLLPFGAGRRGCPGMQL  445

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T+VR V+AQL+HCFDW+ P  +   ELDMTE+FGL   RA HL+V+P YRL
Sbjct  446  GLTVVRFVLAQLVHCFDWDLPAGISPSELDMTEEFGLTTPRAKHLVVMPQYRL  498



>ref|XP_009372714.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=499

 Score =   387 bits (993),  Expect(2) = 5e-150, Method: Compositional matrix adjust.
 Identities = 184/325 (57%), Positives = 254/325 (78%), Gaps = 6/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM+LR GL   +V SSP+AAELFLKTHDLVFASRPP E +K+IS+GQ NLS   YG YWR
Sbjct  66    IMYLRLGLVPTVVVSSPRAAELFLKTHDLVFASRPPHEGSKHISFGQRNLSFAEYGSYWR  125

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALD-RVAVDLSSKVSELIADISC  1253
             ++RK+CTLELLSN KINSF++MRREE+  LI+S+++ A + RVA+DLS KVS L  D++C
Sbjct  126   DIRKMCTLELLSNHKINSFKSMRREEVALLIQSVQEDANNGRVAIDLSDKVSSLSVDMTC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +MVFGKKY+ ++ DERGF  V+KE + L    NLGDY P ++ LDLQG T++MKA+ K +
Sbjct  186   QMVFGKKYKYEEFDERGFTAVMKEALKLSAGPNLGDYIPCIAPLDLQGFTKKMKAINKAF  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D+FFE+I+++H QS      ++TKDFVD M+  M S +++++    +IK  + D+F G+ 
Sbjct  246   DEFFEKIINEHLQSKD---EERTKDFVDVMVDFMGSEDSDYRIEHTNIKAIMLDMFAGSM  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  +EW +SEL+RHP++MK VQ+EL++ +GL+RMVEESDLE L YL+MVVKE+LRLH
Sbjct  303   DTTSTTVEWALSELMRHPQVMKTVQKELENVVGLNRMVEESDLEKLDYLDMVVKETLRLH  362

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+ A EDC+++G+H+PKK
Sbjct  363   PVAPLLVPHAAIEDCIVDGYHVPKK  387


 Score =   174 bits (441),  Expect(2) = 5e-150, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+IIN WAI  DP+ W + EKF+PERFEG+++D RG HF+LIPFGSGRR CPG+QLG
Sbjct  386  KKSRVIINAWAIGRDPSAWEDAEKFVPERFEGNSVDVRGNHFQLIPFGSGRRRCPGIQLG  445

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +T+V+ V+AQL+HCFDWE P++M   +LDMTE FG+ VSRA HL+ IP+YRL 
Sbjct  446  LTVVKFVLAQLVHCFDWELPDNMLPNDLDMTEGFGITVSRAKHLLAIPSYRLQ  498



>ref|XP_009608339.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=495

 Score =   386 bits (991),  Expect(2) = 7e-150, Method: Compositional matrix adjust.
 Identities = 186/323 (58%), Positives = 251/323 (78%), Gaps = 4/323 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P M+LR GL   IV SSP+  E  LKT+D VFASRP  EA++YI YGQ NL    YG YW
Sbjct  62    PFMYLRLGLVPTIVVSSPETVEKVLKTYDHVFASRPHHEASQYICYGQRNLIFSKYGSYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTL+LL++ KINS+Q+ R+EE+  L++S+KQAA D VAVDLS+KVS L A++SC
Sbjct  122   RNMRKLCTLQLLTSQKINSYQSSRKEEVSILVKSIKQAAQDGVAVDLSAKVSSLNANLSC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKK+  +DLD+RGF+ +++E + L    NLGD+FP+L  LDLQGLT R+KAL+K +
Sbjct  182   LMVFGKKFMDEDLDKRGFKSIVQEVVHLAATPNLGDFFPYLGVLDLQGLTSRLKALSKVF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F E+I+D+H QS +     +T+DFVDTM++IM+SGEA F+F+R HIK  L D+  AS 
Sbjct  242   DEFLEKIIDEHVQSKE---QRETEDFVDTMMAIMQSGEAGFEFDRRHIKAVLLDMLMASM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     +EW ++ELLRHP +MKK+Q+EL+  +GLDRMVEESDLE+LKYL+MV+KE+LRLH
Sbjct  299   DTSATSVEWTLTELLRHPHVMKKLQKELEEVVGLDRMVEESDLENLKYLDMVIKEALRLH  358

Query  715   PVAPLIPNEAREDCMIEGFHIPK  647
               APL+ +E+ EDC+++GF++ K
Sbjct  359   SAAPLLIHESIEDCVVDGFYVQK  381


 Score =   174 bits (441),  Expect(2) = 7e-150, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK SRII+NV+A   DPN W  P+KF PERF  SN+D RG  F+L+PFGSGRR CPG
Sbjct  377  FYVQKGSRIIVNVYAAQRDPNAWPEPDKFFPERFVESNVDLRGHDFQLLPFGSGRRSCPG  436

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLGI +VRLVVAQL+HCFDWE PN M   ELDM+EQFG++  RA HLI +P Y+LH
Sbjct  437  MQLGIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGVVTCRAKHLIAVPTYKLH  493



>ref|XP_007211842.1| hypothetical protein PRUPE_ppa004664mg [Prunus persica]
 gb|EMJ13041.1| hypothetical protein PRUPE_ppa004664mg [Prunus persica]
Length=497

 Score =   377 bits (967),  Expect(2) = 7e-150, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 243/325 (75%), Gaps = 6/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM++R GL + IV SSP+AAELFLKTHDLVFASRPP E +K+IS+GQ NLS   YG YWR
Sbjct  62    IMYMRLGLMSTIVISSPEAAELFLKTHDLVFASRPPHEGSKHISFGQKNLSFSEYGVYWR  121

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALD-RVAVDLSSKVSELIADISC  1253
             + RK+CT+ELLSN KINSF++MRREE+   +ES++ AA +  VAVDLS KVS L  D+SC
Sbjct  122   DTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAAANNIGVAVDLSDKVSSLSVDMSC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  ++ DERGF+ V++E + L    NLGDY PF++ LDLQG T+RMK++ K +
Sbjct  182   RMVLGKKYRDEEFDERGFKSVVREGIQLASAPNLGDYIPFIAPLDLQGFTKRMKSVNKAF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D  FE+ +++H Q       ++TKDFVD M+  M S E+E++  R HIK  + D+  AS 
Sbjct  242   DNLFEKSIEEHLQPND---GERTKDFVDVMVGFMGSEESEYRIERPHIKAIMLDMLVASM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  IEW +SEL+RHP+ MKKVQ+EL++ +GLD+MVEESDLE L YL MVVKE+ RLH
Sbjct  299   DTSSTTIEWALSELMRHPKAMKKVQKELENVVGLDKMVEESDLEKLDYLNMVVKETFRLH  358

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+ + EDC + G+HIPK 
Sbjct  359   PVAPLLVPHASIEDCTVNGYHIPKN  383


 Score =   183 bits (465),  Expect(2) = 7e-150, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            K SR++INVWAI  DPN WT+PEKFIPERFEGS++D RG HF+LIPFGSGRR CPG+QLG
Sbjct  382  KNSRVLINVWAIGRDPNAWTDPEKFIPERFEGSSVDVRGNHFQLIPFGSGRRRCPGIQLG  441

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +T+V+LV+AQL+HCFDWE PN+M  +ELDMTE+FG  V RA HL+ IP+YRL
Sbjct  442  LTVVQLVLAQLVHCFDWELPNNMLPDELDMTEEFGFTVPRAKHLLAIPSYRL  493



>ref|XP_011013422.1| PREDICTED: cytochrome P450 CYP736A12-like [Populus euphratica]
Length=493

 Score =   386 bits (991),  Expect(2) = 8e-150, Method: Compositional matrix adjust.
 Identities = 191/325 (59%), Positives = 246/325 (76%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSP+AAELFLKTHDLVFA RPP EAA+Y SYGQ  ++   YGPYW
Sbjct  60    PIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPHEAARYFSYGQKGMTFAQYGPYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CT+ELLS+LKI SF++ R EEL  LI+ +++AA +RVAVDLS+KVS L AD+SC
Sbjct  120   RNMRKMCTIELLSSLKITSFKSTRMEELDLLIKYIQEAARERVAVDLSAKVSSLNADMSC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  +DLDERGF+ V++E M L    +LGDY P ++ LDLQGLT+RMKA++K  
Sbjct  180   RMVFGKKYLDEDLDERGFKSVMQEVMHLSAAPHLGDYIPQIAALDLQGLTKRMKAISKVL  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D +  +I+D+H Q  + G   + KDFVD MLS MKS E E   ++  +K  + D+  G+ 
Sbjct  240   DVYLNKIIDEHAQYQEKG---KNKDFVDVMLSFMKSEENEHLVDQGCMKAIMLDMLAGSM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +    +I+W  SEL+++P +MKK+Q+EL+  +G  RMVEESDLE L+YL+MVVKE+LRLH
Sbjct  297   DTSATVIDWAFSELIKNPRVMKKLQKELEEAVGKQRMVEESDLERLEYLDMVVKETLRLH  356

Query  715   PVAPL-IPNEAREDCMIEGFHIPKK  644
             P  PL IP+EA EDC++ GFHIPKK
Sbjct  357   PAGPLMIPHEAMEDCIVNGFHIPKK  381


 Score =   174 bits (441),  Expect(2) = 8e-150, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKS +IINVWAI  DP  WT+ EKF PERF GS+ID RGR+F+LIPFG+GRR CPG
Sbjct  376  FHIPKKSHVIINVWAIGRDPKAWTDAEKFYPERFVGSDIDVRGRNFQLIPFGTGRRSCPG  435

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRLV+AQL+HCFDWE PN +   E+DMTE+FGL++ R+ HL+ IP YRL+
Sbjct  436  MQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVMCRSKHLVAIPTYRLN  492



>ref|XP_011025622.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP736A12-like 
[Populus euphratica]
Length=493

 Score =   385 bits (990),  Expect(2) = 8e-150, Method: Compositional matrix adjust.
 Identities = 191/325 (59%), Positives = 246/325 (76%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSP+AAELFLKTHDLVFA RPP EAA+YISYGQ  ++   YGPYW
Sbjct  60    PIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPHEAARYISYGQKGMTFAQYGPYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CT+ELLS+LKI SF++ R EEL  LI+  ++A+ +RVAVDLS+KVS L AD+SC
Sbjct  120   RNMRKMCTIELLSSLKITSFKSTRMEELDLLIKYTQEASRERVAVDLSAKVSSLNADMSC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  +DLDERGF+ V++E M L    +LGDY P ++ LDLQGLT+RMKA++K  
Sbjct  180   RMVFGKKYLDEDLDERGFKSVMQEVMHLSAAPHLGDYIPQIAALDLQGLTKRMKAISKVL  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D +  +I+D+H Q  + G   + KDFVD MLS MKS E E   ++  +K  + D+  G+ 
Sbjct  240   DVYLNKIIDEHAQYQEKG---KNKDFVDVMLSFMKSEENEHLVDQGCMKAIMLDMLAGSM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +    +I+W  SEL+++P +MKK+Q+EL+  +G  RMVEESDLE L+YL+MVVKE+LRLH
Sbjct  297   DTSATVIDWAFSELIKNPRVMKKLQKELEEVVGKQRMVEESDLERLEYLDMVVKETLRLH  356

Query  715   PVAPL-IPNEAREDCMIEGFHIPKK  644
             P  PL IP+EA EDC++ GFHIPKK
Sbjct  357   PAGPLMIPHEAMEDCIVNGFHIPKK  381


 Score =   174 bits (442),  Expect(2) = 8e-150, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKS +IINVWAI  DP  WT+ EKF PERF GS+ID RGR+F+LIPFG+GRR CPG
Sbjct  376  FHIPKKSHVIINVWAIGRDPKAWTDAEKFYPERFVGSDIDVRGRNFQLIPFGTGRRSCPG  435

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRLV+AQL+HCFDWE PN +   E+DMTE+FGL++ R+ HL+ IP YRL+
Sbjct  436  MQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVMCRSKHLVAIPTYRLN  492



>ref|XP_009586899.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=500

 Score =   380 bits (977),  Expect(2) = 1e-149, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 243/324 (75%), Gaps = 3/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +RFGL  +IVASSP +AELFLK HDLVFASRP   AA+YI Y Q NL+   YGPYW
Sbjct  65    PIMSMRFGLVPVIVASSPHSAELFLKKHDLVFASRPYNTAAQYIGYNQRNLTFGKYGPYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLS LKINSFQ+MR++E+   +  L +AA + + VD+S+K++ L A+++C
Sbjct  125   RNMRKLCTLELLSTLKINSFQSMRKQEIGNFVTFLNRAASNGIEVDISAKLASLSANMAC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  ++ DERGF+ V++E + +    N+G++FPF    DLQG   RMK LAK +
Sbjct  185   LMVFGKKYMDEEFDERGFKDVIQETLVITATPNIGEFFPFFDRFDLQGFVPRMKKLAKIF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D F E+I+D+H    +   + Q KD VDTM+SIM+SGEAEF+F+R H+K  + DL  AS 
Sbjct  245   DDFLEKIIDEHVHDSKR-ENKQAKDIVDTMMSIMQSGEAEFEFDRRHVKAIMLDLLIASM  303

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  I+W  +ELLRHP++MKK+Q EL+  +G +RMVEE+DLE L+YL+MV+KE  RLH
Sbjct  304   DTASTAIDWTFTELLRHPKVMKKLQNELEQVVGTNRMVEETDLEKLEYLDMVIKEGFRLH  363

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP LIP+E+ EDC+++GF IPK
Sbjct  364   PVAPLLIPHESIEDCIVDGFDIPK  387


 Score =   179 bits (453),  Expect(2) = 1e-149, Method: Compositional matrix adjust.
 Identities = 79/118 (67%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SRI++N WAI  DP  W  PEKF PERF GSNID RGR F+L+PFGSGRR CPG
Sbjct  383  FDIPKGSRILVNTWAIGRDPEAWPEPEKFRPERFVGSNIDLRGRDFQLLPFGSGRRSCPG  442

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LQLG+T+V LV+AQL+HCFDWE PN M  E+LDMTE+FGL+ +RA HL+ IP YRLH+
Sbjct  443  LQLGLTIVLLVLAQLVHCFDWELPNGMMPEDLDMTEKFGLVTARAQHLVAIPTYRLHV  500



>ref|XP_009767392.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=495

 Score =   386 bits (991),  Expect(2) = 3e-149, Method: Compositional matrix adjust.
 Identities = 186/323 (58%), Positives = 253/323 (78%), Gaps = 4/323 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P M+LR GL   I+ SSP+  E  LKT+D VFASRP  EA++YISYGQ NL    YG YW
Sbjct  62    PFMYLRLGLVPTIIVSSPETVEKVLKTYDHVFASRPHNEASQYISYGQRNLIFSKYGSYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTL+LL++ K+NS+Q+ R+EE+  L++S+KQAA D VAVDLS+KVS L A++SC
Sbjct  122   RNMRKLCTLQLLTSQKVNSYQSSRKEEVYILVKSIKQAAQDGVAVDLSAKVSSLNANLSC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKK+  +DLD+RGF+ +++E   L    NLGD+FP+L  LDLQGLT R+KAL+K +
Sbjct  182   LMVFGKKFMDEDLDKRGFKSIVQEVAHLAVTPNLGDFFPYLGVLDLQGLTGRLKALSKFF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F E+I+++H QS +     +T+DFVDTM++IM+SGEA F+F+R H+K  L D+  AS 
Sbjct  242   DEFLEKIIEEHVQSKE---QRETEDFVDTMMAIMQSGEAGFEFDRRHVKAILLDMLTASM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     +EWI+SELLRHP++MKK+Q+EL+  +GLDRMVEESDLE+LKYL+MV+KE+LRLH
Sbjct  299   DTSATSVEWILSELLRHPQVMKKLQKELEEVVGLDRMVEESDLENLKYLDMVIKEALRLH  358

Query  715   PVAPLIPNEAREDCMIEGFHIPK  647
              VAPL+ +E+ EDC+++GF + K
Sbjct  359   SVAPLLNHESIEDCVVDGFFVQK  381


 Score =   172 bits (435),  Expect(2) = 3e-149, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK SRII+NV+A   D N W  P+KF PERF  SN+D RG  F+L+PFGSGRR CPG
Sbjct  377  FFVQKGSRIIVNVYAAQRDSNAWPEPDKFFPERFVESNVDLRGHDFQLLPFGSGRRSCPG  436

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLGI +VRLVVAQL+HCFDWE PN M   ELDM+EQFGL+  RA HL+ +P YRLH
Sbjct  437  MQLGIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGLVTYRAKHLMAVPTYRLH  493



>ref|XP_008227094.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=497

 Score =   372 bits (955),  Expect(2) = 4e-149, Method: Compositional matrix adjust.
 Identities = 184/325 (57%), Positives = 240/325 (74%), Gaps = 6/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM++R GL   IV SSP+AAELFLKTHDLVFASRPP E +K+IS+GQ NL    YG YWR
Sbjct  62    IMYMRLGLMPTIVISSPEAAELFLKTHDLVFASRPPHEGSKHISFGQKNLIFSEYGAYWR  121

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDR-VAVDLSSKVSELIADISC  1253
             + RK+CT+ELLSN KINSF++MRREE+   +ES++ AA +R VAVDLS KVS L  D+SC
Sbjct  122   DTRKMCTIELLSNHKINSFKSMRREEVSLCVESIRAAANNRGVAVDLSDKVSSLSVDMSC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  ++ DERGF+ V++E + L    NLGDY  F++ LDLQG T+RMK++ K +
Sbjct  182   RMVLGKKYRDEEFDERGFKSVVRELIQLASAPNLGDYIRFIAPLDLQGFTKRMKSVNKAF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D  FE+I+++H Q       ++T DFVD M+  M S E+E++  R H K  + D+  AS 
Sbjct  242   DNLFEKIIEEHLQPND---GERTMDFVDVMVGFMGSEESEYRIERPHTKAIMLDMLVASM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SEL+RHP+ MKKVQ+EL++ +GLD+MVEESDLE L YL MVVKE+ RLH
Sbjct  299   DTSATTIEWALSELMRHPKAMKKVQKELENVVGLDKMVEESDLEKLDYLNMVVKETFRLH  358

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+ + EDC + G+HIPKK
Sbjct  359   PVAPLLVPHASIEDCTVNGYHIPKK  383


 Score =   185 bits (470),  Expect(2) = 4e-149, Method: Compositional matrix adjust.
 Identities = 82/112 (73%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR++INVWAI  DPN WT+ EKFIPERFEGS++D RG HF+LIPFGSGRR CPG+QLG
Sbjct  382  KKSRVLINVWAIGRDPNAWTDAEKFIPERFEGSSVDVRGNHFQLIPFGSGRRRCPGIQLG  441

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +T+V+LV+AQL+HCFDWE PN+M  EELDMTE+FGL V RA HL+ IP+YRL
Sbjct  442  LTVVQLVLAQLVHCFDWELPNNMLPEELDMTEEFGLTVPRAKHLLAIPSYRL  493



>ref|XP_002310007.2| cytochrome P450 family protein [Populus trichocarpa]
 gb|EEE90457.2| cytochrome P450 family protein [Populus trichocarpa]
Length=497

 Score =   388 bits (996),  Expect(2) = 6e-149, Method: Compositional matrix adjust.
 Identities = 193/325 (59%), Positives = 245/325 (75%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   +V SSP+AAEL LKTHDLVFA+RPP EAAK+ISY Q +LS  PYG YW
Sbjct  64    PIMYMRLGLVPTVVVSSPRAAELILKTHDLVFANRPPNEAAKHISYEQKSLSFAPYGSYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF + R+EEL  LI+ +K A+ +RVAVDLS+KVS L ADISC
Sbjct  124   RNVRKMCTLELLSNHKINSFMSSRKEELDLLIDYIKDASRERVAVDLSAKVSSLSADISC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  K+ D++GF+ V+ E M L    N GDY P ++ LDLQGLT+RMKA+ K +
Sbjct  184   RMVFGKKYMEKEFDDKGFKPVIHEGMRLAASFNFGDYIPPIAPLDLQGLTKRMKAVGKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D F E+I+D+H Q       ++TKDFVD ML  + S E E+   R++IK  + D L G+ 
Sbjct  244   DDFLEKIIDEHIQFKD---ENRTKDFVDVMLDFLGSEETEYSIGRDNIKAIILDMLVGSM  300

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SEL++HP +MKKVQ+EL+ KIG+DR VEESDLE L+YL MV+KE+ RLH
Sbjct  301   DTSATAIEWTLSELIKHPRVMKKVQKELEEKIGMDRTVEESDLEGLEYLHMVIKEAFRLH  360

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP LIP+E+ EDC I+GF IP+K
Sbjct  361   PVAPLLIPHESMEDCTIDGFLIPQK  385


 Score =   169 bits (428),  Expect(2) = 6e-149, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +K+R+I+NVWAI  D + WT+  KFIPERF GSNID RGR F+L+PFG+GRR CPG
Sbjct  380  FLIPQKTRVIVNVWAIGRDQSAWTDANKFIPERFAGSNIDVRGRDFQLLPFGAGRRGCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            + LG+T+V  +VAQL+HCFDWE PN+M  EELDMTE FGL+  RANHL   P YR H+
Sbjct  440  MHLGLTMVLQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRHHL  497



>ref|XP_010099909.1| Flavonoid 3'-monooxygenase [Morus notabilis]
 gb|EXB80838.1| Flavonoid 3'-monooxygenase [Morus notabilis]
Length=498

 Score =   376 bits (966),  Expect(2) = 7e-149, Method: Compositional matrix adjust.
 Identities = 184/324 (57%), Positives = 250/324 (77%), Gaps = 3/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH+R GL   I+ SSP+AAELFLKTHDLVFASRP  EAAKY+ +   +L   PYG YW
Sbjct  65    PIMHMRLGLIPTIIVSSPEAAELFLKTHDLVFASRPHIEAAKYMFWEYRDLVFAPYGSYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R MRK+CTLELL+++KI+SF+A+R+EE+  LI+++++AA +RV+VDLS+KV+ L AD+SC
Sbjct  125   RYMRKMCTLELLNSVKISSFKAIRKEEIGQLIDTIQKAARERVSVDLSAKVTTLNADMSC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  K+ DERGF+ V++E M L    NLGD+ PF++ LDLQG T+RMK +AK +
Sbjct  185   RMVFGKKYLDKEFDERGFKVVIQEAMHLAAIPNLGDFIPFIAPLDLQGYTKRMKVVAKVF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FFE+I++DH  S    S  +TKDFVD MLS+M+S ++E++  R +IK  + D+  AS 
Sbjct  245   DDFFEKIIEDHILSKDEDS--KTKDFVDVMLSLMESADSEYRIERPNIKAVMLDMLVASM  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SEL++ P ++ KVQ+EL++ +G++RMVEE+DLE L+YL+MVVKE+LRLH
Sbjct  303   DTSASAIEWAISELIKQPRVLMKVQKELETVVGMERMVEETDLEMLEYLDMVVKETLRLH  362

Query  715   PVAPLIPNEAREDCMIEGFHIPKK  644
             PV PL  + A E+C I GFHIPKK
Sbjct  363   PVVPLFHHAAMEECTINGFHIPKK  386


 Score =   180 bits (457),  Expect(2) = 7e-149, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+I+N WAI  DPN W +PEKFIPERF GS+ID +GR F+LIPFG+GRR CPG
Sbjct  381  FHIPKKSRVIVNAWAIGRDPNAWNDPEKFIPERFLGSSIDLKGRDFQLIPFGAGRRHCPG  440

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            LQLG+ +V+LVVAQL+HCFDWE PN +   ELDMTE+FGL   RANHL+ IP YRLH
Sbjct  441  LQLGLIVVKLVVAQLVHCFDWELPNGVIPTELDMTEEFGLTTPRANHLLAIPTYRLH  497



>ref|XP_002310008.2| hypothetical protein POPTR_0007s06270g [Populus trichocarpa]
 gb|EEE90458.2| hypothetical protein POPTR_0007s06270g [Populus trichocarpa]
Length=493

 Score =   385 bits (989),  Expect(2) = 7e-149, Method: Compositional matrix adjust.
 Identities = 192/325 (59%), Positives = 248/325 (76%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSP+AAELFLKTHDLVFA RPP E+A+YISYGQ  ++   YG YW
Sbjct  60    PIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPHESARYISYGQKGMAFAQYGSYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CT+ELLS+LKI SF+ MR EEL  LI+ +++AA +RVAVDLS+KVS L AD+SC
Sbjct  120   RNIRKMCTVELLSSLKITSFKPMRMEELDLLIKYIQEAAQERVAVDLSAKVSSLSADMSC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  +DLDERGF+ V++E M L    +LGDY P ++ LDLQGLT+RMKA++K  
Sbjct  180   RMVFGKKYLDEDLDERGFKSVMQEVMHLSAAPHLGDYIPQIAALDLQGLTKRMKAISKVL  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D F ++I+D+H Q  + G   + KDFVD MLS MKS E E+  ++  +K T+ D L G+ 
Sbjct  240   DVFLDKIIDEHVQYQEKG---KNKDFVDVMLSFMKSEENEYLVDQGCMKATMLDMLVGSM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +    +I+W  SEL+++P +MKK+Q+EL+  +G  RMVEESDLE L+YL+MVVKE+LRLH
Sbjct  297   DTSATVIDWAFSELIKNPRVMKKLQKELEEVVGKQRMVEESDLERLEYLDMVVKETLRLH  356

Query  715   PVAPL-IPNEAREDCMIEGFHIPKK  644
             P  PL IP+EA EDC++  FHIPKK
Sbjct  357   PAGPLMIPHEATEDCVVNDFHIPKK  381


 Score =   172 bits (435),  Expect(2) = 7e-149, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKS +IINVWAI  DP  WT+ EKF PERF GS+ID RGR F+LIPFG+GRR CPG
Sbjct  376  FHIPKKSHVIINVWAIGRDPKAWTDAEKFYPERFVGSDIDVRGRDFQLIPFGTGRRSCPG  435

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRLV+AQ++HCFDWE PN +   E+DM+E+FGL++ R+ HL+ IP YRL+
Sbjct  436  MQLGLTMVRLVLAQMVHCFDWELPNGILPSEVDMSEEFGLVLCRSKHLVSIPTYRLN  492



>ref|XP_010030392.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54382.1| hypothetical protein EUGRSUZ_I00333 [Eucalyptus grandis]
Length=499

 Score =   389 bits (999),  Expect(2) = 8e-149, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 245/325 (75%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M+LR G    I+ SSP+ AE FLKTHDL+FASRPP EAAK+ISY Q +L+  PYGPYW
Sbjct  63    PLMYLRLGFVPTILVSSPEVAEQFLKTHDLIFASRPPHEAAKHISYEQRSLAFAPYGPYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KI SF++MRR+E+  L+  LK A+ D +A+DLS+K+S L AD+SC
Sbjct  123   RNIRKMCTLELLSNAKIYSFRSMRRDEVSLLVNFLKDASHDHMAIDLSAKISSLSADMSC  182

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  ++ DERGF+ V++E M L    N+GDY PFL++ DLQGLT+RMKA+++ +
Sbjct  183   LMVFGKKYMDREFDERGFKAVVQEVMVLTATPNIGDYVPFLASFDLQGLTKRMKAVSRVF  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FFE+I+D+H ++ +     QTKDFVD ML IM   E E+  +R HIK  + D+  G+ 
Sbjct  243   DAFFEKIIDEHLETKK--EEGQTKDFVDVMLGIMGLNEGEYHIDRPHIKAIILDMLAGSM  300

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW M+EL++HP  MKK++EEL+   GL+R+VEESDLE L YL MV+KE++RLH
Sbjct  301   DTSATAIEWAMAELIKHPRAMKKLREELEKAAGLNRVVEESDLEGLDYLHMVIKETMRLH  360

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+EA EDC + GFHIP K
Sbjct  361   PVAPLLLPHEATEDCTVNGFHIPYK  385


 Score =   167 bits (424),  Expect(2) = 8e-149, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = -3

Query  645  KSRIIINVWAITHDPNVWT--NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KSR+I+NVW+I  DP VWT  +PE+F+PERF GS++D +GR F+L+PFG+GRR CPG+QL
Sbjct  385  KSRVIVNVWSIGRDPKVWTTHDPEEFVPERFLGSSVDVKGRDFQLLPFGTGRRGCPGMQL  444

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T+VR VVAQL+HCFDWE P+ M   ELDMTE+FGL   RA HL+V P YRL
Sbjct  445  GLTVVRFVVAQLVHCFDWELPSGMSPSELDMTEKFGLATPRAKHLVVTPRYRL  497



>ref|XP_010027781.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54384.1| hypothetical protein EUGRSUZ_I00335 [Eucalyptus grandis]
Length=500

 Score =   393 bits (1010),  Expect(2) = 9e-149, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 245/325 (75%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M+LR G  + IV SSP+ AE FLKTHDLVFASRPP EA+K+ISY Q +L+  PYGPYW
Sbjct  64    PLMYLRLGFVHTIVVSSPELAEQFLKTHDLVFASRPPHEASKHISYEQRSLAFAPYGPYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF++MRREE+  L+  LK AA D  A+DL+SK+  L AD+SC
Sbjct  124   RNIRKMCTLELLSNAKINSFKSMRREEVGLLVNFLKDAAHDHTAIDLTSKIFSLSADMSC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  K+ DERGF+ V++E M L    N+GDY P+L+  DLQGLT+RMKA++K +
Sbjct  184   RMVFGKKYMDKEFDERGFKAVIQEGMVLGATPNIGDYVPYLARFDLQGLTKRMKAVSKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FFE+I+D+H +S +     ++KDFVD ML  M   E E+  +R HIK  + D+  G+ 
Sbjct  244   DAFFEKIIDEHMKSMK--EEGESKDFVDVMLGFMGLNEGEYHIDRPHIKAIILDMLSGSM  301

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     I+W M+EL+RHP  MK+VQ+EL+  +G++R VEESDLE L YL+MV+KE++RLH
Sbjct  302   DTSATAIDWAMTELVRHPSAMKRVQDELEKAVGMNRAVEESDLEGLHYLDMVIKETMRLH  361

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+EA EDC + GFHIP K
Sbjct  362   PVAPLLLPHEATEDCTVNGFHIPLK  386


 Score =   163 bits (413),  Expect(2) = 9e-149, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 92/113 (81%), Gaps = 2/113 (2%)
 Frame = -3

Query  645  KSRIIINVWAITHDPNVWT--NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KSR+I+NVW+I  DP VWT  +PE+FIPERF GS++D +GR F+L+PFG+GRR CPG+QL
Sbjct  386  KSRVIVNVWSIGRDPKVWTTHDPEEFIPERFLGSSMDVKGRDFQLLPFGAGRRGCPGMQL  445

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T+VR V+AQL+HCFDW+ P  +   ELDMTE+FGL   RA HL+V+P YRL
Sbjct  446  GLTIVRFVLAQLVHCFDWDLPAGISPSELDMTEEFGLTAPRAKHLVVMPRYRL  498



>ref|XP_009615258.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=501

 Score =   391 bits (1004),  Expect(2) = 9e-149, Method: Compositional matrix adjust.
 Identities = 187/323 (58%), Positives = 250/323 (77%), Gaps = 4/323 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   IVASS  AAE  LKT+D +FASRP  EA++Y++YGQ N     YGPYW
Sbjct  62    PIMYMRLGLVPAIVASSADAAEKVLKTNDHIFASRPHHEASQYMAYGQKNFIFAKYGPYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RKLCT+ LLS+ KINSFQ+MR++++  LI+SLK+ A DR+ VDLS+K++ L A+++C
Sbjct  122   RNIRKLCTVHLLSSHKINSFQSMRKQQVQLLIDSLKREAHDRIVVDLSAKITSLNANLTC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  +DLD+RGF+ V+++ + L    NLGD+FPFL  +DLQGLTR++K L+K +
Sbjct  182   LMVFGKKYMDEDLDKRGFKAVVQDVLHLAATPNLGDFFPFLGVIDLQGLTRKLKDLSKVF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D+F E+I+D+H    QS    QTKDFVDTM+ IM+SGEAEFQF+R HIK  L D L  A 
Sbjct  242   DEFLEKIIDEHV---QSHDQKQTKDFVDTMMEIMQSGEAEFQFDRRHIKAILLDMLMAAM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     +EWI++ELLRHP +MKK+Q+EL   +G++RMVEESDLE+LKYL+MVVKE LRLH
Sbjct  299   DTSATSVEWILTELLRHPNVMKKLQKELDEVVGIERMVEESDLENLKYLDMVVKEGLRLH  358

Query  715   PVAPLIPNEAREDCMIEGFHIPK  647
              V P++ +EA EDC+++GFHI K
Sbjct  359   SVVPIMHHEAMEDCVVDGFHIQK  381


 Score =   165 bits (418),  Expect(2) = 9e-149, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK SRI+IN +A+  DPNVW  PEKF PERF GS++D RGR F+L+PFGSGRR CPG
Sbjct  377  FHIQKGSRIMINCYAVQRDPNVWPEPEKFFPERFVGSSVDIRGRDFQLLPFGSGRRSCPG  436

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QLG+T+VRLVVAQL+HCFDWE PN M   +L++ EQFGL+  +   L+ IP YRL
Sbjct  437  MQLGVTIVRLVVAQLVHCFDWEIPNGMQPLDLEIDEQFGLVTCKEKPLMAIPTYRL  492



>ref|XP_009770873.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=500

 Score =   379 bits (973),  Expect(2) = 1e-148, Method: Compositional matrix adjust.
 Identities = 184/324 (57%), Positives = 244/324 (75%), Gaps = 4/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +RFGL  +IVASSP AAE FLK HDLVFASRP  E  +Y+ Y + NL S  YGPYW
Sbjct  65    PIMTIRFGLVPVIVASSPHAAEQFLKNHDLVFASRPYNEVPQYMFYERRNLVSAKYGPYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTL+LLSN KI+ FQ MR++EL  L+  LKQAA +   +DLS+KV+ L A++SC
Sbjct  125   RNMRKLCTLQLLSNAKIHQFQPMRKQELGILVNFLKQAASEGTVIDLSAKVASLSANMSC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FGKKY  +DL ++GF+ ++++ + +    N  ++FPFL  LDLQG  RRMK LAK +
Sbjct  185   LMIFGKKYMDEDLGDKGFKALIQDILHIAALPNFAEFFPFLRVLDLQGFARRMKELAKLF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F ER++D+H QS +     Q KD VDT++ IM+S EAEF+F+R HIK  L DL  AS 
Sbjct  245   DEFLERVIDEHVQSTE--EQKQAKDMVDTLMDIMQSKEAEFEFDRRHIKAILLDLLIASM  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  IEWI++ELLRHPE+MKK+Q EL+  +G +RMVEESDL++L+YL+MV+KE  RLH
Sbjct  303   DTSSTTIEWILTELLRHPEVMKKLQNELEQVVGKNRMVEESDLKNLQYLDMVIKEGCRLH  362

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP L+P+E+ EDC ++GFH+PK
Sbjct  363   PVAPLLLPHESIEDCTVDGFHLPK  386


 Score =   177 bits (449),  Expect(2) = 1e-148, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+++NVWAI  D + W  PEKF PERF+GSN+D RGR++EL+PFGSGRR CPG
Sbjct  382  FHLPKGSRLLLNVWAIGRDSDTWLEPEKFKPERFQGSNVDLRGRNYELLPFGSGRRGCPG  441

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LQLG+T+VRLVVAQL+HCFDWE PN M  +++DMTE+FGL+ +RA +L+ IP YRLHI
Sbjct  442  LQLGLTVVRLVVAQLVHCFDWELPNGMLPKDIDMTEKFGLVTARAQNLMAIPTYRLHI  499



>ref|XP_003524281.2| PREDICTED: cytochrome P450 71A1-like isoform X1 [Glycine max]
 ref|XP_006580303.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Glycine max]
 ref|XP_006580304.1| PREDICTED: cytochrome P450 71A1-like isoform X3 [Glycine max]
Length=497

 Score =   387 bits (993),  Expect(2) = 1e-148, Method: Compositional matrix adjust.
 Identities = 191/325 (59%), Positives = 246/325 (76%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+MHLR G    IV SSPQAAELFLKTHDLVFASRPP EAAKYIS+ Q NLS   YG YW
Sbjct  60    PVMHLRLGFVPTIVVSSPQAAELFLKTHDLVFASRPPLEAAKYISWEQRNLSFAEYGSYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLS+ KINSF++MR EEL  +++ L++AA D   VDLS+KVS L AD+SC
Sbjct  120   RNVRKMCTLELLSHTKINSFRSMREEELDLMVKLLREAAKDGAVVDLSAKVSTLSADMSC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  +DLDE+GF+ V++E M L    N+GDY P+++ LDLQGLT+RMK + K +
Sbjct  180   RMVLGKKYMDRDLDEKGFKAVMQEGMHLAATPNMGDYIPYIAALDLQGLTKRMKVVGKIF  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FFE+I+D+H QS +    D+TKDFVD ML  + + E+E++  R +IK  L D+  G+ 
Sbjct  240   DDFFEKIIDEHLQSEK--GEDRTKDFVDVMLDFVGTEESEYRIERPNIKAILLDMLAGSM  297

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SELL++P +MKKVQ EL++ +G+ R VEESDL+ L YL+MVVKES+RLH
Sbjct  298   DTSATAIEWTLSELLKNPRVMKKVQMELETVVGMKRKVEESDLDKLVYLDMVVKESMRLH  357

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP LIP+++ EDCM+    IPKK
Sbjct  358   PVAPLLIPHQSTEDCMVGDLFIPKK  382


 Score =   169 bits (428),  Expect(2) = 1e-148, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+I+N WAI  DP+ W   EKF PERFEGS+ID RGR FELIPFGSGRR CPGLQLG
Sbjct  381  KKSRVIVNAWAIMRDPSAWDEAEKFWPERFEGSSIDVRGRDFELIPFGSGRRGCPGLQLG  440

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +T+VRL VAQ++HCFDW+ P  +  ++LDM E+FGL + RANHL  IP YRL
Sbjct  441  LTVVRLTVAQIVHCFDWKLPKDILPDDLDMKEEFGLTMPRANHLHAIPTYRL  492



>ref|XP_009782203.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=494

 Score =   387 bits (995),  Expect(2) = 3e-148, Method: Compositional matrix adjust.
 Identities = 187/323 (58%), Positives = 250/323 (77%), Gaps = 4/323 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   IVASS  AAE  LKT+D +FASRP  EA++Y++YGQ NL    YGPYW
Sbjct  62    PIMYMRLGLVPTIVASSADAAEKVLKTYDHIFASRPHHEASQYMAYGQKNLIFAKYGPYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCT+ LLS+ KINSFQ+MR++++  LI+SLK+ A D VAVDLS+K++ L A+++C
Sbjct  122   RNMRKLCTVHLLSSHKINSFQSMRKQQVQLLIDSLKREAHDHVAVDLSAKITSLNANLTC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY   DLD+RGF+ V+++ + L    NLGD+FPFL  +DLQGLTR++K L+K +
Sbjct  182   LMVFGKKYMDADLDKRGFKAVVQDVVHLAATPNLGDFFPFLGVIDLQGLTRKLKDLSKVF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D+F E+I+DDH    QS    QTKDFVDTM+ IM+SGEAEFQF+  +IK  L D L  A 
Sbjct  242   DEFLEKIIDDHV---QSHDDKQTKDFVDTMMEIMQSGEAEFQFDCRNIKAILLDMLMAAI  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     +EWI++ELLRHP +MKK+Q+EL+  +G+++MVEESDLE+LKYL+MVVKE LRLH
Sbjct  299   DTSATSVEWILTELLRHPHVMKKLQKELEELVGIEKMVEESDLENLKYLDMVVKEGLRLH  358

Query  715   PVAPLIPNEAREDCMIEGFHIPK  647
              + P++ +EA EDC+++GFHI K
Sbjct  359   SIVPIMHHEAMEDCVVDGFHIQK  381


 Score =   167 bits (423),  Expect(2) = 3e-148, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK SRI+IN +A+  DPNVW  PEKF PERF GSN+D RGR F+L+PFGSGRR CPG
Sbjct  377  FHIQKGSRIMINCYAVQRDPNVWPEPEKFFPERFVGSNVDTRGRDFQLLPFGSGRRSCPG  436

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QLGIT+V LVVAQL+HCFDWE PN M   +LD+ EQFGL+  +   L+ IP YRL
Sbjct  437  MQLGITIVSLVVAQLVHCFDWEIPNGMQPLDLDIDEQFGLVTCKEKPLMAIPTYRL  492



>ref|XP_007048087.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX92244.1| Cytochrome P450 [Theobroma cacao]
Length=515

 Score =   383 bits (984),  Expect(2) = 3e-148, Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 243/338 (72%), Gaps = 18/338 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLRFG   +IV SSP+AAE FLKT+DLVFASRPP E +KYI Y Q N+S  PYG YW
Sbjct  64    PIMHLRFGSMPVIVVSSPEAAEQFLKTYDLVFASRPPHEGSKYICYNQQNISFSPYGSYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLSNLKINSF++MR+EEL   I+ +++AA  RVAVDL++ VS L  +ISC
Sbjct  124   RNMRKMCTLELLSNLKINSFRSMRKEELHLFIDCIQEAASARVAVDLTATVSSLSTNISC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY   D DE+GF  +++E M +    N+ DY P    LDLQGL +RMKA+AK +
Sbjct  184   RMVLGKKYNNDDFDEKGFEAIIREGMQIGAAFNIADYIPLFKALDLQGLKKRMKAVAKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKP---TLSD---  911
             D FFE+++D+H    QS   ++TKDFVD ML  M S E+E++  R+ IK     LS+   
Sbjct  244   DDFFEKVIDEHV---QSKDENRTKDFVDVMLGFMGSEESEYRVERDTIKAIILALSNYIC  300

Query  910   --------LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLK  755
                     L  A +     IEW +SEL++HP ++KKVQ+EL++ +G++R+VEESDLE L+
Sbjct  301   FSRLLQDMLVAAMDTSATAIEWTLSELIKHPRVIKKVQKELENVVGMERLVEESDLEKLE  360

Query  754   YLEMVVKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             YL+MVVKES R+HPVAP L+P+ + EDC + GFHIPK 
Sbjct  361   YLDMVVKESFRIHPVAPLLVPHASVEDCTVNGFHIPKN  398


 Score =   171 bits (433),  Expect(2) = 3e-148, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+ IN WAI  DPN+WT+ EKFIPERF GS+ID RGR F+LIPFGSGRR CPG
Sbjct  393  FHIPKNSRVFINAWAIGRDPNIWTDAEKFIPERFVGSDIDLRGRDFQLIPFGSGRRGCPG  452

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            + LG+ +VRLVVAQL+HCFDWE P+ M   ELDMTE+FGL+  RA HL+ +P +RL
Sbjct  453  MPLGLIMVRLVVAQLVHCFDWELPDGMLATELDMTEEFGLVSPRAKHLLAMPTWRL  508



>ref|XP_002310005.2| hypothetical protein POPTR_0007s06240g [Populus trichocarpa]
 gb|EEE90455.2| hypothetical protein POPTR_0007s06240g [Populus trichocarpa]
Length=500

 Score =   390 bits (1002),  Expect(2) = 4e-148, Method: Compositional matrix adjust.
 Identities = 192/325 (59%), Positives = 250/325 (77%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSP+AAELFLKTHDLVFA RPP EAA+YISYGQ  ++   YG YW
Sbjct  60    PIMHLRLGLVPTIVVSSPEAAELFLKTHDLVFAGRPPHEAARYISYGQKGMAFAQYGSYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CT+ELLS+LKI SF+ MR EEL  LI+ +++AA +RVAVD+S+KVS L AD+SC
Sbjct  120   RNMRKMCTVELLSSLKITSFKPMRMEELDLLIKYIQEAAQERVAVDMSAKVSSLSADMSC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  +DLDERGF+ V++E M L    +LGDY P ++ LDLQGLT+RM A++K +
Sbjct  180   RMVFGKKYVDEDLDERGFKSVMQEVMHLTAAPHLGDYIPQIAALDLQGLTKRMNAISKVF  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D F ++I+D+H Q  + G   + KDFVD MLS+MKS E E+  ++  +K T+ D L G+ 
Sbjct  240   DVFLDKIIDEHVQYQEKG---KNKDFVDVMLSLMKSEENEYLVDQGCMKATMLDMLVGSM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +    +I+W  SEL+++P +MKK+Q+E++  +G  RMVEESDLE L+YL+MVVKE+LRLH
Sbjct  297   DTSATVIDWAFSELIKNPRVMKKLQKEIEEVVGKQRMVEESDLERLEYLDMVVKETLRLH  356

Query  715   PVAPL-IPNEAREDCMIEGFHIPKK  644
             P  PL IP+EA EDC++ GFHIPKK
Sbjct  357   PAGPLMIPHEATEDCVVNGFHIPKK  381


 Score =   164 bits (415),  Expect(2) = 4e-148, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKS +IINVWAI  DP  WT+ EKF PERF GS+ID RGR F+LIPFG+GRR CPG
Sbjct  376  FHIPKKSHVIINVWAIGRDPKAWTDAEKFYPERFVGSDIDVRGRDFQLIPFGTGRRSCPG  435

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVI  328
            +QLG+T+VRLV+AQL+HCFDWE PN +   E+DMTE+FGL++ R+ HLI I
Sbjct  436  MQLGLTVVRLVLAQLVHCFDWELPNGILPSEVDMTEEFGLVLCRSKHLIKI  486



>emb|CBI21489.3| unnamed protein product [Vitis vinifera]
Length=563

 Score =   389 bits (998),  Expect(2) = 4e-148, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 248/350 (71%), Gaps = 29/350 (8%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++RF L   IV SSPQAAE FLKT+DLVFA RPP E ++ +SY +  +S   YGPYW
Sbjct  92    PIMYMRFALVPTIVVSSPQAAEQFLKTNDLVFAGRPPHEGSRIVSYDRKGISFTDYGPYW  151

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTL LLSNL+I+SFQ +RREEL  LI+SLK+AAL R AVDLS+K+S L AD+SC
Sbjct  152   RNMRKLCTLGLLSNLRISSFQPLRREELDLLIKSLKEAALARTAVDLSAKISSLSADMSC  211

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+FGKKY  KD+DERGF+ V++E M L G  N+GDY PF++ LDLQGL RRMKA++K +
Sbjct  212   RMIFGKKYMDKDIDERGFKAVIQEGMQLAGAPNIGDYIPFVAPLDLQGLARRMKAISKVF  271

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHI------------  929
             D FFE+I+DDH    +     Q KD +D ML  M S E EFQ  R +I            
Sbjct  272   DAFFEKIIDDHIH--EPKEEGQPKDLIDVMLGYMGSKENEFQIERSNIKALVLVSIHTLI  329

Query  928   ----KPTLSD----------LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLD  791
                 KP+ S           L G+ +     IEW ++ELL++P IMKKVQEEL+  +G++
Sbjct  330   IHISKPSSSQYICCLNFQDMLAGSMDTSATAIEWALAELLKNPRIMKKVQEELEKVVGME  389

Query  790   RMVEESDLEDLKYLEMVVKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             R VEESDLE L+YL+MVVKE+LRLHPVAP LIP+E+ EDC + GFHIP+K
Sbjct  390   RKVEESDLESLEYLDMVVKETLRLHPVAPLLIPHESLEDCTVNGFHIPQK  439


 Score =   166 bits (419),  Expect(2) = 4e-148, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 92/115 (80%), Gaps = 0/115 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +KSR+++N +AI  DPNVWT+ EKF+PERF GS+ID RGR F+LIPFGSGRR CPG
Sbjct  434  FHIPQKSRVMVNTYAIGRDPNVWTDAEKFLPERFIGSSIDLRGRDFQLIPFGSGRRGCPG  493

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYR  316
            +QLG+T+VRLV+AQL+HCFDWE PN M   ELDMTE+FGL V RA H++   + R
Sbjct  494  MQLGLTVVRLVLAQLVHCFDWELPNGMMPSELDMTEEFGLTVPRAKHILAYISQR  548



>ref|XP_009607201.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=498

 Score =   377 bits (968),  Expect(2) = 4e-148, Method: Compositional matrix adjust.
 Identities = 184/324 (57%), Positives = 242/324 (75%), Gaps = 5/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +RFGL  +IVASSP AAE FLK HDLVFASRP  E  ++I Y + NL S  YGPYW
Sbjct  65    PIMTIRFGLVPVIVASSPHAAEQFLKNHDLVFASRPYNEVPQHIFYERRNLVSAKYGPYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTL+LLSN KI+ FQ MR++EL  L+  LK AA +   +DLS+KV+ L A++SC
Sbjct  125   RNMRKLCTLQLLSNAKIHQFQPMRKQELGILVNFLKHAASEGTVIDLSAKVASLSANMSC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FGKKY  +DL ++GF+ ++++ + +    N  ++FPFL  LDLQG  RRMK LAK +
Sbjct  185   LMIFGKKYMDEDLGDKGFKALIQDILHIAALPNFAEFFPFLRVLDLQGFARRMKELAKLF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F ER++D+H QS +     Q KD VDT++SIM+S EAEF+F+R HIK  L DL  AS 
Sbjct  245   DEFLERVIDEHVQSTE---QKQAKDMVDTLMSIMQSKEAEFEFDRRHIKAILLDLLIASM  301

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  IEW ++ELLRHPE+MKK+Q EL+  +G +RMVEESDLE L+YL+MV+KE  RLH
Sbjct  302   DTSSTTIEWTLTELLRHPEVMKKLQNELEQVVGRNRMVEESDLESLEYLDMVIKEGCRLH  361

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP L+P+E+ EDC ++GFH+PK
Sbjct  362   PVAPLLLPHESIEDCTVDGFHLPK  385


 Score =   177 bits (449),  Expect(2) = 4e-148, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+++NVWAI  D + W  PEKF PERF+GSN+D RGR++EL+PFGSGRR CPG
Sbjct  381  FHLPKGSRLLLNVWAIGRDSDTWIEPEKFKPERFQGSNVDLRGRNYELLPFGSGRRGCPG  440

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LQLG+T+VRLVVAQL+HCFDWE PN M  +++DMTE+FGL+ +RA HL+  P YRLH+
Sbjct  441  LQLGLTIVRLVVAQLVHCFDWELPNGMLPKDIDMTEKFGLVTARAQHLMATPTYRLHM  498



>ref|XP_006380460.1| hypothetical protein POPTR_0007s06360g [Populus trichocarpa]
 gb|ERP58257.1| hypothetical protein POPTR_0007s06360g [Populus trichocarpa]
Length=497

 Score =   383 bits (983),  Expect(2) = 5e-148, Method: Compositional matrix adjust.
 Identities = 190/325 (58%), Positives = 244/325 (75%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   +V SSP+AAEL LKTHDLVFA+RPP EAAK+I+Y Q  L+  PYG YW
Sbjct  64    PIMYMRLGLVPTVVVSSPRAAELILKTHDLVFANRPPNEAAKHITYEQKGLTFAPYGSYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF + R+EEL  LI+ +K A+ DRVAVDLS+KVS L ADISC
Sbjct  124   RNVRKMCTLELLSNHKINSFMSTRKEELDLLIDYIKDASRDRVAVDLSAKVSSLNADISC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+FGKK   K+ DERGF  +  E + +    NLGDY P ++ LDLQGLT+RMKA+ K +
Sbjct  184   RMIFGKKDLEKEFDERGFEPLTHEGIRIAASFNLGDYIPPIAPLDLQGLTKRMKAIGKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D FFE+I+D+H    Q    ++TKDF+D ML  + S E E++  R +IK  + D L G+ 
Sbjct  244   DDFFEKIIDEHI---QFKDENRTKDFLDVMLDFLGSEETEYRIGRGNIKAIILDMLVGSM  300

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SEL++HP +MKKVQ+EL+ KIG+DRMVEESDLE L+YL MV+KE+ RLH
Sbjct  301   DTPAAAIEWTLSELIKHPRVMKKVQKELEEKIGMDRMVEESDLEGLEYLHMVIKEAFRLH  360

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+E+ EDC I+GF IP+K
Sbjct  361   PVAPLLVPHESMEDCTIDGFLIPQK  385


 Score =   171 bits (433),  Expect(2) = 5e-148, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +K+R+++NVWAI  D + WT+  KFIPERF GSNID RGR F+L+ FG+GRR CPG
Sbjct  380  FLIPQKTRVLVNVWAIGRDQSAWTDANKFIPERFAGSNIDVRGRDFQLLTFGAGRRSCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            + LG+T+VR +VAQL+HCFDWE PN+M  EELDMTE FGL+  RANHL   P YRLH+
Sbjct  440  MHLGLTMVRQIVAQLVHCFDWELPNNMLPEELDMTEAFGLVTPRANHLCATPTYRLHL  497



>ref|XP_007159747.1| hypothetical protein PHAVU_002G263700g [Phaseolus vulgaris]
 gb|ESW31741.1| hypothetical protein PHAVU_002G263700g [Phaseolus vulgaris]
Length=497

 Score =   377 bits (968),  Expect(2) = 6e-148, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 245/325 (75%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M LR G    +V SSPQAAELFLKTHDLVFASRP  +A KY+S+GQ NL+   YG YW
Sbjct  59    PVMFLRLGFMPTVVVSSPQAAELFLKTHDLVFASRPRYQAEKYVSWGQRNLAFAEYGSYW  118

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLS  KINSF++MR EEL  LI+ L++AA     VDLS+K+S L AD+SC
Sbjct  119   RNMRKLCTLELLSQTKINSFRSMREEELDLLIKLLREAANAGATVDLSAKLSTLSADMSC  178

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  +DLDE+GF+ V++E M L    N+GDY P+++ LDLQG+T+R+KA  K +
Sbjct  179   RMVLGKKYMDQDLDEKGFKAVMQEAMRLLATPNMGDYIPYIAALDLQGITKRLKANHKIF  238

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FF++I+D+H +S +    D+TKDFVD ML    + E+E++  R +IK  L+D+  G+ 
Sbjct  239   DHFFDKIIDEHMESDK--GEDKTKDFVDVMLGFYGTQESEYRIERSNIKAILTDMLAGSM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SELL++P +MKK+Q EL+S +G+++ VEESDLE L+YL+MV+KESLRLH
Sbjct  297   DTSATAIEWTLSELLKNPRVMKKLQMELESVVGMEKKVEESDLEKLEYLDMVIKESLRLH  356

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP LIP+++ EDCM+  F IPKK
Sbjct  357   PVAPLLIPHQSTEDCMVGDFFIPKK  381


 Score =   176 bits (447),  Expect(2) = 6e-148, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+I+N WAI  DP+ W   EKF PERFEGSNID RGR FELIPFGSGRR CPG
Sbjct  376  FFIPKKSRLIVNAWAIMRDPDAWIEAEKFWPERFEGSNIDVRGREFELIPFGSGRRGCPG  435

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            +QLG+T++R  VAQL+HCFDW+ PN M  +ELDM ++FGL + RANHL+ IP YRL I
Sbjct  436  IQLGLTVIRHTVAQLVHCFDWKLPNDMMPDELDMADEFGLTMPRANHLLAIPTYRLSI  493



>ref|XP_006428070.1| hypothetical protein CICLE_v10026966mg [Citrus clementina]
 ref|XP_006493870.1| PREDICTED: cytochrome P450 71A1-like [Citrus sinensis]
 gb|ESR41310.1| hypothetical protein CICLE_v10026966mg [Citrus clementina]
Length=498

 Score =   384 bits (986),  Expect(2) = 7e-148, Method: Compositional matrix adjust.
 Identities = 190/325 (58%), Positives = 241/325 (74%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSPQAAE FLKTHDL+FASRPP +A+KY+SY Q N +  PYG YW
Sbjct  65    PIMHLRLGLMTTIVVSSPQAAEQFLKTHDLIFASRPPLQASKYMSYQQKNFAMAPYGSYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R +RK+CT  LLSN KIN FQ +R+EEL  LIE  K+A   R  VD+S+K+S L A+++C
Sbjct  125   RKVRKICTQNLLSNAKINYFQPIRKEELDLLIEYFKEAVRARCVVDISAKLSALSANMTC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKK    + DERGF  V++E M+L GK NLGDY P ++ LDLQGLT+R KA+AK Y
Sbjct  185   RMVLGKKCSDDEFDERGFENVVQEGMELVGKPNLGDYIPQITGLDLQGLTKRSKAVAKAY  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D F E+I+D+H    QS   ++T+DFVD MLS   S + E +  REHIK  L D+  GA 
Sbjct  245   DAFLEKIIDEHV---QSKDENRTEDFVDVMLSFEGSEDTEKKIEREHIKAILLDMLAGAM  301

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +    ++EW +SEL++HP +MKK+Q EL++ +GL RMVEESDLE L+YL+MVVKE+LRLH
Sbjct  302   DTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLEILEYLDMVVKETLRLH  361

Query  715   PVAPLI-PNEAREDCMIEGFHIPKK  644
             PVAPL+ P+E+ EDC + GFHIPKK
Sbjct  362   PVAPLMAPHESMEDCTVNGFHIPKK  386


 Score =   169 bits (429),  Expect(2) = 7e-148, Method: Compositional matrix adjust.
 Identities = 72/116 (62%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+I+N WAI  DP  W +PEKF PERF GS++D RGR F+L+PFGSGRR CPG
Sbjct  381  FHIPKKSRVIVNAWAIGRDPKAWNDPEKFFPERFIGSSVDVRGRDFQLLPFGSGRRACPG  440

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QL +T+V+ V AQL+HCFDWE P  M   ELDMTE+FGL+  RA HL+ +P+YRL
Sbjct  441  MQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTYRAKHLLAVPSYRL  496



>gb|KHN38214.1| Cytochrome P450 71A1 [Glycine soja]
Length=436

 Score =   383 bits (984),  Expect(2) = 8e-148, Method: Compositional matrix adjust.
 Identities = 190/323 (59%), Positives = 244/323 (76%), Gaps = 4/323 (1%)
 Frame = -2

Query  1606  MHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWRN  1427
             MHLR G    IV SSPQAAELFLKTHDLVFASRPP EAAKYIS+ Q NLS   YG YWRN
Sbjct  1     MHLRLGFVPTIVVSSPQAAELFLKTHDLVFASRPPLEAAKYISWEQRNLSFAEYGSYWRN  60

Query  1426  MRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCRM  1247
             +RK+CTLELLS+ KINSF++MR EEL  +++ L++AA D   VDLS+KVS L AD+SCRM
Sbjct  61    VRKMCTLELLSHTKINSFRSMREEELDLMVKLLREAAKDGAVVDLSAKVSTLSADMSCRM  120

Query  1246  VFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYDK  1067
             V GKKY  +DLDE+GF+ V++E M L    N+GDY P+++ LDLQGLT+RMK + K +D 
Sbjct  121   VLGKKYMDRDLDEKGFKAVMQEGMHLAATPNMGDYIPYIAALDLQGLTKRMKVVGKIFDD  180

Query  1066  FFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GASEA  890
             FFE+I+D+H QS +    D+TKDFVD ML  + + E+E++  R +IK  L D+  G+ + 
Sbjct  181   FFEKIIDEHLQSEK--GEDRTKDFVDVMLDFVGTEESEYRIERPNIKAILLDMLAGSMDT  238

Query  889   ITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHPV  710
                 IEW +SELL++P +MKKVQ EL++ +G+ R VEESDL+ L YL+MVVKES+RLHPV
Sbjct  239   SATAIEWTLSELLKNPRVMKKVQMELETVVGMKRKVEESDLDKLVYLDMVVKESMRLHPV  298

Query  709   AP-LIPNEAREDCMIEGFHIPKK  644
             AP LIP+++ EDCM+    IPKK
Sbjct  299   APLLIPHQSTEDCMVGDLFIPKK  321


 Score =   170 bits (430),  Expect(2) = 8e-148, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+I+N WAI  DP+ W   EKF PERFEGS+ID RGR FELIPFGSGRR CPGLQLG
Sbjct  320  KKSRVIVNAWAIMRDPSAWDEAEKFWPERFEGSSIDVRGREFELIPFGSGRRGCPGLQLG  379

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +T+VRL VAQ++HCFDW+ P  +  ++LDM E+FGL + RANHL  IP YRL
Sbjct  380  LTVVRLTVAQIVHCFDWKLPKDILPDDLDMKEEFGLTMPRANHLHAIPTYRL  431



>ref|XP_002276487.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=494

 Score =   377 bits (968),  Expect(2) = 8e-148, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 239/325 (74%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R G    IV SSPQAAE FLKTHDLVFA+RPP E ++++ Y    +S   YGPYW
Sbjct  60    PIMYMRLGFVPAIVVSSPQAAEQFLKTHDLVFANRPPHECSRHMLYDGKGISFSGYGPYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRKLCTLELL++ KINSF+ MRREE+  LI+S ++AA    AVD+S+KV+ L AD+SC
Sbjct  120   RSMRKLCTLELLTSRKINSFKPMRREEVGLLIKSFEEAARAGAAVDVSAKVALLSADMSC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  KDLDERGF+ V++E M L    N+GDY P L  LDLQGLTRR+KA  K +
Sbjct  180   RMVFGKKYMDKDLDERGFKAVIQEAMQLAATPNIGDYIPCLLGLDLQGLTRRIKATGKVF  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FFE+I+D+H    +     QTKD VD ML +M S E E+   R +IK    D+  AS 
Sbjct  240   DDFFEKIIDEHIH--KPKEEGQTKDLVDVMLDLMGSEETEYNIQRANIKAISLDMMAASM  297

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +    +IEW +SEL++HP +MKKV  EL+  +G++RMVEESDLE L+YL MVVKE+LRLH
Sbjct  298   DTSATMIEWALSELIKHPPMMKKVINELEKVVGMERMVEESDLESLEYLNMVVKETLRLH  357

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP LIP+E+ EDC ++GFHIP+K
Sbjct  358   PVAPLLIPHESMEDCTVDGFHIPQK  382


 Score =   176 bits (446),  Expect(2) = 8e-148, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +KSR+I+NVWAI  DPN WT+ +KF+PERF  S+ID+RG+HF+ IPFGSGRR CPG
Sbjct  377  FHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDIDFRGQHFQFIPFGSGRRGCPG  436

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRLV+AQL+HCFDWE P++M   ELDMTE+FGL + RA HL+ IP  RLH
Sbjct  437  MQLGLTVVRLVLAQLVHCFDWELPDNMLPSELDMTEEFGLTLPRAKHLVAIPTCRLH  493



>ref|XP_006365792.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=499

 Score =   381 bits (979),  Expect(2) = 2e-147, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 248/324 (77%), Gaps = 5/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++FGL  +IVASSP AAELFLK HD+ FASRP   A +YI+Y   ++    YGP+W
Sbjct  66    PIMSMQFGLVPVIVASSPHAAELFLKKHDIAFASRPYNAAGQYIAYDHRDIVFAKYGPHW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCT++LL+N+KINSF++MR++EL   + SLKQAA + + VDLS+K++ L A++SC
Sbjct  126   RNMRKLCTIKLLTNIKINSFRSMRKQELGIFVNSLKQAASNHIEVDLSAKLASLSANMSC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MV GKKY  ++ DERGF+ +++E + L    N+G++FPFLS  DLQG   RMK LAK +
Sbjct  186   LMVLGKKYMEEEFDERGFKNIMEETVVLAASPNIGEFFPFLSVFDLQGFIGRMKELAKIF  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FFE+++D+H    QS    + KD +DTM++IM+SGEAEF+F+R H+K  L DL  AS 
Sbjct  246   DDFFEKVIDEHV---QSKDQKKAKDIIDTMMTIMQSGEAEFKFDRRHVKAVLLDLLIAST  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             + I+  I+WI SELLRHP++MKK+Q EL+  +G++RMVEESDLE L+YL+MV+KE LRLH
Sbjct  303   DTISTAIDWIFSELLRHPKVMKKLQNELEQAVGINRMVEESDLERLEYLDMVIKEGLRLH  362

Query  715   PVAPLI-PNEAREDCMIEGFHIPK  647
             P +PL+ P+E+ EDC+++GF +PK
Sbjct  363   PPSPLLTPHESIEDCIVDGFDVPK  386


 Score =   170 bits (431),  Expect(2) = 2e-147, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+ +NVWAI  DP  W +PEKF+PERF  SNID RG  F+L+PFGSGRR CPG
Sbjct  382  FDVPKGSRLFVNVWAIGRDPEAWPDPEKFMPERFIDSNIDLRGHDFQLLPFGSGRRSCPG  441

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LQLG+T+VRLV+AQL+HCFDWE PN M    +DMTE+FGL+  RA HL+ IP YRL++
Sbjct  442  LQLGLTIVRLVLAQLVHCFDWELPNGMMPNHIDMTEKFGLVTPRAQHLMAIPTYRLNV  499



>ref|XP_009629564.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=431

 Score =   388 bits (996),  Expect(2) = 2e-147, Method: Compositional matrix adjust.
 Identities = 183/321 (57%), Positives = 247/321 (77%), Gaps = 4/321 (1%)
 Frame = -2

Query  1606  MHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWRN  1427
             M+++ GL   IVASS  AAE  LKT+D +FASRP  EA++Y+SYGQ N+    YGPYWRN
Sbjct  1     MYIQLGLVPAIVASSADAAEKVLKTYDHIFASRPHNEASQYMSYGQKNMIFAKYGPYWRN  60

Query  1426  MRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCRM  1247
             MRKLC + LLSN KINSFQ+MR++E+  LIESLK+ A DR  VDLS+KV+ L A ++C M
Sbjct  61    MRKLCIVHLLSNHKINSFQSMRKQEVELLIESLKEQAHDRAVVDLSAKVTSLNASLTCLM  120

Query  1246  VFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYDK  1067
             VFGKKY  +D D+RGF+ V++E +   G+ NLGD+FPFL  +DLQGL R++K L+K +D+
Sbjct  121   VFGKKYMDEDFDKRGFKAVVQEVVHFGGRPNLGDFFPFLGVIDLQGLNRKLKDLSKVFDE  180

Query  1066  FFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGASEA  890
             F E+I+D+H    QS    QTKDFVDTM+ IM+SGEAEFQF+R+HIK  L D L  A++ 
Sbjct  181   FLEKIIDEHV---QSHDQKQTKDFVDTMMEIMQSGEAEFQFDRQHIKAILVDMLIAATDT  237

Query  889   ITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHPV  710
                 +EWI++EL+RHP +MKK+Q+EL   +G++RMV+ESDLE++KYL+MV+KE LRLH +
Sbjct  238   SATSVEWILTELIRHPHVMKKLQKELDEVVGIERMVDESDLENMKYLDMVIKEGLRLHSI  297

Query  709   APLIPNEAREDCMIEGFHIPK  647
              P++ +EA EDC+++GFHI K
Sbjct  298   VPVLHHEAMEDCVVDGFHIQK  318


 Score =   164 bits (415),  Expect(2) = 2e-147, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK SRI+IN +AI  DPNVW  PEKF PERF GS++D RGR F+L+PFGSG+R CPG
Sbjct  314  FHIQKGSRIMINCYAIQRDPNVWPEPEKFFPERFVGSSVDIRGRDFQLLPFGSGKRSCPG  373

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QLGIT+VRLVVAQL+HCFDWE  N M   +LD+ EQFG++  +   L+ IP YRL
Sbjct  374  MQLGITIVRLVVAQLVHCFDWELQNGMQPLDLDIDEQFGMVACKEKPLMAIPTYRL  429



>ref|XP_006354722.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=494

 Score =   394 bits (1011),  Expect(2) = 4e-147, Method: Compositional matrix adjust.
 Identities = 191/323 (59%), Positives = 249/323 (77%), Gaps = 4/323 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   I+ASS  AAE  LKT+D +FA+RP  EA++Y+SYGQ NL    YG YW
Sbjct  62    PIMYVRLGLVPTIIASSADAAEKVLKTYDHIFATRPHHEASQYLSYGQKNLIFAKYGVYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLC + LLSN KINSFQ+MR++E+  LIESLK+ A DRVAVDLS+K++ L A+++C
Sbjct  122   RNMRKLCVVHLLSNNKINSFQSMRKQEVELLIESLKKEAHDRVAVDLSAKITSLNANLTC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  +DLD+RGF+ V+++ + L    NLGD+FPF+  +DLQGLTR++K L+K +
Sbjct  182   LMVFGKKYMDEDLDKRGFKSVVQDVVHLAATPNLGDFFPFIGAIDLQGLTRKLKDLSKVF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D+F E+I+D+H     S    QTKDFVDTM+ IM+SGEAEFQF+R HIK  L D L  A 
Sbjct  242   DEFLEKIIDEHV---HSHDQKQTKDFVDTMMGIMQSGEAEFQFDRRHIKAILFDMLIAAM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +      EWI++ELLRHP++MKK+Q+EL+  +GL+RMVEESDLE+LKYL MVVKE LRLH
Sbjct  299   DTTASSTEWILTELLRHPQVMKKLQKELQEVVGLERMVEESDLENLKYLNMVVKEGLRLH  358

Query  715   PVAPLIPNEAREDCMIEGFHIPK  647
             PV PL  +E+ EDC+++GFHI K
Sbjct  359   PVVPLFYHESMEDCVVDGFHIQK  381


 Score =   157 bits (398),  Expect(2) = 4e-147, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK SR+++N +A   DPNVW +PEKF+PERF GS ID+RGR F+L+PFGSGRR CPG
Sbjct  377  FHIQKGSRVMVNCYAAQRDPNVWPDPEKFLPERFVGSCIDFRGRDFQLVPFGSGRRSCPG  436

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QL + +VRLVVAQL+HCF+WE PN M   +LD+ E+FG++  R   L+ IP Y L+
Sbjct  437  MQLAVMVVRLVVAQLVHCFEWELPNGMQPCDLDIDEKFGIVTCREKPLMAIPTYNLN  493



>ref|XP_009378500.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=499

 Score =   380 bits (976),  Expect(2) = 5e-147, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 247/325 (76%), Gaps = 6/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM++R GL + +V SSP+AAELFLKTHDL FASRPP E AK+I +GQ N+S   YG YWR
Sbjct  66    IMYMRLGLHHNVVISSPRAAELFLKTHDLTFASRPPHEGAKHIIFGQKNMSFAEYGSYWR  125

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALD-RVAVDLSSKVSELIADISC  1253
             +MRK+C LELLSN KINSF+AMRREE+  LI+S+++ A + RV ++LS K+S L  D++C
Sbjct  126   DMRKMCMLELLSNHKINSFKAMRREEVSLLIQSVQEEANNRRVPINLSGKISSLGVDLTC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY+  + DERGF  V+KE + L    NL D+ PFL+ LDLQGLT++MK + K +
Sbjct  186   RMVFGKKYKDDEFDERGFTAVMKEAIQLVAAPNLNDHIPFLAPLDLQGLTKKMKTINKAF  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FF++I+DDH    QS   D+TKDF+D ML  M S E++++  R H+K  + D+F AS 
Sbjct  246   DAFFDKIIDDHL---QSKDEDRTKDFIDVMLGHMGSEESDYRIERVHVKALMLDMFAASV  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  I W  SELLRHP++MKKVQ+EL++ +GL+RMVEESDLE L+YL+MVVKE+LRLH
Sbjct  303   DTPSTAILWAFSELLRHPQVMKKVQKELENVVGLNRMVEESDLEKLEYLDMVVKETLRLH  362

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PV P L+P+ + EDC ++G+HIPK 
Sbjct  363   PVVPLLLPHLSIEDCTVDGYHIPKN  387


 Score =   170 bits (431),  Expect(2) = 5e-147, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            K SR+IIN WAI  DP+ W +PEKF+PERFEGSNID +G+HF+L+PFGSGRR C G+QLG
Sbjct  386  KNSRLIINAWAIGRDPSAWEDPEKFVPERFEGSNIDVKGKHFQLVPFGSGRRRCAGMQLG  445

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +T+++ V+AQ++HCFDWE P++M   ELDMTE FGL+VSR   L++IP+YRL 
Sbjct  446  LTVIQFVLAQIVHCFDWELPDNMLPNELDMTEVFGLVVSRTKDLLLIPSYRLQ  498



>gb|ACM89788.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89833.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   376 bits (966),  Expect(2) = 8e-147, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 238/325 (73%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R G    IV SSPQAAE FLKTHDLVFA+RPP E ++++ Y    +S   YGPYW
Sbjct  61    PIMYMRLGFVPAIVVSSPQAAEQFLKTHDLVFANRPPHECSRHMLYDGKGISFSGYGPYW  120

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRKLC LELLS+ KINSF+ MRREE+  LI+S ++AA    AVD+S+KV+ L AD+SC
Sbjct  121   RSMRKLCILELLSSHKINSFKPMRREEVGLLIKSFEEAARAGAAVDVSAKVALLSADMSC  180

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  KDLDERGF+ V+KE M L    N+GDY P L  LDLQGLTRR+KA AK +
Sbjct  181   RMVFGKKYMDKDLDERGFKAVIKEVMQLAATPNIGDYIPCLLGLDLQGLTRRIKATAKVF  240

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FFE+I+D+H    +     QTKD VD ML +M S E E+   R +IK    D+  AS 
Sbjct  241   DDFFEKIIDEHIH--KPKEEGQTKDLVDVMLDLMGSEETEYNIQRANIKAISLDMMAASM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SEL++HP +MKKV+ EL+  +G++RMVEESDLE L+YL MVVKE+LRLH
Sbjct  299   DTSATTIEWALSELIKHPPMMKKVRNELEKVVGMERMVEESDLESLEYLNMVVKETLRLH  358

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PV P LIP+E+ EDC ++GFHIP+K
Sbjct  359   PVVPLLIPHESIEDCTVDGFHIPQK  383


 Score =   173 bits (439),  Expect(2) = 8e-147, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +KSR+I+NVWAI  DPN WT+ +KF+PERF  S+ID+RG+HF+ IPFGSGRR CPG
Sbjct  378  FHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDIDFRGQHFQFIPFGSGRRGCPG  437

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRLV+AQL+HCFDWE P++M   ELDM E+FGL + RA HL+ IP  R H
Sbjct  438  MQLGLTVVRLVLAQLVHCFDWELPDNMLASELDMNEEFGLTLPRAKHLVAIPTCRFH  494



>ref|XP_011090597.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=495

 Score =   375 bits (964),  Expect(2) = 9e-147, Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 239/323 (74%), Gaps = 3/323 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM+LRFG    IV SSP AAEL LKTHDL+FA R   +AAK ISY + N+    YG YW
Sbjct  62    PIMYLRFGFVPTIVVSSPAAAELVLKTHDLIFAGRAHHQAAKEISYDKRNIVFAQYGIYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLSN KIN FQ MRR E+   +ESL++AA  R  VD+S+++S +I D++C
Sbjct  122   RNMRKLCTLELLSNFKINQFQPMRRAEIEVFVESLQRAAGKRETVDISARISAMIGDMTC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFG+K+   DLDE+GF+ V+ E + +    N+ DYFPFL+ LDLQGLTRRMK L+KT+
Sbjct  182   LMVFGRKFADGDLDEKGFKAVIGETLQVAALPNIADYFPFLAALDLQGLTRRMKELSKTF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGASE  893
             D F ERI+DDH Q+ Q     Q  DF DTM++IM+SGEA F+F+R H+K  L  +  A  
Sbjct  242   DGFLERIIDDHIQNKQEKKHAQ--DFADTMITIMESGEAGFEFDRRHVKAVLLVIILAXX  299

Query  892   AI-TILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
                + ++EW +SEL+RHP+ MKK+Q+EL+  +G+D++VEES L+ L+YL+MVVKE+LRLH
Sbjct  300   XTSSTVVEWALSELIRHPKAMKKLQQELEQAVGMDQIVEESHLDRLEYLDMVVKETLRLH  359

Query  715   PVAPLIPNEAREDCMIEGFHIPK  647
             P  PL+ +E+ EDC+++ FH+PK
Sbjct  360   PAVPLLIHESLEDCVVDQFHVPK  382


 Score =   174 bits (441),  Expect(2) = 9e-147, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+I+NVW+I  DPN W  P+KF+PERF GSNID RG+ F+LIPFGSGRR CPG
Sbjct  378  FHVPKGSRVIVNVWSIGKDPNAWREPQKFLPERFIGSNIDLRGQDFQLIPFGSGRRGCPG  437

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LQLG+T+VRLV+AQL+HCFDWE P+ M   ELDM E FGL+  R NHL+ +P YRL
Sbjct  438  LQLGLTVVRLVLAQLVHCFDWELPDGMVASELDMAEHFGLVTCRENHLLAVPTYRL  493



>gb|ACM89789.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
 gb|ACN89832.1| cytochrome P450 monooxygenase CYP736B [Vitis arizonica x Vitis 
rupestris]
Length=495

 Score =   375 bits (962),  Expect(2) = 3e-146, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 238/325 (73%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R G    IV SSPQAAE FLKTHDLVFA+RPP E ++++ +    +S   YGPYW
Sbjct  61    PIMYMRLGFVPAIVVSSPQAAEQFLKTHDLVFANRPPHECSRHMLHDGKGISFSGYGPYW  120

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRKLC LELLS+ KINSF+ MRREE+  LI+S ++AA    AVD+S+KV+ L AD+SC
Sbjct  121   RSMRKLCILELLSSHKINSFKPMRREEVGLLIKSFEEAARAGAAVDVSAKVALLSADMSC  180

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY  KDLDERGF+ V+KE M L    N+GDY P L  LDLQGLTRR+KA AK +
Sbjct  181   RMVFGKKYMDKDLDERGFKAVIKEVMQLAATPNIGDYIPCLLGLDLQGLTRRIKATAKVF  240

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FFE+I+D+H    +     QTKD VD ML +M S E E+   R +IK    D+  AS 
Sbjct  241   DDFFEKIIDEHIH--KPKEEGQTKDLVDVMLDLMGSEETEYNIQRANIKAISLDMMAASM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SEL++HP +MKKV+ EL+  +G++RMVEESDLE L+YL MVVKE+LRLH
Sbjct  299   DTSATTIEWALSELIKHPPMMKKVRNELEKVVGMERMVEESDLESLEYLNMVVKETLRLH  358

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PV P LIP+E+ EDC ++GFHIP+K
Sbjct  359   PVVPLLIPHESIEDCTVDGFHIPQK  383


 Score =   173 bits (439),  Expect(2) = 3e-146, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +KSR+I+NVWAI  DPN WT+ +KF+PERF  S+ID+RG+HF+ IPFGSGRR CPG
Sbjct  378  FHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDIDFRGQHFQFIPFGSGRRGCPG  437

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRLV+AQL+HCFDWE P++M   ELDM E+FGL + RA HL+ IP  R H
Sbjct  438  MQLGLTVVRLVLAQLVHCFDWELPDNMLASELDMNEEFGLTLPRAKHLVAIPTCRFH  494



>ref|XP_004237505.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=494

 Score =   385 bits (989),  Expect(2) = 1e-145, Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 251/323 (78%), Gaps = 4/323 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   I+ASS  AAE  LKT+D +FASRP  EA+++++YGQ NL    Y  YW
Sbjct  62    PIMYMRLGLVPTIIASSADAAEKVLKTYDHIFASRPHHEASQHLAYGQKNLVFAKYDVYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RKLCT+ LLSN KI+SFQ+MR++E+  LIESLKQ A DRV +DLS+KV+ L A+++C
Sbjct  122   RNIRKLCTVHLLSNQKIHSFQSMRKQEVELLIESLKQEARDRVVIDLSAKVTSLNANLTC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  +DLD+RGF+ ++++ + L G  NLGD+FPFL  +DLQG+TR++K L+K +
Sbjct  182   LMVFGKKYMDEDLDKRGFKAIVQDVVHLAGMPNLGDFFPFLGAIDLQGITRKLKDLSKVF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D+F E+I+D+H  + +     Q KDFVDTM+ IM+SG+A+FQF+R HIK  L D L  A 
Sbjct  242   DEFLEKIIDEHVYAHE---HKQNKDFVDTMMDIMQSGDAKFQFDRHHIKAILFDMLIAAM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +      EWI++ELLRHP++MK++Q+EL+  +GLDRMVEESDLE+LKYL+MVVKE LRLH
Sbjct  299   DTTASSTEWILTELLRHPQVMKELQKELQEVVGLDRMVEESDLENLKYLDMVVKEGLRLH  358

Query  715   PVAPLIPNEAREDCMIEGFHIPK  647
             PVAPL  +E+ EDC+++GFHI K
Sbjct  359   PVAPLFYHESIEDCVVDGFHIQK  381


 Score =   160 bits (406),  Expect(2) = 1e-145, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK +RIIIN +AI  DPNVW +PEKF+PERF GS++D+RGR F+L+PFGSGRR CPG
Sbjct  377  FHIQKGTRIIINCYAIHMDPNVWPDPEKFLPERFVGSSVDFRGRDFQLVPFGSGRRSCPG  436

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QL + +VRLVVAQL+HCF+WE PN +   +LD+ E+FG++  R   L+ IP Y+L
Sbjct  437  MQLAVMVVRLVVAQLVHCFEWELPNGIESCDLDIDEKFGIVTCREKPLLAIPTYKL  492



>ref|XP_009607200.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=497

 Score =   369 bits (947),  Expect(2) = 2e-145, Method: Compositional matrix adjust.
 Identities = 178/324 (55%), Positives = 238/324 (73%), Gaps = 2/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +RFGL  +IVASSP AAE FLK HD  FASRP  E ++YI Y Q NL S  YGPYW
Sbjct  60    PIMTIRFGLVPVIVASSPHAAEQFLKNHDSTFASRPYHEVSQYIFYEQRNLVSAKYGPYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTL+LLSN KI+ FQ MR++E+  L+  L+ AA +   +DLS+KV+ L A++SC
Sbjct  120   RNMRKLCTLQLLSNAKIHQFQPMRKQEVGILVNFLRHAASEGTVIDLSAKVASLSANMSC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FGKKY  +DL E+GF+ ++++ + L    N+ ++FPFL  LDLQG + RMK LA+ +
Sbjct  180   LMIFGKKYMDEDLGEKGFKALIQDILHLAALPNVAEFFPFLRVLDLQGFSHRMKELAQLF  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D   ER++D+H     +    Q  D VDT++ IM+S EAEF+F+R H+K  L DL  AS 
Sbjct  240   DGLLERVVDEHVVVQSTEQQKQATDMVDTLMGIMQSKEAEFEFDRRHVKAVLLDLLIAST  299

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  IEWI++ELLRHP++MKK+Q EL+  +G +RMVEE D E+L+YL+MV+KES RLH
Sbjct  300   DTSSTTIEWILTELLRHPDVMKKLQCELEQVVGKNRMVEELDFENLQYLDMVIKESCRLH  359

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP LIP+E+ EDC+I+GFHIPK
Sbjct  360   PVAPLLIPHESIEDCVIDGFHIPK  383


 Score =   176 bits (447),  Expect(2) = 2e-145, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+++NVWAI  D + W  PEKF PERF+GSNID  G++F+L+PFGSGRR CPG
Sbjct  379  FHIPKGSRLLVNVWAIGRDSDTWLEPEKFKPERFQGSNIDLGGQNFQLLPFGSGRRSCPG  438

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LQLG+T+VRLVVAQL+HCFDWE PN M  E +DMTE+FGL+ +RA HL+ IP YRLH+
Sbjct  439  LQLGLTIVRLVVAQLIHCFDWELPNGMLPEHIDMTEKFGLVTARAQHLMAIPTYRLHM  496



>ref|XP_008385983.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
 ref|XP_008359286.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   377 bits (968),  Expect(2) = 2e-145, Method: Compositional matrix adjust.
 Identities = 183/325 (56%), Positives = 246/325 (76%), Gaps = 6/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM++R GL + IV SSP+AAELFLKTHDL FASRPP E AK++ +GQ N+S   YGPYWR
Sbjct  66    IMYMRLGLHHNIVISSPRAAELFLKTHDLTFASRPPHEGAKHVIFGQTNMSFAEYGPYWR  125

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALD-RVAVDLSSKVSELIADISC  1253
             +MRK+C LELLSN KINSF+AMRREE+  LI+S++  A + RV ++LS K++ L  D++C
Sbjct  126   DMRKMCMLELLSNHKINSFKAMRREEVSLLIQSVQXDANNRRVPINLSXKIASLGVDLTC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             R+VFGKKY+  + DERGF  V+KE + L    NL D+ PFL+ LDLQGLT++MKA+ K +
Sbjct  186   RLVFGKKYKDVEFDERGFTAVMKEAIQLVAAPNLNDHIPFLAPLDLQGLTKKMKAINKAF  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FFE I+DDH    QS   ++TKDFVD  L  M S E++++  R H+K  + D+F AS 
Sbjct  246   DAFFENIIDDHL---QSKDEERTKDFVDVXLGHMGSEESDYRIERXHVKALMLDMFAASV  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  + +I W  SELLRHP++MKK+Q+EL++ +GL+RMVEESDLE L+YL+MVVKE+LRLH
Sbjct  303   DTPSTVILWAFSELLRHPQVMKKLQKELENVVGLNRMVEESDLEKLEYLDMVVKETLRLH  362

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             P  P L+P+ + EDC ++G+HIPK 
Sbjct  363   PAVPLLLPHLSIEDCTVDGYHIPKN  387


 Score =   168 bits (426),  Expect(2) = 2e-145, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            K SR+IIN WAI  DP+ W + EKF+PERFEGSNID +G+HF+LIPFGSGRR C G+QLG
Sbjct  386  KNSRLIINAWAIGRDPSAWEDAEKFVPERFEGSNIDVKGKHFQLIPFGSGRRRCAGMQLG  445

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +T+++ V+AQ++HCFDWE P++M   ELDMTE FGL+VSR+  L++IP+YRL 
Sbjct  446  LTVIQFVLAQIVHCFDWELPDNMLPNELDMTEVFGLVVSRSKDLLLIPSYRLQ  498



>ref|XP_011090598.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=500

 Score =   372 bits (955),  Expect(2) = 2e-145, Method: Compositional matrix adjust.
 Identities = 182/328 (55%), Positives = 238/328 (73%), Gaps = 8/328 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM+LRFG    IV SSP AAEL LKTHDL+FA R   +AAK ISY + N+    YG YW
Sbjct  62    PIMYLRFGFVPTIVVSSPAAAELVLKTHDLIFAGRAHHQAAKEISYDKRNIVFAQYGIYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLSN KIN FQ MRR E+   +ESL++AA  R  VD+S+K+S LI D++C
Sbjct  122   RNMRKLCTLELLSNFKINQFQPMRRAEIEVFVESLQRAAGKRETVDISAKISALIGDMTC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFG+K+   DLDE+GF+ V+ E + +    N+ DYFPFL+ LDLQGLTRRMK L+KT+
Sbjct  182   LMVFGRKFADGDLDEKGFKAVIGETLQVAALPNIADYFPFLAALDLQGLTRRMKELSKTF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPT-----LSDL  908
             D F ERI+DDH Q+ Q     Q  DF DTM++IM+SGEA F+F+R H+K       L DL
Sbjct  242   DGFLERIIDDHIQNKQEKKHAQ--DFADTMITIMESGEAGFEFDRRHVKAVLLVIILQDL  299

Query  907   -FGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
                       ++EW +SEL+RHP+ MKK+Q+EL+  +G+D++VEES L+ L+YL+MVVKE
Sbjct  300   XXXXXXXXXTVVEWALSELIRHPKAMKKLQQELEKVVGMDQIVEESHLDRLEYLDMVVKE  359

Query  730   SLRLHPVAPLIPNEAREDCMIEGFHIPK  647
             +LRLHP  PL+ +E+ EDC+++ FH+PK
Sbjct  360   TLRLHPAVPLLIHESLEDCVVDQFHVPK  387


 Score =   174 bits (440),  Expect(2) = 2e-145, Method: Compositional matrix adjust.
 Identities = 76/116 (66%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+I+NVW+I  DPN W  P+KF+PERF GSNID RG+ F+LIPFGSGRR CPG
Sbjct  383  FHVPKGSRLIVNVWSIGKDPNAWREPQKFLPERFIGSNIDLRGQDFQLIPFGSGRRGCPG  442

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LQLG+T+VRLV+AQL+HCFDWE P+ M   ELDM E FGL+  R NHL+ +P YRL
Sbjct  443  LQLGLTVVRLVLAQLVHCFDWELPDGMVASELDMAEHFGLVTCRENHLLAVPTYRL  498



>ref|XP_006366158.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=498

 Score =   381 bits (979),  Expect(2) = 3e-145, Method: Compositional matrix adjust.
 Identities = 189/324 (58%), Positives = 245/324 (76%), Gaps = 5/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M++R GL   IV SS   AE FLKT+D +FASRP  EAA Y++YGQ NL S  +GPYW
Sbjct  63    PLMYVRLGLVPTIVVSSADTAEKFLKTYDHIFASRPHNEAAYYLAYGQKNLISAKHGPYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALD-RVAVDLSSKVSELIADIS  1256
             R+MRKLCT  L  N KINSFQ+MR++++  +I+SLK  A D RV VDLS+K+S L AD++
Sbjct  123   RSMRKLCTQHLFGNQKINSFQSMRKQQVEVMIKSLKNEACDHRVVVDLSAKISSLNADLT  182

Query  1255  CRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             C MVFGKKY  +DLD+RGF+ ++KE   L    NLG++FPFL  +DLQGLTRR+K L+K 
Sbjct  183   CLMVFGKKYMDEDLDKRGFKALVKEVEHLAATPNLGEFFPFLGVIDLQGLTRRIKDLSKV  242

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS  896
             +D FFE+I+D+H    QS    Q+KDFVDTML IM+SGEAEFQF+R HIK  L D+  A+
Sbjct  243   FDDFFEKIIDEHV---QSRDQKQSKDFVDTMLDIMQSGEAEFQFDRRHIKAILFDMLIAA  299

Query  895   EAIT-ILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
                +   IEWI++ELLRHP +MKK+Q+EL+  +GL++MV+ESDLE+L YL+MVVKE LRL
Sbjct  300   MGTSPSAIEWILTELLRHPHVMKKLQKELEEVVGLEKMVKESDLENLNYLDMVVKEGLRL  359

Query  718   HPVAPLIPNEAREDCMIEGFHIPK  647
             H VAPL P+EA EDC++  F+I K
Sbjct  360   HAVAPLAPHEAMEDCVVNSFNIQK  383


 Score =   163 bits (413),  Expect(2) = 3e-145, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK SRI+IN +A+  DPN+W  PEKF+PERF GS+ID RG  F+L+PFGSGRR CP 
Sbjct  379  FNIQKGSRIMINFYAVQRDPNIWPEPEKFLPERFVGSSIDIRGHDFQLLPFGSGRRRCPA  438

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QL I LV L+VAQL+HCFDWE PN M   +LD+ E FGL  SR NHL+ IP YRL
Sbjct  439  MQLAIVLVYLIVAQLVHCFDWELPNGMQPCDLDVEEHFGLATSRENHLMAIPTYRL  494



>ref|XP_011100886.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=520

 Score =   372 bits (955),  Expect(2) = 4e-145, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 245/325 (75%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    +V SSP  AEL LKTHDLVFA+RP  EA+KYI Y Q +L+   YGPYW
Sbjct  85    PIMGLRLGFVPTVVVSSPAGAELVLKTHDLVFANRPRNEASKYIMYEQKDLAFGQYGPYW  144

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLSN +IN F AMR+ EL  L+ SLK+AA  R  VDLS++VS LI D++C
Sbjct  145   RNMRKLCTLELLSNRRINEFGAMRKVELELLVSSLKRAAEMREIVDLSARVSGLIGDVTC  204

Query  1252  RMVFGKKYEMKDLD-ERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
              MVF +KY  KDLD E+GF+ ++ E ++  GK NL DYFP++   DLQG+ R+MK+L+KT
Sbjct  205   LMVFRRKYADKDLDHEKGFKTLIMEALEFAGKFNLADYFPYVGFFDLQGMNRKMKSLSKT  264

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS  896
             +D+F E+++DDH ++       QTKDFVDTM+ IM+SG AEFQF+R H+K  L D+  A 
Sbjct  265   FDRFLEKLIDDHVKN--KQKKKQTKDFVDTMMEIMESGNAEFQFDRRHVKAVLLDILIAG  322

Query  895   -EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
              +  T  IEW ++EL+RHP +MKK+Q+EL++ +G+D+MVEES L  L+YL+ VVKE+LRL
Sbjct  323   IDTSTSAIEWALAELIRHPRVMKKLQKELETVVGMDQMVEESHLHGLEYLDFVVKETLRL  382

Query  718   HPVAP-LIPNEAREDCMIEGFHIPK  647
             HPV P LIP+E+ EDC+I+G+HIPK
Sbjct  383   HPVGPLLIPHESMEDCVIDGYHIPK  407


 Score =   172 bits (436),  Expect(2) = 4e-145, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            K SR I+NVWAI  DPNVW +PE F PERF GSNID RGR F+L+PFGSGRR CPGLQLG
Sbjct  407  KGSRAIVNVWAIGRDPNVWPDPEVFKPERFIGSNIDLRGRDFQLLPFGSGRRSCPGLQLG  466

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +T+V+LV++QL+HCFDW+ PN M   +LDM+E FGL V+RA HL+ IP+YRL
Sbjct  467  LTMVQLVLSQLVHCFDWQLPNGMQPSDLDMSEHFGLTVARAKHLVAIPSYRL  518



>ref|XP_006346716.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=499

 Score =   373 bits (958),  Expect(2) = 4e-145, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 241/324 (74%), Gaps = 4/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++FG+  +IVASSP  AE FLK HDLVFASRP   A + ++Y Q NL+   YGPYW
Sbjct  65    PIMSMKFGVIPIIVASSPHVAEQFLKKHDLVFASRPNNRAMQIVAYNQRNLTFGKYGPYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLS LKINSFQ MR++++   +  + +AA   V VD+S+ ++ L A++SC
Sbjct  125   RNMRKLCTLELLSPLKINSFQDMRKQQVTNFVTFINRAASSHVEVDISANLALLSANMSC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FGK+Y   + DERGF+ V++E + + G  N+G++FPFL   DLQGL  RMK LAK +
Sbjct  185   LMIFGKEYMDDEFDERGFKDVIQEALIIAGTPNIGEFFPFLDKFDLQGLIPRMKKLAKVF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F ER++D+H Q+  S    QTKD VDTM++IM+SGEAEF+F+R H+K  L DL  AS 
Sbjct  245   DEFLERVIDEHVQN--SKEEKQTKDIVDTMMNIMQSGEAEFEFDRRHVKAILLDLLIASI  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     I+WI SELLRHP IMKK+Q+EL+  +G++RMVEESDL  L+YL M++KE  RLH
Sbjct  303   DTSATSIDWIFSELLRHPNIMKKLQKELEQVVGMNRMVEESDLGKLEYLNMIIKEGFRLH  362

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             P+AP LIP E+ EDC+I+GF+IP+
Sbjct  363   PIAPLLIPRESMEDCIIDGFNIPR  386


 Score =   171 bits (433),  Expect(2) = 4e-145, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   + SRI++N WAI  D  VW  PEKF+PERF GS+ID RG  F+L+PF SGRR CPG
Sbjct  382  FNIPRGSRILVNTWAIGRDSEVWPEPEKFMPERFVGSDIDLRGHDFQLLPFSSGRRRCPG  441

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LQLG+T+VRLV+AQL+HCFDW+ PN M   +LDMTE+F L+VSRA HL+ IP YRLH+
Sbjct  442  LQLGLTVVRLVIAQLVHCFDWKLPNDMMPNDLDMTEKFSLVVSRAQHLMAIPTYRLHV  499



>ref|XP_006365795.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Solanum tuberosum]
Length=499

 Score =   374 bits (961),  Expect(2) = 5e-145, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 246/324 (76%), Gaps = 5/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++FGL  +IVASSP AAELFLK HD+ FA+RP   AA+YI+Y   ++    YGP+W
Sbjct  66    PIMSMQFGLVPVIVASSPHAAELFLKKHDIAFANRPYNAAAQYIAYDHRDIVFAKYGPHW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLC ++LLSN+KINSF++MR++EL   +  LKQAA +RV VDLS+ ++ LI D+SC
Sbjct  126   RNMRKLCKMKLLSNIKINSFRSMRKQELGIFVNFLKQAASNRVEVDLSADLASLIVDMSC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  ++ DERGF+ +  E   L    N+ ++FPFLS  DLQG   RMK LAK +
Sbjct  186   LMVFGKKYMEEEFDERGFKNIFYEASFLVASPNIAEFFPFLSVFDLQGFIARMKDLAKIF  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+FFE+++D+H QS +    +Q KD VDTM++IM+SGEAEF+ +R  +K  L DL  AS 
Sbjct  246   DEFFEKVIDEHVQSKE---QNQAKDMVDTMMTIMQSGEAEFKIDRRDVKAVLLDLLLAST  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             + ++I I+WI+SELLRHP++MKK+Q EL+  +G++RMVEESDLE L+YL+MV++E LRLH
Sbjct  303   DNVSIAIDWILSELLRHPKVMKKLQIELEQAVGINRMVEESDLERLEYLDMVIREGLRLH  362

Query  715   PVAPLI-PNEAREDCMIEGFHIPK  647
             P + L+ P+E+ EDC+++GF IPK
Sbjct  363   PPSTLLTPHESIEDCIVDGFDIPK  386


 Score =   169 bits (429),  Expect(2) = 5e-145, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+ +NVWAI  DP  W +PEKF+PERF  SNID RG  F+L+PFGSGRR CPG
Sbjct  382  FDIPKGSRLFVNVWAIGRDPEAWPDPEKFMPERFVDSNIDLRGHDFQLLPFGSGRRSCPG  441

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            LQLG+T+VRLV+AQL+HCFDWE PN M    +DMTE+FGL+  RA HL+ IP YRL+
Sbjct  442  LQLGLTIVRLVLAQLVHCFDWELPNGMMPNHIDMTEKFGLVTPRAQHLMAIPTYRLN  498



>ref|XP_003531375.1| PREDICTED: cytochrome P450 750A1-like isoform X1 [Glycine max]
Length=498

 Score =   374 bits (961),  Expect(2) = 7e-145, Method: Compositional matrix adjust.
 Identities = 184/326 (56%), Positives = 245/326 (75%), Gaps = 4/326 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR G    IV SSPQAAELFLKTHDLVFASRPP EA KYI++ Q NL    YG YW
Sbjct  59    PIMHLRLGFVPTIVISSPQAAELFLKTHDLVFASRPPHEAIKYIAWEQRNLGFAEYGSYW  118

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALD-RVAVDLSSKVSELIADIS  1256
             RNMRK+CTLELLS  KINSF+ +R EEL   I+ L++A+ D   AVD+S+KV+ + AD++
Sbjct  119   RNMRKMCTLELLSQTKINSFRIVREEELDLSIKLLREASNDGAAAVDISAKVARISADVA  178

Query  1255  CRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             CRMV GKKY  +DLDE+GF+ V++E M L    N+GDY P++  LDLQGL +RMKA+ K 
Sbjct  179   CRMVLGKKYMDQDLDEKGFKAVVQEVMHLLATPNIGDYIPYIGKLDLQGLIKRMKAVRKI  238

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGA  899
             +D+FF++I+D+H QS + G  ++ KDFVD ML  + S E E++  R +IK  L D L G+
Sbjct  239   FDEFFDKIIDEHIQSDK-GQDNKVKDFVDVMLGFVGSEEYEYRIERPNIKAILLDMLLGS  297

Query  898   SEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
              +    +IEW +SELL++P +MKKVQ EL++ +G+ R V+ESDL+ L+YL+MV+KE++RL
Sbjct  298   MDTSATVIEWTLSELLKNPRVMKKVQMELETVVGMQRKVKESDLDKLEYLDMVIKENMRL  357

Query  718   HPVAP-LIPNEAREDCMIEGFHIPKK  644
             HPVAP LIP+++REDCM+  F IP+K
Sbjct  358   HPVAPLLIPHQSREDCMVGDFFIPRK  383


 Score =   169 bits (428),  Expect(2) = 7e-145, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +KSR++IN WAI  D +VW+  EKF PERFEGSNID RG  F+ IPFGSGRR CPG
Sbjct  378  FFIPRKSRVVINAWAIMRDSSVWSEAEKFWPERFEGSNIDVRGHDFQFIPFGSGRRACPG  437

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +Q+G+T+VRL VAQL+HCF W+ P+ M  + LDMTE+FGL + RANHL+ +P YRLH
Sbjct  438  MQMGLTMVRLTVAQLVHCFHWKLPSDMLPDHLDMTEEFGLTMPRANHLLAVPTYRLH  494



>gb|EYU31078.1| hypothetical protein MIMGU_mgv1a004963mg [Erythranthe guttata]
Length=502

 Score =   372 bits (954),  Expect(2) = 2e-144, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 236/324 (73%), Gaps = 2/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH+RFG  + I+ SSP AAELFLKTHDLVFA+RP  EA+ YI Y Q N+   PYGPYW
Sbjct  67    PIMHMRFGSVDTIIVSSPAAAELFLKTHDLVFANRPHHEASTYIGYEQRNIVFGPYGPYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKL TLELLS  KIN FQ MR+ EL   ++SLK+A   R  VD+S ++  L AD++C
Sbjct  127   RNMRKLVTLELLSGSKINQFQPMRKAELGLFVDSLKRAGPGREPVDMSERIMSLAADMTC  186

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MV+G+K+  KDLDERGF+ V+K  M+     N+GDYFP+L  LDLQG  RR+K L+K +
Sbjct  187   LMVYGRKFAGKDLDERGFKEVMKMTMEEAAAFNIGDYFPYLRGLDLQGSARRLKKLSKIF  246

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D F ERI+DDH    +    + + DFVDT++SIM+SGEA F F+R H+K  L D L    
Sbjct  247   DGFLERIIDDHAPKKEE-RKEISMDFVDTLMSIMESGEAGFDFDRRHVKAVLLDMLLAGM  305

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     +EW +S+L+++P +MKK+Q+EL+  +G+D+MVEES L +LKYL+ VV+ES+R+H
Sbjct  306   DTSAAAVEWALSDLVKNPTVMKKLQKELEEIVGMDQMVEESHLPNLKYLDYVVRESMRIH  365

Query  715   PVAPLIPNEAREDCMIEGFHIPKK  644
             PV PL+ +E+ EDC ++GFHIPKK
Sbjct  366   PVGPLLIHESMEDCEVDGFHIPKK  389


 Score =   170 bits (430),  Expect(2) = 2e-144, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 95/118 (81%), Gaps = 1/118 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERF-EGSNIDYRGRHFELIPFGSGRRICP  484
            F   KK+R++INVWAI  DPN W +PEKF PERF E  N+D RGR ++LIPFG+GRR CP
Sbjct  384  FHIPKKTRVLINVWAIGRDPNAWAHPEKFWPERFVESPNVDLRGRDYQLIPFGTGRRGCP  443

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            GLQLG+T+V+L+VAQL+HCFDWE P+ +   ELDM+E FGL+ SRA HL+VIP YRL+
Sbjct  444  GLQLGLTIVQLIVAQLVHCFDWELPHGVSASELDMSENFGLVTSRAKHLMVIPTYRLN  501



>ref|XP_004237615.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=492

 Score =   388 bits (997),  Expect(2) = 3e-144, Method: Compositional matrix adjust.
 Identities = 189/323 (59%), Positives = 248/323 (77%), Gaps = 4/323 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL    VASS  AAE  LKT+D VFASRP  EA++Y+SYGQ NL    YG YW
Sbjct  59    PIMYMRLGLVPTFVASSADAAEKVLKTYDHVFASRPHHEASQYLSYGQKNLIFAKYGVYW  118

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCT+ LLSN KINSFQ+MR++++  LIESLK+ A DRVAVDLS+K++ L A+++C
Sbjct  119   RNMRKLCTVHLLSNNKINSFQSMRKQQVQLLIESLKKEAHDRVAVDLSAKITSLNANLTC  178

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  +DLD+RGF+ ++++ + L    NLGD+FPFL  +DLQGLTR++K L++ +
Sbjct  179   LMVFGKKYMDEDLDKRGFKSIVQDVVHLAATPNLGDFFPFLGAIDLQGLTRKLKDLSEVF  238

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D+F E+I+D+H  S +     QTKDFVDTM+ IM+SG AEFQ +R HIK  L D L  A 
Sbjct  239   DEFLEKIIDEHVHSHE---HKQTKDFVDTMMGIMQSGVAEFQLDRRHIKAILFDMLIAAM  295

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +      EWI++ELLRHP++MKK+Q+EL+  +GL+R VEESDLE+LKYL+MVVKE LRLH
Sbjct  296   DTTASSTEWILTELLRHPQVMKKLQKELQEVVGLERTVEESDLENLKYLDMVVKEGLRLH  355

Query  715   PVAPLIPNEAREDCMIEGFHIPK  647
             PV PL  +E+ EDC+++GFHI K
Sbjct  356   PVVPLFYHESMEDCVVDGFHIKK  378


 Score =   153 bits (386),  Expect(2) = 3e-144, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  +K SR+++N +A   DPNVW  PE F+PERF GS ID+RGR F+L+PFGSGRR CPG
Sbjct  374  FHIKKGSRVMVNCYAAQRDPNVWPEPEMFLPERFVGSCIDFRGRDFQLVPFGSGRRSCPG  433

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QL + +VRLVVAQL+HCF+WE PN M   +LD+ E+FG++  R   L+ IP Y L+
Sbjct  434  MQLAVIVVRLVVAQLVHCFEWELPNGMQPCDLDIDEKFGMVTCREKPLMAIPTYNLN  490



>ref|XP_008440668.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=508

 Score =   370 bits (950),  Expect(2) = 3e-144, Method: Compositional matrix adjust.
 Identities = 179/325 (55%), Positives = 236/325 (73%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ GL   I+ SSPQAA+LFLKTHDL+FASRP  +A+K+ISY Q NL   PYGPYW
Sbjct  66    PIMSMKLGLVPTIIVSSPQAAKLFLKTHDLIFASRPSSQASKHISYQQQNLVFAPYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLSN KINSF  +R+ EL  LIE  K+AA ++  V+LS+KV+ L  DI C
Sbjct  126   RNMRKMCTLELLSNHKINSFMPIRKHELGLLIEYFKEAAHNKTVVNLSAKVTSLTTDIIC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M FGKKY  +D DERGF+ V++E M L    NLGD+ P ++ LDLQG TR+MK++ K Y
Sbjct  186   LMAFGKKYGDEDFDERGFKAVIQEGMQLAAAPNLGDFIPAIAWLDLQGFTRKMKSVHKVY  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F E+I+++H     +    +T+DFVD ML ++ S + E+Q +R  IK  + D+  A+ 
Sbjct  246   DEFLEKIINEHL---VARGGKKTRDFVDVMLDLIDSQQTEYQIDRSTIKAIMLDMLAAAM  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  I W MSEL+R P++MKK+Q EL+  +GLDRMVEESDL  L+YLEMVVKE +RL+
Sbjct  303   DTSSTTIGWAMSELIRQPDVMKKMQSELQKVVGLDRMVEESDLVSLEYLEMVVKEIMRLY  362

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             P  P LIP+E+ EDC + GFHIPKK
Sbjct  363   PAGPLLIPHESLEDCTVNGFHIPKK  387


 Score =   171 bits (432),  Expect(2) = 3e-144, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+I+N WAI  DP+VW +P KF PERF GS ID +G+ FELIPFG+GRR CPG
Sbjct  382  FHIPKKSRLIVNAWAIGRDPSVWNDPHKFFPERFIGSQIDLKGKDFELIPFGAGRRGCPG  441

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRL++AQL+HCFDWE PN M   ELDMTE+FGL   RA  L+VIP +RL+
Sbjct  442  MQLGLTMVRLLLAQLVHCFDWELPNGMLPSELDMTEEFGLTCPRAQDLMVIPTFRLY  498



>ref|XP_009600860.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=487

 Score =   370 bits (950),  Expect(2) = 5e-144, Method: Compositional matrix adjust.
 Identities = 185/326 (57%), Positives = 240/326 (74%), Gaps = 10/326 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +RFGL  ++VASSP AAE FLK HDLVFASRP  E ++YI Y Q NL S  YGPYW
Sbjct  54    PIMSMRFGLVPVVVASSPYAAEQFLKNHDLVFASRPYSEVSQYIFYNQRNLVSSKYGPYW  113

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALD--RVAVDLSSKVSELIADI  1259
             RNMRKLCTL+LLSN+KI+SFQ MR++E+  L+  LKQAA     V V+LS K+  L A++
Sbjct  114   RNMRKLCTLQLLSNVKIHSFQPMRKQEVGILVNFLKQAAASDGDVVVNLSDKIGSLSANM  173

Query  1258  SCRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAK  1079
             +C MVFGKKY  +DL E+GF+ +++E M +     LGDY PF     LQGLTRRMK LAK
Sbjct  174   ACMMVFGKKYMDEDLGEKGFKALVQETMRIISMPKLGDYIPF-----LQGLTRRMKELAK  228

Query  1078  TYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGA  899
              +D+F ER++++H Q   +    Q KD VDT++ IM+S EAEF+F+R H+K  L DL  A
Sbjct  229   LFDEFLERVINEHVQQS-TNELKQAKDIVDTLMGIMQSEEAEFEFDRRHVKAILLDLLMA  287

Query  898   S-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLR  722
             S +  +  +EWI+SEL+RHP +MKK+Q EL+  +G +RMVEESDLE+L+YLEMV+KE  R
Sbjct  288   SMDTSSTTVEWILSELIRHPNVMKKLQNELEQVVGKNRMVEESDLENLEYLEMVIKEGFR  347

Query  721   LHPVAP-LIPNEAREDCMIEGFHIPK  647
             LHPV P LIP+E+ +DC ++GFHI K
Sbjct  348   LHPVVPLLIPHESIKDCTVDGFHIRK  373


 Score =   170 bits (431),  Expect(2) = 5e-144, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  +K SRI++NVWAI  DP+VW+ PEKFIPERF G NID +G  F+L+PFG GRR CP 
Sbjct  369  FHIRKGSRILVNVWAIGRDPDVWSEPEKFIPERFLGCNIDLKGHSFQLLPFGFGRRSCPS  428

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LQLG+T+VRL++AQL+HCFDW+ PN+M  ++L+M E+FGL+ +R  HL+ IP YRLHI
Sbjct  429  LQLGLTIVRLLIAQLVHCFDWKLPNNMLPKDLNMNEKFGLVTTRVQHLMAIPTYRLHI  486



>ref|XP_004143568.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=509

 Score =   372 bits (954),  Expect(2) = 6e-144, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 240/325 (74%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ GL   I+ SSPQAA+LFLKT+DL+FASRP  +A+K+ISY Q NL   PYGPYW
Sbjct  67    PIMSMKLGLVPTIIVSSPQAAKLFLKTYDLIFASRPSSQASKHISYQQKNLVFAPYGPYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLSNLKINSF  MR+ EL  LIE LK+AA ++  V+LS+KV+ L  DI C
Sbjct  127   RNMRKMCTLELLSNLKINSFMPMRKHELGLLIEYLKEAAHNKAVVNLSAKVTSLTTDIIC  186

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M FGKKY  +++DERGF+ V++E M L    NLGD+ P ++ LDLQG TR+MK + K Y
Sbjct  187   LMAFGKKYGDEEIDERGFKAVIQEGMQLSAAPNLGDFIPAIAWLDLQGFTRKMKRVHKVY  246

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D+F E+I+++H     +    +T+DFVD ML ++ S + E+Q +R  IK  + D+  GA 
Sbjct  247   DEFLEKIINEHL---VARGGKKTRDFVDVMLDLIGSQQTEYQIDRSAIKAIMLDMLAGAM  303

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  I W MSEL+RHP++MKK+Q+EL+  +GL RMV+ESDL +L+YLEMVVKE +RL+
Sbjct  304   DTSSTTIGWAMSELIRHPDVMKKMQDELQEVVGLHRMVQESDLVNLEYLEMVVKEIMRLY  363

Query  715   PVAPL-IPNEAREDCMIEGFHIPKK  644
             P  PL IP E+ EDC ++GFHIPKK
Sbjct  364   PAGPLSIPRESLEDCTVDGFHIPKK  388


 Score =   168 bits (426),  Expect(2) = 6e-144, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+I+NVWAI  DP+VW +P KF PERF GS ID +G  FELIPFG GRR CPG
Sbjct  383  FHIPKKSRVIVNVWAIGRDPSVWNDPHKFFPERFIGSQIDLKGNDFELIPFGGGRRGCPG  442

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRL++AQL+HCFDW+ PN M   ELDMTE+FGL   RA  L+VIP +RL+
Sbjct  443  MQLGLTMVRLLLAQLVHCFDWKLPNGMLPSELDMTEEFGLTCPRAEDLMVIPTFRLN  499



>ref|XP_008440675.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=494

 Score =   370 bits (949),  Expect(2) = 1e-143, Method: Compositional matrix adjust.
 Identities = 182/324 (56%), Positives = 241/324 (74%), Gaps = 5/324 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM++R GL   ++ SSPQAAELFLKTHD VFASRP  +A+KY+SYGQ NL    YGPYWR
Sbjct  62    IMYMRLGLVPTVIVSSPQAAELFLKTHDTVFASRPFVQASKYMSYGQKNLGFAQYGPYWR  121

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             NMRK+CTLELLS++K+ SF++MR EEL  L++ L+ AA  RV V+LSSK+  L  D++C 
Sbjct  122   NMRKMCTLELLSSVKVKSFRSMRMEELGLLVDYLRDAAKKRVIVNLSSKICSLNTDMTCL  181

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MVFGKKYE ++ DERGF+ V++E M L    NLGD+ P ++ LDLQGL RR KA++K +D
Sbjct  182   MVFGKKYEDQEFDERGFKSVIQEAMQLVASPNLGDFIPQIAGLDLQGLDRRSKAISKIFD  241

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGASE  893
              F ERI+D+H    +S + ++T DFVD ML IM S E E+Q  R +IK  + D L  A +
Sbjct  242   GFLERIIDEHL---ESKNENKTMDFVDVMLEIMGSQETEYQIERSNIKALILDMLVAAMD  298

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
                  I W + EL++HP +MKK+Q+EL+  +GLDR VEE+DL+ L+YL+MVVKE LRLHP
Sbjct  299   TSATTIGWAIPELIKHPHVMKKMQDELEKVVGLDRKVEETDLDHLEYLDMVVKEILRLHP  358

Query  712   VAP-LIPNEAREDCMIEGFHIPKK  644
              AP L+P+EA EDC+++GF+IPKK
Sbjct  359   PAPLLVPHEALEDCIVDGFYIPKK  382


 Score =   169 bits (429),  Expect(2) = 1e-143, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSRII+N WAI  DPN W +PEKF PERF GS +D RGR F+LIPFGSGRR CPG
Sbjct  377  FYIPKKSRIIVNGWAIGRDPNFWIDPEKFFPERFIGSQVDVRGRDFQLIPFGSGRRGCPG  436

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +Q+G+T+VRLV+AQL+HCFDWE PN     +LDMTE+FGL   RA  L+V P YRLH
Sbjct  437  MQMGLTVVRLVIAQLVHCFDWELPNGTLPVKLDMTEEFGLTCPRAQDLMVTPIYRLH  493



>ref|XP_003630098.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04574.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=477

 Score =   359 bits (922),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 185/311 (59%), Positives = 228/311 (73%), Gaps = 5/311 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSPQAAELFLKTHDLVFASRPP  AAK IS+ Q NLS   YG YW
Sbjct  61    PIMHLRLGLIPTIVVSSPQAAELFLKTHDLVFASRPPHLAAKIISWDQRNLSFGEYGSYW  120

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLS+ KINSF+ MR +EL  LI  LK  A D   VDLS+KVS L AD+SC
Sbjct  121   RNMRKMCTLELLSHAKINSFKTMREQELDLLIMFLK--ANDGTKVDLSAKVSTLAADMSC  178

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  KDLDE+GF+ V++E M L    N+GDY P++ +LDLQGLTRRMKA+ K +
Sbjct  179   RMVLGKKYIDKDLDEKGFKAVMQEGMHLAATPNIGDYIPYVGSLDLQGLTRRMKAIGKIF  238

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FFE+I+D+H QS      D+ KDFVD ML  + + E+E++  R +IK  L D+  G+ 
Sbjct  239   DDFFEKIIDEHIQSDY--KDDKNKDFVDVMLGFLGTQESEYRIERPNIKAILLDMLAGSM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SEL+++P +MKKVQ EL++ +G+ R VEESDLE L+YL+M +KESLRLH
Sbjct  297   DTSATAIEWAISELIKNPIVMKKVQNELETVVGMKRKVEESDLEKLEYLDMAIKESLRLH  356

Query  715   PVAPLIPNEAR  683
             PV   IP +AR
Sbjct  357   PVIFSIPKKAR  367


 Score =   179 bits (454),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 78/117 (67%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -3

Query  663  VFTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            +F+  KK+R+I+N W++  DPN WT+PE F PERFE SNID RGR F+LIPFGSGRR CP
Sbjct  359  IFSIPKKARVIVNSWSVMRDPNAWTDPEMFWPERFEESNIDVRGRDFQLIPFGSGRRGCP  418

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            GLQLG+T++RLVVAQL+HCFDW+ PN M   +LDMTE+FGL + RANHL  IP YRL
Sbjct  419  GLQLGLTVIRLVVAQLVHCFDWKLPNHMLPSDLDMTEEFGLTMPRANHLTAIPTYRL  475



>ref|XP_004162327.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=504

 Score =   370 bits (949),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 238/325 (73%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ GL   I+ SSPQAA+LFLKT+DL+FASRP  +A+K+ISY Q NL   PYGPYW
Sbjct  67    PIMSMKLGLVPTIIVSSPQAAKLFLKTYDLIFASRPSSQASKHISYQQKNLVFAPYGPYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLSNLKINSF  MR+ EL  LIE LK+AA ++  V+LS+KV+ L  DI C
Sbjct  127   RNMRKMCTLELLSNLKINSFMPMRKHELGLLIEYLKEAAHNKAVVNLSAKVTSLTTDIIC  186

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M FGKKY  +D DERGF+ V++E M      NLGD+ P ++ LDLQG TR+MK + K Y
Sbjct  187   LMEFGKKYGDEDFDERGFKAVIQEGMQFAAAPNLGDFIPAIAWLDLQGFTRKMKRVHKVY  246

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D+F E+I+++H     +    +T+DFVD ML ++ S + E+Q +R  IK  + D+  GA 
Sbjct  247   DEFLEKIINEHL---VARGGKKTRDFVDVMLDLIDSQQTEYQIDRSAIKAIMLDMLAGAM  303

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  I W MSEL+RHP++MKK+Q+EL+  +GL RMV+ESDL +L+YLEMVVKE +RL+
Sbjct  304   DTSSTTIGWAMSELIRHPDVMKKMQDELQEVVGLHRMVQESDLVNLEYLEMVVKEIMRLY  363

Query  715   PVAPL-IPNEAREDCMIEGFHIPKK  644
             P  PL IP E+ EDC ++GFHIPKK
Sbjct  364   PAGPLSIPRESLEDCTVDGFHIPKK  388


 Score =   169 bits (427),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+I+NVWAI  DP+VW +P KF PERF GS ID +G  FELIPFG GRR CPG
Sbjct  383  FHIPKKSRVIVNVWAIGRDPSVWNDPHKFFPERFIGSQIDLKGNDFELIPFGGGRRGCPG  442

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRL++AQL+HCFDWE PN M   ELDMTE+FGL   RA  L+VIP +RL+
Sbjct  443  MQLGLTMVRLLLAQLVHCFDWELPNGMLPPELDMTEEFGLTCPRAEDLMVIPTFRLN  499



>ref|XP_009588170.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=494

 Score =   379 bits (974),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 245/323 (76%), Gaps = 4/323 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   IVASS  AAE  LKT+D +FASRP  EA++Y++YGQ N     YGPYW
Sbjct  62    PIMYMRLGLVPAIVASSADAAEKVLKTNDHIFASRPHHEASQYMAYGQKNFIFAKYGPYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCT+ LLS+ KINSFQ+ R +++  LI+SLK+ A DRV VDLS+K++ L A+++C
Sbjct  122   RNMRKLCTVHLLSSHKINSFQSTRNQQVQLLIDSLKREAHDRVVVDLSAKITSLNANLTC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  +DLD+RGF+ V+++ + L    NLGD+FPFL  +DLQGLTR++K L+K +
Sbjct  182   LMVFGKKYMDEDLDKRGFKAVVQDVLHLAATPNLGDFFPFLGVIDLQGLTRKLKDLSKVF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D+F E+I+D+H    QS    QT DFVDTM+ IM+SGEAEFQF+R+HIK  + D L  A 
Sbjct  242   DEFLEKIIDEHL---QSHDQKQTNDFVDTMMEIMQSGEAEFQFDRQHIKAIIQDMLMAAM  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     +EWI++ELLRHP +MKK+Q+EL   +G++++V+E DLE+LKYL+MV KE LRLH
Sbjct  299   DTSATSVEWILTELLRHPNVMKKLQKELDEVVGIEKIVKEPDLENLKYLDMVAKEGLRLH  358

Query  715   PVAPLIPNEAREDCMIEGFHIPK  647
              V PL+ +EA E+C++ GFHI K
Sbjct  359   SVVPLMHHEAMEECVVNGFHIQK  381


 Score =   159 bits (401),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK SRI+IN +A+  DPNVW  PEKF PERF GS+ID R R F+L+PFGSGRR CPG
Sbjct  377  FHIQKGSRIMINCYAVQRDPNVWPEPEKFFPERFVGSSIDIRRRDFQLLPFGSGRRSCPG  436

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QLG+T++RLVVAQL+HCFDWE  N M   +L++ EQFGL+  +   L+ IP YRL
Sbjct  437  MQLGVTIIRLVVAQLVHCFDWEISNGMQPLDLEIDEQFGLVTCKEKPLMAIPTYRL  492



>ref|XP_006354708.1| PREDICTED: flavonoid 3'-monooxygenase-like [Solanum tuberosum]
Length=493

 Score =   360 bits (923),  Expect(2) = 3e-143, Method: Compositional matrix adjust.
 Identities = 178/324 (55%), Positives = 238/324 (73%), Gaps = 8/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM + FGL  +IVASSP AAE FLK HDL+FASRP  + A+ + Y + NL S  YGPYW
Sbjct  63    PIMSIHFGLVPVIVASSPHAAEQFLKIHDLIFASRPSNDVAETVFYNRRNLVSSNYGPYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTL LLSN KI SFQ MR++++  L++ +KQ   +R  +D+S+K++ L A++SC
Sbjct  123   RNMRKLCTLHLLSNAKIQSFQPMRKKQVQILVDLMKQ---ERNVIDVSAKIASLSANMSC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FGKKY  +DL E+GF  ++++ + + G  N  ++FPFL  LDLQG TRR K LAK +
Sbjct  180   LMIFGKKYMDEDLGEKGFNALIQDILCIAGLPNFAEFFPFLRVLDLQGFTRRSKELAKLF  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F ER++D+H        S + KD VDT++ IM+SGE EF F+R H+K  L DL  AS 
Sbjct  240   DEFLERVIDEHV---CDKFSHEHKDMVDTLMEIMQSGEGEFDFDRRHVKAILLDLLVASM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     I+WI++ELLRHP +MKK+Q EL+  +G +RMVEESDLE+L+YLEMV+KES RLH
Sbjct  297   DTSATTIDWILAELLRHPNVMKKLQNELEQVVGKNRMVEESDLENLEYLEMVIKESSRLH  356

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP LIP+E+ EDC ++GFHIPK
Sbjct  357   PVAPLLIPHESIEDCEVDGFHIPK  380


 Score =   179 bits (453),  Expect(2) = 3e-143, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 95/118 (81%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR++INVW I  DP++W  PE F PERF+GSNID RGRHFEL+PFGSGRR CPG
Sbjct  376  FHIPKGSRLLINVWTIGRDPDIWVEPENFKPERFQGSNIDLRGRHFELLPFGSGRRSCPG  435

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LQLG+T VRLV+AQL+HCFDW+ PN M  +++DMTE+FGL+ +R  HL +IP YRLHI
Sbjct  436  LQLGLTTVRLVLAQLVHCFDWKLPNGMTPKDIDMTEKFGLVTTRVQHLRLIPKYRLHI  493



>gb|KHN29102.1| Cytochrome P450 71A1 [Glycine soja]
Length=493

 Score =   365 bits (937),  Expect(2) = 3e-143, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 239/325 (74%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+MHLR G    IV SSP++AELFLKTHDLVFASRP   A +YIS+GQ NL    YG YW
Sbjct  59    PVMHLRLGFVPTIVVSSPKSAELFLKTHDLVFASRPRFVADQYISWGQRNLGFAEYGSYW  118

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLS  KINSF+ MR EEL  LI+ +++AA D  AVDLS KV+ LIAD+SC
Sbjct  119   RNMRKMCTLELLSQSKINSFRRMREEELDLLIKLVREAANDGAAVDLSVKVATLIADMSC  178

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ GKKY  +D+  RGF+ V++E M L    N+GDY P++  +DLQGLT+R K L + +
Sbjct  179   RMILGKKYMDQDMCGRGFKAVIQEAMRLLATPNVGDYIPYIGAIDLQGLTKRFKVLYEIF  238

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FFE+++D+H +S +    D+TKDFVD ML  + + E+E++  R +IK  L D+  G+ 
Sbjct  239   DDFFEKVIDEHMESEK--GEDKTKDFVDVMLGFLGTEESEYRIERSNIKAILLDMLAGSM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +    +IEW +SELL++P +MKK+Q EL++ +G+ R V ESDL+ LKYLEMVVKES+RLH
Sbjct  297   DTSATVIEWTLSELLKNPRVMKKLQMELETVVGMKRKVGESDLDKLKYLEMVVKESMRLH  356

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PV P LIP+++ EDC++  F IPKK
Sbjct  357   PVVPLLIPHQSTEDCIVGDFFIPKK  381


 Score =   173 bits (438),  Expect(2) = 3e-143, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+IIN WAI  DP+ W   EKF PERFEGSNID RGR FELIPFGSGRR CPG
Sbjct  376  FFIPKKSRVIINAWAIMRDPSAWVEAEKFWPERFEGSNIDVRGRDFELIPFGSGRRACPG  435

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LQLG+  VR  VAQL+HCFDW+ PN+M  ++LDMTE FGL + RANHL  IP YRL
Sbjct  436  LQLGLITVRQTVAQLVHCFDWKLPNNMFPDDLDMTEAFGLTMPRANHLHAIPTYRL  491



>ref|XP_003531374.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
Length=493

 Score =   364 bits (934),  Expect(2) = 6e-143, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 238/325 (73%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+MHLR G    IV SSP++AELFLKTHDLVFASRP   A +YIS+GQ NL    YG YW
Sbjct  59    PVMHLRLGFVPTIVVSSPKSAELFLKTHDLVFASRPRFVADQYISWGQRNLGFAEYGSYW  118

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLS  KINSF+ MR EEL  LI+ +++AA D  AVDLS KV+ LIAD+SC
Sbjct  119   RNMRKMCTLELLSQSKINSFRRMREEELDLLIKLVREAANDGAAVDLSVKVATLIADMSC  178

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ GKKY  +D+  RGF+ V++E M L    N+GDY P++  +DLQGLT+R K L + +
Sbjct  179   RMILGKKYMDQDMCGRGFKAVIQEAMRLLATPNVGDYIPYIGAIDLQGLTKRFKVLYEIF  238

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FFE+++D+H +S +    D+TKDFVD ML  + + E+E++  R +IK  L D+  G+ 
Sbjct  239   DDFFEKVIDEHMESEK--GEDKTKDFVDVMLGFLGTEESEYRIERSNIKAILLDMLAGSM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SELL++P +MKK+Q EL++ +G+ R V ESDL+ LKYLEMVVKES+RLH
Sbjct  297   DTSATAIEWTLSELLKNPRVMKKLQMELETVVGMKRKVGESDLDKLKYLEMVVKESMRLH  356

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PV P LIP+++ EDC++  F IPKK
Sbjct  357   PVVPLLIPHQSTEDCIVGDFFIPKK  381


 Score =   173 bits (438),  Expect(2) = 6e-143, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 89/116 (77%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+IIN WAI  DP+ W   EKF PERFEGSNID RGR FELIPFGSGRR CPG
Sbjct  376  FFIPKKSRVIINAWAIMRDPSAWVEAEKFWPERFEGSNIDVRGRDFELIPFGSGRRACPG  435

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LQLG+  VR  VAQL+HCFDW+ PN+M  ++LDMTE FGL + RANHL  IP YRL
Sbjct  436  LQLGLITVRQTVAQLVHCFDWKLPNNMFPDDLDMTEAFGLTMPRANHLHAIPTYRL  491



>ref|XP_007221131.1| hypothetical protein PRUPE_ppa019068mg [Prunus persica]
 gb|EMJ22330.1| hypothetical protein PRUPE_ppa019068mg [Prunus persica]
Length=494

 Score =   367 bits (941),  Expect(2) = 6e-143, Method: Compositional matrix adjust.
 Identities = 181/325 (56%), Positives = 240/325 (74%), Gaps = 7/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM++R GL + IV SSPQAAELFLKTHDLVFASRPP E A++IS+GQ +L    YG YWR
Sbjct  62    IMYMRLGLMHTIVVSSPQAAELFLKTHDLVFASRPPHEGAEHISFGQ-SLVFSEYGAYWR  120

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALD-RVAVDLSSKVSELIADISC  1253
             +MRK+CTLELLSN KINSF++MRR+ +   +ES++  A + RVAVDLS  VS L   ISC
Sbjct  121   DMRKMCTLELLSNHKINSFKSMRRDAIALCVESIRATADNGRVAVDLSDNVSSLSEVISC  180

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GK Y  ++ D RG R V+KE + L    NLGDY PF++  DLQG T++MK++ K  
Sbjct  181   RMVLGKMYRDEEFDARGIRSVIKEGIQLIVAANLGDYIPFIAPFDLQGFTKQMKSVNKAL  240

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D FFE+++D+H QS +    ++TKDFVD M++ M S ++E++  R HIK  + D L G+ 
Sbjct  241   DTFFEKVIDEHIQSNE---GERTKDFVDVMVAFMGSEQSEYRIERPHIKAIIFDMLVGSI  297

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             + +++ +EW +SEL+R+P+ MKKVQ+EL+  +GL RMVEESDL  L YL MVVKE++RLH
Sbjct  298   DTLSVTVEWALSELMRNPKAMKKVQKELEDVVGLGRMVEESDLGKLDYLSMVVKETMRLH  357

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PV P LIP+ A EDC + G+HIPKK
Sbjct  358   PVGPLLIPHAATEDCTVNGYHIPKK  382


 Score =   170 bits (431),  Expect(2) = 6e-143, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKS +IIN WAI  DP+ W + E+FIPERF+GS++D RG HF+LIPFGSGRR CPG+QL 
Sbjct  381  KKSHVIINAWAIGRDPSAWIDAEEFIPERFDGSDVDVRGNHFQLIPFGSGRRRCPGIQLA  440

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            + +V+L++AQL+HCFDWE PN M  EELDMTE FG+ V+RA  LI IP+YRLH
Sbjct  441  LIVVQLMLAQLVHCFDWELPNDMLPEELDMTEVFGITVARAKRLIAIPSYRLH  493



>emb|CDP01384.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   378 bits (971),  Expect(2) = 6e-143, Method: Compositional matrix adjust.
 Identities = 196/325 (60%), Positives = 250/325 (77%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M+LRFG    I+ SSP+AAE FLKT+D VFASRP  EA+ Y+SY Q NL+   YGPYW
Sbjct  64    PLMYLRFGYVPAIIVSSPEAAEKFLKTYDQVFASRPYHEASWYVSYEQRNLTFGQYGPYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLC L+LLS+ KINSF  MRREE+  L++SLKQAA D  AVDLS+ +S L A++SC
Sbjct  124   RNMRKLCILQLLSSHKINSFLPMRREEVGTLVKSLKQAASDGAAVDLSAAISSLGANMSC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FGKKY  KD D+RGFR V++E + +    NLGDYFP L  LDLQGLTRR K LAK +
Sbjct  184   LMIFGKKYMDKDFDDRGFRDVIQEGLHVAAMPNLGDYFPLLGLLDLQGLTRRFKDLAKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGASE  893
             DKFFE+I+D+H  S +     QTKDFVD M+ IM+SGEAEF+F+R H+K  L DL  AS 
Sbjct  244   DKFFEKIIDEHLHSQE---HKQTKDFVDIMMGIMQSGEAEFEFDRSHVKAILLDLLVASM  300

Query  892   AITIL-IEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
               ++  +EW +SELLRHPE M+K+Q+ L+ K+GL+R+VEESD+E L+YL+MV+KES+RLH
Sbjct  301   DTSVTAVEWAISELLRHPEAMRKLQKALEEKVGLERIVEESDIEGLEYLDMVIKESMRLH  360

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+E+ EDC ++ FHI KK
Sbjct  361   PVAPLLLPHESMEDCTVDDFHIQKK  385


 Score =   158 bits (400),  Expect(2) = 6e-143, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QKKSRIIIN++ I  DPNVW +P  F PERF+ SNID RG+ F LIPFGSGRR CPG
Sbjct  380  FHIQKKSRIIINIYTIGRDPNVWPDPATFNPERFKDSNIDLRGQDFRLIPFGSGRRSCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            LQLG+ LVR V+AQL+HCF+W+  +++   +LDM+E FGL+ SRA HL V+P  RL 
Sbjct  440  LQLGLLLVRFVLAQLVHCFNWDLADNIQPTDLDMSEAFGLVTSRAKHLKVVPTCRLQ  496



>ref|XP_010027782.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW54386.1| hypothetical protein EUGRSUZ_I00339 [Eucalyptus grandis]
Length=498

 Score =   378 bits (970),  Expect(2) = 7e-143, Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 239/327 (73%), Gaps = 6/327 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+MHLR G  + IV SSP+ AE FLKTHD+VFA RPP EA+K+ISY Q +L+   YGPYW
Sbjct  64    PLMHLRLGFVHTIVVSSPEVAEQFLKTHDIVFAGRPPHEASKHISYEQRSLAFSSYGPYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF++MRREE+  L+  LK AA D  A+DLS+K+S L AD+SC
Sbjct  124   RNIRKMCTLELLSNAKINSFKSMRREEVGLLVNFLKDAAHDHTAIDLSAKISSLSADMSC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+FGKKY  K+ DE  F  V++E + L    N+GDY P+L+  DLQGLT+RMKA++K +
Sbjct  184   RMIFGKKYMDKEFDE--FMAVMQEGVVLGATPNIGDYVPYLARFDLQGLTKRMKAVSKVF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FFE+I+D+H ++ +     ++KDFVD ML IM   E E+  +R HIK  + D+  AS 
Sbjct  242   DAFFEKIIDEHMKAKK--EEGESKDFVDVMLGIMGLNEGEYHIDRSHIKAIILDMLSASM  299

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     I+W ++EL RHP +MKK+Q+EL+  +G++R VEESDLE L YL MV+KE +RLH
Sbjct  300   DTSATTIDWAITELTRHPSVMKKLQDELEKAVGMNRAVEESDLEGLHYLNMVIKEIMRLH  359

Query  715   PVAP-LIPNEAREDCMIEGFHIPKKIT  638
             P +P L+P EA EDC + GFHIP K T
Sbjct  360   PASPFLLPREATEDCTVNGFHIPSKST  386


 Score =   159 bits (401),  Expect(2) = 7e-143, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 89/118 (75%), Gaps = 2/118 (2%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT--NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRIC  487
            F    KS +I+NVW+I  DP VWT  NPE+FIPERF G ++D  G  F+L+PFG+GRR C
Sbjct  379  FHIPSKSTVIVNVWSIGRDPKVWTTHNPEEFIPERFLGLSVDVMGHDFQLLPFGAGRRGC  438

Query  486  PGLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            PG+QLG+T+VR V+AQL+HCFDW+ P  +   ELDMTE+FGL   RANHL+V P YRL
Sbjct  439  PGIQLGLTVVRFVLAQLVHCFDWDLPGGISPSELDMTEEFGLTAPRANHLVVTPRYRL  496



>ref|XP_011090604.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=497

 Score =   357 bits (917),  Expect(2) = 8e-143, Method: Compositional matrix adjust.
 Identities = 173/324 (53%), Positives = 231/324 (71%), Gaps = 2/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++RFG    I+ SSP AAELFLK HDL FA++P  EA+ Y+SY Q N+    YGPYW
Sbjct  63    PIMYMRFGTVPTIIVSSPAAAELFLKKHDLTFANKPHHEASNYLSYEQRNIVFGRYGPYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKL TLELLSNLKI+ FQ MR+ E+  L+ SLK AA     VD+S +++ + AD++C
Sbjct  123   RNMRKLATLELLSNLKISQFQPMRKAEIDILVGSLKSAAEIGETVDMSVRIASVSADMTC  182

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFG+KY  KDL++ G + V+KE ++     NLGDYFP+L  LDLQG  RR+K L+K +
Sbjct  183   LMVFGRKYADKDLNDEGLKEVMKETVEEAAAFNLGDYFPYLRGLDLQGSARRLKKLSKIF  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D+F ERI+DDH Q+ +      ++DFVDTM+ IM+SGEA F F+R H+K  L D L    
Sbjct  243   DRFLERIIDDHVQNKKE-KQQSSQDFVDTMMGIMESGEAGFDFDRRHVKAVLLDMLLAGI  301

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  T  +EW +SE++RHP + KK+Q+EL+  +GLD+ V ES L  LKYL+ VV+ES+RLH
Sbjct  302   DTSTAAVEWALSEVIRHPVVTKKLQKELEEVVGLDQTVNESHLSSLKYLDYVVRESMRLH  361

Query  715   PVAPLIPNEAREDCMIEGFHIPKK  644
             PV+PL+  E  EDC ++GFHI KK
Sbjct  362   PVSPLLIREGMEDCEVDGFHIQKK  385


 Score =   179 bits (454),  Expect(2) = 8e-143, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QKKS++++NVWAI  DP+ WT+PE F PERF GSN+D RGR  +LIPFG+GRR CPG
Sbjct  380  FHIQKKSQVLVNVWAIGRDPDAWTDPETFFPERFLGSNVDVRGRDSQLIPFGTGRRGCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            LQLG+T+V+L+VAQL+HCFDWE P  M  +ELDM+E FGL+ +RA HL+ IP YRLH
Sbjct  440  LQLGLTIVQLMVAQLVHCFDWELPEGMQPDELDMSENFGLITARAKHLVAIPKYRLH  496



>ref|XP_004237154.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=499

 Score =   358 bits (919),  Expect(2) = 1e-142, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 239/324 (74%), Gaps = 4/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++FG+  +IVASSP AAE FLK HDL+FASRP   A + ++Y Q NL+   YGPYW
Sbjct  65    PIMSMKFGVIPIIVASSPHAAEQFLKKHDLIFASRPNNRAMRIVAYNQRNLTFAKYGPYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RKLC LELLS +KI SFQ MR++++   +  + +AA     VD+S+ +S L A++SC
Sbjct  125   RNIRKLCMLELLSPIKIKSFQDMRKQQVTNFVTFINRAASCHDEVDISANLSLLSANMSC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FGKKY   + +ERGF+ V++E + +    N+GD+FPFL   D QGL  R K LAK +
Sbjct  185   LMIFGKKYMDDEFNERGFKDVIQEALIIAATPNIGDFFPFLDKFDFQGLIPRTKKLAKVF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F ER++D+H Q+  S    QTKD VDTM++IM+SGEAEF+F+R HIK  L DL  AS 
Sbjct  245   DEFLERVIDEHVQN--SKEEKQTKDIVDTMMNIMQSGEAEFEFDRRHIKAILLDLLIASI  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     I+WI SEL+RHP++MKK+Q+EL+  +G++R+VEESDLE LKYL+M++KE  RLH
Sbjct  303   DTSATSIDWIFSELVRHPKVMKKLQKELEQVVGMNRIVEESDLEKLKYLDMIIKEGFRLH  362

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             P+AP LIP+E+ +DC+I+GF+I +
Sbjct  363   PIAPLLIPHESIKDCIIDGFNITR  386


 Score =   178 bits (451),  Expect(2) = 1e-142, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   + SRI++N WAI  DP VW  PEKF+PERF GS+ID RGR F+L+PF SGRR CPG
Sbjct  382  FNITRGSRILVNTWAIGRDPEVWPEPEKFMPERFVGSDIDLRGRDFQLLPFSSGRRSCPG  441

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LQLG+ +VRLV+AQL+HCFDW+ PN M   +LDMTE+FGL+VSRA HL+ IP YRLH+
Sbjct  442  LQLGLIVVRLVIAQLVHCFDWKLPNDMMPNDLDMTEKFGLVVSRAQHLVAIPTYRLHV  499



>ref|XP_006428066.1| hypothetical protein CICLE_v10025445mg [Citrus clementina]
 gb|ESR41306.1| hypothetical protein CICLE_v10025445mg [Citrus clementina]
Length=498

 Score =   373 bits (957),  Expect(2) = 1e-142, Method: Compositional matrix adjust.
 Identities = 182/325 (56%), Positives = 237/325 (73%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSPQAAE FLKTHDL+FASRPP +A KY+SY Q N +  PYG YW
Sbjct  65    PIMHLRLGLMTTIVVSSPQAAEQFLKTHDLIFASRPPLQATKYMSYQQKNFAMAPYGSYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R +RK+CT  LLSN KIN FQ  R+E+L  LIE  K+AA  R  VD+S+K+S L  +++C
Sbjct  125   RKIRKICTQNLLSNAKINYFQPTRKEDLDLLIEYFKEAAHARCVVDISAKLSALSTNMTC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKK    + D  GF  V++E  +L GK NLGDY P ++ LDLQGLT+R KA+AK +
Sbjct  185   RMVLGKKRSDNEFDSGGFETVIREGFELVGKPNLGDYIPQIAGLDLQGLTKRSKAVAKVF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D F E+I+D+H    QS   ++T+DFVD MLS   S + E + +REHIK  + D+  GA 
Sbjct  245   DAFMEKIIDEHI---QSKDENRTEDFVDVMLSFEGSEDTEKKIDREHIKAVVMDMLAGAI  301

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +    ++EW +SEL++HP +MKK+Q EL++ +GL RMVEESDLE+L+YL+MVV+E+LRLH
Sbjct  302   DTSPTVVEWALSELIKHPTVMKKLQRELENIVGLKRMVEESDLENLEYLDMVVRETLRLH  361

Query  715   PVAPLI-PNEAREDCMIEGFHIPKK  644
             PV PL+ P+E+ EDC + GFHIPKK
Sbjct  362   PVTPLMAPHESMEDCTVNGFHIPKK  386


 Score =   163 bits (412),  Expect(2) = 1e-142, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+I+N WAI  DP  WT+PE F PERF GS++D  G  F+L+PFGSGRR CPG
Sbjct  381  FHIPKKSRVIVNAWAIGRDPEAWTDPETFFPERFVGSSVDVLGHDFQLLPFGSGRRGCPG  440

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QL +T+V+ V AQL+HCFDWE P  M   ELDMTE+FGL+  RA HL+ +P+YRL
Sbjct  441  IQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTPRAKHLLAVPSYRL  496



>ref|XP_008364814.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=498

 Score =   362 bits (928),  Expect(2) = 2e-142, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 244/324 (75%), Gaps = 5/324 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM+LR GL + +V SS +AAELFLKTHDL FASRPP E AK++ +GQ +LS   YG YW 
Sbjct  66    IMYLRLGLQHTVVVSSTRAAELFLKTHDLNFASRPPNEGAKHLIFGQRSLSFAEYGSYWT  125

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             NMRK+C LELLSN KINSF++MRREE+  LI+S++  A  R   +++ KVS L  +++CR
Sbjct  126   NMRKICMLELLSNQKINSFKSMRREEVALLIKSVQDDANSRRIANVTDKVSSLGINMTCR  185

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MVFGKKY+ ++   RGF  V+KE M L    NLGD+ P ++ LDLQGLT++MKA+ K +D
Sbjct  186   MVFGKKYKDEEFGGRGFASVMKEGMKLAAAPNLGDFIPCIAPLDLQGLTKKMKAVNKAFD  245

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-E  893
             +FFE+++D+H    Q    ++TKDF+D ML+ M S  ++++  R +IK  +SD+F AS +
Sbjct  246   EFFEKVIDEHL---QYKDKERTKDFIDAMLAHMGSEGSDYRIERLNIKAMMSDMFAASAD  302

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
               +  ++W +SELLRHP++MKKVQ+EL++ +GL RMVEESD+E L+YL+MVVKE++RLHP
Sbjct  303   TSSTTVQWALSELLRHPQVMKKVQKELENVVGLKRMVEESDMEKLEYLDMVVKETMRLHP  362

Query  712   VAP-LIPNEAREDCMIEGFHIPKK  644
             V P L+P+ A EDC ++G+HIPKK
Sbjct  363   VVPLLLPHAAIEDCTVDGYHIPKK  386


 Score =   174 bits (440),  Expect(2) = 2e-142, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+I+N WAI  DP+ W + EKF+PERFEG+N+D RG HF+L+PFGSGRR C G+QLG
Sbjct  385  KKSRVIVNAWAIGRDPSAWEDAEKFVPERFEGNNVDVRGHHFQLVPFGSGRRRCVGMQLG  444

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            IT+V  V+AQL+HCFDWE P++M   ELDMTE+FGL+VSRA +L+ IP+YRL 
Sbjct  445  ITVVHFVLAQLVHCFDWELPDNMLPNELDMTEEFGLVVSRAKNLLAIPSYRLQ  497



>gb|AJD25258.1| cytochrome P450 CYP736A123 [Salvia miltiorrhiza]
Length=488

 Score =   360 bits (923),  Expect(2) = 3e-142, Method: Compositional matrix adjust.
 Identities = 181/326 (56%), Positives = 232/326 (71%), Gaps = 11/326 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    +V SSP AAEL LKTHDLVFASRP  +A+  +SY Q NL+  PYGPYW
Sbjct  59    PIMGLRLGFVRAVVVSSPAAAELVLKTHDLVFASRPRSDASCRMSYDQRNLAFAPYGPYW  118

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTL+LLS  K+  F+ MR+ EL  L+ SLKQ+   R  VDL +++S +  D++C
Sbjct  119   RNMRKLCTLQLLSASKMKQFEPMRKAELGLLVASLKQS---RDTVDLRARISAVNGDMNC  175

Query  1252  RMVFGKKYEMKDLDER-GFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
              M+ G+KY  +DLDE+ GF+ +  E +D+  + NL DYFP++  LDL GL RRMK L+  
Sbjct  176   LMILGRKYSDRDLDEQDGFKALFSEALDITAQFNLADYFPYIGGLDLHGLNRRMKRLSNV  235

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS  896
             +D F E+I++DH    Q     Q+ DFVDTM++IM SGEA F+F+R HIK  L DL  A 
Sbjct  236   FDGFLEKIMEDHLHKKQ-----QSHDFVDTMMAIMDSGEAGFEFDRTHIKAVLLDLLIAG  290

Query  895   -EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
              +      EW MSELLRHP +MKK+QEEL+S +GL+ MVEES L+ L+YLE VVKE +RL
Sbjct  291   MDTSATATEWTMSELLRHPTVMKKLQEELESMVGLESMVEESHLDKLEYLECVVKEVMRL  350

Query  718   HPVAP-LIPNEAREDCMIEGFHIPKK  644
             HPVAP LIP+E+ EDC ++GFHIPKK
Sbjct  351   HPVAPLLIPHESMEDCELQGFHIPKK  376


 Score =   175 bits (443),  Expect(2) = 3e-142, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 94/121 (78%), Gaps = 0/121 (0%)
 Frame = -3

Query  669  LRVFTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRI  490
            L+ F   KKSR+++NVWAI  DP+VW NP+ F PERF GS+ID RGRHFELIPF SGRR 
Sbjct  368  LQGFHIPKKSRVMVNVWAIGRDPDVWANPDSFTPERFVGSDIDMRGRHFELIPFSSGRRG  427

Query  489  CPGLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            CPG+QLG  LV+L+VAQL+HCF WE PN M   ++DM+E FGL+ +RA  L+ +P YRLH
Sbjct  428  CPGMQLGSALVKLLVAQLVHCFHWELPNGMKPHDIDMSEHFGLVTARAKRLMAVPTYRLH  487

Query  309  I  307
            I
Sbjct  488  I  488



>ref|XP_003596030.1| Cytochrome P450 [Medicago truncatula]
 gb|AES66281.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=473

 Score =   367 bits (941),  Expect(2) = 4e-142, Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 244/325 (75%), Gaps = 3/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSPQAAELFLKTHD+VFASRPP EAA+ + Y Q ++S   YG YW
Sbjct  40    PIMHLRLGLVPTIVVSSPQAAELFLKTHDIVFASRPPIEAAQLMFYNQKDVSFSVYGSYW  99

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLS+ KINSF++MR +EL  LI+ +++AA D   VD+S+KV+ L AD++C
Sbjct  100   RNMRKMCTLELLSHTKINSFRSMREQELDLLIKFIREAANDGTTVDISAKVAALTADMTC  159

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              +VFGKKY  KDL+E+GF+  ++E M L    N+ D+ P++  LDL GLTRRMKA+ K +
Sbjct  160   IIVFGKKYSDKDLNEKGFKASMQELMSLAATPNIADFIPYIGALDLNGLTRRMKAIGKIF  219

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D+F E+I+D+H QS ++   ++TKDFVD ML  + + E++++  R +IK  + D L G++
Sbjct  220   DEFLEKIIDEHIQS-ENKDDNKTKDFVDVMLGFVGTEESDYRIERSNIKGIMMDMLIGST  278

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SELL++P +MKKVQ+EL++ +G+ R VEESDL+ L+YL MV+KESLR+H
Sbjct  279   DTSATSIEWTISELLKNPRVMKKVQKELETVVGMKRKVEESDLDKLEYLNMVIKESLRIH  338

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PV P L+P+++ EDC +E F IPK 
Sbjct  339   PVVPLLVPHQSMEDCTVEDFFIPKN  363


 Score =   167 bits (424),  Expect(2) = 4e-142, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SRII+N WAI  DPN WT+PEKF PERFEG+NID  G  F+LIPFGSGRR CPG
Sbjct  358  FFIPKNSRIIVNGWAIMRDPNSWTDPEKFWPERFEGNNIDVGGHDFQLIPFGSGRRGCPG  417

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            L LG+T+VRLVVAQ++HCFD + PN M   +LDMTE FG+ + RANHLI +P YRL
Sbjct  418  LHLGLTMVRLVVAQIVHCFDLKLPNDMLPSDLDMTEAFGITMPRANHLIALPVYRL  473



>ref|XP_006493867.1| PREDICTED: cytochrome P450 71A1-like isoform X1 [Citrus sinensis]
 ref|XP_006493868.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Citrus sinensis]
Length=498

 Score =   371 bits (952),  Expect(2) = 5e-142, Method: Compositional matrix adjust.
 Identities = 182/325 (56%), Positives = 236/325 (73%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSPQAAE FLKTHDL+FASRPP +A KY+SY Q N +  PYG YW
Sbjct  65    PIMHLRLGLMTTIVVSSPQAAEQFLKTHDLIFASRPPLQATKYMSYQQKNFAMAPYGSYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R +RK+CT  LLSN KIN FQ  R+E+L  LIE  K+AA  R  VD+S+K+S L  +++C
Sbjct  125   RKIRKICTQNLLSNAKINYFQPTRKEDLDLLIEYFKEAAHARCVVDISAKLSALSTNMTC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKK    + D  GF  V++E  +L GK NLGDY P ++ LDLQGLT+R KA+AK +
Sbjct  185   RMVLGKKRSDNEFDSGGFETVIREGFELVGKPNLGDYIPQIAGLDLQGLTKRSKAVAKVF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D F E+I+D+H    QS   ++T+DFVD MLS   S + E + +REHIK  + D+  GA 
Sbjct  245   DAFMEKIIDEHI---QSKDENRTEDFVDVMLSFEGSEDTEKKIDREHIKAVVMDMLAGAI  301

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +    ++EW +SEL++HP +MKK+Q EL++ +GL RMVEESDLE L+YL+MVV+E+LRLH
Sbjct  302   DTSPTVVEWALSELIKHPAVMKKLQRELENIVGLKRMVEESDLEILEYLDMVVRETLRLH  361

Query  715   PVAPLI-PNEAREDCMIEGFHIPKK  644
             PV PL+ P+E+ EDC + GFHIPKK
Sbjct  362   PVTPLMAPHESMEDCTVNGFHIPKK  386


 Score =   163 bits (412),  Expect(2) = 5e-142, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+I+N WAI  DP  WT+PE F PERF GS++D  G  F+L+PFGSGRR CPG
Sbjct  381  FHIPKKSRVIVNAWAIGRDPEAWTDPETFFPERFVGSSVDVLGHDFQLLPFGSGRRGCPG  440

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QL +T+V+ V AQL+HCFDWE P  M   ELDMTE+FGL+  RA HL+ +P+YRL
Sbjct  441  IQLALTVVKQVTAQLVHCFDWELPEGMLPTELDMTEEFGLVTPRAKHLLAVPSYRL  496



>gb|EYU24037.1| hypothetical protein MIMGU_mgv1a005167mg [Erythranthe guttata]
Length=494

 Score =   389 bits (999),  Expect(2) = 1e-141, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 246/325 (76%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    +V SSP AAEL LKTHDLVFASRP   AA+Y+SY Q N+   PYGPYW
Sbjct  60    PIMGLRLGFVPAVVVSSPAAAELVLKTHDLVFASRPKSAAAEYMSYQQKNIVFGPYGPYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRKLCTLELLS+L+I+ FQA+R  ELC L++SLKQAA     VDLS++VS +  D++C
Sbjct  120   RDMRKLCTLELLSSLRISQFQALRAAELCLLVDSLKQAAELGEIVDLSARVSGVNGDMNC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FG+KY  KD D++GF+ V  E M++  K NL DYFP++  LDLQG+ RRMK L+  +
Sbjct  180   LMIFGRKYADKDFDDKGFKDVFMEAMEISAKFNLADYFPYIGVLDLQGMNRRMKELSNIF  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D F E+I+D+H Q  +    ++TKDFVDTM++IM SGEA F+F+R H+K  L DL  A  
Sbjct  240   DGFLEQIIDEHLQ--EKPEKEETKDFVDTMMAIMDSGEAGFEFDRRHVKAVLLDLLIAGM  297

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  +EW +SEL+RHP +MKK+Q EL+S +G+DR VEES L++L+YL++VVKE+LRLH
Sbjct  298   DTSSTAVEWAISELIRHPRVMKKLQNELESTVGIDRTVEESHLDNLEYLDLVVKETLRLH  357

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP LIP+E+ EDC I+G+HIPKK
Sbjct  358   PVAPLLIPHESMEDCTIDGYHIPKK  382


 Score =   144 bits (362),  Expect(2) = 1e-141, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR I+NVWAI  DP+VW +PE F PERF GS+ID RGR F+L+PFGSGRR CP LQLG
Sbjct  381  KKSRAIVNVWAIGRDPSVWAHPETFSPERFSGSDIDLRGRDFQLLPFGSGRRSCPALQLG  440

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            + LV+LV+AQL+HCFDWE PN M   +LDM+E FG++ SRA H++ IP YRL
Sbjct  441  LVLVKLVLAQLVHCFDWELPNGMLPSDLDMSEHFGIVTSRAEHIMAIPKYRL  492



>ref|XP_004162313.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=509

 Score =   369 bits (946),  Expect(2) = 1e-141, Method: Compositional matrix adjust.
 Identities = 179/325 (55%), Positives = 237/325 (73%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ GL   I+ SSP AA+LFLKTHDL FASRP  +A+K+ISY Q NL   PYGPYW
Sbjct  67    PIMSMKLGLVPTIIVSSPHAAQLFLKTHDLFFASRPSSQASKHISYQQKNLVFAPYGPYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLSNLKINSF  MR+ EL  LIE LK+AA ++  V+LS+KV+ L  DI C
Sbjct  127   RNMRKMCTLELLSNLKINSFMPMRKHELGLLIEYLKEAAHNKAVVNLSAKVTSLTTDIIC  186

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M FGKKY  +++DERGF+ V++E M L    NLGD+ P ++ LDLQG TR+MK + K Y
Sbjct  187   LMAFGKKYGDEEIDERGFKAVIQEGMQLSAAPNLGDFIPAIAWLDLQGFTRKMKRVHKVY  246

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F E+I+++H     +    +T+DFVD ML ++ S + E+Q +R  IK  + D+  A+ 
Sbjct  247   DEFLEKIINEHL---VARGGKKTRDFVDVMLDLIDSQQTEYQIDRSAIKAIMLDMLAAAM  303

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  I W MSEL+RHP++MKK+Q+EL+  +GL RMV+ESDL  L+YLEMVVKE +RL+
Sbjct  304   DTSSTTIGWAMSELIRHPDVMKKMQDELQEVVGLHRMVQESDLVSLEYLEMVVKEIMRLY  363

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             P  P LIP E+ EDC ++GFHIPKK
Sbjct  364   PAGPLLIPRESVEDCTVDGFHIPKK  388


 Score =   164 bits (415),  Expect(2) = 1e-141, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 89/117 (76%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+I+NVW I  DP+VW +P KF PERF GS ID +G  FELIPFG GRR CPG
Sbjct  383  FHIPKKSRVIVNVWTIGRDPSVWNDPHKFFPERFIGSKIDLKGNDFELIPFGGGRRGCPG  442

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRL++AQL+HCFDW+ PN M   ELDM E+FGL   RA  L+VIP +RL+
Sbjct  443  IQLGLTMVRLLLAQLVHCFDWKLPNGMLPSELDMIEEFGLTCPRAKDLMVIPTFRLN  499



>ref|XP_006354704.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=497

 Score =   369 bits (947),  Expect(2) = 1e-141, Method: Compositional matrix adjust.
 Identities = 183/324 (56%), Positives = 243/324 (75%), Gaps = 5/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PI++++FGL    V SSP++AE  LKT+D +FASRP  E A+YISYGQ NL    YG YW
Sbjct  63    PIIYMKFGLVPTYVISSPESAEKILKTYDHIFASRPHNETAQYISYGQRNLIFSKYGAYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALD-RVAVDLSSKVSELIADIS  1256
             RNMRKLCT+ LLSN+KINSFQ+ R EE+  +I+S+K+ A   RV VDLS++VS+L A++S
Sbjct  123   RNMRKLCTVHLLSNMKINSFQSTRSEEIAIMIKSIKEIAQGRRVDVDLSAQVSKLSANLS  182

Query  1255  CRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             C MVFGKK+   DLD+RGF+ +++E   L    NLGD+FPFL  +DLQGLTRRMK  +K 
Sbjct  183   CLMVFGKKFTDDDLDKRGFKYLVQEVTTLAATPNLGDFFPFLGVIDLQGLTRRMKDTSKV  242

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS  896
              D F E+I+D+H     +    + KDFVDTM+ IM+SGEAEFQF+R H+K  + D+  AS
Sbjct  243   LDPFVEKIIDEHV---NAKDHKKNKDFVDTMMEIMQSGEAEFQFDRRHVKAVMLDMLVAS  299

Query  895   -EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
              +  +  IEW++SELLR+P+IMKK+Q+EL+  +GL+RMV+ESDLE+LKYL MV KES RL
Sbjct  300   IDTSSSSIEWMLSELLRNPDIMKKLQKELEEVVGLNRMVQESDLENLKYLNMVFKESFRL  359

Query  718   HPVAPLIPNEAREDCMIEGFHIPK  647
             H  APL+ +EA EDCM++ F+I K
Sbjct  360   HAAAPLLLHEAMEDCMVDDFYIKK  383


 Score =   163 bits (413),  Expect(2) = 1e-141, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  +K S++I+N + I  DPN WT+ +KF+PERF  SN+D RGR ++L+PFGSGRR  PG
Sbjct  379  FYIKKGSQVIVNAYTIHRDPNFWTDADKFLPERFLESNVDVRGRDYQLLPFGSGRRSFPG  438

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QL + +VRLVVAQL+HCFDWE PN M  ++LDMTEQFG++  RANHL+ +P YRL 
Sbjct  439  MQLALIIVRLVVAQLVHCFDWELPNEMQPKDLDMTEQFGIVTGRANHLMAVPTYRLQ  495



>ref|XP_009631554.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=503

 Score =   372 bits (954),  Expect(2) = 2e-141, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 243/323 (75%), Gaps = 4/323 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM+L+ GL    V SSP++AE  LKT+D VFASRP  E A+YISYGQ NL    YG YW
Sbjct  71    PIMYLKLGLVPTYVISSPESAEKILKTYDHVFASRPHNETAQYISYGQRNLIFSKYGAYW  130

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCT+ LLSN KINS+++ R EE+  +I+S+K +A D V VDLS+KVS L A++SC
Sbjct  131   RNMRKLCTVHLLSNHKINSYRSTRSEEVALMIKSIKPSAQDGVVVDLSAKVSSLSANLSC  190

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKK+  +DLD+RGF+ +++E   L    NLGD+FPF   +D+QGLTRRMK ++K +
Sbjct  191   LMVFGKKFMDEDLDKRGFKSLVQEVTHLAATPNLGDFFPFFGVIDIQGLTRRMKDISKVF  250

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F E+I+D+H    Q+    +TKDFVDTM+SIM+SGEAEFQF+R H+K  L D+  AS 
Sbjct  251   DEFVEKIIDEHV---QTTDQKKTKDFVDTMMSIMQSGEAEFQFDRRHVKAVLLDMLVASI  307

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  +EW++SELL++P +M+K+Q+EL+  + LDRMVEESDL+ LKYL MV KES RLH
Sbjct  308   DTSSTSVEWMLSELLKNPNVMEKLQKELEEVVVLDRMVEESDLDKLKYLNMVFKESFRLH  367

Query  715   PVAPLIPNEAREDCMIEGFHIPK  647
               APL+ +EA EDCM++ F+I K
Sbjct  368   AAAPLLLHEAMEDCMVDDFYIQK  390


 Score =   160 bits (405),  Expect(2) = 2e-141, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK S++I+N ++I  DPNVW   +KF+PERF  SN+D RGR F+L+PFGSGRR CPG
Sbjct  386  FYIQKGSQVIVNSYSIHMDPNVWPEADKFLPERFLESNVDVRGRDFQLLPFGSGRRSCPG  445

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            + L + +VRLVVAQL+HCFDW+ PN +  ++LDMTE+FG++  RA +L+ IP YRLH
Sbjct  446  MHLALIIVRLVVAQLVHCFDWKLPNGIQPKDLDMTEKFGIVTGRAKNLMAIPTYRLH  502



>ref|XP_003532846.1| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=500

 Score =   368 bits (944),  Expect(2) = 2e-141, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 241/324 (74%), Gaps = 3/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M+LR G    I+ SSPQAAELFLKTHDLVFA RPP EAAKY+++ Q NL+   YG YW
Sbjct  61    PVMYLRLGFVPAIIVSSPQAAELFLKTHDLVFAGRPPHEAAKYMAWEQKNLAFGEYGSYW  120

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLS  KINSF+ MR EEL  LI++L+ A+ D   VDLS+KV+ L AD+SC
Sbjct  121   RNVRKMCTLELLSQTKINSFRPMREEELDLLIKNLRGASNDGAVVDLSAKVATLSADMSC  180

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ GKKY  +DLD++GF+ V++E + L    N+GDY P++  LDLQGL RRMK L + +
Sbjct  181   RMILGKKYMDQDLDQKGFKAVMQEVLHLAAAPNIGDYIPYIGKLDLQGLIRRMKTLRRIF  240

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D+FF++I+D+H QS + G  ++ KDFVD ML  + + E+E++  R +IK  L D L G+ 
Sbjct  241   DEFFDKIIDEHIQSDK-GEVNKGKDFVDAMLDFVGTEESEYRIERPNIKAILLDMLVGSI  299

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SELL++P +MKK+Q EL++ +G+ R V ESDL+ LKYLEMVVKE LRLH
Sbjct  300   DTSATAIEWTISELLKNPRVMKKLQRELETVVGMKRKVGESDLDKLKYLEMVVKEGLRLH  359

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP L+P+ +REDCM+  + IPK
Sbjct  360   PVAPLLLPHHSREDCMVGEYFIPK  383


 Score =   164 bits (415),  Expect(2) = 2e-141, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            K SR+I+N W I  DP+ W   EKF PERFEGSNID RG+ F  +PFGSGRR+CPGLQLG
Sbjct  383  KNSRVIVNAWTIMRDPSAWDEAEKFWPERFEGSNIDVRGKDFRFLPFGSGRRVCPGLQLG  442

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPN-YRLH  310
            +  V L VAQL+HCFDW+ PN+M   ELDMTE+FGL + RANHL+VIP  YRLH
Sbjct  443  LNTVLLTVAQLVHCFDWKLPNNMLPCELDMTEEFGLSMPRANHLLVIPTYYRLH  496



>ref|XP_009770688.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana sylvestris]
Length=495

 Score =   367 bits (941),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 245/325 (75%), Gaps = 8/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM+L+ GL    V SSP++AE  L+T D VFASRP  E A+YISYGQ NL    YG YW
Sbjct  63    PIMYLKLGLVPTYVISSPESAENILRTFDHVFASRPHNETAQYISYGQRNLIFSKYGAYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCT+ LLSN KINS+++ R EE+  +I+S+K +A D V VDLS+KVS L A++SC
Sbjct  123   RNMRKLCTVHLLSNHKINSYRSTRSEEVALMIKSIKPSAEDGVVVDLSAKVSSLSANLSC  182

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FGKK+  +DL +RGF+ +++E   L    NLGD+FPF   +D+QGLTRRMK ++K +
Sbjct  183   LMIFGKKFMDEDLGKRGFKSLVQEVTHLAATPNLGDFFPFFGIIDIQGLTRRMKDISKVF  242

Query  1072  DKFFERILDDHEQSGQSGSSDQ--TKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGA  899
             D+F E+I+D+H Q     ++DQ  TKDFVDTM+SIM+SGEAEFQF+R H+K  L D+  A
Sbjct  243   DEFVEKIIDEHVQ-----TTDQKKTKDFVDTMMSIMQSGEAEFQFDRRHVKAILLDMLVA  297

Query  898   S-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLR  722
             S +  +  +EW++SELL++P +M+K+Q+EL+  +GL+RMVEESDL++LKYL MV KES R
Sbjct  298   SIDTSSTSVEWMLSELLKNPNVMEKLQKELEEVVGLNRMVEESDLDNLKYLNMVFKESFR  357

Query  721   LHPVAPLIPNEAREDCMIEGFHIPK  647
             LH  APL+ +EA EDC+++ F+I K
Sbjct  358   LHAAAPLLLHEAMEDCIVDDFYIQK  382


 Score =   164 bits (416),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK S++I+N ++I  DPNVW   +KF+PERF  SN+D RGR F+L+PFGSGRR CPG
Sbjct  378  FYIQKGSQVIVNSYSIHMDPNVWPEADKFLPERFLESNVDVRGRDFQLLPFGSGRRSCPG  437

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            + L + +VRLVVAQL+HCFDW+ PN M  ++LDMTE+FG++  RA HL+ IP YRLH
Sbjct  438  MHLALIIVRLVVAQLVHCFDWKLPNGMQPKDLDMTEKFGIVTGRAKHLMAIPTYRLH  494



>ref|XP_004237435.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=500

 Score =   359 bits (922),  Expect(2) = 9e-141, Method: Compositional matrix adjust.
 Identities = 174/328 (53%), Positives = 241/328 (73%), Gaps = 9/328 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P MH++ GL   IV SSP   E  LKT+D VFASRP  EA++++ YGQ NL    YGPYW
Sbjct  63    PFMHIQLGLVPTIVVSSPNTIEKVLKTYDHVFASRPHHEASQHVCYGQRNLIFSKYGPYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDR-----VAVDLSSKVSELI  1268
             RNMRKL T+ L+S+ KINS+Q  R+EE+  +++S+K  A        VAVDLS+KVS L 
Sbjct  123   RNMRKLTTMNLVSSQKINSYQPSRKEEVSLMVKSIKHVADHNDQQHVVAVDLSAKVSSLN  182

Query  1267  ADISCRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKA  1088
             A++SC MVFGKK+   DLD+RGF+ +++E + L    NLGD+FP+L  LDLQG+T R+K 
Sbjct  183   ANLSCLMVFGKKFMDDDLDKRGFKSLVQEVVHLAATPNLGDFFPYLGVLDLQGITSRLKT  242

Query  1087  LAKTYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDL  908
             L+K +D+F E+I+D+H +S +     +TKDFVDTM+ IM+SGEA F+F+R H+K  L D+
Sbjct  243   LSKVFDEFLEKIIDEHVESKE---QRETKDFVDTMMDIMQSGEAGFEFDRRHVKAVLLDM  299

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               AS +     +EWI++ELLRHP +MKK+Q+EL+  +GLDRMV+ESDLE+L YL+MV+KE
Sbjct  300   LMASMDTSATSVEWILTELLRHPHVMKKLQKELEQVVGLDRMVDESDLENLNYLDMVIKE  359

Query  730   SLRLHPVAPLIPNEAREDCMIEGFHIPK  647
             +LRLH  APL+ +E+ EDC+++GF + K
Sbjct  360   ALRLHSAAPLLIHESIEDCVVDGFFVQK  387


 Score =   171 bits (432),  Expect(2) = 9e-141, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK SRI++NV+A   DPN W  P+KF+PERF  S++D RG  F+L+PFGSGRR CPG
Sbjct  383  FFVQKGSRIVVNVYAAQRDPNAWPEPDKFLPERFVESSVDLRGHDFQLLPFGSGRRSCPG  442

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            +QLGI +VRLVVAQL+HCFDWE PN M   ELDM+EQFG++  RA HL+ IP YRL +
Sbjct  443  MQLGIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGVVTCRAKHLMAIPTYRLQL  500



>gb|EYU24035.1| hypothetical protein MIMGU_mgv1a020942mg [Erythranthe guttata]
Length=499

 Score =   355 bits (911),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 180/326 (55%), Positives = 226/326 (69%), Gaps = 5/326 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM  R G    +V SSP AAEL LKTHD VFASRP   A   +SY Q NL    +GPYW
Sbjct  64    PIMGFRLGFVPAVVVSSPAAAELILKTHDAVFASRPKIIAVDSVSYEQRNLVFAAHGPYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMR+LCT ELL+  +I  FQA RR E+  L+ SLK AA     VDLS++V+ L AD++C
Sbjct  124   RNMRRLCTSELLNAARIAQFQAARRAEVRLLVTSLKSAAELGEIVDLSARVTGLSADMNC  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFG+KY+  DL E GF+ V  E  ++  K NL DYFPF+  LDLQGL  R+K L K +
Sbjct  184   VMVFGRKYDDSDLGEMGFKSVFMETAEISAKFNLADYFPFIGALDLQGLNSRIKELGKVF  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D F E+I+DDH Q  +     +TKDFVDTM+++M SGEA F+F+R H+K  L D L   +
Sbjct  244   DGFLEKIIDDHLQ--EKPEKKETKDFVDTMMAVMNSGEAGFEFDRRHVKAVLQDMLIAGT  301

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  +EW +SEL+RHP IMKK+Q+EL+S +GL+ MVEES LE L+YL+ VVKE+LRLH
Sbjct  302   DTSSTSVEWAISELIRHPSIMKKLQKELESTVGLNHMVEESHLEKLEYLDFVVKETLRLH  361

Query  715   PVAP-LIPNEAREDCMIEG-FHIPKK  644
             P AP LIP E+ EDC I G FHIPKK
Sbjct  362   PPAPLLIPRESMEDCTINGIFHIPKK  387


 Score =   174 bits (441),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -3

Query  663  VFTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            +F   KKSR I+NVWAI  DP+ W NPE F PERF GS++D RGR F+LIPFGSGRR CP
Sbjct  381  IFHIPKKSRAIVNVWAIGRDPSAWANPETFWPERFAGSDVDSRGRDFQLIPFGSGRRSCP  440

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G QLG+T+V+L++AQL+HCFDWE PN M   +LDM+E FG+++SRA HL++IP YRL
Sbjct  441  GQQLGLTVVKLMLAQLVHCFDWELPNGMLPSDLDMSEHFGVVMSRAEHLMLIPKYRL  497



>ref|XP_006367702.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=542

 Score =   371 bits (952),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 241/323 (75%), Gaps = 4/323 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   IV SS  AAE  L+ +D +FASRP  + ++Y+SYGQ NL+   YGPYW
Sbjct  106   PIMYVRLGLVPTIVVSSADAAEKVLRRYDHIFASRPHHQTSQYLSYGQKNLAFAKYGPYW  165

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
              NMRKLCT+ LLSN KI+SFQ+MR++E+  LIES+K  A   VAVDLS+K++ L A+++C
Sbjct  166   HNMRKLCTVHLLSNHKIHSFQSMRKQEVELLIESIKMEAHHHVAVDLSAKITSLNANLTC  225

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  +D D+RGF+ V+++ + L    NLGD+FPFL  +DLQG TR++K L+K +
Sbjct  226   LMVFGKKYMDEDFDKRGFKTVVQDAVHLAAMPNLGDFFPFLGVIDLQGFTRKLKDLSKVF  285

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGASE  893
             D+F ERI+D+H    +     QTKDFVDTM+ IMKSGEAEF F+R HIK  L D+  AS 
Sbjct  286   DEFLERIIDEHV---EYHDRKQTKDFVDTMMDIMKSGEAEFPFDRTHIKAILLDMLLASM  342

Query  892   AITI-LIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
               T    +WI++ELLRHP++MKK+Q+EL+  +G++RMVEESDL +L YLEMVVKE +RLH
Sbjct  343   DTTASSTDWILAELLRHPQVMKKLQKELQEVVGVERMVEESDLVNLNYLEMVVKEGMRLH  402

Query  715   PVAPLIPNEAREDCMIEGFHIPK  647
             PV PL  +EA EDC+++GF I K
Sbjct  403   PVGPLFYHEAMEDCVVDGFQIHK  425


 Score =   158 bits (399),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR +IN +A+  DPNVW  PEKF PERF GS+ID+RG  F+L+PFGSGRR CPG
Sbjct  421  FQIHKGSRTVINCYAVQRDPNVWPEPEKFFPERFFGSSIDFRGNDFQLVPFGSGRRSCPG  480

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QLG+T+VRLVVAQL+HCF+WE PN +   +LD+ E FG++  R   L+ IP YRL
Sbjct  481  MQLGVTVVRLVVAQLVHCFEWELPNGIQPCDLDIDEHFGIVTCREKPLLAIPTYRL  536



>ref|XP_009372721.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=496

 Score =   356 bits (913),  Expect(2) = 3e-140, Method: Compositional matrix adjust.
 Identities = 171/324 (53%), Positives = 244/324 (75%), Gaps = 5/324 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM+LR GL + +V S+ +AAELFLKTHDL FASRPP E AK++ +GQ +LS   YG YW 
Sbjct  64    IMYLRLGLQHTVVVSTARAAELFLKTHDLNFASRPPNEGAKHLIFGQKSLSFAEYGSYWT  123

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             NMR++C LELLSN KINSF++MRREE+  LI+S+++ A +R   +L+ KV  L  D++CR
Sbjct  124   NMRRICMLELLSNQKINSFKSMRREEVALLIKSVQEDANNRRIANLTDKVMSLGIDMTCR  183

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MVFGKKY+ ++   RG   V+KE M L    NLGD+ P ++ LDLQGLT++MKA+ K +D
Sbjct  184   MVFGKKYKDEEFGGRGIASVMKEGMKLAAAPNLGDFIPCIAPLDLQGLTKKMKAVNKAFD  243

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-E  893
             +FFE+++D+H    Q    ++TKDF+D +L+ M S  ++++  R +IK  +SD+F AS +
Sbjct  244   EFFEKVIDEHL---QYKDKERTKDFIDALLAHMGSEGSDYRIERLNIKAMMSDMFAASAD  300

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
               +  ++W +SELLRHP++MKKVQ+EL++ +GL RMVEESD+E L+YL+MV+KE++RLHP
Sbjct  301   TSSTTVQWALSELLRHPQVMKKVQKELENVVGLKRMVEESDMEKLEYLDMVLKETMRLHP  360

Query  712   VAP-LIPNEAREDCMIEGFHIPKK  644
             V P L+P+ A EDC ++G+HIPKK
Sbjct  361   VVPLLLPHAAIEDCTVDGYHIPKK  384


 Score =   172 bits (435),  Expect(2) = 3e-140, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSRIIIN WAI  DP+ W + EKF+PERFE +N+D RG HF+L+PFGSGRR C G+QLG
Sbjct  383  KKSRIIINAWAIGRDPSAWEDAEKFVPERFEDNNVDVRGHHFQLVPFGSGRRRCVGMQLG  442

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            IT+V  V+AQL+HCFDWE P++M   ELDMTE+FGL+VSRA +L+ IP+YRL 
Sbjct  443  ITVVHFVLAQLVHCFDWELPDNMLPNELDMTEEFGLVVSRAKNLLAIPSYRLQ  495



>ref|XP_004253509.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=493

 Score =   360 bits (923),  Expect(2) = 5e-140, Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 238/322 (74%), Gaps = 7/322 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             I++++FGL    V SSPQ+AE  LKT+D +FASRP  E A+YISYGQ NL    YG YWR
Sbjct  64    IIYMKFGLVPTYVISSPQSAEKILKTYDHIFASRPHNETAQYISYGQRNLIFSKYGAYWR  123

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             NMRKLCT+ LLSN+KI+SFQ+ R EE+  +I+ + Q     V VDLS++VS+L A++SC 
Sbjct  124   NMRKLCTVHLLSNMKIHSFQSTRSEEIALMIKEIAQG---HVEVDLSAQVSKLSANLSCL  180

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MVFGKK+   DLD+RGF+ +++E   L    NLGD+FPFL  +DLQGLTRRMK  +K  D
Sbjct  181   MVFGKKFTDDDLDKRGFKYLVQEVTTLAATPNLGDFFPFLGVIDLQGLTRRMKDTSKVLD  240

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-E  893
              F E+I+D+H  + +     + KDFVDTM+ IM+SGEAEFQF+R H+K  + D+  AS +
Sbjct  241   PFVEKIIDEHVNAKE---QKKNKDFVDTMMDIMQSGEAEFQFDRRHVKAVMLDMLVASID  297

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
               +  IEW++SELLR+P+IMKK+Q EL+  +GL+RMV+ESDLE+LKYL MV KES RLH 
Sbjct  298   TSSSSIEWMLSELLRNPDIMKKLQRELEEVVGLNRMVQESDLENLKYLNMVFKESFRLHA  357

Query  712   VAPLIPNEAREDCMIEGFHIPK  647
              APL+ +EA EDC+++ F+I K
Sbjct  358   AAPLLLHEAMEDCVVDDFYIKK  379


 Score =   167 bits (424),  Expect(2) = 5e-140, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  +K S++I+N + I  DPN WT+ +KF+PERF  SN+D RGR ++L+PFGSGRR CPG
Sbjct  375  FYIKKGSQVIVNAYTIHRDPNFWTDADKFMPERFLESNVDVRGRDYQLLPFGSGRRSCPG  434

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QL + +VRLVVAQL+HCFDWE PN M  ++LDMTEQFG++  RANHL+ +P YRL 
Sbjct  435  MQLALIIVRLVVAQLVHCFDWELPNEMNPKDLDMTEQFGIVTGRANHLMAVPTYRLQ  491



>ref|XP_011078642.1| PREDICTED: cytochrome P450 CYP736A12-like [Sesamum indicum]
Length=500

 Score =   426 bits (1096),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 210/334 (63%), Positives = 262/334 (78%), Gaps = 8/334 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++RFGL   ++ SSP+AAELFLKTHDL+FASRPP +AAKY+S+ Q NLS   YGPYW
Sbjct  65    PIMYMRFGLVPNVIVSSPKAAELFLKTHDLIFASRPPHQAAKYLSWDQRNLSFGAYGPYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLSNLKI+ FQ MRREEL   IESLKQAA D + VDLS+KVS L A++SC
Sbjct  125   RNMRKLCTLELLSNLKISCFQTMRREELGIFIESLKQAARDGIPVDLSAKVSSLTAEMSC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKYE KD+DERGF+ V++E M L    NLGDYFPFL  LD+QGLTR+MKAL+K Y
Sbjct  185   RMVFGKKYEDKDIDERGFKTVIQEGMKLAAVPNLGDYFPFLGILDIQGLTRKMKALSKVY  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEA-EFQFNREHIKPTLSDLF-GA  899
             D FFE+++++H +    G  +QTKD VDTM+SIM+SG+  EFQF+R H+K  + D+  G+
Sbjct  245   DDFFEKVINEHVRDWDHG--EQTKDIVDTMMSIMQSGQTREFQFDRRHVKAIMLDMLAGS  302

Query  898   SEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
              +     +EWI+SELLR+P  MKKVQ+EL+  +GL+RMVEESD++ L+YL+MVVKE+ RL
Sbjct  303   MDTAASSVEWILSELLRNPTTMKKVQKELEEVVGLERMVEESDIDQLEYLDMVVKETFRL  362

Query  718   HPVAP-LIPNEAREDCMIEGFHIPKK---ITNHH  629
             HPVAP LIP+ A EDC + G+ IPK    I N H
Sbjct  363   HPVAPLLIPHYAMEDCTVNGYDIPKASRIIINTH  396


 Score =   167 bits (423),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            K SRIIIN  AI  DP+ W+ PEKFIPERF GS ID RG+HF+L+PFGSGRR CPG+QLG
Sbjct  387  KASRIIINTHAIGRDPDAWSEPEKFIPERFVGSEIDVRGQHFQLLPFGSGRRGCPGMQLG  446

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +  VRL+V+QL+HCFDW  PN +  +ELDM E+FGL+V+RANHL+ IP +RL 
Sbjct  447  LIQVRLIVSQLVHCFDWRLPNGVLPKELDMAEEFGLVVNRANHLMAIPTFRLQ  499



>gb|EYU27291.1| hypothetical protein MIMGU_mgv1a023536mg [Erythranthe guttata]
Length=497

 Score =   370 bits (949),  Expect(2) = 6e-140, Method: Compositional matrix adjust.
 Identities = 170/323 (53%), Positives = 232/323 (72%), Gaps = 4/323 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G+    V SSP  AELFLKTHDL FA+R P +AA++ISYG  N++S PYGPYW
Sbjct  65    PIMFLRLGMVPAFVVSSPAGAELFLKTHDLSFANRHPSQAAEHISYGSRNIASAPYGPYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKL T+ LLSN+KIN FQAMR+ EL  L+  L++A+ +R  VD+   V+ L  D+ C
Sbjct  125   RNMRKLSTVNLLSNIKINQFQAMRKGELGALVNRLRRASDNREIVDVGKMVTTLTGDMIC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFG+KY   DL ++GF+ V++E +D+    NLGDYFPF+ T+DLQGLTRRMK L+K +
Sbjct  185   MMVFGRKYGDSDLGDKGFKAVIEEALDIAAAPNLGDYFPFMGTIDLQGLTRRMKQLSKIF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D F  +I+D+H Q+ Q     +T+DFVDTM++IM SGEA F+F+  H+K  L D L G +
Sbjct  245   DGFLGKIIDNHVQNKQ---EKETQDFVDTMIAIMDSGEAGFEFDHRHVKAVLLDMLIGGT  301

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +   + + W ++EL+RHP+IMKK+Q+EL   +G+D  +EES L+ L YL  V+KE+ RLH
Sbjct  302   DTSAVTVNWALAELIRHPQIMKKLQQELDKVVGMDEYIEESHLDKLDYLNFVIKETFRLH  361

Query  715   PVAPLIPNEAREDCMIEGFHIPK  647
             P+ PLI ++  ED  +E FH+PK
Sbjct  362   PIVPLIGHKTMEDLTVENFHVPK  384


 Score =   157 bits (397),  Expect(2) = 6e-140, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 87/117 (74%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K S + +NVW+I  DPNVW +PEKF PERF  +N+D +GR F L+PFGSGRR+CPG
Sbjct  380  FHVPKGSSVFVNVWSIHKDPNVWEDPEKFWPERFSETNVDLQGRDFRLLPFGSGRRVCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
             QLG+T+VRLV+A+L+HCFDWE PN M   ELDM E F  ++SR   L+ IP YRLH
Sbjct  440  YQLGLTVVRLVLARLVHCFDWELPNGMLPNELDMAEHFRFVMSREKPLMAIPVYRLH  496



>ref|XP_008440671.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=508

 Score =   361 bits (926),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 235/325 (72%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ G+   I+ SSPQAA+LFLKTHDL+FA+RP  +A+K+ISY Q NL   PYGPYW
Sbjct  66    PIMSMKLGIVPTIIVSSPQAAKLFLKTHDLIFANRPSLQASKHISYQQKNLVFSPYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLSN KINSF  +R+ EL  LIE  K+AA ++  V+LS+KV+ L  DI C
Sbjct  126   RNMRKMCTLELLSNHKINSFMPIRKHELGLLIEYFKEAAHNKTVVNLSAKVTSLTTDIIC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M FGKKY  +D DERGF+ V++E M L    NLGD+ P ++ LDLQG TR++K + K Y
Sbjct  186   LMAFGKKYGDEDFDERGFKAVIQEGMQLAAAPNLGDFIPTIAWLDLQGFTRKIKRVHKVY  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D F ++I+++H     +    +T+DFVD ML ++ S + E+Q +R  IK  + D+  A+ 
Sbjct  246   DDFLDKIINEHL---VARGRKKTRDFVDVMLDLIDSQQTEYQIDRSAIKAIMLDMLAAAM  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  I W MSEL+RHP +MKK+Q+EL+  +GL RMVEESDL  L+YLEMVVKE +RL+
Sbjct  303   DTSSTTIGWAMSELIRHPYVMKKMQDELQKVVGLHRMVEESDLVCLEYLEMVVKEIMRLY  362

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             P AP LIP+E+ EDC + GFHIPKK
Sbjct  363   PAAPLLIPHESLEDCTVNGFHIPKK  387


 Score =   165 bits (418),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSR+I+N WAI  DP+VW +P KF PERF GS ID +G+ FELIPFG+GRR CPG
Sbjct  382  FHIPKKSRLIVNAWAIGRDPSVWNDPHKFFPERFIGSQIDLKGKDFELIPFGAGRRGCPG  441

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRL++AQL+HCFDWE PN M   ELDM E+FGL   RA  L++IP +RL+
Sbjct  442  MQLGLTMVRLLLAQLVHCFDWELPNGMLPSELDMIEEFGLTCPRAQDLMIIPIFRLN  498



>ref|XP_004488758.1| PREDICTED: cytochrome P450 71A1-like [Cicer arietinum]
Length=496

 Score =   359 bits (922),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 242/324 (75%), Gaps = 4/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH+R GL   IV SSPQAA+ FLKTHDLVFASRP  EAAKYI + Q +++ C YG YW
Sbjct  61    PIMHMRLGLIPTIVVSSPQAAKHFLKTHDLVFASRPYVEAAKYIFWEQKDVAFCEYGSYW  120

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLEL+S  KINSF++MR EE+  LI+ L++A+ D   VD+S+KVS L+ D++C
Sbjct  121   RNMRKMCTLELMSQSKINSFRSMREEEVDILIKFLREASNDGTKVDISAKVSTLMVDMTC  180

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  K+LDE+GF+ ++ E M+L G  N+GDY P++  LDLQGLT+RMK ++K +
Sbjct  181   RMVVGKKYMDKELDEKGFKLMMDEAMNLLGTPNIGDYIPYIGLLDLQGLTKRMKVISKIF  240

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D FF++I+++H +S       +  DFVD +L  + + E +++  R +IK  + D+F AS 
Sbjct  241   DDFFDKIIEEHIKSNDKDG--EPMDFVDVLLGFLGTEEYDYRIERSNIKAIMMDIFIAST  298

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  IEW +SELL++P +MKKVQ+EL+S +GL R VEESDL+ L+YL+MV+KES R+H
Sbjct  299   DTSSTTIEWTISELLKNPRVMKKVQKELESVVGLKRKVEESDLDKLEYLDMVIKESFRIH  358

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             P  P LIP+++ EDCM+E F IPK
Sbjct  359   PAGPLLIPHQSLEDCMVEDFFIPK  382


 Score =   166 bits (421),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+I+N W+I  D   W++PEKF PERFEGSNID +G +FELIPFGSGRR CPG
Sbjct  378  FFIPKNSRVIVNAWSIMRDKMAWSDPEKFWPERFEGSNIDAKGSYFELIPFGSGRRGCPG  437

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            L+LG+T+VRLVVAQL+HCFD++ P+++   +LDMTE+FGL + RANHL+VIP YRL
Sbjct  438  LKLGLTIVRLVVAQLVHCFDFKLPDNILSYDLDMTEKFGLNLIRANHLLVIPTYRL  493



>ref|XP_007159750.1| hypothetical protein PHAVU_002G263900g [Phaseolus vulgaris]
 gb|ESW31744.1| hypothetical protein PHAVU_002G263900g [Phaseolus vulgaris]
Length=497

 Score =   355 bits (911),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 234/325 (72%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR G    IV SSP AA+LFLKTHDL++ASRPP E A YIS+GQ NL+   YG YW
Sbjct  60    PIMHLRLGFVPTIVVSSPHAAQLFLKTHDLIYASRPPLEVANYISWGQRNLAFAQYGSYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+ RK+CT ELLS+ KINSF+ +R EEL  L++ L++AA D   VD+S+KV+ L AD +C
Sbjct  120   RSTRKMCTSELLSHAKINSFRPLREEELDLLVKHLREAAKDGAVVDVSAKVAALSADSAC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ GKKY  ++LDE GF+ V+KE M L    N+GDY P++  LDLQGL +RMK + K +
Sbjct  180   RMILGKKYMDQELDEMGFKAVMKELMYLAAAPNMGDYIPYIGKLDLQGLIKRMKVMRKIF  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D+FF++I+D+H QS +    ++ KDFVD ML  + + E  F+    +IK  L DL  G+ 
Sbjct  240   DEFFDKIIDEHIQSEK--GEEEVKDFVDVMLGFVGTEELGFRVEIPNIKAILLDLLVGSI  297

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SELL++P +MKK+Q EL+S +G+ R VEESDLE L+YL+MV+KESLRLH
Sbjct  298   DTSATAIEWTLSELLKNPRVMKKLQVELESVVGMKRKVEESDLEKLEYLDMVIKESLRLH  357

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P++  EDCM+  F IPK 
Sbjct  358   PVAPLLVPHQTTEDCMVGDFFIPKN  382


 Score =   169 bits (428),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+I+N WAI  DP  W   EKF PERFEGSNID RGR FELIPFGSGRR CPG
Sbjct  377  FFIPKNSRLIVNAWAIMRDPGAWIEAEKFWPERFEGSNIDVRGREFELIPFGSGRRGCPG  436

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T++R  VAQL+HCFDW+ PN M  +ELDM ++FGL + RANHL+ IP+ RL+
Sbjct  437  IQLGLTVIRHTVAQLVHCFDWKLPNDMMPDELDMADEFGLTMPRANHLLAIPSQRLY  493



>ref|XP_006354705.1| PREDICTED: cytochrome P450 750A1-like [Solanum tuberosum]
Length=504

 Score =   359 bits (921),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 179/331 (54%), Positives = 241/331 (73%), Gaps = 12/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PI++++FGL    V SSPQ+AE  LKT+D +FASRP  E ++YISYGQ NL    +G YW
Sbjct  63    PIIYMKFGLVPTYVISSPQSAEKILKTYDHIFASRPHSETSQYISYGQRNLIFSKHGAYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAA--------LDRVAVDLSSKVS  1277
             RNMRKLCT+ LLSN+KINSFQ+ R EE+  +I+S+K+ A           V VDLS++VS
Sbjct  123   RNMRKLCTVHLLSNMKINSFQSTRSEEIDIMIKSIKEIAQGQGQSQGQGHVEVDLSAQVS  182

Query  1276  ELIADISCRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRR  1097
             +L A++SC MVFGKK+  +DLD+RGF+ +++E   L    NLGD+FPFL  +DLQGLTRR
Sbjct  183   KLTANLSCLMVFGKKFTDEDLDKRGFKYLVQEVTTLAATPNLGDFFPFLGVIDLQGLTRR  242

Query  1096  MKALAKTYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTL  917
             MK  +K  D F E+I+D+H     +    + KDFVDTM+ IM+SGE EFQF+R H+K  +
Sbjct  243   MKDTSKVLDPFVEKIIDEHV---NAKDHKKNKDFVDTMMDIMQSGEVEFQFDRRHVKAVM  299

Query  916   SDLFGASEAI-TILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
              D+  AS    +  IEW++SELL++P+IMKK+Q+EL+  +GL+RMVEESDLE+LKYL MV
Sbjct  300   LDMLVASIGTSSSSIEWMLSELLKNPDIMKKLQKELEEVVGLNRMVEESDLENLKYLNMV  359

Query  739   VKESLRLHPVAPLIPNEAREDCMIEGFHIPK  647
              KES RLH  APL+ +EA EDCM++ F++ K
Sbjct  360   FKESFRLHVAAPLLLHEAMEDCMVDDFYVKK  390


 Score =   165 bits (418),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 91/117 (78%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  +K S++I+N + I  DPN WTN +KF+PERF  SN+D RGR ++L+PFGSGRR CPG
Sbjct  386  FYVKKGSQVIVNAYTIHRDPNFWTNADKFLPERFLESNVDVRGRDYQLLPFGSGRRSCPG  445

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QL + +VRLVVAQL+ CFDWE PN M  ++LDMTEQFG++  RA+HL+ +P YRL 
Sbjct  446  MQLALIIVRLVVAQLVQCFDWELPNEMQPKDLDMTEQFGMVTGRASHLMAVPTYRLQ  502



>ref|XP_006354701.1| PREDICTED: cytochrome P450 84A1-like [Solanum tuberosum]
Length=496

 Score =   356 bits (914),  Expect(2) = 5e-139, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 243/328 (74%), Gaps = 10/328 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P MHL+ GL   IV SSP+  E  LKT+D VFASRP  EA++++ YGQ NL    YG YW
Sbjct  60    PFMHLQLGLVPTIVVSSPKTIEKVLKTYDHVFASRPHHEASQHVCYGQRNLIFSKYGSYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDR-----VAVDLSSKVSELI  1268
             RNMRKL T+ L+S+ KINS+Q  R+EE+  L++S+K  A D      VAVDLS+KVS L 
Sbjct  120   RNMRKLTTMNLVSSQKINSYQPSRKEEVSLLVKSIKHVA-DHDQEHVVAVDLSAKVSSLN  178

Query  1267  ADISCRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKA  1088
             A++SC MVFGKK+  +DLD+RGF+ +++E + L    NLGD+FP+L  LDLQG+T R+KA
Sbjct  179   ANLSCLMVFGKKFMDEDLDKRGFKYLVQEVVHLAATPNLGDFFPYLGVLDLQGITSRLKA  238

Query  1087  LAKTYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDL  908
             L+K +D+F E+I+D+H +S +     +TKDFVDTM+ IM+SGEA F+F+R H+K  L D+
Sbjct  239   LSKVFDEFLEKIIDEHVESKE---QKETKDFVDTMMDIMQSGEAGFKFDRCHVKAVLLDM  295

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
                S +     +EWI++ELLRHP +MKK+Q+EL+  +GLDRMVEESDLE+L YL+MV+KE
Sbjct  296   LMTSMDTSATSVEWILTELLRHPHVMKKLQKELEQVVGLDRMVEESDLENLNYLDMVIKE  355

Query  730   SLRLHPVAPLIPNEAREDCMIEGFHIPK  647
             +LRLH  APL+ +E+ +DC+++GF + K
Sbjct  356   ALRLHSAAPLLIHESIQDCVVDGFFVQK  383


 Score =   167 bits (423),  Expect(2) = 5e-139, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  QK SRII+NV+A   DPN W  P+KF+PERF  S +D RG  F+L+PF SGRR CPG
Sbjct  379  FFVQKGSRIIVNVYAAQRDPNAWPEPDKFLPERFVESTVDLRGHDFQLLPFSSGRRSCPG  438

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            +QLGI +VRLVVAQL+HCFDWE PN M   ELDM+EQFG++  RA HL+ IP YRL +
Sbjct  439  MQLGIIIVRLVVAQLVHCFDWELPNGMQPSELDMSEQFGVVNCRAKHLMAIPTYRLQL  496



>gb|EYU24036.1| hypothetical protein MIMGU_mgv1a005182mg [Erythranthe guttata]
Length=494

 Score =   379 bits (972),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 182/325 (56%), Positives = 242/325 (74%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    +V SSP AAEL LKTHDLVFASRP   AA+Y+SY Q N+   PYGPYW
Sbjct  60    PIMGLRLGFVPAVVVSSPAAAELILKTHDLVFASRPKSAAAEYMSYQQKNIIFGPYGPYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRK+CTLELLS+L+I+ FQAMR  EL  +++SLKQAA     VDLS++VS +  D++C
Sbjct  120   RDMRKICTLELLSSLRISQFQAMRAAELRLMVDSLKQAAELGEIVDLSARVSGVNGDMNC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FG+KY  +D DE+GF+ V  E +++  K NL DYFP++  LDLQG+ RRMK L+K +
Sbjct  180   LMIFGRKYADEDFDEKGFKAVFTEVVEMSAKFNLADYFPYIGVLDLQGMNRRMKELSKIF  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D F E+I+D+H Q  +     +TKDFVDTM+++M+SGEA F+F+R H+K  L DL  A  
Sbjct  240   DGFLEKIIDEHLQ--EKPEKKETKDFVDTMMAVMESGEAGFEFDRRHVKAVLLDLLVAGM  297

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  +EW +SEL+RHP +MKK+Q EL+S +G+DR VEES L  L+YL+ VVKE+LRLH
Sbjct  298   DTSSTAVEWAISELIRHPRVMKKLQNELESTVGIDRTVEESHLNKLEYLDSVVKETLRLH  357

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PV P L+P+E+ EDC I+G+HIPKK
Sbjct  358   PVVPLLVPHESMEDCTIDGYHIPKK  382


 Score =   142 bits (359),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR I+N+WAI  DP+VW +PE F PERF GS ID RGR F+L+PFGSGRR CP LQLG
Sbjct  381  KKSRAIVNMWAIGRDPSVWAHPETFSPERFSGSGIDLRGRDFQLVPFGSGRRTCPALQLG  440

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            + LV+LV+AQL+HCFDWE PN M   +LDM+E FGL+ SRA H++ IP YRL
Sbjct  441  VVLVKLVLAQLVHCFDWELPNGMLPCDLDMSEHFGLVTSRAEHIMAIPKYRL  492



>ref|XP_008385982.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=499

 Score =   351 bits (901),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 180/325 (55%), Positives = 246/325 (76%), Gaps = 6/325 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM++R GL + IV SSP+AAELFLKTHDL FASRPP E AK++ +GQ N+S   YGPYWR
Sbjct  66    IMYMRLGLQHNIVISSPRAAELFLKTHDLNFASRPPHEGAKHVIFGQTNMSFAKYGPYWR  125

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALD-RVAVDLSSKVSELIADISC  1253
             +MRK+CTLELLSN KINSF+AMRREE+  LI+S+++ A + RV ++LS K++ L  D++C
Sbjct  126   DMRKMCTLELLSNHKINSFKAMRREEVSLLIQSVQEDANBRRVPINLSDKIASLSVDLTC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             R+VFGKKY+ +D DERGF  VLKE + +    NL D+ PFL   DLQGLT++MK++ K +
Sbjct  186   RLVFGKKYKDEDFDERGFTAVLKESIQIVAAPNLNDHIPFLRPFDLQGLTKKMKSINKKF  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             + FFE+I+DDH    QS   ++TKDFVD +L  M S E++++  R H+K  + D+F A+ 
Sbjct  246   NTFFEKIIDDHL---QSKDEERTKDFVDVVLGRMGSEESDYRIERVHVKAVMLDMFAAAL  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     I W +SELLRHP++MKK+Q+EL++ +GL+RMVEESDLE L+YL++VVKE+LRLH
Sbjct  303   DTPPSAILWALSELLRHPQVMKKLQKELENVVGLNRMVEESDLEKLEYLDIVVKETLRLH  362

Query  715   PVAPLIPNEAR-EDCMIEGFHIPKK  644
             PV PL+      EDC ++G+HIPK 
Sbjct  363   PVLPLLLPHLSIEDCTVDGYHIPKN  387


 Score =   168 bits (425),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            K SR+I+N WAI  DP+ W + EKF+PERFEGSNID +G+HF+LIPFGSGRR C G+QLG
Sbjct  386  KNSRLIVNAWAIGRDPSAWEDAEKFVPERFEGSNIDVKGKHFQLIPFGSGRRRCAGMQLG  445

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +T+V+ V+AQ++HCFDWE P++M   ELDMTE FGL VSR   L++IP+YRL 
Sbjct  446  LTVVQFVLAQIVHCFDWELPDNMLPNELDMTEVFGLAVSRTKDLLLIPSYRLQ  498



>ref|XP_004162326.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=507

 Score =   357 bits (916),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 171/327 (52%), Positives = 244/327 (75%), Gaps = 7/327 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH++ GL N IV SSPQAAELFLKTHDL+FASRP    +K++SYGQ NL    YG YW
Sbjct  72    PIMHIKLGLVNTIVVSSPQAAELFLKTHDLIFASRPLTMVSKFLSYGQKNLVFAQYGSYW  131

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF++MR+EE+  LIE LK+AA D V++++SSK + LI D++C
Sbjct  132   RNVRKMCTLELLSNHKINSFKSMRKEEVGLLIEYLKEAASDGVSINISSKAASLITDMTC  191

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFG+K+  ++LD+RGF+ +++E M L    NLGD+ PF+   DLQGL RRM  ++K +
Sbjct  192   LMVFGRKFGDEELDDRGFKAMMQEVMQLIAAPNLGDFIPFIERFDLQGLNRRMINVSKVF  251

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG--EAEFQFNREHIKPTLSDLFGA  899
             D FFERI+D+H    +S    +TKDF+D ML +M +     E++ +R ++K  + D+ GA
Sbjct  252   DGFFERIIDEHL---KSMGEKKTKDFLDVMLDLMNTECLSYEYRIDRSNVKAIILDMLGA  308

Query  898   S-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLR  722
             + +    +I W + EL+RHP++MKKV++EL++ +GLD +VEES L  L+YL+MV+KE LR
Sbjct  309   AMDTSATVIGWALPELIRHPQVMKKVKDELENVVGLDTIVEESHLIHLQYLDMVIKEILR  368

Query  721   LHPVAP-LIPNEAREDCMIEGFHIPKK  644
             L+P  P L+P+E+ +DC+++GF IP+K
Sbjct  369   LYPPVPLLVPHESLQDCVVDGFFIPRK  395


 Score =   159 bits (401),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +KSR+I+N WAI  DP  W +P KF PERF  S +D +GR F+LIPFG+GRR CPG
Sbjct  390  FFIPRKSRVIVNAWAIGRDPTAWIHPLKFHPERFMDSQLDVKGRDFQLIPFGAGRRGCPG  449

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            + LG+T+VRLV+AQLLHCFDW+    M  +ELDMTE FGL   RA  LI+IP YRLHI
Sbjct  450  IHLGLTVVRLVLAQLLHCFDWKLLGGMSIDELDMTENFGLTCPRAQDLILIPVYRLHI  507



>ref|XP_004143566.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=506

 Score =   357 bits (916),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 171/327 (52%), Positives = 244/327 (75%), Gaps = 7/327 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH++ GL N IV SSPQAAELFLKTHDL+FASRP    +K++SYGQ NL    YG YW
Sbjct  71    PIMHIKLGLVNTIVVSSPQAAELFLKTHDLIFASRPLTMVSKFLSYGQKNLVFAQYGSYW  130

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF++MR+EE+  LIE LK+AA D V++++SSK + LI D++C
Sbjct  131   RNVRKMCTLELLSNHKINSFKSMRKEEVGLLIEYLKEAASDGVSINISSKAASLITDMTC  190

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFG+K+  ++LD+RGF+ +++E M L    NLGD+ PF+   DLQGL RRM  ++K +
Sbjct  191   LMVFGRKFGDEELDDRGFKAMMQEVMQLIAAPNLGDFIPFIERFDLQGLNRRMINVSKVF  250

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG--EAEFQFNREHIKPTLSDLFGA  899
             D FFERI+D+H    +S    +TKDF+D ML +M +     E++ +R ++K  + D+ GA
Sbjct  251   DGFFERIIDEHL---KSMGEKKTKDFLDVMLDLMNTECLSYEYRIDRSNVKAIILDMLGA  307

Query  898   S-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLR  722
             + +    +I W + EL+RHP++MKKV++EL++ +GLD +VEES L  L+YL+MV+KE LR
Sbjct  308   AMDTSATVIGWALPELIRHPQVMKKVKDELENVVGLDTIVEESHLIHLQYLDMVIKEILR  367

Query  721   LHPVAP-LIPNEAREDCMIEGFHIPKK  644
             L+P  P L+P+E+ +DC+++GF IP+K
Sbjct  368   LYPPVPLLVPHESLQDCVVDGFFIPRK  394


 Score =   159 bits (401),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +KSR+I+N WAI  DP  W +P KF PERF  S +D +GR F+LIPFG+GRR CPG
Sbjct  389  FFIPRKSRVIVNAWAIGRDPTAWIHPLKFHPERFMDSQLDVKGRDFQLIPFGAGRRGCPG  448

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            + LG+T+VRLV+AQLLHCFDW+    M  +ELDMTE FGL   RA  LI+IP YRLHI
Sbjct  449  IHLGLTVVRLVLAQLLHCFDWKLLGGMSIDELDMTENFGLTCPRAQDLILIPVYRLHI  506



>gb|AJD25257.1| cytochrome P450 CYP736A122 [Salvia miltiorrhiza]
Length=502

 Score =   347 bits (890),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 233/325 (72%), Gaps = 2/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM+ RFG    I+ SSP AAELFLKTHDL+FA RP  EAA Y+ Y Q N+    YGPYW
Sbjct  66    PIMYTRFGSIPTIIVSSPSAAELFLKTHDLIFADRPHHEAAYYLGYEQRNIVFGRYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCTLELLS L+I+ FQ MRR E+   ++ L++AA +   VD+S++VS L+ D++C
Sbjct  126   RNMRKLCTLELLSGLRIDEFQPMRRAEIMRAVDGLRRAAEEGEVVDVSARVSGLVGDMNC  185

Query  1252  RMVFGKKYEMKDLD-ERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
              MVFG+K+  +DLD E GF+ V++E   +  + NLGDYFP ++ LDLQGL RR++ L+ T
Sbjct  186   LMVFGRKFVDRDLDQELGFKDVIEETTRVAAQPNLGDYFPLVAPLDLQGLNRRVERLSAT  245

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGA  899
             +D F + I+DDH +  +     + KDFVD M+ IM+SG A F F+R H+K  L D L G 
Sbjct  246   FDGFLDMIIDDHVKKNEEEKEKKDKDFVDVMMGIMESGAAGFDFDRRHVKAMLLDMLIGG  305

Query  898   SEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
              +  +  ++WIMSEL+++P +MKK+Q+E++  +G+D+MVE+S L  LKYL+ VVKESLRL
Sbjct  306   IDTTSTAVDWIMSELMKNPTVMKKLQKEIEEVVGMDQMVEKSHLSSLKYLDCVVKESLRL  365

Query  718   HPVAPLIPNEAREDCMIEGFHIPKK  644
             HPVAPL+ + A+ DC + GF IP K
Sbjct  366   HPVAPLLAHAAQGDCQVAGFDIPDK  390


 Score =   165 bits (418),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F    K+ + +NVWAI  DP+VW NPE F P+RF  SN+D+RGR F+L+PFGSGRR CPG
Sbjct  385  FDIPDKTHVFVNVWAIGRDPHVWPNPETFCPDRFLRSNVDFRGRDFQLLPFGSGRRSCPG  444

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LQLG+T+VR VVAQL+HCFDWE P+ M  +ELDM E++G++++RA HL  IP YRL
Sbjct  445  LQLGLTIVRSVVAQLVHCFDWELPDGMLADELDMFEKYGMVITRAKHLRAIPTYRL  500



>ref|XP_008440670.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=497

 Score =   350 bits (897),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 174/327 (53%), Positives = 235/327 (72%), Gaps = 7/327 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH++ GL + I+ SSP AA+LFLKTHD VFASRP    +  +SYGQ +L   PYG YW
Sbjct  62    PIMHMKLGLVHTIIVSSPHAAKLFLKTHDQVFASRPLIHTSNIMSYGQKDLVFAPYGSYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLEL S +KINSF++MR+EE+  LIE LK A+ DRVAV +SSKVS L AD++C
Sbjct  122   RNIRKMCTLELFSPVKINSFKSMRKEEVRELIEYLKTASRDRVAVRVSSKVSSLSADMTC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M FGKKY  ++  ERGF+ V++E M L    NL DY PF+++ D+QGL RR   + K +
Sbjct  182   LMAFGKKYRDEEFGERGFKAVIQEAMQLAIAPNLADYIPFVASFDIQGLNRRATFVGKEF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEA--EFQFNREHIKPTLSDLFGA  899
             D F ERI+++H    +S   ++ KDFVD +L IM S +   E+Q +R +IK    D+  A
Sbjct  242   DGFLERIIEEHI---ESKDGNRNKDFVDYLLDIMMSSQEADEYQIDRSNIKAIALDVLSA  298

Query  898   S-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLR  722
             + +     I+W ++EL++HP+ MK++Q EL+  +GL+RMVEES LE LKYLEMV+KE LR
Sbjct  299   AMDTSATAIDWALAELIKHPQAMKELQVELEKVVGLNRMVEESHLEHLKYLEMVIKEVLR  358

Query  721   LHPVAP-LIPNEAREDCMIEGFHIPKK  644
             LHP AP L+P+E+ EDC ++GFHIPKK
Sbjct  359   LHPPAPLLVPHESLEDCTVDGFHIPKK  385


 Score =   159 bits (403),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSRII+N W+I  DPNVWT+P+KF PERF  S  D +GR F+LIPFGSGRR CPG
Sbjct  380  FHIPKKSRIIVNAWSIGQDPNVWTDPQKFFPERFIHSLTDVKGRDFQLIPFGSGRRGCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +QLG+ +V LVVA L+HCFDWE PN M   +LDM E+FGL   RA  L++IP YRL
Sbjct  440  IQLGLLIVSLVVANLVHCFDWELPNCMLAIDLDMEEEFGLTCPRAQELMLIPAYRL  495



>ref|XP_004162312.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=501

 Score =   341 bits (875),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 172/326 (53%), Positives = 241/326 (74%), Gaps = 6/326 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH++ GL N I+ SSP AAELFLKTHDL+FASRP    +K++SYGQ NL    YG YW
Sbjct  67    PIMHIKLGLVNTIIVSSPPAAELFLKTHDLIFASRPLTMVSKFLSYGQKNLVFAQYGSYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF++MR+EE+  LIE LK+AA D V+V++SSKV  L  D++C
Sbjct  127   RNVRKMCTLELLSNHKINSFKSMRKEEVGLLIEYLKEAANDGVSVNISSKVVSLSTDMTC  186

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFG+K+  ++LD+RGF+ +++E M L    NLGD  PF++  DLQGLTRRMK + K +
Sbjct  187   LMVFGRKFGDEELDDRGFKAMIQEVMQLVAAPNLGDLIPFIAMFDLQGLTRRMKNINKVF  246

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEA-EFQFNREHIKPTLSDLFGAS  896
             D+FFERI+D+H    +S    +TKDF+D ML +MKS +  E++ +R  +K  + D+ GA+
Sbjct  247   DRFFERIIDEHL---KSMGEKRTKDFLDVMLDLMKSEDTHEYRIDRSSVKAIILDVLGAA  303

Query  895   -EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE-SLR  722
              +    +I W ++EL+RHP++MKKVQ+E+++ +GLDRMVEE DL  L+YL+MV+KE    
Sbjct  304   MDTSATVIGWALAELIRHPDVMKKVQDEVENVVGLDRMVEELDLIHLEYLDMVIKEILRL  363

Query  721   LHPVAPLIPNEAREDCMIEGFHIPKK  644
               P+  L+P+E+ +DC++E F IPK 
Sbjct  364   YPPLPLLVPHESLQDCIVEDFFIPKN  389


 Score =   167 bits (424),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+I+N WAI  +P+ W +P KF PERF GS++D RGR F+LIPFG+GRR CPG
Sbjct  384  FFIPKNSRVIVNAWAIGRNPSAWIHPLKFCPERFMGSHLDVRGRDFQLIPFGAGRRGCPG  443

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            +QLG+T++RLV+AQLLHCFDW+ PN    +ELDMTE+FGL   RA  LIVIP YRLHI
Sbjct  444  IQLGMTVIRLVLAQLLHCFDWKLPNGTSIDELDMTEEFGLTCPRAQDLIVIPIYRLHI  501



>ref|XP_004143494.1| PREDICTED: cytochrome P450 750A1-like [Cucumis sativus]
Length=501

 Score =   341 bits (875),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 172/326 (53%), Positives = 241/326 (74%), Gaps = 6/326 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH++ GL N I+ SSP AAELFLKTHDL+FASRP    +K++SYGQ NL    YG YW
Sbjct  67    PIMHIKLGLVNTIIVSSPPAAELFLKTHDLIFASRPLTMVSKFLSYGQKNLVFAQYGSYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF++MR+EE+  LIE LK+AA D V+V++SSKV  L  D++C
Sbjct  127   RNVRKMCTLELLSNHKINSFKSMRKEEVGLLIEYLKEAANDGVSVNISSKVVSLSTDMTC  186

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFG+K+  ++LD+RGF+ +++E M L    NLGD  PF++  DLQGLTRRMK + K +
Sbjct  187   LMVFGRKFGDEELDDRGFKAMIQEVMQLVAAPNLGDLIPFIAMFDLQGLTRRMKNINKVF  246

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEA-EFQFNREHIKPTLSDLFGAS  896
             D+FFERI+D+H    +S    +TKDF+D ML +MKS +  E++ +R  +K  + D+ GA+
Sbjct  247   DRFFERIIDEHL---KSMGEKKTKDFLDVMLDLMKSEDTHEYRIDRSSVKAIILDVLGAA  303

Query  895   -EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE-SLR  722
              +    +I W ++EL+RHP++MKKVQ+E+++ +GLDRMVEE DL  L+YL+MV+KE    
Sbjct  304   MDTSATVIGWALAELIRHPDVMKKVQDEVENVVGLDRMVEELDLIHLEYLDMVIKEILRL  363

Query  721   LHPVAPLIPNEAREDCMIEGFHIPKK  644
               P+  L+P+E+ +DC++E F IPK 
Sbjct  364   YPPLPLLVPHESLQDCIVEDFFIPKN  389


 Score =   167 bits (424),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 92/118 (78%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+I+N WAI  +P+ W +P KF PERF GS++D RGR F+LIPFG+GRR CPG
Sbjct  384  FFIPKNSRVIVNAWAIGRNPSAWIHPLKFCPERFMGSHLDVRGRDFQLIPFGAGRRGCPG  443

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            +QLG+T++RLV+AQLLHCFDW+ PN    +ELDMTE+FGL   RA  LIVIP YRLHI
Sbjct  444  IQLGMTVIRLVLAQLLHCFDWKLPNGTSIDELDMTEEFGLTCPRAQDLIVIPIYRLHI  501



>ref|XP_006365796.1| PREDICTED: cytochrome P450 71A1-like isoform X2 [Solanum tuberosum]
Length=482

 Score =   374 bits (961),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 179/324 (55%), Positives = 246/324 (76%), Gaps = 5/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++FGL  +IVASSP AAELFLK HD+ FA+RP   AA+YI+Y   ++    YGP+W
Sbjct  66    PIMSMQFGLVPVIVASSPHAAELFLKKHDIAFANRPYNAAAQYIAYDHRDIVFAKYGPHW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLC ++LLSN+KINSF++MR++EL   +  LKQAA +RV VDLS+ ++ LI D+SC
Sbjct  126   RNMRKLCKMKLLSNIKINSFRSMRKQELGIFVNFLKQAASNRVEVDLSADLASLIVDMSC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  ++ DERGF+ +  E   L    N+ ++FPFLS  DLQG   RMK LAK +
Sbjct  186   LMVFGKKYMEEEFDERGFKNIFYEASFLVASPNIAEFFPFLSVFDLQGFIARMKDLAKIF  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+FFE+++D+H QS +    +Q KD VDTM++IM+SGEAEF+ +R  +K  L DL  AS 
Sbjct  246   DEFFEKVIDEHVQSKE---QNQAKDMVDTMMTIMQSGEAEFKIDRRDVKAVLLDLLLAST  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             + ++I I+WI+SELLRHP++MKK+Q EL+  +G++RMVEESDLE L+YL+MV++E LRLH
Sbjct  303   DNVSIAIDWILSELLRHPKVMKKLQIELEQAVGINRMVEESDLERLEYLDMVIREGLRLH  362

Query  715   PVAPLI-PNEAREDCMIEGFHIPK  647
             P + L+ P+E+ EDC+++GF IPK
Sbjct  363   PPSTLLTPHESIEDCIVDGFDIPK  386


 Score =   134 bits (338),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+ +NVWAI  DP  W +PEKF+PERF  SNID RG  F+L+PFGSGRR CPG
Sbjct  382  FDIPKGSRLFVNVWAIGRDPEAWPDPEKFMPERFVDSNIDLRGHDFQLLPFGSGRRSCPG  441

Query  480  LQLGITLVRLVVAQLLHCFDWEFPN  406
            LQLG+T+VRLV+AQL+HCFDWE PN
Sbjct  442  LQLGLTIVRLVLAQLVHCFDWELPN  466



>ref|XP_009372715.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=496

 Score =   337 bits (863),  Expect(2) = 2e-133, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 242/324 (75%), Gaps = 5/324 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM+LR GL + +V SS +AAELFLKTHDL FA+RPP E AK++ +GQ +LS   YG YW 
Sbjct  64    IMYLRLGLQHTVVVSSARAAELFLKTHDLNFANRPPNEGAKHLIFGQKSLSFAEYGSYWT  123

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             NMRKLC LELLSN KINSF++MRREE+  LI+S+++ A +R   +L+ KV  L  D++CR
Sbjct  124   NMRKLCMLELLSNQKINSFKSMRREEVALLIKSVQEDANNRRIANLTDKVMSLGIDMTCR  183

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MVFGKKY+ ++   RG   V+KE + L G  N GD+FP ++ LDLQGLT++MKA+ K +D
Sbjct  184   MVFGKKYKDEEFGGRGIVYVMKEGLKLAGAPNWGDFFPCIAPLDLQGLTKKMKAVNKVFD  243

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-E  893
              F+E+I+D+H    QS  +++TKDF D ML+ M S E++++  R +IK  +SD+  AS +
Sbjct  244   DFYEKIIDEHL---QSMDAERTKDFTDAMLAYMGSEESDYRIERLNIKAMMSDMLVASAD  300

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
               +  + W +SEL+RHP++MKKVQ+E+K+ +GL+RMVEESD E L+YL+MVVKE++RLHP
Sbjct  301   TSSTTVLWALSELMRHPQVMKKVQKEIKNVVGLNRMVEESDTEKLEYLDMVVKETMRLHP  360

Query  712   VAPLIPNEAR-EDCMIEGFHIPKK  644
             V PL+   A  EDC ++G+HIPKK
Sbjct  361   VLPLLLPHAAIEDCTVDGYHIPKK  384


 Score =   168 bits (426),  Expect(2) = 2e-133, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+I+NVWAI  DP+ W + EKF+PERFE SN+D RG HF+++PFGSGRR C G+QLG
Sbjct  383  KKSRVIVNVWAIGRDPSAWEDAEKFVPERFEDSNVDVRGHHFQILPFGSGRRRCVGMQLG  442

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            IT+V  V+AQL+HCFDWE P++M   ELDM E+FGL VSRA +L+ IP YRL 
Sbjct  443  ITVVHFVLAQLVHCFDWELPDNMLPNELDMAEEFGLAVSRAKNLLAIPLYRLQ  495



>ref|XP_009372727.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   340 bits (872),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 243/324 (75%), Gaps = 5/324 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM+LR GL + +V S+ +AAELFLKTHDL FASRPP E AK++ +GQ +LS   YG YW 
Sbjct  64    IMYLRLGLQHTVVVSTARAAELFLKTHDLNFASRPPNEGAKHLIFGQKSLSFAEYGSYWT  123

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             NMRKLC LELLSN KINSF++MRREE+  LI+S+++ A +R   +L+ KV  L  D++CR
Sbjct  124   NMRKLCMLELLSNQKINSFKSMRREEVALLIKSVQEDANNRRIANLTDKVMSLGIDMTCR  183

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MVFGKKY+ ++   RG   V+KE + L G  N GD+FP ++ LDLQGLT++MKA+ K +D
Sbjct  184   MVFGKKYKDEEFGGRGIVSVMKEGLKLAGAPNWGDFFPCIAPLDLQGLTKKMKAVNKVFD  243

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-E  893
              F+E+I+D+H    QS  +++TKDF+D ML+ M S E++++  R +IK  +SD+  AS +
Sbjct  244   DFYEKIIDEHL---QSKDAERTKDFIDAMLAYMGSEESDYRIERLNIKAMMSDMLVASAD  300

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
               +  + W +SEL+RHP++MKKVQ+E+K+ +GL+RMVEESD E L+YL+MVVKE++RLHP
Sbjct  301   TSSTTVLWALSELMRHPQVMKKVQKEIKNVVGLNRMVEESDTEKLEYLDMVVKETMRLHP  360

Query  712   VAPLIPNEAR-EDCMIEGFHIPKK  644
             V PL+   A  EDC ++G+HIPKK
Sbjct  361   VLPLLLPHAAIEDCTVDGYHIPKK  384


 Score =   164 bits (416),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+I+NVWAI  DP+ W + EKF+PERFE SN+D RG HF+++PFGSGRR C G+QLG
Sbjct  383  KKSRVIVNVWAIGRDPSAWEDAEKFVPERFEDSNVDVRGHHFQILPFGSGRRRCVGMQLG  442

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIP  325
            IT+V  V+AQL+HCFDWE P++M   ELDMTE+FGL VSRA +L+ IP
Sbjct  443  ITVVHFVLAQLVHCFDWELPDNMLPNELDMTEEFGLAVSRAKNLLAIP  490



>ref|XP_008344234.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=496

 Score =   337 bits (864),  Expect(2) = 5e-133, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 240/324 (74%), Gaps = 5/324 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM+LR GL   +V SS +AAELFLKTHDL FASRPP E AK++ +GQ +LS   YG YW 
Sbjct  64    IMYLRLGLQYTVVVSSARAAELFLKTHDLNFASRPPNEGAKHLIFGQKSLSFAEYGSYWT  123

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             NMRK+C LELLSN KINSF++MRREE+  LI+S+++   +R   +L+ KV  L  D++CR
Sbjct  124   NMRKICMLELLSNQKINSFKSMRREEVALLIKSVQEDTNNRRIANLTDKVMSLGIDMTCR  183

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MVFGKKY+ ++   RG   V+KE + L    NLGD+FP ++ LDLQGLT++MKA+ K +D
Sbjct  184   MVFGKKYKDEEFGGRGIVSVMKEGLKLAAAPNLGDFFPCIAPLDLQGLTKKMKAVNKVFD  243

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-E  893
              F+E+I+D H QS     +++TKDF D MLS M S E++++  R +IK  +SD+  AS +
Sbjct  244   DFYEKIIDKHLQSKD---AERTKDFTDAMLSYMGSEESDYRIERLNIKAMMSDMLVASAD  300

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
               +  + W++SEL+RHP++MKKVQ+EL++ +GL+RMVEESD E L+YL+MVVKE++RLHP
Sbjct  301   TSSTTVLWVLSELMRHPQVMKKVQKELENVVGLNRMVEESDTEKLEYLDMVVKETMRLHP  360

Query  712   VAPLIPNEAR-EDCMIEGFHIPKK  644
             V PL+   A  EDC ++G+HIPKK
Sbjct  361   VLPLLLPHAAIEDCTVDGYHIPKK  384


 Score =   167 bits (423),  Expect(2) = 5e-133, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 90/113 (80%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKS +I+NVWAI  DP  W + EKF+PERFE SN+D RG HF+++PFGSGRR C G+QLG
Sbjct  383  KKSSVIVNVWAIGRDPIAWGDAEKFVPERFEDSNVDVRGHHFQILPFGSGRRRCIGMQLG  442

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            IT+V  V AQL+HCFDWE P++M   ELDMTE+FGL VSRA +L+ IP+YRL 
Sbjct  443  ITVVHFVSAQLVHCFDWELPDNMLPNELDMTEEFGLAVSRAKNLLAIPSYRLQ  495



>ref|XP_006348217.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
 ref|XP_006354706.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=492

 Score =   340 bits (873),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 171/324 (53%), Positives = 225/324 (69%), Gaps = 5/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM + FGL   I+ASSP AA+ FLK HD +FASRP   A  YI Y Q NL    YGPYW
Sbjct  60    PIMTIYFGLVPTIIASSPHAAQQFLKNHDQIFASRPYHAACYYIFYKQRNLIMGKYGPYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRKLCT +LLSN+KINSFQ+MR++EL  L+  L++AA +R  VDLS+K++ L A+++C
Sbjct  120   RHMRKLCTQQLLSNVKINSFQSMRKQELQILVNFLEKAASNRDVVDLSAKLASLSANMAC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MV GKKY   D D   F+ ++KE   +    NL + FPFL  +D QG   RMK +AK+ 
Sbjct  180   LMVIGKKYNNVDGD---FKDMVKETSRMAATPNLAELFPFLRFIDFQGSIHRMKQIAKSC  236

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F E ++D+H +   S  S  + D VDT++ IM+SGEAEF+F+R H+K  L DL  AS 
Sbjct  237   DEFLENVIDEHARQYSSDQSKTSTDMVDTLMEIMQSGEAEFEFDRRHVKAILLDLLVASM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  IEWI+SEL RHP +MKK+Q EL   +G   +VEE DLE+L YL MV+KE  RLH
Sbjct  297   DTSSTSIEWILSELFRHPNVMKKLQSELDYVVGQKGIVEEKDLENLDYLNMVIKEGFRLH  356

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP L+P+E+ EDC ++GFHIPK
Sbjct  357   PVAPLLLPHESIEDCTLDGFHIPK  380


 Score =   163 bits (413),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 74/116 (64%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+++NVWAI  DP+VW  PEKFIPERF  S ID RG++F+L+PFGSGRR CPG
Sbjct  376  FHIPKGSRVLVNVWAIGRDPDVWHEPEKFIPERFVESTIDVRGQNFQLLPFGSGRRSCPG  435

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LQLG+T+VRLVVAQL+H FDWEFPN M   +++MTE+FGL+ +RA  L+ IP YR+
Sbjct  436  LQLGLTIVRLVVAQLVHSFDWEFPNGMMSCDINMTEKFGLVTARALSLMAIPIYRV  491



>ref|XP_009372726.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   338 bits (867),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 242/324 (75%), Gaps = 5/324 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM+LR GL + +V SS +AAELFLKTHDL FA+RPP E AK++ +GQ +LS   YG YW 
Sbjct  64    IMYLRLGLQHTVVVSSARAAELFLKTHDLNFANRPPNEGAKHLIFGQKSLSFAEYGSYWT  123

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             NMRKLC LELLSN KINSF++MRREE+  LI+S+++ A +R   +L+ KV  L  D++CR
Sbjct  124   NMRKLCMLELLSNQKINSFKSMRREEVALLIKSVQEDANNRRIANLTDKVMSLGIDMTCR  183

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MVFGKKY+ ++   RG   V+KE + L G  N GD+FP ++ LDLQGLT++MKA+ K +D
Sbjct  184   MVFGKKYKDEEFGGRGIVSVMKEGLKLAGAPNWGDFFPCIAPLDLQGLTKKMKAVNKVFD  243

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-E  893
              F+E+I+D+H    QS  +++TKDF D ML+ M S E++++  R +IK  +SD+  AS +
Sbjct  244   DFYEKIIDEHL---QSMDAERTKDFTDAMLAYMGSEESDYRIERLNIKAMMSDMLVASAD  300

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
               +  + W +SEL+RHP++MKKVQ+E+K+ +GL+RMVEESD E L+YL+MVVKE++RLHP
Sbjct  301   TSSTTVLWALSELMRHPQVMKKVQKEIKNVVGLNRMVEESDTEKLEYLDMVVKETMRLHP  360

Query  712   VAPLIPNEAR-EDCMIEGFHIPKK  644
             V PL+   A  EDC ++G+HIPKK
Sbjct  361   VLPLLLPHAAIEDCTVDGYHIPKK  384


 Score =   165 bits (417),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+I+NVWAI  DP+ W + EKF+PERFE SN+D RG HF+++PFGSGRR C G+QLG
Sbjct  383  KKSRVIVNVWAIGRDPSAWEDAEKFVPERFEDSNVDVRGHHFQILPFGSGRRRCVGMQLG  442

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIP  325
            IT+V  V+AQL+HCFDWE P++M   ELDMTE+FGL VSRA +L+ IP
Sbjct  443  ITVVHFVLAQLVHCFDWELPDNMLPNELDMTEEFGLAVSRAKNLLAIP  490



>ref|XP_004153471.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
 ref|XP_004162314.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=497

 Score =   340 bits (871),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 174/326 (53%), Positives = 233/326 (71%), Gaps = 6/326 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH++ GL   I+ SSP+AAELFLKTHDLVFASRP  EA+K ++YGQ NL   PYGPYW
Sbjct  63    PIMHIKLGLVPTIIVSSPKAAELFLKTHDLVFASRPLLEASKQMNYGQKNLVFAPYGPYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLSNLKINSF  MR+ EL  LIE LK+ A ++  V+LS+KV+ L  D+ C
Sbjct  123   RNMRKMCTLELLSNLKINSFMPMRKHELGLLIEYLKEVAHNKAVVNLSAKVTSLTTDLIC  182

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M FGKKY  +++DERGF+  ++E   L    NLGD+FPF++  D+Q L  RM+ + K  
Sbjct  183   LMAFGKKYGDEEIDERGFKATIQEGSQLAATPNLGDFFPFIARFDVQRLNNRMQCVHKVL  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMK-SGEAEFQFNREHIKPTLSDLFGAS  896
             D F ERI+++H    ++    +TKD VD ML +M    E ++Q +R  IK  + D+  A 
Sbjct  243   DGFLERIVNEHL---EAKGDKKTKDLVDVMLELMNFQEETDYQIDRSAIKAIMLDMLSAG  299

Query  895   -EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLR-  722
              +    +I W MSEL++HP IMKK+QEEL+++IGLD++VEESDLE L+YL+MVVKE  R 
Sbjct  300   MDTSATVIGWAMSELIKHPHIMKKLQEELENEIGLDKIVEESDLERLEYLKMVVKEIFRL  359

Query  721   LHPVAPLIPNEAREDCMIEGFHIPKK  644
               P   L+P+E+ +DC+++GFHIPKK
Sbjct  360   YPPAPLLLPHESLQDCIVDGFHIPKK  385


 Score =   163 bits (412),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 88/118 (75%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSRIIINVWAI  D N W +P KF PERF  S +D +GR F+LIPFGSGRR CPG
Sbjct  380  FHIPKKSRIIINVWAIGRDRNSWIDPHKFDPERFIDSQVDVKGRDFQLIPFGSGRRGCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            +QLG+TLV+ V+AQL+HCFDW   N MP  +LDMTE+FGL   R + LIVIP YRL I
Sbjct  440  MQLGLTLVQFVLAQLVHCFDWMLSNGMPASQLDMTEEFGLTCPRLHDLIVIPRYRLRI  497



>gb|EYU31074.1| hypothetical protein MIMGU_mgv1a005121mg [Erythranthe guttata]
Length=496

 Score =   332 bits (852),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 169/326 (52%), Positives = 222/326 (68%), Gaps = 6/326 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM+LRFG    +V SSP  AEL LKTHDLVFA R   +AAK+ISY   N+    YG YW
Sbjct  60    PIMYLRFGFVPTVVFSSPAGAELVLKTHDLVFAGRASNQAAKHISYDGRNIVFAQYGSYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRKL TL LLS  K++ FQ +R+ EL   ++SL++AA  R  VD+S  +   I D+ C
Sbjct  120   RDMRKLATLNLLSTSKVSQFQPVRKAELRLAVDSLRRAAAGRETVDVSEMIMGTIGDMVC  179

Query  1252  RMVFGKKYE--MKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAK  1079
              MVFG+K+          GF+ V+ E   +  K NLGD+FP++ T+DLQGLTRRMK L+ 
Sbjct  180   LMVFGRKFAGGELGGSGGGFKYVIDETFQVAAKPNLGDFFPYMGTIDLQGLTRRMKELST  239

Query  1078  TYDKFFERILDDHE-QSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LF  905
             T+D F E+I+DDH  Q+ Q    +Q  DFVDTM++IM SGEA F+F+R H+K  L D L 
Sbjct  240   TFDGFLEKIIDDHVLQNKQQKKENQ--DFVDTMMAIMDSGEAGFEFDRRHVKAVLLDMLL  297

Query  904   GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESL  725
             G ++  +  I+W ++EL+RHP+IMKK+Q+EL+  +GLD+ VEES LE L YL  VVKE+ 
Sbjct  298   GGTDTSSATIDWALAELIRHPQIMKKLQQELEQVVGLDQYVEESHLEKLDYLNFVVKETF  357

Query  724   RLHPVAPLIPNEAREDCMIEGFHIPK  647
             RLHPV PL  +EA EDC +E FHI K
Sbjct  358   RLHPVVPLFIHEALEDCTVEEFHIAK  383


 Score =   168 bits (426),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 73/117 (62%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K +RI++NVW+++ DPNVW +PEKF PERF GSN+D  G  FEL+PFGSGRR CPG
Sbjct  379  FHIAKGTRIMVNVWSMSKDPNVWQDPEKFFPERFIGSNLDLHGHDFELLPFGSGRRSCPG  438

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            LQLG+T VRLV+AQL+HCFDWE PN M   ELDM+E FGL+  +  H++ IP  RLH
Sbjct  439  LQLGLTTVRLVLAQLVHCFDWELPNGMSPSELDMSEHFGLVTGKDKHIMAIPVCRLH  495



>ref|XP_009372725.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Pyrus x bretschneideri]
Length=490

 Score =   339 bits (869),  Expect(2) = 3e-131, Method: Compositional matrix adjust.
 Identities = 174/324 (54%), Positives = 243/324 (75%), Gaps = 5/324 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM+LR GL + +V SS +AAELFLKTHDL FA+RPP E AK++ +GQ +LS   YG YW 
Sbjct  64    IMYLRLGLQHTVVVSSARAAELFLKTHDLNFANRPPNEGAKHLIFGQKSLSFAEYGSYWT  123

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             NMRKLC LELLSN KINSF++MRREE+  LI+S+++ A +R   +L+ KV  L  D++CR
Sbjct  124   NMRKLCMLELLSNQKINSFKSMRREEVALLIKSVQEDANNRRIANLTDKVMSLGIDMTCR  183

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MVFGKKY+ ++   RG   V+KE + L G  NLGD+FP ++ LDLQGLT++MKA+ K +D
Sbjct  184   MVFGKKYKDEEFGGRGIVSVMKEGLKLAGAPNLGDFFPCIAPLDLQGLTKKMKAVNKEFD  243

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-E  893
              F+E+I+D+H    QS  +++TKDF+D ML+ M S E++++  R +IK  +SD+  AS +
Sbjct  244   DFYEKIIDEHL---QSKDAERTKDFIDAMLAYMGSEESDYRIERLNIKAMMSDMLVASAD  300

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
               +  + W +S L+RHP++MKKVQ+E+K+ +GL+RMVEESD E L+YL+MVVKE++RLHP
Sbjct  301   TSSTTVLWALSGLMRHPQVMKKVQKEIKNVVGLNRMVEESDTEKLEYLDMVVKETMRLHP  360

Query  712   VAPLIPNEAR-EDCMIEGFHIPKK  644
             V PL+   A  EDC ++G+HIPKK
Sbjct  361   VLPLLLPHAAIEDCTVDGYHIPKK  384


 Score =   159 bits (402),  Expect(2) = 3e-131, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 88/108 (81%), Gaps = 0/108 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+I+NVWAI  DP+VW + EKF+PERFE SN+D RG HF+++PFGSGRR C G+QLG
Sbjct  383  KKSRVIVNVWAIGRDPSVWEDAEKFVPERFEDSNVDVRGHHFQILPFGSGRRRCVGMQLG  442

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIP  325
            IT+V  V+AQL+H FDWE P++M   ELDMT +FGL VSRA +L+ IP
Sbjct  443  ITVVHFVLAQLVHWFDWELPDNMLPNELDMTAEFGLAVSRAKNLLAIP  490



>ref|XP_004143571.1| PREDICTED: cytochrome P450 71A1-like, partial [Cucumis sativus]
Length=414

 Score =   330 bits (846),  Expect(2) = 5e-131, Method: Compositional matrix adjust.
 Identities = 163/305 (53%), Positives = 222/305 (73%), Gaps = 9/305 (3%)
 Frame = -2

Query  1540  LKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWRNMRKLCTLELLSNLKINSFQAMR  1361
             LKTHD VFASRP  +A+KY++YGQ NL+   YGPYWRN+RK+CTLELLS++K+ SF++MR
Sbjct  1     LKTHDTVFASRPFVQASKYMAYGQKNLAFSQYGPYWRNLRKMCTLELLSSVKVKSFRSMR  60

Query  1360  REELCYLIESLKQAALDRVAVDLSSKVSELIADISCRMVFGKKYEMKDLDERGFRGVLKE  1181
              EEL   ++ L+ AA  RV V+LSSK+  L  D++C MVFGKKY+ ++ DERGF+ V++E
Sbjct  61    MEELGLFVDYLRDAARKRVIVNLSSKICSLNTDMTCLMVFGKKYKDQEFDERGFKSVIQE  120

Query  1180  EMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYDKFFERILDDHEQSGQSGSSDQTK  1001
              M +    NLGD+ P ++ LDLQGL RR KA++K +D+FFERI+D+H +S      ++TK
Sbjct  121   AMQIVASPNLGDFIPQIAVLDLQGLDRRSKAVSKIFDEFFERIIDEHLESRY---ENKTK  177

Query  1000  DFVDTMLSIMKSGEAEFQFNR-----EHIKPTLSDLFGASEAITILIEWIMSELLRHPEI  836
             DFVD ML IM S   E+Q  R       I  T+  L  A +     I W + EL++HP +
Sbjct  178   DFVDVMLEIMDSHGTEYQIERSIKESRRIWLTVDMLVAAMDTSATTIGWAIPELIKHPHV  237

Query  835   MKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHPVAP-LIPNEAREDCMIEGF  659
             MKK+Q+EL+  +GLDR VEE+DL+ L+YL+MVVKE LRLHP AP L+P+EA EDC+++GF
Sbjct  238   MKKMQDELQKVVGLDRKVEETDLDHLQYLDMVVKEILRLHPPAPLLVPHEALEDCIVDGF  297

Query  658   HIPKK  644
             +IPKK
Sbjct  298   YIPKK  302


 Score =   167 bits (423),  Expect(2) = 5e-131, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSRII+N WAI  DPN W +PEKF PERF GS +D RG+ F+LIPFGSGRR CPG
Sbjct  297  FYIPKKSRIIVNGWAIGRDPNFWIDPEKFFPERFIGSQVDVRGKDFQLIPFGSGRRGCPG  356

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +Q+G+T+VRLV+AQL+HCFDWE PN     ELDMTE+FGL   RA  L+V P YRL+
Sbjct  357  MQMGLTVVRLVIAQLVHCFDWELPNGTLPVELDMTEEFGLTCPRAQDLMVTPIYRLN  413



>gb|EYU31073.1| hypothetical protein MIMGU_mgv1a004944mg [Erythranthe guttata]
Length=503

 Score =   340 bits (873),  Expect(2) = 7e-131, Method: Compositional matrix adjust.
 Identities = 156/324 (48%), Positives = 227/324 (70%), Gaps = 2/324 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR G    +V SSP  AELFLKTHDLVFA RP  +AAK++ Y   +++   YG YW
Sbjct  67    PIMHLRLGFLPTVVVSSPAGAELFLKTHDLVFAGRPLHQAAKHMVYDGRDIAFGQYGSYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL LLS+ KIN F+  R+ EL   + S ++AA  R A+D+S  ++ L  D+ C
Sbjct  127   RDIRKLCTLNLLSSHKINQFRHTRKAELSLFVGSFRRAACQREALDVSKMITGLSWDMIC  186

Query  1252  RMVFGKKYEMKDLDE-RGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
               VFG+K+   DLDE +GF+ V++E + L    NLGD+FP++  LDLQGLTRRMK +  +
Sbjct  187   MTVFGRKFADSDLDETKGFKSVIEEILQLVAIPNLGDFFPYVGWLDLQGLTRRMKQVHNS  246

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGA  899
             +D F E++++DH  + Q  +    +DFVDTM++IM SGEA F  +R H+K  L+D L G 
Sbjct  247   FDGFLEKVIEDHGSNNQENTKKDARDFVDTMMAIMDSGEAGFDLDRRHVKAVLADMLIGG  306

Query  898   SEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
             ++   +  +W ++EL+RHP+IM K+Q+EL+  +G+++ VEES LE L YL++V+KE+ RL
Sbjct  307   TDTTAVTTDWALAELIRHPQIMNKLQQELEQVVGMEQYVEESHLEKLDYLDLVIKETFRL  366

Query  718   HPVAPLIPNEAREDCMIEGFHIPK  647
             HP+ PL+ ++A +DC ++ FHIPK
Sbjct  367   HPIVPLLNHKAMQDCTVDEFHIPK  390


 Score =   156 bits (395),  Expect(2) = 7e-131, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 86/117 (74%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K +R+I+N+ +I+ DPNVW  PEKF PERF G + DYRG  F  IPFGSGRR+CPG
Sbjct  386  FHIPKGTRVIVNLLSISRDPNVWQEPEKFSPERFVGIDTDYRGMDFRFIPFGSGRRMCPG  445

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            + LG+T +RL++AQL+HCFDWE PN     EL+M E FGL+ SR  HL+ IP YRLH
Sbjct  446  IHLGLTSLRLMLAQLIHCFDWELPNGTSPNELNMAEHFGLVTSRDEHLMAIPIYRLH  502



>gb|EYU31075.1| hypothetical protein MIMGU_mgv1a005090mg [Erythranthe guttata]
Length=497

 Score =   335 bits (859),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 170/325 (52%), Positives = 224/325 (69%), Gaps = 5/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM+LRFG    +V SSP  AEL LKTHDLVFA RP  +AAK+ISY   N+    YG YW
Sbjct  62    PIMYLRFGFVPTVVFSSPAGAELVLKTHDLVFAGRPSIQAAKHISYDGRNIVFAQYGSYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRKL T+ LLS+ KI+ FQ +R+ EL   ++SL++AA  R  VD+S  +   I D+ C
Sbjct  122   RDMRKLATINLLSSSKISQFQPVRKAELRLAVDSLRRAAAGRETVDVSEMIMGTIGDMVC  181

Query  1252  RMVFGKKYE-MKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
              MVFG+K+         GF+ V+ E   +  K NLGD+FP++ T+DLQGLTRRMK L+ T
Sbjct  182   LMVFGRKFAGGGLGGSGGFKSVIDETFQVAAKPNLGDFFPYMGTIDLQGLTRRMKELSTT  241

Query  1075  YDKFFERILDDHE-QSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFG  902
             +D F E+I+DDH  Q+ Q    +Q  DFVDTM++IM SGEA F+F+R H+K  L D L G
Sbjct  242   FDGFLEKIIDDHVLQNKQQKKENQ--DFVDTMMAIMDSGEAGFEFDRRHVKAVLLDMLLG  299

Query  901   ASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLR  722
              ++  +  I+W ++EL+RHP+IMKK+Q+EL+  +GLD+ VEES LE L YL  VVKE+ R
Sbjct  300   GTDTSSATIDWALAELIRHPQIMKKLQQELEQVVGLDQYVEESHLEKLDYLNFVVKETFR  359

Query  721   LHPVAPLIPNEAREDCMIEGFHIPK  647
             LHPV PL  +EA EDC +E FHI K
Sbjct  360   LHPVVPLFIHEALEDCTVEEFHIAK  384


 Score =   160 bits (404),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 88/116 (76%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K +RI++NVW+++ DPNVW +PEKF PERF GS++D  G  FEL+PFGSGRR CPG
Sbjct  380  FHIAKGTRIMVNVWSMSKDPNVWQDPEKFFPERFIGSDLDLLGHDFELLPFGSGRRSCPG  439

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LQLG+T VRLV+AQL+HCFDWE  N M   ELDM+E FGL+  +  H++ IP  RL
Sbjct  440  LQLGLTTVRLVLAQLVHCFDWELTNGMSPNELDMSEHFGLVTGKDKHIMAIPVCRL  495



>ref|XP_004153472.1| PREDICTED: cytochrome P450 71B13-like [Cucumis sativus]
 ref|XP_004162329.1| PREDICTED: cytochrome P450 71B13-like [Cucumis sativus]
 gb|KGN48795.1| hypothetical protein Csa_6G501350 [Cucumis sativus]
Length=498

 Score =   340 bits (873),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 168/327 (51%), Positives = 234/327 (72%), Gaps = 7/327 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH++ GL + I+ SSP AA+LFLKTHD VFASRP    +  ++YG+ +L   PYG YW
Sbjct  63    PIMHMKLGLVHTIIVSSPHAAKLFLKTHDHVFASRPLIHTSSIMTYGKKDLVFAPYGSYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLEL S+LKINSF++MR++E+  LIE LK A+ DR+ V LSSKV+ LIAD++C
Sbjct  123   RNIRKMCTLELFSSLKINSFKSMRKKEVRELIEYLKTASTDRMVVRLSSKVTSLIADMTC  182

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M FGKKY  ++  ERGF+ V++E M L    NL DY PF++  D+QGL RR   + K +
Sbjct  183   LMAFGKKYRDEEFGERGFKAVIQEGMQLVIAPNLADYIPFVAPFDIQGLNRRATFVLKEF  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAE--FQFNREHIKPTLSDLFGA  899
             D FFERI+++H +S      ++ KDF+D +L IM S +    +Q +R +IK    D+  A
Sbjct  243   DGFFERIIEEHIESKD---GNRNKDFMDHLLDIMMSSQDPDGYQIDRSNIKAIALDVLSA  299

Query  898   S-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLR  722
             + +     I+W ++EL++HP+ MK++Q EL+  +GL+RMVEES LE L+YL MV+KE LR
Sbjct  300   AMDTSATAIDWALAELIKHPQAMKELQVELEKVVGLNRMVEESHLEHLQYLGMVIKEVLR  359

Query  721   LHPVAP-LIPNEAREDCMIEGFHIPKK  644
             LHP AP L+P+E+ EDC ++GFHIPKK
Sbjct  360   LHPPAPLLVPHESLEDCTVDGFHIPKK  386


 Score =   154 bits (389),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   KKSRI +N W+I  DPNVW +P+KF PERF  S  D +GR F LIPFGSGRR CPG
Sbjct  381  FHIPKKSRIFVNAWSIGQDPNVWIDPQKFFPERFIHSLADVKGRDFHLIPFGSGRRSCPG  440

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            + LG+ +V LVVA L+HCFDWE PN M   +LDM E+FGL   RA  L++IP YRL
Sbjct  441  IHLGLLIVSLVVANLVHCFDWELPNCMLATDLDMEEEFGLTCPRAQELMLIPTYRL  496



>gb|EYU24031.1| hypothetical protein MIMGU_mgv1a004909mg [Erythranthe guttata]
Length=505

 Score =   397 bits (1020),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 195/337 (58%), Positives = 256/337 (76%), Gaps = 10/337 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PI+ +RFG    IV SS ++AELFLKTHDLVFASRPP +AA+ +S+GQ NLS   YGPYW
Sbjct  66    PIVFMRFGWVPHIVVSSNKSAELFLKTHDLVFASRPPHQAAEIMSWGQKNLSFGKYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRKLCTLELLS LKINSFQ MR+EEL   +ESLK +   + AVDLS+K+S L A++SC
Sbjct  126   RSMRKLCTLELLSTLKINSFQPMRKEELGLFVESLKLSCRGKAAVDLSAKISSLTAEMSC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKYE KD+  RGF+ V++E M L    NLGDYFPFL   DLQG   +MK +AK Y
Sbjct  186   RMVFGKKYEDKDMGGRGFKSVIEEGMKLAALPNLGDYFPFLGIFDLQGFKSKMKKIAKAY  245

Query  1072  DKFFERILDDHEQSGQSGSSD----QTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF  905
             D FFE+++D+H  +G + ++D    + +D VDT++SIM+SG+AEFQF+R H+K  + D+ 
Sbjct  246   DDFFEKVIDEH-VNGAAEAADRADGKARDIVDTLMSIMQSGDAEFQFDRGHVKAIMLDML  304

Query  904   GAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKES  728
              AS +     +EWI++ L+++P++MKKVQEEL+  +GL+RMVEESDL+ LKYL+MVVKE+
Sbjct  305   AASMDTAASTVEWILALLIKNPKVMKKVQEELEQVVGLERMVEESDLDQLKYLDMVVKET  364

Query  727   LRLHPVAP-LIPNEAREDCMIEGFHIPKK---ITNHH  629
              RLHPVAP LIP+ + EDC + G+HIPK+   I N H
Sbjct  365   FRLHPVAPLLIPHYSTEDCTVNGYHIPKESRVIVNTH  401


 Score =   164 bits (415),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            K+SR+I+N  AI  DPNVW  P +F PERF GS ID RG+HFEL+PFGSGRR CPG+QLG
Sbjct  392  KESRVIVNTHAIGRDPNVWARPNEFFPERFVGSEIDLRGQHFELLPFGSGRRGCPGMQLG  451

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +  VRL+V+QL+HCFDW+ P  M  EELDMTE+F L+VSRAN LI IP +RL
Sbjct  452  LIQVRLIVSQLVHCFDWKLPEGMLPEELDMTEEFSLVVSRANPLIAIPTFRL  503



>ref|XP_004237617.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=494

 Score =   324 bits (831),  Expect(2) = 4e-128, Method: Compositional matrix adjust.
 Identities = 164/324 (51%), Positives = 224/324 (69%), Gaps = 5/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM + FGL   IVASSP AA+ FLK HD +FASRP   A  YI Y Q NL    YGPYW
Sbjct  60    PIMTIYFGLIPTIVASSPYAAQQFLKDHDQIFASRPYHAACYYIFYKQRNLIMGKYGPYW  119

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRKLCTL+LL+N+KINSFQ+MR++E+  L+  L +AA +R  VDLS+K++ L A+++C
Sbjct  120   RHMRKLCTLQLLNNVKINSFQSMRKQEVQILVNFLIKAASNRDVVDLSAKLASLSANMAC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MV GKKY   D D   F+ ++++   +    NL + FPFL  +D QG   RMK +A++ 
Sbjct  180   LMVIGKKYNNVDGD---FKDMIQQTSHMAATPNLAELFPFLRFIDFQGSVLRMKQIAESC  236

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F E ++D+H +   S  S  + D VDT++ IM+SGEAEF+F+R H+K  L DL  AS 
Sbjct  237   DEFLENVIDEHTRQYSSDQSKTSIDMVDTLMEIMQSGEAEFEFDRRHVKAILLDLLVASM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +  +  IEWI+SELL+HP +MKK+Q EL +      +VEE DL++L YL MV+KE  RLH
Sbjct  297   DTSSTSIEWILSELLKHPNVMKKLQSELDNVFDQKGIVEEKDLKNLDYLNMVIKEGFRLH  356

Query  715   PVAP-LIPNEAREDCMIEGFHIPK  647
             PVAP L+P+E+ EDC ++GF +PK
Sbjct  357   PVAPLLLPHESIEDCTLDGFQMPK  380


 Score =   164 bits (414),  Expect(2) = 4e-128, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+++NVWAI  DP+VW  PEKFIPERF  S ID RG++F+L+PFGSGRR CPG
Sbjct  376  FQMPKGSRVLVNVWAIGRDPDVWREPEKFIPERFVESTIDVRGQNFQLLPFGSGRRSCPG  435

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            LQLG+T+V LVVAQL+H FDWE PN M   +++MTE+FGL+ +RA  L+ IP YRLH
Sbjct  436  LQLGLTIVHLVVAQLVHSFDWELPNGMMPNDINMTEKFGLVTARALPLMAIPIYRLH  492



>ref|XP_002275826.1| PREDICTED: cytochrome P450 CYP736A12 [Vitis vinifera]
Length=506

 Score =   325 bits (834),  Expect(2) = 4e-128, Method: Compositional matrix adjust.
 Identities = 164/330 (50%), Positives = 225/330 (68%), Gaps = 11/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+AAELFLKTHD VFASRP  +A++Y+ YG+  ++   YGPYW
Sbjct  66    PIMSMRLGYVPTIVVSSPEAAELFLKTHDAVFASRPKIQASEYLCYGRKGMAFTEYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN RKLCTLELL+ +KI+SF AMR+EEL  L++SLKQ A  R  V++S KV ELI D++ 
Sbjct  126   RNARKLCTLELLTKVKIDSFAAMRKEELGVLVQSLKQMAAAREVVNISKKVGELIEDMTH  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+FG+    KD      + +++E + L G  N+ DY PFL  LDLQGL RRMKA++   
Sbjct  186   RMLFGR---CKDYQRADLKALVQETLILVGAFNIADYVPFLGALDLQGLKRRMKAISGAV  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMK-----SGEAEFQFNREHIKPTLSD-  911
             D   E+++D+H+Q       +  KDFVD MLS+M        E  +   +E+IK  + D 
Sbjct  243   DHILEKVIDEHKQDASENQGNH-KDFVDVMLSLMNEMKNFHQEPSYLIEQENIKGIVWDI  301

Query  910   LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
             + GA +     IEW++SEL RHP +M+++QEEL++ IG++RMVEE DL +L YL+MV+KE
Sbjct  302   IIGAIDTSATTIEWLLSELFRHPRVMRQLQEELENVIGMERMVEEVDLANLVYLDMVLKE  361

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
              LRLHP  P L+P+E+ ED  + G++IPKK
Sbjct  362   GLRLHPAGPLLLPHESIEDITLNGYYIPKK  391


 Score =   162 bits (409),  Expect(2) = 4e-128, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNP-EKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSRIIIN WAI  DPN+W+N  E F PERF GSNID++G+ F+ IPFGSGRR CPG+QL
Sbjct  390  KKSRIIINAWAIGRDPNIWSNNVEDFFPERFIGSNIDFQGKDFQFIPFGSGRRKCPGMQL  449

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  VRLV+AQL+HCFDW+ PN M   ELDM+E+FGL + RA HL  +P YRL
Sbjct  450  GLINVRLVLAQLVHCFDWKLPNGMLPSELDMSEEFGLALPRATHLHALPTYRL  502



>ref|XP_010041191.1| PREDICTED: cytochrome P450 CYP736A12-like, partial [Eucalyptus 
grandis]
Length=400

 Score =   390 bits (1003),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 244/325 (75%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M+LR G    I+ SSP+ AE FLKTHDL+FASRPP EAAK+ISY Q +L+  PYGPYW
Sbjct  63    PLMYLRLGFVPTILISSPEVAEQFLKTHDLIFASRPPHEAAKHISYEQRSLAFAPYGPYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KI SF++MRR+E+  L+  LK A+ D +A+DLS+K+S L AD+SC
Sbjct  123   RNIRKMCTLELLSNAKIYSFKSMRRDEVGLLVNFLKDASRDHMAIDLSAKISSLSADMSC  182

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  ++ DERGF+ V++E M L    N+GDY PFL++ DLQGLT+RMKA+++ +
Sbjct  183   LMVFGKKYMDREFDERGFKAVVQEVMVLTATPNIGDYVPFLASFDLQGLTKRMKAVSRVF  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FFE+I+D+H ++ +     QTKDFVD ML IM   E E+  +R HIK  + D+  G+ 
Sbjct  243   DAFFEKIIDEHLETKK--EEGQTKDFVDVMLGIMGLNEGEYHIDRPHIKAIILDMLAGSM  300

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW M+EL++HP  MKK+QEEL+   GL+R VEESDLE L YL MV+KE++RLH
Sbjct  301   DTSATAIEWAMAELIKHPRAMKKLQEELEKAAGLNRAVEESDLEGLDYLHMVIKETMRLH  360

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP L+P+EA EDC + GFHIP K
Sbjct  361   PVAPLLLPHEATEDCTVNGFHIPYK  385



>gb|KDP20096.1| hypothetical protein JCGZ_05865 [Jatropha curcas]
Length=510

 Score =   315 bits (807),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 217/331 (66%), Gaps = 13/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    IV SS  AA+LFLKTHD VF SRP   A++Y+SYG   ++   YGPYW
Sbjct  73    PIMSLRLGYVQTIVVSSANAAKLFLKTHDAVFGSRPKLRASRYMSYGTKGMAFTEYGPYW  132

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCT++LLS  KI  F  +R+EEL + +ESLK+AA  R  VD S  V ++I +I+C
Sbjct  133   RSVRKLCTVQLLSASKIEYFAPIRKEELGFYVESLKRAAAARKVVDFSVGVGDMIQNIAC  192

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFG +    +LD    + ++KE + L G  N+ DY PFL  +DLQGLT+RMKA +K  
Sbjct  193   RMVFG-EVNNHELD---LKALVKEALLLAGAFNIADYIPFLGPIDLQGLTKRMKAFSKAM  248

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS------GEAEFQFNREHIKPTLSD  911
             DK  ERI+D+HE+        Q  DF+D +LS+M          A    +R HIK    D
Sbjct  249   DKVLERIIDEHEKEAY-WEKKQKSDFIDVLLSLMNQPMVTSHDNALSTIDRTHIKAISID  307

Query  910   -LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
              + G+ +     IEW +SELLRHP  MK +Q+EL+S +G+D MVEE  L  L YL+MV+K
Sbjct  308   MIIGSFDTSATTIEWTLSELLRHPHAMKCLQDELQSVVGMDNMVEEKHLSKLPYLDMVIK  367

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             ESLRLHP+AP L+P EA ED M++G++IPKK
Sbjct  368   ESLRLHPIAPLLVPREAMEDVMVDGYYIPKK  398


 Score =   167 bits (422),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 70/112 (63%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+I+N WAI  DP+ W++ EKF+PERF   NID RG+ F+LIPFGSGRR CPG+QLG
Sbjct  397  KKSRVIVNAWAIGRDPDAWSDTEKFLPERFIDMNIDLRGQDFQLIPFGSGRRGCPGIQLG  456

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +T++++++AQL+HCFDWE PN +   ELDM E+FGL + RANHL+V+P YRL
Sbjct  457  LTIIKIIIAQLVHCFDWELPNGLLPGELDMNEKFGLSLPRANHLLVVPKYRL  508



>ref|XP_004143572.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3',5'-hydroxylase 1-like 
[Cucumis sativus]
Length=500

 Score =   340 bits (873),  Expect(2) = 6e-126, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 235/323 (73%), Gaps = 5/323 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IMH++ GL N IV SS +AAELFLKTHDL FA+ PP +A K+IS+GQ ++     GPY R
Sbjct  68    IMHIKLGLVNTIVVSSSEAAELFLKTHDLDFANHPPNDALKHISFGQSSMVVAKDGPYVR  127

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             ++RK+CT +LL++ K+NSF++MR EE+   I+ L++AA   + V+L+SK+S L A++ C 
Sbjct  128   SVRKMCTQKLLNSHKLNSFKSMRMEEVGLFIQELREAARSGLLVNLTSKLSSLGANMICL  187

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
              VFG+KY+ K+LD +GF+ ++ E + + G VN+GD+ PF++ LDLQGL RR K++ K +D
Sbjct  188   TVFGRKYKDKELDAKGFKRMVGEALKVIGAVNVGDFIPFIAPLDLQGLIRRAKSVHKVFD  247

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGASE  893
             +F ERI+D+H +S  + S   TKDFVD ML IM+S + ++Q +R  IK  + D LF   +
Sbjct  248   RFLERIIDEHLESKNNNS---TKDFVDVMLEIMESQQTDYQIDRSTIKAIMLDLLFAGMD  304

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
               T  I W ++EL+RHPEIMKKVQ EL+  +GL RMV+ES+L  LKYLEMVVKE  RLHP
Sbjct  305   TTTTTIGWAIAELIRHPEIMKKVQNELEEVVGLKRMVQESELSHLKYLEMVVKEVFRLHP  364

Query  712   VAP-LIPNEAREDCMIEGFHIPK  647
              AP LIP++  +DC++  FHIPK
Sbjct  365   PAPLLIPHQPLKDCIVNNFHIPK  387


 Score =   140 bits (352),  Expect(2) = 6e-126, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+I+N WAI  DP  WT+  +F PERF GS +D +G HFELIPFGSGRR C G
Sbjct  383  FHIPKMSRVIVNAWAIGRDPCAWTDAHRFFPERFIGSKVDVKGNHFELIPFGSGRRGCVG  442

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +Q+G+  V  V+A LLHCFDW+ PN M   +LD TE+FG+    A+ ++V P YRL
Sbjct  443  IQMGLLKVHFVLAXLLHCFDWKLPNGMLPVDLDTTEEFGISCPLAHDVMVTPIYRL  498



>ref|XP_004172515.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3',5'-hydroxylase 1-like 
[Cucumis sativus]
Length=475

 Score =   340 bits (873),  Expect(2) = 7e-126, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 235/323 (73%), Gaps = 5/323 (2%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IMH++ GL N IV SS +AAELFLKTHDL FA+ PP +A K+IS+GQ ++     GPY R
Sbjct  43    IMHIKLGLVNTIVVSSSEAAELFLKTHDLDFANHPPNDALKHISFGQSSMVVAKDGPYVR  102

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             ++RK+CT +LL++ K+NSF++MR EE+   I+ L++AA   + V+L+SK+S L A++ C 
Sbjct  103   SVRKMCTQKLLNSHKLNSFKSMRMEEVGLFIQELREAARSGLLVNLTSKLSSLGANMICL  162

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
              VFG+KY+ K+LD +GF+ ++ E + + G VN+GD+ PF++ LDLQGL RR K++ K +D
Sbjct  163   TVFGRKYKDKELDAKGFKRMVGEALKVIGAVNVGDFIPFIAPLDLQGLIRRAKSVHKVFD  222

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGASE  893
             +F ERI+D+H +S  + S   TKDFVD ML IM+S + ++Q +R  IK  + D LF   +
Sbjct  223   RFLERIIDEHLESKNNNS---TKDFVDVMLEIMESQQTDYQIDRSTIKAIMLDLLFAGMD  279

Query  892   AITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHP  713
               T  I W ++EL+RHPEIMKKVQ EL+  +GL RMV+ES+L  LKYLEMVVKE  RLHP
Sbjct  280   TTTTTIGWAIAELIRHPEIMKKVQNELEEVVGLKRMVQESELSHLKYLEMVVKEVFRLHP  339

Query  712   VAP-LIPNEAREDCMIEGFHIPK  647
              AP LIP++  +DC++  FHIPK
Sbjct  340   PAPLLIPHQPLKDCIVNNFHIPK  362


 Score =   140 bits (352),  Expect(2) = 7e-126, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+I+N WAI  DP  WT+  +F PERF GS +D +G HFELIPFGSGRR C G
Sbjct  358  FHIPKMSRVIVNAWAIGRDPCAWTDAHRFFPERFIGSKVDVKGNHFELIPFGSGRRGCVG  417

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +Q+G+  V  V+A LLHCFDW+ PN M   +LD TE+FG+    A+ ++V P YRL
Sbjct  418  IQMGLLKVHFVLAXLLHCFDWKLPNGMLPVDLDTTEEFGISCPLAHDVMVTPIYRL  473



>ref|XP_009337209.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   327 bits (838),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 233/333 (70%), Gaps = 15/333 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+AAELFLKTHD +FASRP  +++K++SYG   ++   YGPYW
Sbjct  68    PIMSMRLGSKTTIVVSSPKAAELFLKTHDTIFASRPQVQSSKHMSYGTKAMAFSEYGPYW  127

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LLS  +I +F  +R+EE+  L++SLK AA     VDLS KVS+L+  I+ 
Sbjct  128   RHVRKLCTLQLLSPSRIEAFAPLRKEEVGLLVQSLKVAAEAGEVVDLSEKVSDLVVGITY  187

Query  1252  RMVFGKK-YEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             RMV G+K  EM DL     +G+++E M L G  N+ DY PFL  LDLQGLT+RMK ++KT
Sbjct  188   RMVLGRKNNEMFDL-----KGIIEEVMFLSGAFNISDYVPFLIPLDLQGLTKRMKRISKT  242

Query  1075  YDKFFERILDDHEQSGQSG--SSDQTKDFVDTMLSIMK-----SGEAEFQFNREHIKPTL  917
              D+ FE+I+ DHEQ  +S     +  KDFVD +LS++      + E  + F R + K  L
Sbjct  243   VDQLFEKIIQDHEQVSRSEQVQGNHHKDFVDVLLSLIHQPLNPNDEEVYMFERTNAKAIL  302

Query  916   SDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
              D+  G+ +     I W ++ELLRHPE+MK++Q+EL+S +G+DRMVEESDL  L YL MV
Sbjct  303   LDMISGSFDTSATAIVWTLAELLRHPEVMKRLQKELQSVVGVDRMVEESDLPKLDYLSMV  362

Query  739   VKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             VKE+LRLHPV P LIP+++ ED +++G+HIPKK
Sbjct  363   VKETLRLHPVGPLLIPHQSMEDVIVDGYHIPKK  395


 Score =   150 bits (380),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSR+ IN+W I  DPNVW+ N E+F PERF  SN+D +G  F+LIPFGSGRR CP +QL
Sbjct  394  KKSRVFINIWTIGRDPNVWSDNVEEFYPERFMNSNVDLQGHDFQLIPFGSGRRRCPAMQL  453

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VRL +  L+HCF+WE P  M  ++LDMTE+FGL +S+A HL+ +P +RL
Sbjct  454  GLTTVRLALGNLVHCFNWELPTGMLPKDLDMTEKFGLSLSKAKHLLAMPTHRL  506



>gb|KDP35215.1| hypothetical protein JCGZ_09374 [Jatropha curcas]
Length=499

 Score =   387 bits (995),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 193/337 (57%), Positives = 251/337 (74%), Gaps = 8/337 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PI HLR GL   IV SSP AAE FLKT+D+VFASRPP E+AKYISY Q NLS   YGPYW
Sbjct  66    PITHLRLGLVTTIVVSSPNAAESFLKTNDIVFASRPPHESAKYISYQQKNLSFASYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLSN KINSF+ +R+EEL  LI+ +K+A+  R AVDLS+KV+ L AD+SC
Sbjct  126   RNVRKMCTLELLSNHKINSFKFIRKEELDLLIKYIKEASFQREAVDLSAKVASLSADMSC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGKKY   + D RGF+ V++E M L    NLGDY P ++ LDLQGLT+RMKA++K +
Sbjct  186   RMVFGKKYMDDEFDARGFKVVIQEGMKLAAAPNLGDYIPQIAWLDLQGLTKRMKAVSKVF  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FFE+I+D+H Q        +TKDFVD ML  + S  +E+   R+HIK  + D+  G+ 
Sbjct  246   DGFFEKIIDEHIQFKDES---RTKDFVDVMLEFVGSEVSEYHIGRDHIKAIILDMLAGSM  302

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +    +IEW +SELL+HP IMKKVQ+EL+ K+GL++MVEESDLE+L+YLEMV+KE+ RLH
Sbjct  303   DTSAAVIEWALSELLKHPRIMKKVQKELELKVGLNKMVEESDLENLEYLEMVIKETFRLH  362

Query  715   PVAP-LIPNEAREDCMIEGFHIPKKITNHHKCLGDYT  608
             PVAP LIP++A +D +++G+ IPK   N H  +  + 
Sbjct  363   PVAPLLIPHQATQDTIVDGYLIPK---NSHIVINTWA  396


 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            K S I+IN WAI  DP+ WT+PE+F+PERF G+N+D+RGR F+L+PFGSGRR CPG+QLG
Sbjct  386  KNSHIVINTWAIGRDPSAWTDPERFLPERFAGNNVDFRGRDFQLLPFGSGRRGCPGIQLG  445

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +T+VRLV+AQL+HCFDWE PN M   ELDM+E+F L+  RA HL+ +P YRL
Sbjct  446  VTVVRLVLAQLVHCFDWELPNDMLPNELDMSEEFSLVTPRAKHLLALPTYRL  497



>ref|XP_007159748.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
 gb|ESW31742.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
Length=389

 Score =   383 bits (984),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 247/325 (76%), Gaps = 4/325 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M+LR G    +V SSPQAAELFLKTHDLVFASRPP EAAKYIS+ Q NLS   YG YW
Sbjct  59    PVMYLRLGFVPTVVVSSPQAAELFLKTHDLVFASRPPHEAAKYISWDQRNLSFAEYGSYW  118

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLS  KINSF++MR EEL  L++ L++AA    AVDLS+KVS + AD++C
Sbjct  119   RNMRKMCTLELLSQSKINSFRSMRTEELDLLVKVLREAADVGAAVDLSAKVSTVSADMAC  178

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  +DLDE+GF+ V++E M L    N+GDY P+++ LDLQGL +RMK + K +
Sbjct  179   RMVLGKKYMDRDLDEKGFKAVMQEGMHLSATPNMGDYIPYIAALDLQGLNKRMKVVGKIF  238

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FFE+I+D+H QS +    ++TKDFVD ML  + + E+E++  R +IK  + D+  G+ 
Sbjct  239   DDFFEKIIDEHMQSEK--EENKTKDFVDVMLGFVGTEESEYRIERPNIKAIMLDMLAGSM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SELL++P +MKK+Q EL++ +G+++ VEESDLE L+YL+MV+KESLRLH
Sbjct  297   DTSATAIEWTLSELLKNPRVMKKLQVELENVVGMEKKVEESDLEKLEYLDMVIKESLRLH  356

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP LIP+++ EDCM+  F IPKK
Sbjct  357   PVAPLLIPHQSTEDCMVGDFFIPKK  381



>ref|XP_004143569.1| PREDICTED: LOW QUALITY PROTEIN: flavonoid 3'-monooxygenase-like 
[Cucumis sativus]
Length=499

 Score =   353 bits (907),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 172/324 (53%), Positives = 234/324 (72%), Gaps = 6/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH++ G    I+ SSP+A ELFLKTHDL FASRP    + +ISYG+  ++   YGPYW
Sbjct  66    PIMHIQLGFLPAIIVSSPRATELFLKTHDLHFASRPLTITSNHISYGRKGVAFAQYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLS+LKINSF +MR++E+  LIE LK AA D VAVDL+SK+S +I D+ C
Sbjct  126   RNIRKMCTLELLSSLKINSFSSMRKQEVGSLIEVLKXAATDGVAVDLTSKISCVIGDMIC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MV G+KYE  +LDE+GF+G+++E   L    NLGD+ P ++  D+QG   R KA+ K +
Sbjct  186   VMVLGRKYEDNELDEKGFKGLIREATQLAAAPNLGDFIPLIARFDVQGFGGRAKAVGKIF  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D F ERI+++H    +    ++ KDFVD +L +M  G  E+Q +R +IK  + D L  A 
Sbjct  246   DGFLERIVEEHVVFQR---DNKDKDFVDVLLDLM--GSREYQIDRSNIKAIILDFLIAAV  300

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             ++ T  I W++SEL+++P IMKK+QEEL+  +GL+RMVEESDL +LKYLEMV+KESLR+H
Sbjct  301   DSTTTTINWMLSELIKNPHIMKKLQEELEKVVGLNRMVEESDLSNLKYLEMVIKESLRMH  360

Query  715   PVAPLIPNEAREDCMIEGFHIPKK  644
             P  PLIP E  +DC I G+HIP+K
Sbjct  361   PPVPLIPRECIQDCNINGYHIPEK  384


 Score =   121 bits (304),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            +KSRI+IN WAI  DPN W +P KF PERF  S +D +GR FELIPFGSGRR C G+QL 
Sbjct  383  EKSRIVINAWAIGRDPNTWVDPHKFDPERFLESEVDVKGRDFELIPFGSGRRGCVGIQLA  442

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            + +VRLVVAQL+HCFD + PN M   ELDMTE  GL+  RA +L V+P +RL
Sbjct  443  LVVVRLVVAQLVHCFDLKPPNGMSPLELDMTEILGLICPRAQNLKVVPIFRL  494



>gb|AAL66194.1|AF386512_1 cytochrome P450 [Pyrus communis]
Length=506

 Score =   326 bits (836),  Expect(2) = 5e-124, Method: Compositional matrix adjust.
 Identities = 167/330 (51%), Positives = 225/330 (68%), Gaps = 11/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+ A+LFLKTHD +FASRP  +A++Y++YG   ++   YGPYW
Sbjct  67    PIMSMRLGSVPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYGTKAMAFTEYGPYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LL   KI SF  +RREE+  L++SLK AA     VD S KV EL+  I+ 
Sbjct  127   RHIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAEAGEVVDFSEKVGELVEGITY  186

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G+K +    D    +G+++E + L G  N+ DY PFLS LDLQGLT+RMK ++KT 
Sbjct  187   RMVLGRKND----DMFDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVSKTV  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLS-----IMKSGEAEFQFNREHIKPTLSDL  908
             D+ FE+I+ DHEQ  +S   +  KDFVD +LS     +  + E  +   R + K TL D+
Sbjct  243   DQLFEKIIQDHEQVSRSEQGNHHKDFVDVLLSSIHQTLKPNDEEVYMLERTNAKATLLDM  302

Query  907   F-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               GA +     I W ++ELLRHP++MK++QEEL+S IG+DRMVEESDL  L YL MVVKE
Sbjct  303   IAGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKE  362

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             S RLHPVAP L+P+++ ED  ++G+H PKK
Sbjct  363   SFRLHPVAPLLVPHQSMEDITVDGYHTPKK  392


 Score =   148 bits (373),  Expect(2) = 5e-124, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSRI IN+W I  DP  W N E+F PERF   N+D RG  F+LIPFGSGRR CP +QLG
Sbjct  391  KKSRIFINIWTIGRDPKSWDNAEEFYPERFMNRNVDLRGHDFQLIPFGSGRRGCPAMQLG  450

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +T VRL +  LLHC +WE P+ M  ++LDMTE+FGL +S+A HL+  P  RL+
Sbjct  451  LTTVRLALGNLLHCSNWELPSGMLPKDLDMTEKFGLSLSKAKHLLATPTCRLY  503



>ref|XP_007209911.1| hypothetical protein PRUPE_ppa004377mg [Prunus persica]
 gb|EMJ11110.1| hypothetical protein PRUPE_ppa004377mg [Prunus persica]
Length=513

 Score =   322 bits (826),  Expect(2) = 7e-124, Method: Compositional matrix adjust.
 Identities = 172/332 (52%), Positives = 223/332 (67%), Gaps = 13/332 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP AAELFLKTHD +FASRP  +A++Y+SYG   ++   YGPYW
Sbjct  70    PIMSMRLGNTPAIVVSSPTAAELFLKTHDTIFASRPKVQASEYMSYGTKGMAFTEYGPYW  129

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LL   KI  F  +RREE+   I+SLK+AA     VDLS KV  L+ DI+ 
Sbjct  130   RHIRKLCTLQLLCPSKIEGFAPLRREEVGLFIQSLKKAAAAGEMVDLSEKVGGLVEDITY  189

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G K +    D    +G ++E + L G  N+GDY PFLS LDLQGL +RMK ++KT 
Sbjct  190   RMVLGSKND----DMFDLKGTIEEALFLSGAFNIGDYMPFLSPLDLQGLAKRMKRISKTI  245

Query  1072  DKFFERILDDHEQSGQSGS-SDQT-KDFVDTMLSIMK-----SGEAEFQFNREHIKPTLS  914
             D+ FE+I+ +HEQ  +SG   D + KDFVD +LS++      + E  +   R ++K  L 
Sbjct  246   DQLFEKIIGEHEQVSKSGQVQDHSHKDFVDVLLSLIHQPLNPNDEQVYMMERTNVKAILL  305

Query  913   DLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVV  737
             D+  GA +     I W ++ELLRHP +MK +Q E++S IG DRMVEESDL  L YL MVV
Sbjct  306   DMISGAFDTSATAIVWTLAELLRHPRVMKHLQGEIQSVIGTDRMVEESDLPKLGYLSMVV  365

Query  736   KESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             KESLRLHPVAP LIP+E+ ED  +EGF +PKK
Sbjct  366   KESLRLHPVAPFLIPHESMEDITVEGFDVPKK  397


 Score =   151 bits (381),  Expect(2) = 7e-124, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 85/117 (73%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            F   KKSRI IN WAI  DP VW+ N E+F PERF   NID RG  F+L+PFGSGRR CP
Sbjct  392  FDVPKKSRIFINTWAIGRDPKVWSENVEEFYPERFIDGNIDLRGHDFQLLPFGSGRRGCP  451

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
             +QLG+  VRL +A L+HCF+WE P+ +  E+LDMTE+FGL +S+A HL  +P YRL
Sbjct  452  AMQLGLITVRLALANLVHCFNWELPSGLKPEDLDMTEKFGLSLSKAKHLFAMPTYRL  508



>ref|XP_009346975.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   323 bits (829),  Expect(2) = 7e-124, Method: Compositional matrix adjust.
 Identities = 166/330 (50%), Positives = 225/330 (68%), Gaps = 11/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+ A+LFLKTHD +FASRP  +A++Y++YG   ++   YGPYW
Sbjct  67    PIMSMRLGSIPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYGTKAMAFSEYGPYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LL   KI SF  +RREE+  L++SLK AA     VD S KV EL+  I+ 
Sbjct  127   RHIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAEAGEVVDFSEKVGELVEGITY  186

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G+K +    D    +G+++E + L G  N+ DY PFLS LD+QGLT+RMK ++KT 
Sbjct  187   RMVLGRKND----DMFDLKGIIEEALFLTGAFNISDYVPFLSPLDVQGLTKRMKRVSKTV  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLS-----IMKSGEAEFQFNREHIKPTLSDL  908
             D+  E+I+ DHEQ  +S   +  KDFVD +LS     +  + E  +   R + K  L D+
Sbjct  243   DQLLEKIIQDHEQGSRSEQGNHHKDFVDVLLSSIHQPLKPNDEEVYMLERTNAKAILLDM  302

Query  907   F-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               GA +     I W ++ELLRHP++MK++QEEL+S IG+DRMVEESDL  L YL MVVKE
Sbjct  303   IAGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKE  362

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             SLRLHPVAP L+P+++ ED  ++G+HIPKK
Sbjct  363   SLRLHPVAPLLVPHQSMEDITVDGYHIPKK  392


 Score =   150 bits (378),  Expect(2) = 7e-124, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSRI IN+W I  DP+VW+ N E+F PERF  SN+D RG  F+LIPFGSGRR CP +QL
Sbjct  391  KKSRIFINIWTIGRDPSVWSDNVEEFYPERFMNSNVDLRGHDFQLIPFGSGRRGCPAMQL  450

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            G+T VR  +  LLHCF+WE P+ M  ++LDMTE+FGL +S+A HL+ +P  RL+
Sbjct  451  GLTTVRFALGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMPTCRLY  504



>ref|XP_002275714.2| PREDICTED: cytochrome P450 CYP736A12-like [Vitis vinifera]
Length=502

 Score =   312 bits (800),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 227/333 (68%), Gaps = 15/333 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R G    ++ SS QA +LFLKTHD+VFASRP  +A ++++YG   ++   YGPYW
Sbjct  66    PIMYMRLGCVPTVIVSSAQATKLFLKTHDVVFASRPKLQAFEHLTYGTKGIAFSEYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RKLCT+ELL+  KINSF ++R+EE+  L++SLK+ A     VD+S+KV++++ DIS 
Sbjct  126   RNVRKLCTVELLNTAKINSFASVRKEEVGMLVQSLKEMAAAGEVVDISTKVAQVVEDISY  185

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             RMVFG+ K  M DL     + +++E   L G  NLGDYFPFL  LDLQGL +R KA+ K 
Sbjct  186   RMVFGRNKDGMIDL-----KTLVREGTRLAGTFNLGDYFPFLGPLDLQGLVQRFKAINKA  240

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSD  911
              D+  E+I+D   Q G  G      +F+D MLS+M +      E+ +  +R ++K  L D
Sbjct  241   ADEVLEKIIDRRIQDG--GKDHNHSNFIDIMLSLMSNFSNLRSESSYIIDRTNVKAILLD  298

Query  910   -LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
              L G  ++ +  IEW+ SELLRHP +M+++Q EL++ + +DRMV+ESDLE+L YL MVVK
Sbjct  299   MLVGGIDSSSTTIEWVFSELLRHPRVMRQLQHELQNVVKMDRMVDESDLENLVYLNMVVK  358

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKKIT  638
             E LRLHP+ P L+P+ + ED  IEG  IPK+ T
Sbjct  359   EVLRLHPIGPFLVPHASTEDITIEGHFIPKRST  391


 Score =   160 bits (406),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 90/115 (78%), Gaps = 1/115 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            K+S I+IN WAI  DPN W+ N ++F+PERF  SNID +GR FELIPFGSGRR CPG+QL
Sbjct  388  KRSTILINTWAIGRDPNFWSDNVDEFLPERFINSNIDLQGRDFELIPFGSGRRGCPGIQL  447

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            G+  VRLV+AQLLHCF+WE PN M  ++LDM+E+FGL + R NHL  IP YRL I
Sbjct  448  GLRTVRLVLAQLLHCFNWELPNDMSSDDLDMSEKFGLTMPRVNHLYAIPTYRLLI  502



>ref|XP_009337257.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=506

 Score =   323 bits (827),  Expect(2) = 3e-123, Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 232/333 (70%), Gaps = 15/333 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+AAELFLKTHD +FASRP  +++K++S+G   ++   YGPYW
Sbjct  68    PIMSMRLGSKTTIVVSSPKAAELFLKTHDTIFASRPQVQSSKHMSHGTKAMAFSEYGPYW  127

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKL TL+LLS  +I +   +RREE   L++SLK AA     VDLS KVSEL+  I+ 
Sbjct  128   RHVRKLSTLQLLSPSRIEASAPLRREEAGLLVQSLKVAAEAGEVVDLSEKVSELVVGITY  187

Query  1252  RMVFGKK-YEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             RMV G+K  +M DL     +G+++E M L G  N+GDY PFL  LDLQGLT+RMK ++KT
Sbjct  188   RMVLGRKNNDMFDL-----KGIIEEVMFLSGAFNIGDYVPFLIPLDLQGLTKRMKRISKT  242

Query  1075  YDKFFERILDDHEQSGQSG--SSDQTKDFVDTMLSIMK-----SGEAEFQFNREHIKPTL  917
              D+ FE+I+ DHEQ  +S     +  KDFVD +LS++      + E  + F R + K  L
Sbjct  243   VDQLFEKIIQDHEQVSRSEQVQGNHHKDFVDVLLSLIHQPLNPNDEEVYMFERTNAKAIL  302

Query  916   SDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
              D+  G+ +   + I W ++ELLRHPE+MK++Q+EL+S +G+DRMVEESDL  L YL MV
Sbjct  303   LDMISGSFDTSAMAIVWTLAELLRHPEVMKRLQKELQSVVGMDRMVEESDLPKLDYLSMV  362

Query  739   VKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             VKESLRLHPV P LIP+++ ED +++G+HIPKK
Sbjct  363   VKESLRLHPVGPLLIPHQSMEDVIVDGYHIPKK  395


 Score =   149 bits (375),  Expect(2) = 3e-123, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSR+ IN+W I  DPNVW+ N E+F PERF  SN+D +G  F+LIPFGSGRR CP +QL
Sbjct  394  KKSRVFINIWTIGRDPNVWSDNVEEFYPERFMNSNVDLQGHDFQLIPFGSGRRRCPAMQL  453

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VRL +  L+HCF+WE P  M  ++LDMTE+FGL +S+A HL+ +P + L
Sbjct  454  GLTTVRLALGNLVHCFNWELPTGMLPKDLDMTEKFGLSLSKAKHLLAMPTHHL  506



>ref|XP_010094782.1| Cytochrome P450 71A1 [Morus notabilis]
 gb|EXB56947.1| Cytochrome P450 71A1 [Morus notabilis]
Length=507

 Score =   320 bits (820),  Expect(2) = 4e-123, Method: Compositional matrix adjust.
 Identities = 167/331 (50%), Positives = 220/331 (66%), Gaps = 13/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    +V SSP+AAELFLKT D  FASRP  ++++Y+SYG   ++   YGPYW
Sbjct  66    PIMSLRLGQVPAVVVSSPEAAELFLKTFDTTFASRPRVQSSEYMSYGTKGMAFTEYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RKLCTL+LLS LKI SF A+RRE++  ++ESL+ +A  R  VD+S K+ ELIAD+SC
Sbjct  126   RNVRKLCTLQLLSALKIESFAALRREDVASVVESLRASAAAREVVDISRKIGELIADMSC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ G   E    D    + ++ E M L G  NL DY P+L+ LDLQG TRRMK  ++  
Sbjct  186   RMILGISLE----DRNHLKELVHEAMFLSGAFNLSDYVPYLAPLDLQGYTRRMKKNSEAI  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG------EAEFQFNREHIKPTLSD  911
             D+  E I+ +HE+ G S    + KDFVD +LS++         E  +  +R +IK  L D
Sbjct  242   DRVLEEIITEHER-GTSEKGHRQKDFVDVLLSLVNQPMNPQDLEHLYIIDRTNIKAILLD  300

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             +  AS +    LIEW  SELL+HP +M  +Q EL+  +G+D+MVEE DLE L YL+MVVK
Sbjct  301   MVAASFDTSAALIEWTFSELLKHPRVMNNLQRELERVVGMDKMVEEQDLEKLDYLDMVVK  360

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             ES RLHPVAP L+P E+ ED  IEG+ IPKK
Sbjct  361   ESFRLHPVAPLLVPRESMEDITIEGYFIPKK  391


 Score =   150 bits (380),  Expect(2) = 4e-123, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSRII+N W I  DPNVW+ N E+F+PERF   NID RG  F L+PFGSGRR CPG+ L
Sbjct  390  KKSRIIVNAWTIGRDPNVWSENVEEFLPERFVDKNIDLRGHDFRLLPFGSGRRGCPGVHL  449

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  +RLV+AQL+HCF WE PN +  +++DM+E+FGL + RAN L+  P YRL
Sbjct  450  GLVNIRLVLAQLVHCFSWELPNGVETKDVDMSEKFGLSMGRANQLLAKPTYRL  502



>ref|XP_008441066.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=499

 Score =   347 bits (890),  Expect(2) = 5e-123, Method: Compositional matrix adjust.
 Identities = 169/324 (52%), Positives = 231/324 (71%), Gaps = 6/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH++ GL   I+ SS +A ELFLKTHDL FASRP    + +ISYG+  +    YGPYW
Sbjct  66    PIMHIQLGLLPAIIVSSARATELFLKTHDLHFASRPLTITSNHISYGRKGIVFAQYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLS+LKINSF +MR++E+  LI+ L+ AA D VAVDL+SK+S +I D+ C
Sbjct  126   RNIRKMCTLELLSSLKINSFSSMRKQEVGSLIKGLEDAATDGVAVDLTSKISSVIGDMIC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MV G+KYE  +L E+GF+G+++E   L    NLGD+ P ++  D+QG   R KA+ K +
Sbjct  186   VMVLGRKYEDNELGEKGFKGLIREATQLAAAPNLGDFIPLIARFDVQGFGGRAKAVGKIF  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D F E I+++H    +    ++ KDFVD +L +M  G  E+Q +R +IK  + D +  A 
Sbjct  246   DGFLESIVEEHVVFEK---DNKDKDFVDVLLDLM--GSREYQIDRSNIKAIILDFVIAAV  300

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             ++ T  I W++SEL++HP IMKK+QEEL+  +GL+RMVEESDL +LKYLEMV+KESLR+H
Sbjct  301   DSTTTTINWMLSELIKHPHIMKKLQEELEKVVGLNRMVEESDLSNLKYLEMVMKESLRMH  360

Query  715   PVAPLIPNEAREDCMIEGFHIPKK  644
             P  PLIP E  +DC I G+HIPKK
Sbjct  361   PPVPLIPRECIQDCNINGYHIPKK  384


 Score =   124 bits (310),  Expect(2) = 5e-123, Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 82/112 (73%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSRI+IN WAI  DPN W +P KF PERF  S +D RGR FELIPFGSGRR C G+QL 
Sbjct  383  KKSRIVINAWAIGRDPNTWVDPHKFDPERFLESEVDVRGRDFELIPFGSGRRGCVGIQLA  442

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            + +VRLVVAQLLHCFD + P+ M   ELDMTE  GL   RA +L VIP +RL
Sbjct  443  LVVVRLVVAQLLHCFDLKLPDGMSPLELDMTEILGLTCPRAQNLRVIPIFRL  494



>sp|H2DH18.1|C7A12_PANGI RecName: Full=Cytochrome P450 CYP736A12 [Panax ginseng]
 gb|AEY75215.1| cytochrome P450 CYP736A12 [Panax ginseng]
Length=500

 Score =   308 bits (790),  Expect(2) = 6e-123, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 223/330 (68%), Gaps = 13/330 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSPQAAELFLKTHD +FASRP  +AA+Y+SYG M +S   YGP+W
Sbjct  66    PIMSMRLGSVPTIVVSSPQAAELFLKTHDNIFASRPKLQAAEYMSYGTMGMSFTAYGPHW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK   LELL+  KINSF  MRREEL  +++S+K+A+     VDLS+KV+ +I +++ 
Sbjct  126   RNIRKFVVLELLTPAKINSFVGMRREELGTVVKSIKEASAANEVVDLSAKVANIIENMTY  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             R++ G+    KD D    +G++ E + L G+ N+ D+ PFL  LD+QGLTR+ K   K  
Sbjct  186   RLLLGRT---KD-DRYDLKGIMNEALTLAGRFNIADFVPFLGPLDIQGLTRQFKDTGKRL  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSDL  908
             DK  E I+D+HEQ+  +G++  + DF+D MLS+         E     +R  IK  + D+
Sbjct  242   DKILEFIIDEHEQNSSNGNA--SGDFIDDMLSLKNKPSNTHDELSKVIDRSVIKAIMIDI  299

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               A+ +     IEWI++EL++HP  MKK QEE+ + +G+DRMVEE+DL +L+Y+ MVVKE
Sbjct  300   ISAAIDTSDTSIEWILTELIKHPRAMKKCQEEIDAVVGVDRMVEETDLPNLEYVYMVVKE  359

Query  730   SLRLHPVAPLI-PNEAREDCMIEGFHIPKK  644
              LRLHPVAPL+ P+E+ ED  I G+ IPK+
Sbjct  360   GLRLHPVAPLLGPHESMEDITINGYFIPKQ  389


 Score =   162 bits (409),  Expect(2) = 6e-123, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 89/113 (79%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            K+SR+I+N WA+  DPNVW+ N E+F+PERFEGSN+D RGR F+L+PFGSGRR CPG+QL
Sbjct  388  KQSRVIVNSWALGRDPNVWSENAEEFLPERFEGSNVDVRGRDFQLLPFGSGRRGCPGMQL  447

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  V+LVVA+L+HCFDW  PN    + LDMTE+FGL   R  HL+ +P YRL
Sbjct  448  GLITVQLVVARLVHCFDWNLPNGTTPDNLDMTEKFGLTTPRVKHLLAVPKYRL  500



>ref|XP_008240284.1| PREDICTED: cytochrome P450 CYP736A12-like [Prunus mume]
Length=509

 Score =   324 bits (831),  Expect(2) = 9e-123, Method: Compositional matrix adjust.
 Identities = 173/332 (52%), Positives = 222/332 (67%), Gaps = 13/332 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP AAELFLKTHD +FASRP  +A++Y+SYG   ++   YGPYW
Sbjct  66    PIMSMRLGNIPAIVVSSPTAAELFLKTHDTIFASRPKVQASEYMSYGTKGMAFTEYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LL   KI     +RREE+   I+SLK+AA     VDLS KV  L+ DI+ 
Sbjct  126   RHIRKLCTLQLLCPSKIEGSAPLRREEVGLFIQSLKKAAAAGEVVDLSEKVGGLVEDITY  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G K +    D    +G ++E + L G  N+GDY PFLS LDLQGL +RMK ++KT 
Sbjct  186   RMVLGSKND----DMFDLKGTIQEALFLSGAFNIGDYVPFLSPLDLQGLAKRMKRISKTI  241

Query  1072  DKFFERILDDHEQSGQSG--SSDQTKDFVDTMLSIMK-----SGEAEFQFNREHIKPTLS  914
             D+ FE+I+ +HEQ  +SG       KDFVD +LS++      + E  +   R ++K  L 
Sbjct  242   DQLFEKIIGEHEQVSKSGQVQGHSHKDFVDVLLSLIHQPLNPNDEKVYMMERTNVKAILL  301

Query  913   DLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVV  737
             D+  GA +     I W ++ELLRHP +MK +QEEL+S IG+DRMVEESDL  L YL MVV
Sbjct  302   DMISGAFDTSATTIVWTLAELLRHPRVMKHLQEELQSVIGMDRMVEESDLPKLCYLSMVV  361

Query  736   KESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             KESLRLHPVAP LIP+E+ ED  +EGF IPKK
Sbjct  362   KESLRLHPVAPLLIPHESMEDITVEGFDIPKK  393


 Score =   145 bits (367),  Expect(2) = 9e-123, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 84/117 (72%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            F   KKSRI IN WAI  DP VW+ N E+F  ERF   NID RG  F+L+PFGSGRR CP
Sbjct  388  FDIPKKSRIFINTWAIGRDPKVWSENVEEFYTERFIDGNIDLRGHDFQLLPFGSGRRGCP  447

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
             +QLG+T V L +A L+HCF+WE P+ +  ++LDMTE+FGL +S+A HL  +P YRL
Sbjct  448  AMQLGLTTVCLALANLVHCFNWELPSGLKPKDLDMTEKFGLSLSKAKHLFAMPTYRL  504



>ref|XP_004162328.1| PREDICTED: flavonoid 3'-monooxygenase-like [Cucumis sativus]
Length=499

 Score =   346 bits (887),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 231/324 (71%), Gaps = 6/324 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH++ G    I+ SS +A ELFLKTHDL FASRP    + +ISYG+  ++   YGPYW
Sbjct  66    PIMHIQLGFLPAIIVSSARATELFLKTHDLHFASRPLTITSNHISYGRKGVAFAQYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CTLELLS+LKINSF +MR++E+  LIE L+ AA D VAVDL+SK+S +I D+ C
Sbjct  126   RNIRKMCTLELLSSLKINSFSSMRKQEVGSLIEGLEVAATDGVAVDLTSKISCVIGDMIC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MV G+KYE  +LDE+GF+G+++E   L    NLGD+ P ++  D+QG   R KA+ K +
Sbjct  186   VMVLGRKYEDNELDEKGFKGLIREATQLAAAPNLGDFIPLIARFDVQGFGGRAKAVGKIF  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D F ERI+   E+       ++ KDFVD +L +M  G  E+Q +R +IK  + D L  A 
Sbjct  246   DGFLERIV---EERVVFQRDNKDKDFVDVLLDLM--GSREYQIDRSNIKAIILDFLIAAV  300

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             ++ T  I W++SEL+++P IMKK+QEEL+  +GL+RMVEESDL +LKYLEMV+KESLR+H
Sbjct  301   DSTTTTINWMLSELIKNPHIMKKLQEELEKVVGLNRMVEESDLSNLKYLEMVIKESLRMH  360

Query  715   PVAPLIPNEAREDCMIEGFHIPKK  644
             P  PLIP E  +DC I G+HIP+K
Sbjct  361   PPVPLIPRECIQDCNINGYHIPEK  384


 Score =   123 bits (309),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            +KSRI+IN WAI  DPN W +P KF PERF  S +D +GR FELIPFGSGRR C G+QL 
Sbjct  383  EKSRIVINAWAIGRDPNTWVDPHKFDPERFLESEVDVKGRDFELIPFGSGRRGCVGIQLA  442

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            + +VRLVVAQL+HCFD + PN M   ELDMTE  GL+  RA +L V+P +RL
Sbjct  443  LVVVRLVVAQLVHCFDLKLPNGMSPLELDMTEILGLICPRAQNLKVVPIFRL  494



>ref|XP_009337201.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=519

 Score =   321 bits (823),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 230/333 (69%), Gaps = 15/333 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+AAELFLKTHD +FASRP  +A+KY+SYG   ++   YG YW
Sbjct  81    PIMSMRLGSKTTIVVSSPKAAELFLKTHDTIFASRPQVQASKYMSYGTKAMAFSEYGSYW  140

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LL   +I +F  +RREE+  L++SLK AA     VDLS KV EL+  I+ 
Sbjct  141   RHVRKLCTLQLLCPSRIEAFAPLRREEVGLLVQSLKVAAEAGKVVDLSEKVGELVVGITY  200

Query  1252  RMVFGKK-YEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             +MV G++  +M DL     +G+++E M L G  N+ DY PFL  LDLQGLT+RMK ++KT
Sbjct  201   KMVLGRRNNDMFDL-----KGIIEETMFLTGAFNISDYVPFLIPLDLQGLTKRMKRISKT  255

Query  1075  YDKFFERILDDHEQSGQSGS--SDQTKDFVDTMLSIMK-----SGEAEFQFNREHIKPTL  917
              D+ FERI+ +HEQ  +S     +  KDFVD +LS++      + +  + F R + K  L
Sbjct  256   VDQLFERIIQEHEQVSRSEQVHGNHHKDFVDVLLSLIHQPLNPNDKEVYMFERTNAKAIL  315

Query  916   SDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
              D+  G+ +     I W ++ELLRHP++MK++Q+EL+S +G+DRMVEESDL  L YL MV
Sbjct  316   LDMISGSFDTSATAIVWTLAELLRHPKVMKRLQKELQSVVGMDRMVEESDLPKLDYLSMV  375

Query  739   VKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             VKESLRLHPV P LIP+++ ED +++G+HIPKK
Sbjct  376   VKESLRLHPVGPLLIPHQSMEDVIVDGYHIPKK  408


 Score =   148 bits (373),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKS I IN+W I  DPNVW+ N E+F PERF  SN+D +G  F+LIPFGSGRR CP +QL
Sbjct  407  KKSIIFINIWTIGRDPNVWSDNVEEFYPERFMNSNVDLQGHDFQLIPFGSGRRRCPAMQL  466

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VRL +  L+HCF+WE P  M  ++LDMTE+FGL +S+A HL+ +P +RL
Sbjct  467  GLTTVRLALGNLVHCFNWELPTGMLPKDLDMTEKFGLSMSKAKHLLAMPTHRL  519



>ref|XP_008460602.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=528

 Score =   311 bits (796),  Expect(2) = 6e-122, Method: Compositional matrix adjust.
 Identities = 157/329 (48%), Positives = 219/329 (67%), Gaps = 8/329 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMH++ G+   I+ SSP AAELFL+T+D VFASRP   A+ Y+ YGQ N     YG YW
Sbjct  90    PIMHIKLGIIPTIIVSSPNAAELFLRTYDHVFASRPQTYASNYLFYGQKNFGFSKYGSYW  149

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CT ELLSN K++ F+ +RR ++  L+E+LK+AA  +VAV+LSSKV  ++ D++C
Sbjct  150   RNMRKMCTHELLSNQKVSMFEPIRRNQVGLLVENLKEAARTQVAVNLSSKVLCVVRDMTC  209

Query  1252  RMVFGKKY----EMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKAL  1085
              MVFGKKY    EM  +DE+ F   +KE + L    NL D+ P ++  D QG+ RR K+L
Sbjct  210   LMVFGKKYVEDQEMI-MDEKSFHDAVKEVVQLVATPNLSDFIPCVAWFDFQGINRRAKSL  268

Query  1084  AKTYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDL-  908
                +D F ERI+++H    Q  + ++ +DFVD +L +M S   E+  +   IK  + ++ 
Sbjct  269   RNMFDGFLERIIEEHLDD-QFKNENKNQDFVDVLLGLMGSQNNEYNIDPSTIKALILEMV  327

Query  907   FGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKES  728
               A +     I+W + EL+RHP IMKK+Q+EL   +GL RMV ESDLE L+YL MV+KE 
Sbjct  328   ITAMDTTATNIDWAIVELIRHPHIMKKMQQELDKVVGLQRMVLESDLEHLQYLNMVIKEV  387

Query  727   LRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             LRLHP  P L+P+E+ +DC   GFHIPK+
Sbjct  388   LRLHPPVPLLVPHESLQDCTTNGFHIPKQ  416


 Score =   156 bits (395),  Expect(2) = 6e-122, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 87/116 (75%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K+SRII+N WAI  DP VW +P+KF PERF  S +D +G+ FELIPFGSGRR CPG
Sbjct  411  FHIPKQSRIIVNAWAIGRDPTVWNDPQKFFPERFIDSEVDLKGKDFELIPFGSGRRCCPG  470

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            + LG+T+VRL++AQL+H F WE PN +   +LDMTE+FGL   RA HL+V P YRL
Sbjct  471  MHLGLTMVRLLLAQLVHAFYWELPNGILPNQLDMTEEFGLTCPRAQHLMVTPIYRL  526



>ref|XP_009336569.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=507

 Score =   316 bits (809),  Expect(2) = 6e-122, Method: Compositional matrix adjust.
 Identities = 164/330 (50%), Positives = 221/330 (67%), Gaps = 11/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +  G    IV SSP+ A+LFLKTHD +FASRP  +A++Y++YG   ++   YGPYW
Sbjct  67    PIMSMHLGSIPTIVVSSPKTAKLFLKTHDTIFASRPKLQASEYMAYGTKAMAFTEYGPYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LL   KI SF  +RREE+  L++SLK AA     VD S KV EL+  I+ 
Sbjct  127   RHIRKLCTLQLLCPSKIESFAPLRREEVGLLVQSLKVAAEAGEVVDFSEKVGELVEGITY  186

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G+K +    D    +G+++E + L G  N+ DY PFLS LDLQGLT+RMK ++KT 
Sbjct  187   RMVLGRKND----DMFDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVSKTV  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLS-----IMKSGEAEFQFNREHIKPTLSDL  908
             D+  E+I+ DHE   +       KDFVD +LS     +  + E  +   R + K  L D+
Sbjct  243   DQLLEKIIQDHELVSRREQGKHHKDFVDVLLSSIHQPLNPNDEEVYMLERTNAKAILLDM  302

Query  907   F-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               GA +     I W ++ELLRHP++MK++QEEL+S IG+DRMVEESDL  L YL MVVKE
Sbjct  303   IAGAFDTSATAIIWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVKE  362

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             SLRLHPVAP L+P+++ ED  ++G+HIPKK
Sbjct  363   SLRLHPVAPLLVPHQSMEDITVDGYHIPKK  392


 Score =   151 bits (382),  Expect(2) = 6e-122, Method: Compositional matrix adjust.
 Identities = 68/114 (60%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSRI IN+W I  DP+VW+ N E+F PERF  SN+D RG  F+LIPFGSGRR CP +QL
Sbjct  391  KKSRIFINIWTIGRDPSVWSDNVEEFYPERFMNSNVDLRGHDFQLIPFGSGRRGCPAMQL  450

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            G+T VRL +  LLHCF+WE P+ M  ++LDMTE+FGL +S+A HL+ +P  RL+
Sbjct  451  GLTTVRLALGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMPTCRLY  504



>dbj|BAD15331.1| cytochrome P450 [Panax ginseng]
Length=500

 Score =   306 bits (783),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 222/330 (67%), Gaps = 13/330 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSPQAAELFLKTHD +FASRP  +AA+Y+SYG   +S   YGP+W
Sbjct  66    PIMSMRLGSVPTIVVSSPQAAELFLKTHDNIFASRPKLQAAEYMSYGTKGMSFTAYGPHW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK   LELL+  KINSF  MRREEL  +++S+K+A+     VDLS+KV+ +I +++ 
Sbjct  126   RNIRKFVVLELLTPAKINSFVGMRREELGMVVKSIKEASAANEVVDLSAKVANIIENMTY  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             R++ G+    KD D    +G++ E + L G+ N+ D+ PFL  LD+QGLTR+ K   K  
Sbjct  186   RLLLGRT---KD-DRYDLKGIMNEALTLAGRFNIADFVPFLGPLDIQGLTRQFKDTGKRL  241

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSDL  908
             DK  E I+D+HEQ+  +G++  + DF+D MLS+         E     +R  IK  + D+
Sbjct  242   DKILEFIIDEHEQNSSNGNA--SGDFIDDMLSLKNKPSNTHDELSKVIDRSVIKAIMIDI  299

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               A+ +     IEWI++EL++HP  MKK QEE+ + +G+DRMVEE+DL +L+Y+ MVVKE
Sbjct  300   ISAAIDTSDTSIEWILTELIKHPRAMKKCQEEIDAVVGVDRMVEETDLPNLEYVYMVVKE  359

Query  730   SLRLHPVAPLI-PNEAREDCMIEGFHIPKK  644
              LRLHPVAPL+ P+E+ ED  I G+ IPK+
Sbjct  360   GLRLHPVAPLLGPHESMEDITINGYFIPKQ  389


 Score =   160 bits (404),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            K+SR+I+N WA+  DPNVW+ + ++F+PERFEGSNID RGR F+L+PFGSGRR CPG+QL
Sbjct  388  KQSRVIVNSWALGRDPNVWSEDADEFLPERFEGSNIDVRGRDFQLLPFGSGRRGCPGMQL  447

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  V+LVVA+L+HCFDW  PN +  + LDMTE+FGL   R  HL+ +P YRL
Sbjct  448  GLITVQLVVARLVHCFDWNLPNGITPDNLDMTEKFGLTTPRVKHLLAVPKYRL  500



>ref|XP_008374738.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=529

 Score =   315 bits (808),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 223/331 (67%), Gaps = 12/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+AA+LFLKTHD +FASRP  +A +Y++YG   ++   YGPYW
Sbjct  88    PIMSMRLGFIPTIVVSSPKAAKLFLKTHDTIFASRPKLQAFEYMAYGSKVMAFIEYGPYW  147

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LL   KI  F  +RREE+  L++SLK AA     VD S KV EL+  I+ 
Sbjct  148   RHIRKLCTLQLLCPSKIEGFAPLRREEVGLLVQSLKVAAEGGEVVDFSEKVGELVEGITY  207

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G+K +    D    +G+++E + L G  N+ DY PFLS LDLQGLT+RMK ++K  
Sbjct  208   RMVLGRKND----DMFDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVSKIV  263

Query  1072  DKFFERILDDHEQSGQSG-SSDQTKDFVDTMLS-----IMKSGEAEFQFNREHIKPTLSD  911
             D+  E+I+ DHEQ  +S    +  KDFVD +LS     +  + E  +   R ++K  L D
Sbjct  264   DQLLEKIIQDHEQVSRSEVQGNHHKDFVDVLLSSIHQPLNPNNEEVYMLERTNVKAILLD  323

Query  910   LF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             +  GA +  T  I W ++ELLRHP++MK++QEELKS I +DRMVEESDL  L YL  VVK
Sbjct  324   MIVGALDTSTTAIVWTLAELLRHPKVMKRLQEELKSVIRMDRMVEESDLPKLDYLSTVVK  383

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +SLRLHP+AP L+P+++ ED  ++G+HIPKK
Sbjct  384   DSLRLHPIAPLLVPHQSMEDITVDGYHIPKK  414


 Score =   147 bits (370),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSR+ IN+W I  DP+VW+ N E+F  ERF  +N+D RG  F+LIPFGSGRR CP +QL
Sbjct  413  KKSRVFINIWTIGRDPSVWSDNVEEFYNERFMNNNVDLRGHDFQLIPFGSGRRGCPAMQL  472

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            G+T VRLV+  LLHCF+WE P+ M  ++LDMTE+FGL +S+A HL+ +P  RL+
Sbjct  473  GLTTVRLVLGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMPTCRLY  526



>ref|XP_009337234.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=504

 Score =   317 bits (811),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/336 (50%), Positives = 221/336 (66%), Gaps = 15/336 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+ AELFLKTHD +FASRP  +++ Y+SYG   +    YGPYW
Sbjct  62    PIMSMRLGSKTTIVVSSPKVAELFLKTHDTIFASRPKVQSSDYLSYGTKGMGFSEYGPYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LL   KI  F  +RREE+  L++ LK+AA     VDLS KV ELI DI+ 
Sbjct  122   RHIRKLCTLQLLCQSKIEGFAPLRREEVGLLVQWLKKAAKAGEVVDLSEKVGELIEDITY  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G K +    D    +G+++E M L G VN+GDY PFLS  D+QGL +RMK L+KT 
Sbjct  182   RMVLGSKND----DTFDVKGIIEEVMLLTGAVNIGDYVPFLSPFDIQGLNKRMKRLSKTI  237

Query  1072  DKFFERILDDHEQSGQS----GSSDQTKDFVDTMLSIMK-----SGEAEFQFNREHIKPT  920
             D+  E+I+ +HEQ  +S    G     KDFV+ +LS+M      + E  +  +R ++K  
Sbjct  238   DQLLEKIIGEHEQVSKSEQLQGRPQNHKDFVEMLLSLMNQPLNPNDEQVYVVDRTNVKAI  297

Query  919   LSDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEM  743
             L D+  GA +     I W ++ELLRHP +MK +Q+EL++ IG+DR VEESDL  L YL  
Sbjct  298   LLDMISGAFDTSATAIVWNLAELLRHPRVMKLLQQELQTVIGMDRTVEESDLPKLAYLNK  357

Query  742   VVKESLRLHPVAP-LIPNEAREDCMIEGFHIPKKIT  638
             VVKES RLHPVAP LIP+ + ED  ++G+HIPKK T
Sbjct  358   VVKESFRLHPVAPLLIPHASMEDITVDGYHIPKKST  393


 Score =   145 bits (365),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKS I +N+W I  DP+VW+ N E+F PERF  S++D +G  F+L+PFGSGRR CP +QL
Sbjct  390  KKSTIFVNIWTIGRDPSVWSDNVEEFYPERFNDSDVDLKGHDFQLLPFGSGRRGCPAMQL  449

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            G+T VRL +A L+HCF+++ P+ +   ELDMTE FGL +S+  HL+V+P YRLH
Sbjct  450  GLTTVRLALANLVHCFNFDLPSGLLPNELDMTETFGLSLSKTKHLLVVPTYRLH  503



>ref|XP_003627829.1| Cytochrome P450, partial [Medicago truncatula]
Length=591

 Score =   283 bits (724),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 201/325 (62%), Gaps = 45/325 (14%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL  +IV SSPQAAELFLKTHDLVFASRPP EAAK    G   L  C      
Sbjct  104   PIMHLRLGLVPIIVVSSPQAAELFLKTHDLVFASRPPIEAAKNHRLGSEELEFC------  157

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
                          + KINSF+ MR +EL  LI+ L++   DR  VDLS+KVS L AD+SC
Sbjct  158   -------------HAKINSFKTMREQELDLLIKFLREKTNDRTKVDLSTKVSTLTADMSC  204

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY   DLDE+GF+ V+ E M L    N+                       K+ 
Sbjct  205   RMVLGKKYTDDDLDEKGFKAVMLETMHLSATPNI----------------------EKSL  242

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
               FF++I+D+H QS      D+TKDFVD ML  + + E+E++  R  IK  + D+ G S 
Sbjct  243   MIFFDKIIDEHIQS--DNKDDKTKDFVDVMLGFVGTEESEYRIERNDIKAIMLDMLGGSM  300

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SELL++P +MK VQ+EL++ +G+ R VEESDL+ LKYLEMV+KESLRLH
Sbjct  301   DTSATAIEWAISELLKNPRVMKNVQKELETVVGMKRKVEESDLDKLKYLEMVIKESLRLH  360

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP LIP ++ EDCM+E   IPKK
Sbjct  361   PVAPLLIPYQSLEDCMVEDLFIPKK  385


 Score =   179 bits (453),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+I+N W+I  DPN WT+PEKF PERFEG+NID +GR F+LIPFGSGRR CPGLQLG
Sbjct  384  KKSRVIVNAWSIMRDPNAWTDPEKFWPERFEGNNIDVKGRDFQLIPFGSGRRGCPGLQLG  443

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +T++RLVVAQL+HCFDW+ PN M   +LDMTE FGL + RAN+LI IP YRL
Sbjct  444  LTVIRLVVAQLVHCFDWKLPNHMLPSDLDMTEDFGLTMPRANNLIAIPAYRL  495


 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYIS  1478
             PIMHLR GL   IV SSPQAAELFLKTHDLVFASRPP    + I+
Sbjct  546   PIMHLRLGLIPTIVVSSPQAAELFLKTHDLVFASRPPHLVRQKIN  590



>ref|XP_003630097.1| Cytochrome P450 [Medicago truncatula]
 gb|AET04573.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=457

 Score =   282 bits (722),  Expect(2) = 3e-120, Method: Compositional matrix adjust.
 Identities = 160/325 (49%), Positives = 201/325 (62%), Gaps = 45/325 (14%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL  +IV SSPQAAELFLKTHDLVFASRPP EAAK    G   L  C      
Sbjct  61    PIMHLRLGLVPIIVVSSPQAAELFLKTHDLVFASRPPIEAAKNHRLGSEELEFC------  114

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
                          + KINSF+ MR +EL  LI+ L++   DR  VDLS+KVS L AD+SC
Sbjct  115   -------------HAKINSFKTMREQELDLLIKFLREKTNDRTKVDLSTKVSTLTADMSC  161

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY   DLDE+GF+ V+ E M L    N+                       K+ 
Sbjct  162   RMVLGKKYTDDDLDEKGFKAVMLETMHLSATPNI----------------------EKSL  199

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
               FF++I+D+H QS      D+TKDFVD ML  + + E+E++  R  IK  + D+ G S 
Sbjct  200   MIFFDKIIDEHIQS--DNKDDKTKDFVDVMLGFVGTEESEYRIERNDIKAIMLDMLGGSM  257

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SELL++P +MK VQ+EL++ +G+ R VEESDL+ LKYLEMV+KESLRLH
Sbjct  258   DTSATAIEWAISELLKNPRVMKNVQKELETVVGMKRKVEESDLDKLKYLEMVIKESLRLH  317

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVAP LIP ++ EDCM+E   IPKK
Sbjct  318   PVAPLLIPYQSLEDCMVEDLFIPKK  342


 Score =   179 bits (454),  Expect(2) = 3e-120, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 94/112 (84%), Gaps = 0/112 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLG  469
            KKSR+I+N W+I  DPN WT+PEKF PERFEG+NID +GR F+LIPFGSGRR CPGLQLG
Sbjct  341  KKSRVIVNAWSIMRDPNAWTDPEKFWPERFEGNNIDVKGRDFQLIPFGSGRRGCPGLQLG  400

Query  468  ITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            +T++RLVVAQL+HCFDW+ PN M   +LDMTE FGL + RAN+LI IP YRL
Sbjct  401  LTVIRLVVAQLVHCFDWKLPNHMLPSDLDMTEDFGLTMPRANNLIAIPAYRL  452



>ref|XP_007036492.1| Cytochrome P450 superfamily protein [Theobroma cacao]
 gb|EOY20993.1| Cytochrome P450 superfamily protein [Theobroma cacao]
Length=512

 Score =   301 bits (770),  Expect(2) = 6e-120, Method: Compositional matrix adjust.
 Identities = 159/334 (48%), Positives = 217/334 (65%), Gaps = 21/334 (6%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM +R G    IV SSPQAAELFLKTHD +F SRP  + ++Y+SYG   L+   YG YWR
Sbjct  72    IMSIRLGYVPTIVVSSPQAAELFLKTHDTIFDSRPKVQGSEYLSYGTKGLAFAQYGSYWR  131

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
              +RK CTL+LLS  K+  F   RR EL  L++ LK AA     VDLS+KV ELI DI  R
Sbjct  132   TVRKWCTLQLLSASKVEFFAPKRRTELQSLVKLLKNAAAASEVVDLSAKVGELIEDIMYR  191

Query  1249  MVFGK----KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALA  1082
             M+ G+    K+++K L   G R        L G  NL D+ PFL+ LDLQGL +R +++ 
Sbjct  192   MILGRCKDDKFDLKPLIHEGIR--------LLGTFNLADFVPFLAPLDLQGLRQRFESVR  243

Query  1081  KTYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG------EAEFQFNREHIKPT  920
             K  DKF E I+D+HE+  + G   Q +DFVD MLS +         E  +  +R +IK  
Sbjct  244   KACDKFLEEIIDEHEKLNK-GQQKQHRDFVDFMLSYLNQPMNPNDEEQTYIIDRTNIKAI  302

Query  919   LSDLFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEM  743
             + D+  A+ E   ++IEW ++E++RHP +  ++Q+EL++ +G++RMVEE+DL +L YL+M
Sbjct  303   ILDMIAAALETSAVVIEWALAEIIRHPRVKSRLQKELEAVVGMNRMVEEADLANLTYLDM  362

Query  742   VVKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             V+KESLRLHPVAP LIP+E+ ED  I G+HIPKK
Sbjct  363   VIKESLRLHPVAPLLIPHESMEDVTINGYHIPKK  396


 Score =   159 bits (403),  Expect(2) = 6e-120, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSRI+IN+WAI  DPNVW+ N E F+PERF GSN+D RG  F+LIPFGSGRR CPGLQL
Sbjct  395  KKSRILINIWAIGRDPNVWSDNVEDFLPERFVGSNVDLRGHDFQLIPFGSGRRGCPGLQL  454

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VRL +AQL+HCF+WE PN M   +L M+E+FGL   RA HL+  P YRL
Sbjct  455  GLTTVRLALAQLVHCFEWELPNGMLPNDLSMSEKFGLSAPRAEHLLARPVYRL  507



>ref|XP_008360900.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=504

 Score =   314 bits (805),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 220/336 (65%), Gaps = 15/336 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+ AELFLKTHD +FASRP  +++ Y+SYG   +    YGPYW
Sbjct  62    PIMSMRLGSKTTIVVSSPKVAELFLKTHDTIFASRPKVQSSDYLSYGTKGMGFSEYGPYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LL   KI  F  +RREE+  L++SLK+A      VDLS KV ELI  I+ 
Sbjct  122   RHIRKLCTLQLLCPSKIEGFAPLRREEVGLLVQSLKKATEAGEVVDLSEKVGELIEGITY  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G K +    D    +G+++E M L G VN+GDY PFLS  D+QGL +RMK L+KT 
Sbjct  182   RMVLGSKND----DTFDVKGIIEEIMLLTGAVNIGDYVPFLSPFDIQGLNKRMKTLSKTI  237

Query  1072  DKFFERILDDHEQSGQS----GSSDQTKDFVDTMLSIMK-----SGEAEFQFNREHIKPT  920
             D+  E+I+ +HEQ  +S    G     KDFV+ +LS+M      + E  +  +R ++K  
Sbjct  238   DQLLEKIIGEHEQVSKSKQLQGRPQNHKDFVEMLLSLMNQPLNPNDEQVYVVDRTNVKAI  297

Query  919   LSDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEM  743
             L D+  GA +     I W ++ELLRHP +MK +Q+EL++ IG+DR VEESDL  L YL  
Sbjct  298   LLDMISGAFDTSATAIVWNLAELLRHPRVMKLLQQELQTVIGMDRTVEESDLPKLAYLNK  357

Query  742   VVKESLRLHPVAP-LIPNEAREDCMIEGFHIPKKIT  638
             V+KES RLHPVAP LIP+ + ED  ++G+HIPKK T
Sbjct  358   VIKESFRLHPVAPLLIPHASMEDITVDGYHIPKKST  393


 Score =   145 bits (366),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKS I +N+W I  DP+VW+ N E+F PERF  S++D +G  F+L+PFGSGRR CP +QL
Sbjct  390  KKSTIFVNIWTIGRDPSVWSDNVEEFYPERFNDSDVDLKGHDFQLLPFGSGRRGCPAMQL  449

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            G+T VRL +A L+HCF+++ P+ +   ELDMTE FGL +S+  HL+V+P YRLH
Sbjct  450  GLTTVRLALANLVHCFNFDLPSGLLPNELDMTETFGLSLSKTKHLLVVPTYRLH  503



>ref|XP_002511968.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF50637.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=501

 Score =   308 bits (788),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 219/330 (66%), Gaps = 11/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R GL   I+ SSPQAAELFLKT+D  FASRP  +A+ Y+SYG+  L    YG YW
Sbjct  62    PIMSMRLGLVPTIIISSPQAAELFLKTYDTNFASRPNIQASHYLSYGRKGLVFSEYGSYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+ RKLCTL+LLS  KI +F  MR+EE   ++  LK+AA  R  V+LS  VS+LI ++SC
Sbjct  122   RSTRKLCTLQLLSASKIQAFAPMRKEEYGLMVGKLKKAAAAREVVNLSVSVSDLIQNMSC  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFG      D      + V++E + L G  N+GD+ PFL   DLQG+ +R KA  + +
Sbjct  182   RMVFGVSTNNGDFR---LKSVVEETLRLVGAFNIGDFVPFLGAFDLQGVKKRSKACNEAF  238

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG-----EAEFQFNREHIKPTLSDL  908
             DK  E+I+D+HE+      + Q +DFVD +LS++         AE + +R +IK  L D+
Sbjct  239   DKIMEKIIDEHEKEAH-WENKQQRDFVDALLSVVNQSMISHDGAESEIDRSNIKAILIDI  297

Query  907   F-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
                A +     IEW ++EL+RHP+ MK +Q+EL++ +GLD+MVEE DL  L YL+MV+KE
Sbjct  298   IVAAVDTSATAIEWTLAELIRHPQAMKTLQDELQNVVGLDKMVEEKDLSKLTYLDMVIKE  357

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             S RLHPVAP L+P+E+ ++  I+G+HIPK+
Sbjct  358   SSRLHPVAPLLVPHESIDEITIDGYHIPKR  387


 Score =   151 bits (382),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 90/114 (79%), Gaps = 2/114 (2%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            K+SRI++N+WAI  D NVW+ N ++F+PERF G+N+D  G  F LIPFGSGRR CPG+ L
Sbjct  386  KRSRILVNIWAIGRDSNVWSDNVDEFLPERFIGTNVDLHGHDFRLIPFGSGRRGCPGIHL  445

Query  471  GITLVRLVVAQLLHCFDWEFPN-SMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VR+ +AQL+HCF+W+ P+  +   ELDM+EQFGL VSRA+HL ++P YRL
Sbjct  446  GLTTVRMAIAQLVHCFNWKLPDGDVSPSELDMSEQFGLTVSRASHLFLVPEYRL  499



>ref|XP_007159749.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
 gb|ESW31743.1| hypothetical protein PHAVU_002G263800g [Phaseolus vulgaris]
Length=483

 Score =   373 bits (958),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 181/318 (57%), Positives = 243/318 (76%), Gaps = 4/318 (1%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M+LR G    +V SSPQAAELFLKTHDLVFASRPP EAAKYIS+ Q NLS   YG YW
Sbjct  59    PVMYLRLGFVPTVVVSSPQAAELFLKTHDLVFASRPPHEAAKYISWDQRNLSFAEYGSYW  118

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTLELLS  KINSF++MR EEL  L++ L++AA    AVDLS+KVS + AD++C
Sbjct  119   RNMRKMCTLELLSQSKINSFRSMRTEELDLLVKVLREAADVGAAVDLSAKVSTVSADMAC  178

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV GKKY  +DLDE+GF+ V++E M L    N+GDY P+++ LDLQGL +RMK + K +
Sbjct  179   RMVLGKKYMDRDLDEKGFKAVMQEGMHLSATPNMGDYIPYIAALDLQGLNKRMKVVGKIF  238

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
             D FFE+I+D+H QS +    ++TKDFVD ML  + + E+E++  R +IK  + D+  G+ 
Sbjct  239   DDFFEKIIDEHMQSEK--EENKTKDFVDVMLGFVGTEESEYRIERPNIKAIMLDMLAGSM  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SELL++P +MKK+Q EL++ +G+++ VEESDLE L+YL+MV+KESLRLH
Sbjct  297   DTSATAIEWTLSELLKNPRVMKKLQVELENVVGMEKKVEESDLEKLEYLDMVIKESLRLH  356

Query  715   PVAP-LIPNEAREDCMIE  665
             PVAP LIP+++ EDCM++
Sbjct  357   PVAPLLIPHQSTEDCMVD  374


 Score =   158 bits (399),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 86/116 (74%), Gaps = 0/116 (0%)
 Frame = -3

Query  654  YQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            +Q     +++   I  DP+ W   EKF PERFEGSNID RGR FELIPFGSGRR CPG+Q
Sbjct  365  HQSTEDCMVDSECIMRDPDAWIEAEKFWPERFEGSNIDVRGREFELIPFGSGRRGCPGIQ  424

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LG+T++R  VAQL+HCFDW+ PN M   ELDM ++FGL + RANHL+ IP+YRL +
Sbjct  425  LGLTVIRHTVAQLVHCFDWKLPNDMMPAELDMADEFGLTMPRANHLLAIPSYRLSL  480



>ref|XP_009337244.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=523

 Score =   308 bits (790),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 160/333 (48%), Positives = 220/333 (66%), Gaps = 14/333 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R GL   IV SSPQAAELFLKTHD VF+SRP  +A++YISYG   ++   YGPYW
Sbjct  81    PIMSIRLGLVPTIVVSSPQAAELFLKTHDTVFSSRPKLQASEYISYGAKGIAFTEYGPYW  140

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCT++LL   KI  F  +RREE+  L++SLK+AA     V+LS KV EL+ DI+ 
Sbjct  141   RHVRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKAAEAGEVVNLSEKVGELVEDITY  200

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G K +    D    + +++E M +    N+GDY PFL  LD+QGLT+R K ++K  
Sbjct  201   RMVLGSKSD----DMFDIKTIIREVMSVLAFFNIGDYVPFLRPLDIQGLTKRNKRISKIV  256

Query  1072  DKFFERILDDHEQSGQSGSSD---QTKDFVDTMLSIMK-----SGEAEFQFNREHIKPTL  917
             D+ FE+I+ +HEQ  +S  +      KDFVD M+S++      + E  ++  R  +K  L
Sbjct  257   DQLFEKIIWEHEQVSKSERAQGHHHHKDFVDVMVSLIHQPLNPNDEQGYRIERTDVKAIL  316

Query  916   SDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
              D+  G+ +     I W ++ELLRHP +MK +QEEL+  IG DRMVEESDL  L YL  V
Sbjct  317   LDMITGSFDTSATAIVWNLAELLRHPRVMKHLQEELQRVIGTDRMVEESDLRKLSYLNAV  376

Query  739   VKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +KES RLHP+AP L+P E+ +D  ++G++IPKK
Sbjct  377   IKESFRLHPIAPFLVPRESMQDVTVDGYYIPKK  409


 Score =   148 bits (373),  Expect(2) = 1e-118, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKS+I+IN WAI  DPNVW+ N  KF PERF  SN+D RG  F+L+PFGSGRR CPG+QL
Sbjct  408  KKSKILINTWAIGRDPNVWSDNVGKFYPERFINSNVDLRGHDFQLLPFGSGRRGCPGVQL  467

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VRLV+A ++HCF+W+ P+ +  ++LDMTE FG + ++A HL+  P YRL
Sbjct  468  GLTTVRLVLANIVHCFNWDLPSGLLPQDLDMTETFGSVPTKAQHLLATPTYRL  520



>ref|XP_009337218.1| PREDICTED: cytochrome P450 CYP736A12-like [Pyrus x bretschneideri]
Length=523

 Score =   308 bits (789),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 219/333 (66%), Gaps = 14/333 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R GL   IV SSPQAAELFLKTHD VF+SRP  +A++YISYG   ++   YGPYW
Sbjct  81    PIMSIRLGLVPTIVVSSPQAAELFLKTHDTVFSSRPKLQASEYISYGAKGIAFTEYGPYW  140

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCT++LL   KI  F  +RREE+  L++SLK+AA     V+LS KV EL+ DI+ 
Sbjct  141   RHVRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKAAEAGEVVNLSEKVGELVEDITY  200

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G K +    D    + +++E M +    N+GDY PFL  LD+QGLT+R K ++K  
Sbjct  201   RMVLGSKSD----DMFDIKTIIREVMSVLAFFNIGDYVPFLRPLDIQGLTKRNKRISKMV  256

Query  1072  DKFFERILDDHEQ---SGQSGSSDQTKDFVDTMLSIMK-----SGEAEFQFNREHIKPTL  917
             D+ FE+I+ +HEQ   S Q       KDFVD +LS++      + E  ++  R  +K  L
Sbjct  257   DQLFEKIIWEHEQVSKSEQVQGHHHHKDFVDVLLSLIHQPLNPNDEQGYRIERTDVKAIL  316

Query  916   SDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
              D+  G+ +     I W ++ELLRHP +MK +QEEL+  IG DRMVEESDL  L YL  V
Sbjct  317   LDMITGSFDTSATAIVWNLAELLRHPRVMKHLQEELQRVIGTDRMVEESDLRKLSYLNAV  376

Query  739   VKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +KES RLHP+AP L+P E+ +D  ++G++IPKK
Sbjct  377   IKESFRLHPIAPFLVPRESMQDVTVDGYYIPKK  409


 Score =   147 bits (370),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKS+I+IN WAI  DPNVW+ N  KF PERF  SN+D RG  F+L+PFGSGRR CPG+QL
Sbjct  408  KKSKILINTWAIGRDPNVWSDNVGKFYPERFINSNVDLRGHDFQLLPFGSGRRGCPGMQL  467

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VRL +A ++HCF+W+ P+ +  ++LDMTE FG + ++A HL  +P YRL
Sbjct  468  GLTTVRLALANIVHCFNWDLPSGLLPQDLDMTETFGSVPTKAQHLFAMPTYRL  520



>ref|XP_003530005.1| PREDICTED: cytochrome P450 71A1-like [Glycine max]
 gb|KHN20713.1| Cytochrome P450 71A1 [Glycine soja]
Length=503

 Score =   302 bits (773),  Expect(2) = 3e-118, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 209/326 (64%), Gaps = 7/326 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ G    IV SSP+ AELFLKTHD VFASRP  +A+KY+SYG   +    YGPYW
Sbjct  67    PIMSIKLGQIPTIVVSSPETAELFLKTHDTVFASRPKTQASKYMSYGTRGIVFTEYGPYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CT ELLS  K+     +RR+EL  L++SL++AA     V++S KV ELI++I C
Sbjct  127   RNVRKVCTTELLSASKVEMLAPLRRQELGILVKSLEKAAASHDVVNVSDKVGELISNIVC  186

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +M+ G+  +    D    +G+  + + L G  N+ DY P+    DLQGL R+ K  +K +
Sbjct  187   KMILGRSRD----DRFDLKGLTHDYLHLLGLFNVADYVPWAGVFDLQGLKRQFKQTSKAF  242

Query  1072  DKFFERILDDHEQSGQSGSSD-QTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GA  899
             D+ FE I+ DHE    +   +  +KDFVD +LS+M         +R +IK  L D+  GA
Sbjct  243   DQVFEEIIKDHEHPSDNNKENVHSKDFVDILLSLMHQPSEHHVIDRINIKAILLDMIAGA  302

Query  898   SEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
              +   I +EW MSELLRHP +MKK+Q+EL   +G DR VEESDL  L YL MVVKE+LRL
Sbjct  303   YDTSAIGVEWAMSELLRHPRVMKKLQDELNIVVGTDRPVEESDLAKLPYLNMVVKETLRL  362

Query  718   HPVAP-LIPNEAREDCMIEGFHIPKK  644
             +PV P L+P E+ ED  I G++I KK
Sbjct  363   YPVGPLLVPRESLEDITINGYYIKKK  388


 Score =   153 bits (386),  Expect(2) = 3e-118, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            +  +KKSRI+IN WAI  DP VW+ N E F PERF  SNID RG++F+LIPFGSGRR CP
Sbjct  383  YYIKKKSRILINAWAIGRDPKVWSDNVEMFYPERFLNSNIDMRGQNFQLIPFGSGRRGCP  442

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+QLGIT   LV+AQL+HCF+WE P  M  +++DMTE FGL + R+ HL+ +P +RL
Sbjct  443  GIQLGITTFSLVLAQLVHCFNWELPFGMSPDDIDMTENFGLSLPRSKHLLAVPTHRL  499



>gb|KEH15707.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=430

 Score =   290 bits (742),  Expect(2) = 3e-118, Method: Compositional matrix adjust.
 Identities = 151/325 (46%), Positives = 208/325 (64%), Gaps = 46/325 (14%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR GL   IV SSPQAAELFLKTHDL+FASRPP EA K + Y Q +          
Sbjct  40    PIMHLRLGLVPTIVVSSPQAAELFLKTHDLLFASRPPSEAGKLMFYNQKDF---------  90

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
                                               +K+AA D   VD+S+KVS L AD++C
Sbjct  91    ----------------------------------MKEAANDGTTVDISAKVSTLTADMTC  116

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMVFGK Y  K L E+GF+ V++E M+L    N+ DY P++  LDL+GL++RMK ++K +
Sbjct  117   RMVFGKNYLDKGLYEKGFKAVVQELMNLAATPNISDYIPYIGALDLKGLSKRMKEISKIF  176

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D+F E+I+D+H QS Q+   D+TKDFVD ML  + + ++E++  R +IK  + D L GA 
Sbjct  177   DEFLEKIIDEHVQS-QNKDDDKTKDFVDVMLDFVGTEQSEYRIERSNIKAIMMDMLIGAM  235

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW +SELL++P +MKKVQ+EL++ +G+ R VEESDL+ L+YL +V+KESLR+H
Sbjct  236   DTSATSIEWTISELLKNPRVMKKVQKELETVVGMKRKVEESDLDKLEYLNIVIKESLRIH  295

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PV P L+P+++ EDC +E F IPK 
Sbjct  296   PVVPLLVPHQSMEDCTVEEFFIPKN  320


 Score =   164 bits (416),  Expect(2) = 3e-118, Method: Compositional matrix adjust.
 Identities = 75/115 (65%), Positives = 88/115 (77%), Gaps = 0/115 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K S I++N WAI  DPN WT+PEKF PERFEG+NID  G  F+LIPF SGRR CPG
Sbjct  315  FFIPKNSMIVVNAWAIMRDPNSWTDPEKFWPERFEGNNIDVGGHDFQLIPFSSGRRGCPG  374

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYR  316
            LQLG+T+VRLVVAQL+HCFD++ PN M   +LDM E FG+ + RANHLI IP YR
Sbjct  375  LQLGLTMVRLVVAQLVHCFDFKLPNHMLPSDLDMAEAFGVTMRRANHLIAIPVYR  429



>ref|XP_004299223.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=504

 Score =   294 bits (752),  Expect(2) = 6e-118, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 225/333 (68%), Gaps = 17/333 (5%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM LR G    IV SSP+AAELFLKTHD  FASRP  +A++Y++YG   L+   YGPYWR
Sbjct  66    IMSLRLGNVPTIVISSPKAAELFLKTHDTNFASRPKIQASEYLAYGTKGLAFSEYGPYWR  125

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             ++RK+CTL+L    K+ +F  +R+EEL  L+  LK+AA +   VD+S K+ E+  DI+ R
Sbjct  126   HVRKICTLQLFCPAKLEAFAPLRKEELGGLVGKLKRAAEEGEVVDVSEKIGEMNEDITYR  185

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MV G K +    D+   +  ++E   L G  N+ D+ P LS  D+QGLT+R+K ++KT D
Sbjct  186   MVLGCKRD----DKFDLKAFVEEMFFLVGAFNISDFIPSLSAFDIQGLTKRLKKVSKTAD  241

Query  1069  KFFERILDDHEQSGQS--GSSDQTKDFVDTMLS----IMKSGEAEFQF-NREHIKPTLSD  911
             +  ++I++DHEQ+ ++  G   Q +DFVD +LS    ++   + +  F +RE++K  L D
Sbjct  242   QLLDKIINDHEQAAETKGGKQGQHEDFVDVLLSFTNQLLNPNDEQVHFLDRENVKAILLD  301

Query  910   LFGA---SEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
             +  A   + A TI+  W ++EL+RHP IMK++QEEL++ +G+DRMVEESDL  L YL +V
Sbjct  302   MITAAFDTSATTII--WSLAELMRHPRIMKQLQEELQTVVGMDRMVEESDLPKLDYLNLV  359

Query  739   VKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             VKES RLHPVAP L+P+E+ +D  I+G+ IPKK
Sbjct  360   VKESFRLHPVAPLLVPHESIKDITIDGYDIPKK  392


 Score =   159 bits (403),  Expect(2) = 6e-118, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSR+I+N W+I  DPNVW+ N E+F PERF  SNID RG  ++LIPFG+GRR CPG+QL
Sbjct  391  KKSRLIVNFWSIARDPNVWSENVEEFYPERFTNSNIDLRGHDYQLIPFGTGRRGCPGMQL  450

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VRLV+AQL+HCF+WE PN M  ++L+MTE+FGL +S+A HL+  P YRL
Sbjct  451  GLTTVRLVLAQLVHCFNWELPNGMLPQDLNMTEKFGLSLSKAKHLLAKPTYRL  503



>ref|XP_004252295.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=496

 Score =   369 bits (946),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 246/333 (74%), Gaps = 8/333 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   IV SS   AE FLKT+D +FA++P  EAA Y++YGQ N+    YGPYW
Sbjct  62    PIMYMRLGLVPTIVVSSSDVAEKFLKTYDHIFANKPHNEAAHYLAYGQKNIIFAKYGPYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAAL-DRVAVDLSSKVSELIADIS  1256
             RNMRKLCT  LL+N KINSFQ++R +++  +IESL+  +  +RV VDLS +V+ L A+++
Sbjct  122   RNMRKLCTQHLLTNQKINSFQSLRSQQVELMIESLQNESRGERVVVDLSERVASLNANMT  181

Query  1255  CRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             C MVFGKKY  +D D+RGF+ VL+E + L    NLGD+FPFL  +DLQGLTRR+K L+K 
Sbjct  182   CLMVFGKKYMDEDFDKRGFKAVLQEVVHLAAITNLGDFFPFLGVIDLQGLTRRLKDLSKV  241

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS  896
             +D+F E+I+D+H    +S   +QTKDFV TML  M+SG+AEFQF+R HIK  L D+  A+
Sbjct  242   FDEFLEKIIDEHV---ESHDENQTKDFVHTMLEFMQSGKAEFQFDRIHIKAVLFDMIVAA  298

Query  895   -EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
              +     I+WI++ELLRHP +MKK+Q E+K  +GL+RMV+ESDLE+LKYL+MVVKE +RL
Sbjct  299   IDTSATTIDWILTELLRHPHVMKKLQIEIKQVVGLERMVKESDLENLKYLDMVVKEGMRL  358

Query  718   HPVAPLIPNEAREDCMIEGFHIPKK---ITNHH  629
             H V P+   EA EDC+I+GF+I K    + NH+
Sbjct  359   HSVVPVTQREAMEDCVIDGFNIRKGSRIMINHY  391


 Score =   161 bits (407),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  +K SRI+IN +AI  DPN+W+ PEKF+PERF GSNID RGR F+L+PF SGRR CP 
Sbjct  378  FNIRKGSRIMINHYAIQRDPNLWSEPEKFLPERFIGSNIDVRGRDFQLLPFNSGRRSCPA  437

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLGI +VRLVVAQL+HCFDWE PN M   +LD+ E FG++ S+  HL+ IP  RL+
Sbjct  438  IQLGIIVVRLVVAQLVHCFDWELPNGMQPCDLDLEEHFGIVTSKEKHLMAIPTCRLN  494



>ref|XP_006354707.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=383

 Score =   285 bits (728),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 191/269 (71%), Gaps = 5/269 (2%)
 Frame = -2

Query  1447  YGPYWRNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELI  1268
             YGPYWR+MRKLCT +LLSN+KINSFQ+MR++EL  L+  L++AA +R  VDLS+K++ L 
Sbjct  4     YGPYWRHMRKLCTQQLLSNVKINSFQSMRKQELQILVNFLEKAASNRDVVDLSAKLASLS  63

Query  1267  ADISCRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKA  1088
             A+++C MV GKKY   D D   F+ ++KE   +    NL + FPFL  +D QG   RMK 
Sbjct  64    ANMACLMVIGKKYNNVDGD---FKDMVKETSRMAATPNLAELFPFLRFIDFQGSIHRMKQ  120

Query  1087  LAKTYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDL  908
             +AK+ D+F E ++D+H +   S  S  + D VDT++ IM+SGEAEF+F+R H+K  L DL
Sbjct  121   IAKSCDEFLENVIDEHARQYSSDQSKTSTDMVDTLMEIMQSGEAEFEFDRRHVKAILLDL  180

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               AS +  +  IEWI+SEL RHP +MKK+Q EL   +G   +VEE DLE+L YL MV+KE
Sbjct  181   LVASMDTSSTSIEWILSELFRHPNVMKKLQSELDYVVGQKGIVEEKDLENLDYLNMVIKE  240

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPK  647
               RLHPVAP L+P+E+ EDC ++GFHIPK
Sbjct  241   GFRLHPVAPLLLPHESIEDCTLDGFHIPK  269


 Score =   168 bits (425),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+++NVWAI  DP+VW  PEKFIPERF  S ID RG++F+L+PFGSGRR CPG
Sbjct  265  FHIPKGSRVLVNVWAIGRDPDVWHEPEKFIPERFVESTIDVRGQNFQLLPFGSGRRSCPG  324

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            LQLG+T+VRLVVAQL+H FDWEFPN M   +++MTE+FGL+ +RA  L+ IP YRLH
Sbjct  325  LQLGLTIVRLVVAQLVHSFDWEFPNGMMSCDINMTEKFGLVTARALSLMAIPIYRLH  381



>ref|XP_008374739.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=508

 Score =   304 bits (779),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 218/331 (66%), Gaps = 12/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+ A+LFLKTHD +FAS P  +A++Y++YG   ++   YGPYW
Sbjct  67    PIMSMRLGFIPTIVVSSPKTAKLFLKTHDNIFASXPKLQASEYMAYGTKAMAFTEYGPYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
               +RKL TL+LL   KI  F  +RREE+  L++SLK AA     VD S KV EL+  I+ 
Sbjct  127   XRIRKLYTLQLLCPSKIEGFAPLRREEVGLLVQSLKVAAEAGEVVDFSEKVGELVEGITY  186

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G+K +    D    +G+++E + L G  N+ DY PFLS LDLQGLT+RMK ++K  
Sbjct  187   RMVLGRKND----DMFDLKGIIEEALFLTGAFNISDYVPFLSPLDLQGLTKRMKRVSKXV  242

Query  1072  DKFFERILDDHEQSGQSG-SSDQTKDFVDTMLS-----IMKSGEAEFQFNREHIKPTLSD  911
             D+  E+I+ DHEQ  +S    +  KDFVD +LS     +  + E  +   R + K  L D
Sbjct  243   DQLLEKIIQDHEQVSRSEVQGNHHKDFVDVLLSSIHQPLNPNBEEVYMLERTNXKAILLD  302

Query  910   LF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             +  GA +     I W ++ELLRHP++MK++QEEL+S IG+DRMVEESDL  L YL MVVK
Sbjct  303   MIAGAXDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMDRMVEESDLPKLDYLSMVVK  362

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             ESLRL PVAP L+P+++ ED  ++G+HIPKK
Sbjct  363   ESLRLXPVAPLLVPHQSMEDITVDGYHIPKK  393


 Score =   147 bits (372),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSR+ IN+W I  DP+VW+ N E+F PERF  +N+D RG  F+LIPFGSGRR C  +QL
Sbjct  392  KKSRVFINIWTIGRDPSVWSDNVEEFYPERFMNNNVDLRGHDFQLIPFGSGRRGCXAMQL  451

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            G+T VRLV+  LLHCF+WE P+ M  ++LDMTE+FGL +S+A HL+ +P  RL+
Sbjct  452  GLTTVRLVLGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMPTCRLY  505



>ref|XP_010045641.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=506

 Score =   291 bits (744),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 211/329 (64%), Gaps = 10/329 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR GL   +V SSP+AA LFL THD +FASRP    A+   Y    L    YGPYW
Sbjct  69    PIMSLRLGLVPAVVVSSPEAAGLFLGTHDAIFASRPRIPEAELEFYTTKGLVFTEYGPYW  128

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCT  LLS  ++ SF+ MRREE+  L+ SL+++A    AVDLS++V   + D++C
Sbjct  129   RSVRKLCTTHLLSAARVRSFEGMRREEVGSLVASLRESAAAHEAVDLSAQVERAMEDMAC  188

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ G+  +     E   +G+++E   + G  NL DY PFL  LDLQG +R+ KA+ ++ 
Sbjct  189   RMILGRSTD----GEHDLKGIIQENARVAGVFNLADYVPFLRPLDLQGSSRQFKAVRRSV  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG----EAEFQFNREHIKPTLSDLF  905
             DK  E+I+DDH Q      S+  +DF+D +LS+M       E ++  +R +IK  + D+ 
Sbjct  245   DKLLEKIIDDHVQDTAHYDSEHQQDFIDILLSMMNQPIGPREEKYIIDRTNIKAIILDMI  304

Query  904   -GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKES  728
              G+ E  +  I+W  SEL+R+P+ M  +QEEL++ +GL RMVEESDL  L YL+MVVKES
Sbjct  305   SGSFETASTSIDWAFSELMRNPQTMAHLQEELETIVGLTRMVEESDLPKLNYLDMVVKES  364

Query  727   LRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +RLHPV P L+P E+ ED +I    IPKK
Sbjct  365   MRLHPVVPLLVPRESMEDAVINECFIPKK  393


 Score =   160 bits (405),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSRII+N+WAI  DP+VW+ N EKF+PERF  + ID +G HFEL+PFGSGRR CPG+QL
Sbjct  392  KKSRIIVNIWAIGRDPSVWSENTEKFVPERFVDNGIDVKGHHFELLPFGSGRRGCPGIQL  451

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  V+LV+AQL+HCF WE P  M   ++DM+E+FGL V RANHL+ +P YRL
Sbjct  452  GLLQVKLVLAQLVHCFKWEIPEDMVPSDIDMSERFGLSVPRANHLLAVPTYRL  504



>ref|XP_002514610.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
 gb|EEF47716.1| flavonoid 3-hydroxylase, putative [Ricinus communis]
Length=511

 Score =   311 bits (796),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 155/329 (47%), Positives = 217/329 (66%), Gaps = 14/329 (4%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM L+ G  + +V SS QAAELFLKTHD  FA+RP    + Y+SYG   +    YGPYWR
Sbjct  77    IMFLKLGFVDTVVVSSAQAAELFLKTHDAAFANRPKVLVSHYLSYGSRGMIFDDYGPYWR  136

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             N+RK+CTL+LLS+ KI SF  +R+EEL  ++ ++KQAA  +  VD+S+++ +   ++ CR
Sbjct  137   NVRKVCTLQLLSSSKIESFAPLRKEELELMVATIKQAAERKEMVDVSARLGDFSENLICR  196

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             M+FG++      DE   R ++KE ++L G +N+ DY P++  LDLQGLTRRM+A  K  D
Sbjct  197   MIFGQRSN----DEFDLRPLIKESLELIGAINIADYVPYIGVLDLQGLTRRMRAYRKGMD  252

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEA--------EFQFNREHIKPTLS  914
             K  E+I+D HE+ G+  + +Q KDF+D MLS+M              +  +R  IK  + 
Sbjct  253   KVLEKIIDSHEKDGRWKTKEQ-KDFIDVMLSVMNRSSPMIPPNDPQSYVIDRTCIKAIIQ  311

Query  913   DLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVV  737
             D+  G  E  T  IEW  SELLRHP +MK +Q+EL++ +GLDRMVEE DL +L YL+M+V
Sbjct  312   DIIVGGFETSTSSIEWTFSELLRHPRVMKCLQKELETVVGLDRMVEERDLPNLTYLDMIV  371

Query  736   KESLRLHPVAPLIPNEAREDCMIEGFHIP  650
             KESLRL+P  PLIP +  ED  + G+HIP
Sbjct  372   KESLRLYPTLPLIPRKCVEDITVNGYHIP  400


 Score =   140 bits (354),  Expect(2) = 3e-117, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 83/113 (73%), Gaps = 5/113 (4%)
 Frame = -3

Query  642  SRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLGI  466
            SRI++N WAI  D NVW+ N  +F PERF+   +D RG HF+LIPFGSGRR CPG+ LG+
Sbjct  403  SRILVNAWAIGRDTNVWSDNALEFYPERFKDECVDLRGLHFQLIPFGSGRRSCPGMSLGL  462

Query  465  TLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
              +RLV+AQL HCF+W+ P+     +LDMTE++GL + RANH   +P YRLH+
Sbjct  463  RNIRLVIAQLAHCFNWDLPSG----DLDMTEKYGLTLPRANHFSALPTYRLHV  511



>ref|XP_004169555.1| PREDICTED: cytochrome P450 71A1-like [Cucumis sativus]
Length=429

 Score =   308 bits (789),  Expect(2) = 4e-117, Method: Compositional matrix adjust.
 Identities = 148/320 (46%), Positives = 220/320 (69%), Gaps = 6/320 (2%)
 Frame = -2

Query  1600  LRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWRNMR  1421
             ++ GL + IV SSP AA+LFLKTHD +FA+RP  + +  +SY   N++   +GPYW++MR
Sbjct  1     MKLGLQSTIVVSSPNAAKLFLKTHDPIFANRPVPQTSNQMSYDHKNIAFVQFGPYWQSMR  60

Query  1420  KLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCRMVF  1241
             K+C+  LL++ K+NSF ++RR+EL  LI  LK+AA +   VDLSSK+S L  D+ C M+F
Sbjct  61    KICSSHLLTSSKVNSFSSIRRQELGLLIHHLKEAARNHAIVDLSSKISSLTFDVICVMLF  120

Query  1240  GKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYDKFF  1061
             GKK+  K+L        ++E   L G  NLGD+FPF++ LDLQGL RR KA+ K  D F 
Sbjct  121   GKKFVDKEL-----TAAIREGTSLSGAPNLGDFFPFIAFLDLQGLGRRAKAVNKVVDGFL  175

Query  1060  ERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDL-FGASEAIT  884
             + I+++  +      ++ ++ FVD ML +++S E E Q +R +IK  + DL  G  ++ +
Sbjct  176   DMIIEERLEFKDKNKTESSELFVDVMLDLIRSEEMEHQIDRSNIKAVIFDLMIGGVDSSS  235

Query  883   ILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHPVAP  704
               I W +SE++++P++MKK+QEELK  +GL++MVEES L  LKYL+M +KESLR+HPV P
Sbjct  236   TTIIWALSEIIKNPQVMKKIQEELKEVVGLNKMVEESHLNQLKYLDMTIKESLRIHPVIP  295

Query  703   LIPNEAREDCMIEGFHIPKK  644
             LIP ++ +DC + G+HIPK 
Sbjct  296   LIPRKSIQDCNVNGYHIPKN  315


 Score =   142 bits (359),  Expect(2) = 4e-117, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 84/116 (72%), Gaps = 2/116 (2%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGR--HFELIPFGSGRRICPGLQ  475
            K + IIIN WAI  DP  W  P+KF P+RF  + ID+ G   +FE+IPFGSGRR CPG+Q
Sbjct  314  KNTDIIINDWAIGQDPCYWIEPQKFNPDRFVDTQIDFIGNKNNFEMIPFGSGRRGCPGMQ  373

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LG+ LVR++VAQL+HCFDWE PN +   ELDM+E FGL   RA +L V+P YR+ I
Sbjct  374  LGLVLVRMIVAQLVHCFDWELPNGVLPSELDMSEDFGLSCPRAQNLRVVPVYRVCI  429



>ref|XP_004301061.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=504

 Score =   290 bits (741),  Expect(2) = 7e-117, Method: Compositional matrix adjust.
 Identities = 154/333 (46%), Positives = 222/333 (67%), Gaps = 17/333 (5%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM +R G    IV SSP+AAELFLKTHD  FASRP  +A++Y+SYG   ++   YGPYWR
Sbjct  66    IMSIRLGNVPTIVISSPKAAELFLKTHDTNFASRPKIQASEYLSYGTKGMAFSEYGPYWR  125

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             ++RKLCTL+L  + K+ +F  +R+EEL  L+  LK+AA +   VD+S K+ E+   I+ R
Sbjct  126   HVRKLCTLQLFCSAKLEAFAPLRKEELGGLVGKLKKAAEEGEVVDVSEKIGEMNEGITYR  185

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MV G K +    D    + +++E   L G  N+ D+ P LS  D+QGLT+R+K +++T D
Sbjct  186   MVLGCKRD----DRFDLKAIVEEMFFLVGAFNISDFIPSLSAFDIQGLTKRLKKVSRTVD  241

Query  1069  KFFERILDDHEQSGQS--GSSDQTKDFVDTMLSIMKS----GEAEFQF-NREHIKPTLSD  911
             +  ++I+DDHEQ+ ++  G   Q +DFVD +LS  K      + +  F +RE++K  L D
Sbjct  242   QLLDKIIDDHEQAAETEGGKQGQHEDFVDVLLSFTKQPLNPNDEQVHFLDRENVKAILLD  301

Query  910   LFGA---SEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
             +  A   + A TI+  W ++EL+RHP IMK++QEEL+  +G+DR VEESDL  L YL +V
Sbjct  302   MITAAFDTSATTII--WSLAELMRHPRIMKQLQEELQIVVGMDRGVEESDLPKLDYLNLV  359

Query  739   VKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             VKES RLHPVAP L+P+E+ +D  I+G+ IPKK
Sbjct  360   VKESFRLHPVAPLLLPHESIKDITIDGYDIPKK  392


 Score =   160 bits (406),  Expect(2) = 7e-117, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSR+I+N W+I  DPNVW+ N E+F PERF  SNID +G  ++LIPFG+GRR CPG+QL
Sbjct  391  KKSRLIVNFWSIARDPNVWSENVEEFCPERFTNSNIDLQGHDYQLIPFGTGRRGCPGMQL  450

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VRLV+AQL+HCF+WE PN M  ++LDMTE+FGL +S+A HL+  P YRL
Sbjct  451  GLTTVRLVLAQLMHCFNWELPNGMLPQDLDMTEKFGLSLSKAKHLLAKPTYRL  503



>ref|XP_006346619.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=493

 Score =   365 bits (937),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 179/337 (53%), Positives = 246/337 (73%), Gaps = 9/337 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R GL   I+ SS   AE  LKT+D +FA++P  EAA Y++YGQ N+    YGPYW
Sbjct  62    PIMYMRLGLVPTIIVSSTDVAEKILKTYDHIFANKPHNEAAHYLAYGQKNIIFAKYGPYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCT  LL+N KINSFQ++RR+++  +I+SL+     RV VDLS +V+ L A+++C
Sbjct  122   RNMRKLCTQHLLTNQKINSFQSLRRQQVELMIKSLQNEG--RVVVDLSERVASLNANMTC  179

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  +D D+RGF+ VL+E + L    NLGD+FPFL  +DLQGLTRR+K L+K +
Sbjct  180   LMVFGKKYMDQDFDKRGFKAVLQEVVHLAAITNLGDFFPFLGVIDLQGLTRRLKDLSKVF  239

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             D+F E+I+++H    +S   +Q+KDFVDTML IM+SG+ EFQF+R HIK  L D+  A+ 
Sbjct  240   DEFLEKIINEHV---ESRDENQSKDFVDTMLDIMQSGKMEFQFDRIHIKAVLFDMIVAAI  296

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     I+WI++ELLRHP +MKK+Q EL+  +GL+RMV+ESDLE+LKYL+MVVKE +RLH
Sbjct  297   DTSATSIDWILTELLRHPHVMKKLQNELEQVVGLERMVKESDLENLKYLDMVVKEGMRLH  356

Query  715   PVAPLIPNEAREDCMIEGFHIPKK---ITNHHKCLGD  614
              V P+   EA EDC+++GF+I K    + NH+    D
Sbjct  357   SVVPVTQREAMEDCVVDGFNIRKGTRIMINHYAIQRD  393


 Score =   161 bits (408),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F  +K +RI+IN +AI  DPNVW+ PEKF PERF GS++D RGR F+L+PF SGRR CP 
Sbjct  375  FNIRKGTRIMINHYAIQRDPNVWSEPEKFFPERFIGSSVDVRGRDFQLLPFNSGRRSCPA  434

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLGI +VRLVVAQL+HCFDWE PN M   +LD+ E FG++ S+  HL+ IP YRL+
Sbjct  435  IQLGIIVVRLVVAQLVHCFDWELPNDMQPCDLDLEEHFGIVTSKEKHLMAIPTYRLN  491



>emb|CAN69566.1| hypothetical protein VITISV_033535 [Vitis vinifera]
Length=1390

 Score =   303 bits (776),  Expect(2) = 3e-116, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 225/333 (68%), Gaps = 17/333 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R G    ++ SS QA +LFLKTHD+VFASRP  +A ++++YG   ++   YGPYW
Sbjct  66    PIMYMRLGCVPTVIVSSAQATKLFLKTHDVVFASRPKLQAFEHLTYGTKGIAFSEYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RKLCT+ELL+  KINSF ++R+EE+  L++SLK+ A     VD+S+KV++++ DIS 
Sbjct  126   RNVRKLCTVELLNTAKINSFASVRKEEVGMLVQSLKEMAAAGEVVDISTKVAQVVEDISY  185

Query  1252  RMVFGKKYE-MKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             RMVFG+  + M DL     + +++E   L G  NLGDYFPFL  LDL    +R KA+ K 
Sbjct  186   RMVFGRNKDGMIDL-----KTLVREGTRLAGTFNLGDYFPFLGPLDLS--VQRFKAINKA  238

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSD  911
              D+  E+I+D H Q G  G      +F+D MLS+M +      E+ +  +R ++K  + D
Sbjct  239   ADEVLEKIIDRHIQDG--GKDHNHSNFIDIMLSLMSNFSNLRSESSYIIDRTNVKAIVLD  296

Query  910   -LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
              L G  ++ +  IEW+ SELLRHP +M+++Q EL++ + +DRMV+ESDLE+L YL MVVK
Sbjct  297   MLVGGIDSSSTTIEWVFSELLRHPRVMRQLQHELQNVVKMDRMVDESDLENLVYLNMVVK  356

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKKIT  638
             E LRLHP+ P L+P+ + ED  IEG  IPK+ T
Sbjct  357   EVLRLHPIGPFLVPHASAEDITIEGHFIPKRST  389


 Score =   145 bits (365),  Expect(2) = 3e-116, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 82/101 (81%), Gaps = 1/101 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            K+S I+IN WAI  DPN+W+ N ++F+PERF  SNID +GR FELIPFGSGRR CPG+QL
Sbjct  386  KRSTILINTWAIGRDPNIWSDNVDEFLPERFINSNIDLQGRDFELIPFGSGRRGCPGIQL  445

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSR  349
            G+  VRLV+AQLLHCF+WE PN M  ++LDM+E+FGL + R
Sbjct  446  GLRTVRLVLAQLLHCFNWELPNDMSSDDLDMSEKFGLTMPR  486



>ref|XP_010094781.1| Cytochrome P450 71D8 [Morus notabilis]
 gb|EXB56946.1| Cytochrome P450 71D8 [Morus notabilis]
Length=508

 Score =   293 bits (750),  Expect(2) = 6e-116, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 218/334 (65%), Gaps = 18/334 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    +V SSPQAAEL L+THD +FASRP  +A+ Y+SYG   ++   YGPYW
Sbjct  64    PIMSMRLGRVPTVVVSSPQAAELILQTHDAIFASRPKVQASAYLSYGSKGMAFNEYGPYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK CTL+LL++ K  SF A+R  E+  L+ SL+ AA     VD+SSKV  L+ADISC
Sbjct  124   RNVRKFCTLQLLTSSKTASFAALRAAEVASLVASLRAAAAAGEVVDVSSKVGRLVADISC  183

Query  1252  RMVFGKKYEMKDLDER-GFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             R+V G+       DER   + +++E M L G  NL DY P+L+ LDLQG TR++K + K 
Sbjct  184   RIVLGRNVG----DERYDLKRLVEEIMRLTGAFNLADYVPYLAPLDLQGYTRQLKKVNKE  239

Query  1075  YDKFFERILDDHEQSG--QSGSSDQTKDFVDTMLSIM------KSGEAEFQFNREHIKPT  920
              DK  E I+ +HE+ G  + G  D   DF+D +LS+M      +  E  F  +R +IK  
Sbjct  240   MDKVLEEIIAEHEEVGRYKQGHHD---DFIDVLLSLMNQPMNPQDRENVFIIDRTNIKAI  296

Query  919   LSDLFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEM  743
             L DL  A+ +  +  +EW +SEL+++P +MK  Q EL+S IG++R VEE D+E L YL+M
Sbjct  297   LVDLLTAALDTSSASVEWTLSELIKNPRVMKNAQRELESVIGMERTVEEKDVEKLDYLDM  356

Query  742   VVKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             VVKES RLHPV P L+P E+ ++  I+G+HIP K
Sbjct  357   VVKESFRLHPVIPLLLPRESLKEITIKGYHIPNK  390


 Score =   154 bits (388),  Expect(2) = 6e-116, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 88/113 (78%), Gaps = 2/113 (2%)
 Frame = -3

Query  645  KSRIIINVWAITHDPNVWT-NPEKFIPERF-EGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KSR+I+NVWAI  DPNVW+ N E+F PERF E  +ID+RGR F L+PFGSGRR CPG+QL
Sbjct  390  KSRVIVNVWAIGRDPNVWSENVEEFYPERFGESDDIDFRGRDFRLLPFGSGRRGCPGMQL  449

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T +  VVAQL+HCF WE P+ M   E+DM E+FGL V RANHL++ P YRL
Sbjct  450  GLTTIHFVVAQLVHCFSWEVPSGMNPAEIDMIEKFGLSVVRANHLLLKPIYRL  502



>gb|KCW83844.1| hypothetical protein EUGRSUZ_B00712 [Eucalyptus grandis]
Length=436

 Score =   286 bits (733),  Expect(2) = 7e-116, Method: Compositional matrix adjust.
 Identities = 149/327 (46%), Positives = 209/327 (64%), Gaps = 10/327 (3%)
 Frame = -2

Query  1606  MHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWRN  1427
             M LR GL   +V SSP+AA LFL THD +FASRP    A+   Y    L    YGPYWR+
Sbjct  1     MSLRLGLVPAVVVSSPEAAGLFLGTHDAIFASRPRIPEAELEFYTTKGLVFTEYGPYWRS  60

Query  1426  MRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCRM  1247
             +RKLCT  LLS  ++ SF+ MRREE+  L+ SL+++A    AVDLS++V   + D++CRM
Sbjct  61    VRKLCTTHLLSAARVRSFEGMRREEVGSLVASLRESAAAHEAVDLSAQVERAMEDMACRM  120

Query  1246  VFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYDK  1067
             + G+  +     E   +G+++E   + G  NL DY PFL  LDLQG +R+ KA+ ++ DK
Sbjct  121   ILGRSTD----GEHDLKGIIQENARVAGVFNLADYVPFLRPLDLQGSSRQFKAVRRSVDK  176

Query  1066  FFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG----EAEFQFNREHIKPTLSDLF-G  902
               E+I+DDH Q      S+  +DF+D +LS+M       E ++  +R +IK  + D+  G
Sbjct  177   LLEKIIDDHVQDTAHYDSEHQQDFIDILLSMMNQPIGPREEKYIIDRTNIKAIILDMISG  236

Query  901   ASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLR  722
             + E  +  I+W  SEL+R+P+ M  +QEEL++ +GL RMVEESDL  L YL+MVVKES+R
Sbjct  237   SFETASTSIDWAFSELMRNPQTMAHLQEELETIVGLTRMVEESDLPKLNYLDMVVKESMR  296

Query  721   LHPVAP-LIPNEAREDCMIEGFHIPKK  644
             LHPV P L+P E+ ED +I    IPKK
Sbjct  297   LHPVVPLLVPRESMEDAVINECFIPKK  323


 Score =   160 bits (405),  Expect(2) = 7e-116, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSRII+N+WAI  DP+VW+ N EKF+PERF  + ID +G HFEL+PFGSGRR CPG+QL
Sbjct  322  KKSRIIVNIWAIGRDPSVWSENTEKFVPERFVDNGIDVKGHHFELLPFGSGRRGCPGIQL  381

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  V+LV+AQL+HCF WE P  M   ++DM+E+FGL V RANHL+ +P YRL
Sbjct  382  GLLQVKLVLAQLVHCFKWEIPEDMVPSDIDMSERFGLSVPRANHLLAVPTYRL  434



>ref|XP_007036495.1| Cytochrome P450 superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY20996.1| Cytochrome P450 superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=535

 Score =   294 bits (753),  Expect(2) = 8e-116, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 217/333 (65%), Gaps = 11/333 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    IV SSPQAAELFLKTHD+VFASRP  +A +Y+SYG   +    YG YW
Sbjct  88    PIMLLRLGYVPTIVVSSPQAAELFLKTHDVVFASRPKVQACEYLSYGGKGMGFTEYGSYW  147

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R +RK CTL LLS  K+  F  +R+ EL  ++E++K+AA     VD+S KV E+I DI  
Sbjct  148   RTVRKWCTLHLLSGSKVEYFAPLRKAELGSMVETVKKAAAAGETVDISGKVGEVIEDIMY  207

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +M+FG+    +D D    + ++KE   L G  NL D+ P L+ LDLQGL ++ K ++K  
Sbjct  208   KMIFGRPSNSED-DNINLKLLIKEISRLAGAFNLSDFVPCLAPLDLQGLAQKQKRISKIL  266

Query  1072  DKFFERILDDHEQSGQSGSSDQT--KDFVDTMLSIMKSG------EAEFQFNREHIKPTL  917
             DKF E+I+D+HEQ+  S   +Q   ++FV  M+S++         E E+  +R +IK  +
Sbjct  267   DKFLEKIIDEHEQAVGSNPEEQKPHRNFVHVMVSLLNKPMNPHDEEQEYIIDRTNIKAIM  326

Query  916   SDLFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
              ++  A  E+    IEW +SELL+HP +M  +Q+EL++ +G  RMVEESDL  L YL++V
Sbjct  327   LEMIAAGLESSAAAIEWALSELLKHPRVMFSLQQELETVVGRSRMVEESDLPQLTYLDVV  386

Query  739   VKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             VKESLRLHPV P LIP+E+ ED  I+G+ IPKK
Sbjct  387   VKESLRLHPVGPLLIPHESMEDITIDGYFIPKK  419


 Score =   152 bits (384),  Expect(2) = 8e-116, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTN-PEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSRII+N W++  DP+VW+N  E+F PERF  SNID RG+ F+LIPFGSGRR CPG+QL
Sbjct  418  KKSRIIVNAWSMGRDPDVWSNNAEEFFPERFIDSNIDLRGQDFQLIPFGSGRRGCPGMQL  477

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  +RLV+AQ +HCFDWE P+ M   +LDM+E FGL +SRAN L+V   YRL
Sbjct  478  GLITIRLVLAQFVHCFDWELPDGMLPVQLDMSENFGLSMSRANPLLVKATYRL  530



>ref|XP_003528941.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=981

 Score =   293 bits (750),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 223/330 (68%), Gaps = 14/330 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    +V SSP+AAELFLKTHD VFA+RP  E A+Y +YG+ +++   YGPYW
Sbjct  541   PIMSLQLGNVPTVVVSSPEAAELFLKTHDTVFANRPKFETAQY-TYGEESVAFAEYGPYW  599

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CT  LLS  K+ SF  +R+ E+  ++ESLK+AA+ R  VD+S +V E++ D++C
Sbjct  600   RNVRKVCTTHLLSASKVESFDGLRKREIGAMVESLKEAAMAREVVDVSERVGEVLRDMAC  659

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +MV G+    KD D    +G+L E M + G  NL DY P+L   DLQGLTRR K ++K+ 
Sbjct  660   KMVLGRN---KD-DRFDLKGILVETMSVSGAFNLADYVPWLRLFDLQGLTRRSKKISKSL  715

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLS-----IMKSGEAEFQFNREHIKPTLSD-  911
             DK  + ++++H+ +    +    KDF+D +LS     I    +     ++  IK  + D 
Sbjct  716   DKMLDEMIEEHQLA--PPAQGHLKDFIDILLSLKDQPIHPHDKHAPIIDKRSIKGIVFDM  773

Query  910   LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
             + GASE  + +IEW +SEL+RHP +M+ +Q ELK  +G+++MV+E+DL  L YL+MVVKE
Sbjct  774   IIGASETSSNVIEWAISELVRHPRVMENLQNELKDVVGINKMVDENDLAKLSYLDMVVKE  833

Query  730   SLRLHPVAPLI-PNEAREDCMIEGFHIPKK  644
             +LRLHPV PL+ P+E+ ED +IEG++I KK
Sbjct  834   TLRLHPVVPLLAPHESMEDIVIEGYYIKKK  863


 Score =   152 bits (385),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            +  +KKSR+IIN WAI  DP VW+ N E F PERF  SNID++G+ F+LIPFGSGRR CP
Sbjct  858  YYIKKKSRVIINAWAIGRDPKVWSENAEVFYPERFMNSNIDFKGQDFQLIPFGSGRRSCP  917

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+ +G+T+V+LV+ QL+HCF WE P  +  +ELDM E+ GL + RA HL+VIP YRL
Sbjct  918  GIVMGLTIVKLVLTQLVHCFKWELPCGIGPDELDMNEKSGLSMPRARHLLVIPTYRL  974


 Score =   283 bits (724),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 152/331 (46%), Positives = 214/331 (65%), Gaps = 12/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    IV SSP+ AELFLKTHD  FASRP   ++KYISYG   L    YGPYW
Sbjct  66    PIMSLKLGQVTTIVISSPETAELFLKTHDTTFASRPKSISSKYISYGGKGLVFSEYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCT++LL   K+  F  +R ++L  L++ L++ A  R  VDLS  V +LI +I+ 
Sbjct  126   RNMRKLCTVQLLIASKVEMFSPLRSQQLQELVKCLRKTASSREVVDLSDMVGDLIENINF  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +M+FG     KD D    + +  E ++L G  N+ DY P+L   DLQGL RR+K ++K++
Sbjct  186   QMIFGCS---KD-DRFDVKNLAHEIVNLAGTFNVADYMPWLRVFDLQGLVRRLKKVSKSF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQT-KDFVDTMLSIMK-----SGEAEFQFNREHIKPT-LS  914
             D+  E+I+ DHEQS  +    Q  KDFVD  L++M        E     +R ++K   ++
Sbjct  242   DEVLEQIIKDHEQSSDNKQKSQRLKDFVDIFLALMHQPLDPQDEHGHVLDRTNMKAIMMT  301

Query  913   DLFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
              +  A +     IEW MSELL+HP +MKK+Q+EL+S +G++R VEESD+E L YL++VVK
Sbjct  302   MIVAAIDTSATAIEWAMSELLKHPRVMKKLQDELESVVGMNRKVEESDMEKLPYLDLVVK  361

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRL+PVAP L+P E RE+  I+G+ I ++
Sbjct  362   ETLRLYPVAPLLVPRECREEITIDGYCIKER  392


 Score =   155 bits (391),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            +  +++SRII+N WAI  DP VW+ N E F PERF  SN+D RG  F L+PFGSGRR CP
Sbjct  387  YCIKERSRIIVNAWAIGRDPKVWSDNAEVFYPERFANSNVDMRGYDFRLLPFGSGRRGCP  446

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+ LG+T V++V+AQL+HCF+WE P  M  ++LDMTE+FGL + R+NHL+ +P YRL
Sbjct  447  GIHLGLTTVKIVLAQLVHCFNWELPLGMSPDDLDMTEKFGLTIPRSNHLLAVPTYRL  503



>gb|KHN20715.1| Cytochrome P450 71A1 [Glycine soja]
Length=500

 Score =   293 bits (750),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 222/330 (67%), Gaps = 14/330 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    +V SSP+AAELFLKTHD VFA+RP  E A+Y +YG  +++   YGPYW
Sbjct  60    PIMSLQLGNVPTVVVSSPEAAELFLKTHDTVFANRPKFETAQY-TYGAESVAFAEYGPYW  118

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CT  LLS  K+ SF  +R+ E+  ++ESLK+AA+ R  VD+S +V E++ D++C
Sbjct  119   RNVRKVCTTHLLSASKVESFDGLRKREIGAMVESLKEAAMAREVVDVSERVGEVLRDMAC  178

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +MV G+    KD D    +G+L E M + G  NL DY P+L   DLQGLTRR K ++K+ 
Sbjct  179   KMVLGRN---KD-DRFDLKGILVETMSVSGAFNLADYVPWLRLFDLQGLTRRSKKISKSL  234

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLS-----IMKSGEAEFQFNREHIKPTLSD-  911
             DK  + ++++H+ +    +    KDF+D +LS     I    +     ++  IK  + D 
Sbjct  235   DKMLDEMIEEHQLA--PPAQGHLKDFIDILLSLKDQPIHPHDKHAPIIDKRSIKGIVFDM  292

Query  910   LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
             + GASE  + +IEW +SEL+RHP +M+ +Q ELK  +G+++MV+E+DL  L YL+MVVKE
Sbjct  293   IIGASETSSNVIEWAISELVRHPRVMENLQNELKDVVGINKMVDENDLAKLSYLDMVVKE  352

Query  730   SLRLHPVAPLI-PNEAREDCMIEGFHIPKK  644
             +LRLHPV PL+ P+E+ ED +IEG++I KK
Sbjct  353   TLRLHPVVPLLAPHESMEDIVIEGYYIKKK  382


 Score =   152 bits (384),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            +  +KKSR+IIN WAI  DP VW+ N E F PERF  SNID++G+ F+LIPFGSGRR CP
Sbjct  377  YYIKKKSRVIINAWAIGRDPKVWSENAEVFYPERFMNSNIDFKGQDFQLIPFGSGRRSCP  436

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+ +G+T V+LV+ QL+HCF WE P  +  +ELDM E+ GL + RA HL+VIP YRL
Sbjct  437  GIVMGLTTVKLVLTQLVHCFKWELPCGIGPDELDMNEKSGLSMPRARHLLVIPTYRL  493



>ref|XP_008393300.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=523

 Score =   303 bits (776),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 218/333 (65%), Gaps = 14/333 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R GL   IV SSP+AAELFLKTHD VF SRP  +AA+YISYG   ++   YGPYW
Sbjct  81    PIMSIRLGLVPTIVVSSPKAAELFLKTHDTVFCSRPKLQAAEYISYGIRGIAFTEYGPYW  140

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCT++LL   KI  F  +RREE+  L++SLK+AA     V+LS KV EL+ DI+ 
Sbjct  141   RHIRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKAAEAGEVVNLSEKVGELVEDITY  200

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G K +    D    + ++++ M +    N+GDY PFL  LD+QGLT+R K ++K  
Sbjct  201   RMVLGSKSD----DMFDIKTIIRDVMSVLALFNIGDYVPFLRPLDIQGLTKRNKRISKIV  256

Query  1072  DKFFERILDDHEQ---SGQSGSSDQTKDFVDTMLSIMK-----SGEAEFQFNREHIKPTL  917
             D+ FE+I+ +HEQ   S Q       KDFVD +LS++      + E  ++  R  +K  L
Sbjct  257   DQLFEKIIWEHEQVSKSEQVQGHHHHKDFVDVVLSLIHQPLNPNDEQGYRIERTDVKAIL  316

Query  916   SDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
              D+  G+ +     I W ++ELLRHP ++K +QEEL+  IG DRMVEESDL  L YL  V
Sbjct  317   LDMITGSFDTSATAIVWNLAELLRHPRVLKHLQEELQRVIGTDRMVEESDLRMLSYLNAV  376

Query  739   VKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +KES RLHP+AP L+P E+ +D  ++G++IPKK
Sbjct  377   IKESFRLHPIAPFLVPRESMQDVTVDGYYIPKK  409


 Score =   142 bits (357),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 86/113 (76%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKS+I+IN WAI  DPNVW+ N  +F PERF  SN+D RG  F+L+PFGSGRR CPG+QL
Sbjct  408  KKSKILINTWAIGRDPNVWSDNVGEFYPERFINSNVDLRGHDFQLLPFGSGRRGCPGMQL  467

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VRL +A ++HCF+W+ P+ +  ++LDMTE FG + ++A  L+ +P YRL
Sbjct  468  GLTTVRLALANIVHCFNWDLPSGLLPQDLDMTETFGSVPTKAQPLLAMPTYRL  520



>ref|XP_003534173.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=978

 Score =   299 bits (765),  Expect(2) = 3e-115, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 218/330 (66%), Gaps = 11/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ G    +V SSP+ AELFLKTHD +FASRP   A++Y+SYG   L+   YGPYW
Sbjct  537   PIMFIKLGQVPTVVVSSPETAELFLKTHDTIFASRPKTLASEYMSYGSKGLAFSEYGPYW  596

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN++KLCT +LLS  K+  F  +RREEL   ++SL++AA  R  V+LS +V ELI++I C
Sbjct  597   RNVKKLCTTQLLSASKVEMFAPLRREELGVFVKSLEKAAASRDVVNLSEQVGELISNIVC  656

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ G+    KD D    +G+ +E + L G  N+ DY P+   LDLQGL  ++K ++K +
Sbjct  657   RMILGRS---KD-DRFDLKGLAREVLRLAGVFNIADYVPWTGFLDLQGLKGKIKKMSKVF  712

Query  1072  DKFFERILDDHEQ-SGQSGSSDQTKDFVDTMLS----IMKSGEAEFQFNREHIKPTLSDL  908
             D+ FE+I+ DHE  S  +  S  ++DFVD +LS     M   E ++   R +IK  + D+
Sbjct  713   DEVFEQIIKDHEDPSASNKKSVHSEDFVDILLSHMHQAMNQQEQKYVTGRTNIKAIILDM  772

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               AS +  T+ +EW MSELLR+P  MKK+QEEL + +G D++VEESDL  L YL MVVKE
Sbjct  773   IAASFDTSTVAVEWAMSELLRNPSDMKKLQEELNNVVGEDKLVEESDLSKLPYLNMVVKE  832

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +LRL+P  P L+P E+ ED  I G+HI KK
Sbjct  833   TLRLYPAGPLLLPRESLEDITINGYHIKKK  862


 Score =   145 bits (367),  Expect(2) = 3e-115, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            +KK+RI++N WAI  DP VW+ N + F PERF  SN+D RG  F+L+PFGSGRR CPG+Q
Sbjct  860  KKKTRILVNAWAIGRDPKVWSDNADMFCPERFVNSNVDIRGHDFQLLPFGSGRRGCPGIQ  919

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LG+T   LV+AQL+HCF+WE P  +  ++LDM+E+FGL + R+  L+ IP YRL I
Sbjct  920  LGLTTFGLVLAQLVHCFNWELPFGVSPDDLDMSERFGLSLPRSKPLLAIPTYRLFI  975


 Score =   297 bits (761),  Expect(2) = 6e-114, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 217/330 (66%), Gaps = 11/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ G    +V SSP+ AELFLKTHD +FASRP   A++Y+SYG   L+   YGPYW
Sbjct  66    PIMFIKLGQVPTVVVSSPETAELFLKTHDTIFASRPKTLASEYMSYGSKGLAFSEYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN++KLCT +LLS  K+  F  +RREEL   ++SL++AA  R  V+LS +V ELI++I C
Sbjct  126   RNVKKLCTTQLLSASKVEMFAPLRREELGVFVKSLEKAAASRDVVNLSEQVGELISNIVC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ G+    KD D    +G+ +E + L G  N+ DY P+   LDLQGL  +MK ++K +
Sbjct  186   RMILGRS---KD-DRFDLKGLAREVLRLTGVFNIADYVPWTGFLDLQGLKGKMKKMSKAF  241

Query  1072  DKFFERILDDHEQ-SGQSGSSDQTKDFVDTMLSIMKSG----EAEFQFNREHIKPTLSDL  908
             D+ FE+I+ DHE  S  + +S  ++DFVD +LS M       E ++   R +IK  + D+
Sbjct  242   DEVFEQIIKDHEDPSASNKNSVHSEDFVDILLSHMHQAVNQQEQKYVIGRTNIKAIILDM  301

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
                S +   + +EW MSELLR+P  MKK+QEEL + +G +++VEESDL  L YL MVVKE
Sbjct  302   IAGSFDTSAVAVEWAMSELLRNPSDMKKLQEELNNVVGENKLVEESDLSKLPYLNMVVKE  361

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +LRL+P  P L+P E+ ED  I G+HI KK
Sbjct  362   TLRLYPAGPLLVPRESLEDITINGYHIKKK  391


 Score =   143 bits (360),  Expect(2) = 6e-114, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            +KK+RI++N WAI  DP VW+ N + F PERF  SN+D RG  F+L+PFGSGRR CPG+Q
Sbjct  389  KKKTRILVNAWAIGRDPKVWSDNADMFCPERFVNSNVDIRGHDFQLLPFGSGRRGCPGIQ  448

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LG+T   LV+AQL+HCF+WE P  +  ++LDM+E FGL + R+  L+ IP YRL
Sbjct  449  LGLTTFGLVLAQLVHCFNWELPFGVSPDDLDMSEIFGLSLPRSKPLLAIPTYRL  502



>ref|XP_007036496.1| Cytochrome P450 superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY20997.1| Cytochrome P450 superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=514

 Score =   292 bits (747),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 156/332 (47%), Positives = 216/332 (65%), Gaps = 11/332 (3%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM LR G    IV SSPQAAELFLKTHD+VFASRP  +A +Y+SYG   +    YG YWR
Sbjct  68    IMLLRLGYVPTIVVSSPQAAELFLKTHDVVFASRPKVQACEYLSYGGKGMGFTEYGSYWR  127

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
              +RK CTL LLS  K+  F  +R+ EL  ++E++K+AA     VD+S KV E+I DI  +
Sbjct  128   TVRKWCTLHLLSGSKVEYFAPLRKAELGSMVETVKKAAAAGETVDISGKVGEVIEDIMYK  187

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             M+FG+    +D D    + ++KE   L G  NL D+ P L+ LDLQGL ++ K ++K  D
Sbjct  188   MIFGRPSNSED-DNINLKLLIKEISRLAGAFNLSDFVPCLAPLDLQGLAQKQKRISKILD  246

Query  1069  KFFERILDDHEQSGQSGSSDQT--KDFVDTMLSIMKSG------EAEFQFNREHIKPTLS  914
             KF E+I+D+HEQ+  S   +Q   ++FV  M+S++         E E+  +R +IK  + 
Sbjct  247   KFLEKIIDEHEQAVGSNPEEQKPHRNFVHVMVSLLNKPMNPHDEEQEYIIDRTNIKAIML  306

Query  913   DLFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVV  737
             ++  A  E+    IEW +SELL+HP +M  +Q+EL++ +G  RMVEESDL  L YL++VV
Sbjct  307   EMIAAGLESSAAAIEWALSELLKHPRVMFSLQQELETVVGRSRMVEESDLPQLTYLDVVV  366

Query  736   KESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             KESLRLHPV P LIP+E+ ED  I+G+ IPKK
Sbjct  367   KESLRLHPVGPLLIPHESMEDITIDGYFIPKK  398


 Score =   152 bits (384),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTN-PEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSRII+N W++  DP+VW+N  E+F PERF  SNID RG+ F+LIPFGSGRR CPG+QL
Sbjct  397  KKSRIIVNAWSMGRDPDVWSNNAEEFFPERFIDSNIDLRGQDFQLIPFGSGRRGCPGMQL  456

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  +RLV+AQ +HCFDWE P+ M   +LDM+E FGL +SRAN L+V   YRL
Sbjct  457  GLITIRLVLAQFVHCFDWELPDGMLPVQLDMSENFGLSMSRANPLLVKATYRL  509



>gb|KHN32024.1| Cytochrome P450 71A1 [Glycine soja]
Length=459

 Score =   298 bits (762),  Expect(2) = 7e-115, Method: Compositional matrix adjust.
 Identities = 155/330 (47%), Positives = 217/330 (66%), Gaps = 11/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ G    +V SSP+ AELFLKTHD +FASRP   A++Y+SYG   L+   YGPYW
Sbjct  19    PIMFIKLGQVPTVVVSSPETAELFLKTHDTIFASRPKTLASEYMSYGSKGLAFSEYGPYW  78

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN++KLCT +LLS  K+  F  +RREEL   ++SL++AA  R  V+LS +V ELI++I C
Sbjct  79    RNVKKLCTTQLLSASKVEMFAPLRREELGVFVKSLEKAAASRDVVNLSEQVGELISNIVC  138

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ G+    KD D    +G+ +E + L G  N+ DY P+   LDLQGL  +MK ++K +
Sbjct  139   RMILGRS---KD-DRFDLKGLAREVLRLTGVFNIADYVPWTGFLDLQGLKGKMKKMSKAF  194

Query  1072  DKFFERILDDHEQ-SGQSGSSDQTKDFVDTMLSIMKSG----EAEFQFNREHIKPTLSDL  908
             D+ FE+I+ DHE  S  + +S  ++DFVD +LS M       E ++   R +IK  + D+
Sbjct  195   DEVFEQIIKDHEDPSASNKNSVHSEDFVDILLSHMHQAVNQQEQKYVIGRTNIKAIILDM  254

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
                S +   + +EW MSELLR+P  MKK+QEEL + +G +++VEESDL  L YL MVVKE
Sbjct  255   IAGSFDTSAVAVEWAMSELLRNPSDMKKLQEELNNVVGENKLVEESDLSKLPYLNMVVKE  314

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +LRL+P  P L+P E+ ED  I G+HI KK
Sbjct  315   TLRLYPAGPLLVPRESLEDITINGYHIKKK  344


 Score =   145 bits (367),  Expect(2) = 7e-115, Method: Compositional matrix adjust.
 Identities = 65/116 (56%), Positives = 87/116 (75%), Gaps = 1/116 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            +KK+RI++N WAI  DP VW+ N + F PERF  SN+D RG  F+L+PFGSGRR CPG+Q
Sbjct  342  KKKTRILVNAWAIGRDPKVWSDNADMFCPERFVNSNVDIRGHDFQLLPFGSGRRGCPGIQ  401

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LG+T   LV+AQL+HCF+WE P  +  ++LDM+E+FGL + R+  L+ IP YRL I
Sbjct  402  LGLTTFGLVLAQLVHCFNWELPFGVSPDDLDMSERFGLSLPRSKPLLAIPTYRLFI  457



>ref|XP_002275691.1| PREDICTED: cytochrome P450 CYP736A12 isoform X1 [Vitis vinifera]
Length=501

 Score =   283 bits (723),  Expect(2) = 9e-115, Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 212/330 (64%), Gaps = 15/330 (5%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM +R G    IV SSPQAA+LFLKTHD VFASR   +  +Y++YG   ++   YG Y R
Sbjct  66    IMFMRLGSVPTIVVSSPQAAKLFLKTHDAVFASRAKLQGVEYLTYGTKGIAFSEYGLYLR  125

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             N+RKLC L+L S  KINSF +MR E +   ++SLK+ A     VD+S++V+E+I D++ R
Sbjct  126   NVRKLCALKLFSTAKINSFASMRGEAIGLFVQSLKEMAAAGNVVDISTRVAEVIEDMAYR  185

Query  1249  MVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             MVFG  K EM DL     + ++ E   L G  N+ DY PFL + DLQGLTRR +A ++  
Sbjct  186   MVFGHDKDEMIDL-----KTLIGEATSLAGTFNIADYLPFLGSFDLQGLTRRFQAASEAI  240

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG-----EAEFQFNREHIKPTLSD-  911
             D+  E+I+D H +  + G +    +F+D MLS+M        E  +  +R ++K  + D 
Sbjct  241   DEVLEKIIDKHTKDARDGVNHM--NFMDIMLSLMSKSNDFKDEPLYAIDRTNVKAIILDI  298

Query  910   LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
             L G  ++  I ++W ++ELLRHP +MKKVQEELK+ +G+ R VEESDL+ L Y+ MV+KE
Sbjct  299   LVGGIDSSLISVDWALAELLRHPRVMKKVQEELKNVVGMGRTVEESDLKSLIYMNMVLKE  358

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +LRLHPV P LIP E+ E   I   +IPKK
Sbjct  359   ALRLHPVGPFLIPRESVEHSTINEHYIPKK  388


 Score =   160 bits (405),  Expect(2) = 9e-115, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 88/115 (77%), Gaps = 1/115 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTN-PEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KK+RI+IN WAI  DPN W+N  E+F PERF  +NID  G  FELIPFGSGRR CPG+QL
Sbjct  387  KKARILINTWAIGRDPNAWSNNAEEFFPERFIDNNIDLYGHDFELIPFGSGRRRCPGIQL  446

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            G+  V+L++AQL+HCFDWE PN M   +L+M E+FGL + RANHLI  P YRLHI
Sbjct  447  GLITVQLILAQLVHCFDWELPNDMSPSDLNMREKFGLTMPRANHLIAKPTYRLHI  501



>emb|CAN69565.1| hypothetical protein VITISV_033534 [Vitis vinifera]
Length=501

 Score =   283 bits (724),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 212/330 (64%), Gaps = 15/330 (5%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM +R G    IV SSPQAA+LFLKTHD VFASR   +  +Y++YG   ++   YG Y R
Sbjct  66    IMFMRLGSVPTIVVSSPQAAKLFLKTHDAVFASRAKLQGVEYLTYGTKGIAFSEYGLYLR  125

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             N+RKLC L+L S  KINSF +MR E +   ++SLK+ A     VD+S++V+E+I D++ R
Sbjct  126   NVRKLCALKLFSTAKINSFASMRXEAIGLFVQSLKEMAAAGNVVDISTRVAEVIEDMAYR  185

Query  1249  MVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             MVFG  K EM DL     + ++ E   L G  N+ DY PFL + DLQGLTRR +A ++  
Sbjct  186   MVFGHDKDEMIDL-----KTLIGEATSLAGTFNIADYLPFLGSFDLQGLTRRFQAASEAI  240

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG-----EAEFQFNREHIKPTLSD-  911
             D+  E+I+D H +  + G +    +F+D MLS+M        E  +  +R ++K  + D 
Sbjct  241   DEVLEKIIDKHTKDARDGVNHM--NFMDIMLSLMSKSNDFKDEPLYAIDRTNVKAIIFDI  298

Query  910   LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
             L G  ++  I ++W ++ELLRHP +MKKVQEELK+ +G+ R VEESDL+ L Y+ MV+KE
Sbjct  299   LVGGIDSSLISVDWALAELLRHPRVMKKVQEELKNVVGMGRTVEESDLKSLIYMNMVLKE  358

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +LRLHPV P LIP E+ E   I   +IPKK
Sbjct  359   ALRLHPVGPFLIPRESVEHSTINEHYIPKK  388


 Score =   159 bits (403),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 88/115 (77%), Gaps = 1/115 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTN-PEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KK+RI+IN WAI  DP+ W+N  E+F PERF  +NID  G  FELIPFGSGRR CPG+QL
Sbjct  387  KKARILINTWAIGRDPBAWSNNAEEFFPERFIDNNIDLYGHDFELIPFGSGRRRCPGIQL  446

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            G+  V+L++AQL+HCFDWE PN M   +L+M E+FGL + RANHLI  P YRLHI
Sbjct  447  GLITVQLILAQLVHCFDWELPNDMSPSDLNMREKFGLTMPRANHLIAKPTYRLHI  501



>ref|XP_008385725.1| PREDICTED: cytochrome P450 CYP736A12-like [Malus domestica]
Length=510

 Score =   299 bits (766),  Expect(2) = 4e-114, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 215/333 (65%), Gaps = 14/333 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R GL   IV SSP+AAELFLKTHD VF+SRP  +A++YISYG   ++   YGPYW
Sbjct  68    PIMSMRLGLVPTIVVSSPKAAELFLKTHDTVFSSRPKLQASEYISYGAKGIAFTEYGPYW  127

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCT++LL   KI  F  +RREE+  L++SLK+A      V+LS KV EL+ DI+ 
Sbjct  128   RHVRKLCTMQLLCPSKIEDFAPLRREEVGLLVQSLKKAXEAGEVVNLSEKVGELVEDITY  187

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G K +    D    + ++++ M +    N+GDY PFL  LD+QGLT+R K ++K  
Sbjct  188   RMVLGSKSD----DMFDJKTIIRDVMSVLALFNIGDYVPFLRPLDIQGLTKRNKRISKIV  243

Query  1072  DKFFERILDDHEQ---SGQSGSSDQTKDFVDTMLSIMK-----SGEAEFQFNREHIKPTL  917
             D+ FE+I+ +HEQ   S Q       KDFVD  LS++      + E  +   R  +K  L
Sbjct  244   DQLFEKIIWEHEQVSKSEQVQGHHHHKDFVDVXLSLIHQPLNPNDEQGYXIERTDVKAIL  303

Query  916   SDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
              D+  G+ +     I W ++ELLRHP + K +QEEL+  IG DRMVEESDL  L YL  V
Sbjct  304   LDMITGSFDTSATAIVWNLAELLRHPRVXKXLQEELQRVIGTDRMVEESDLRXLSYLNAV  363

Query  739   VKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +KES RLHP+AP L+P E+ +D  ++G++IPKK
Sbjct  364   IKESFRLHPIAPFLVPRESMQDVTVDGYYIPKK  396


 Score =   141 bits (356),  Expect(2) = 4e-114, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKS+I+IN WAI  DPNVW+ N   F PERF  SN+D RG  F+L+PFGSGRR CPG+QL
Sbjct  395  KKSKILINTWAIGRDPNVWSDNXGXFYPERFINSNVDLRGHDFQLLPFGSGRRGCPGMQL  454

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VRL +A ++HCF+W+ P+ +  ++LDMTE FG + ++A  L+ +P YRL
Sbjct  455  GLTTVRLALANIVHCFNWDLPSGLLPQDLDMTETFGSVPTKAQPLLAMPTYRL  507



>emb|CDP12931.1| unnamed protein product [Coffea canephora]
Length=980

 Score =   266 bits (679),  Expect(2) = 6e-114, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 173/223 (78%), Gaps = 5/223 (2%)
 Frame = -2

Query  1309  RVAVDLSSKVSELIADISCRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFL  1130
             R+ ++++ +V+ L A++SC MVFGKKY  K+ DERGF+ V+KE M L    NLGDY+P+L
Sbjct  643   RIIINVA-EVAALNANMSCLMVFGKKYAEKEFDERGFKAVMKEAMQLAATPNLGDYYPYL  701

Query  1129  STLDLQGLTRRMKALAKTYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEF  950
               LD QGLTRRMKA+ K +D+FFE+I+D+HEQS  +    Q  DFV TML++ KSGE EF
Sbjct  702   GVLDPQGLTRRMKAVGKVFDEFFEKIIDEHEQS--ANKVRQADDFVYTMLALKKSGETEF  759

Query  949   QFNREHIKPTLSDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEES  773
             QF+R HIK  L D+  G+ +     +EW ++ELL++P +MKK+++EL  K+GLDRMVEES
Sbjct  760   QFDRPHIKAILLDMLAGSMDTSATTVEWTLAELLKNPRVMKKLRQELNEKVGLDRMVEES  819

Query  772   DLEDLKYLEMVVKESLRLHPVAP-LIPNEAREDCMIEGFHIPK  647
             DL++L+YL+MVVKE+LRLHPVAP LIP+ AREDC ++GFHIPK
Sbjct  820   DLDNLQYLDMVVKEALRLHPVAPLLIPHAAREDCTVDGFHIPK  862


 Score =   174 bits (442),  Expect(2) = 6e-114, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   K SR+IINVW I  DPN W +PEKFIPERF G+NID RG  F+L+PFGSGRR CPG
Sbjct  858  FHIPKDSRVIINVWTIGRDPNAWPDPEKFIPERFVGNNIDVRGHDFQLLPFGSGRRGCPG  917

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
             QLG+T+VRL+VAQL+HCF+W+ PN M   ELDMTE+FGL+V+RA HL+ +P YRL
Sbjct  918  TQLGLTVVRLLVAQLVHCFNWKLPNGMLPSELDMTEEFGLVVTRAKHLVAVPTYRL  973


 Score =   341 bits (875),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 175/324 (54%), Positives = 229/324 (71%), Gaps = 27/324 (8%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++RFG    I+ SSP+AAE FLKT+D VFASRP  EA+ YI+Y Q NL+   YGPYW
Sbjct  342   PIMYMRFGYVPAIIVSSPEAAEKFLKTYDQVFASRPYHEASWYIAYEQRNLTFGQYGPYW  401

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNM                      +E+  L++SLKQAA D  +VDLS+ +S L A++SC
Sbjct  402   RNM----------------------QEVGKLVKSLKQAASDGASVDLSAAISSLGANMSC  439

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              M+FGK+Y  KD D+RGFR V++E + +    NLGDYFP L  LDLQGLTRR KALAK +
Sbjct  440   LMIFGKRYMDKDFDDRGFREVIQESLHVAALPNLGDYFPLLGVLDLQGLTRRFKALAKVF  499

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGAS-  896
             DKFF++I+D+H +S +     QTKDFVD M+ I++S  +EF F+R H+K  L D+  AS 
Sbjct  500   DKFFDKIIDEHLESKE---HKQTKDFVDIMMGIIQSETSEFDFDRRHVKAILLDMLLASM  556

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             ++    +EW MSELLRHPE M+K+Q+EL+ K+GL R+VEESDLE L+YL+MVVKES+RLH
Sbjct  557   DSSATAVEWAMSELLRHPEAMQKLQKELEEKVGLKRIVEESDLEGLEYLDMVVKESMRLH  616

Query  715   PVAPL-IPNEAREDCMIEGFHIPK  647
             PV PL +P+E+ EDC I+ FHI K
Sbjct  617   PVGPLMLPHESMEDCKIDDFHIQK  640


 Score =   181 bits (460),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/192 (49%), Positives = 126/192 (66%), Gaps = 2/192 (1%)
 Frame = -2

Query  1600  LRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWRNMR  1421
             +RFG    I+ SSP+AAE FLKT D VFASRP  E + YI++   N +   YG +WRNMR
Sbjct  8     MRFGYVPAIIVSSPEAAEKFLKTSDQVFASRPHHEGSWYIAHELRNSTFGQYGTFWRNMR  67

Query  1420  KLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCRMVF  1241
             KLC L LLSN KI  F  MR  E+  L++SLKQAA    AV+LS+ +S L A+++C M+F
Sbjct  68    KLCILRLLSNYKIKLFLPMRIGEIGILVKSLKQAAFHGAAVNLSAAISSLGANMNCLMIF  127

Query  1240  GKKYEMK--DLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYDK  1067
             GK    K  D D+RGFR V++E + +    NL DYFP L  LDLQ   R +KAL+K +D 
Sbjct  128   GKMCMDKDFDFDDRGFREVIEEALHVAAMANLCDYFPQLRVLDLQRFARWLKALSKVFDN  187

Query  1066  FFERILDDHEQS  1031
             F ++I++ H +S
Sbjct  188   FPKKIINKHLES  199



>ref|XP_009617817.1| PREDICTED: cytochrome P450 CYP736A12-like [Nicotiana tomentosiformis]
Length=501

 Score =   289 bits (740),  Expect(2) = 6e-114, Method: Compositional matrix adjust.
 Identities = 148/325 (46%), Positives = 209/325 (64%), Gaps = 6/325 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    +V SSP+ AEL LKTHD VFASRP  +A +Y+S G   L+  PYGP W
Sbjct  68    PIMFLKLGNVPTVVVSSPETAELILKTHDAVFASRPKLKAVEYVSDGAKGLAFAPYGPQW  127

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
              N RK CT ELL+  KI SF  MR+EE+  L+  LK AA+    V+L  KV ELIA+I+ 
Sbjct  128   CNARKFCTQELLTAEKIESFAGMRKEEIGVLVRRLKVAAVGGEVVELGEKVGELIANITY  187

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+FG   + ++ D    + +++E + L G  N+ DY PFL   D+QGL +++K   K  
Sbjct  188   RMLFG---DFRNSDRFDLKNIVQEMVRLAGAFNIADYVPFLEPFDIQGLNKQLKETGKAV  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GAS  896
              K  + I+++HEQ  + G+   +KD VD MLS  ++    +  +R  +K  LSD+  GA 
Sbjct  245   QKVLDTIINEHEQDARDGTRKGSKDLVDVMLS-HQNCPKSYSIDRATMKAILSDMIVGAI  303

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     IEW+ +E+++H  +M K+QEEL S +GLDRMVEE DL  L+YLE+V+KE+ RLH
Sbjct  304   DTSHTWIEWVFAEIVKHSRVMNKLQEELISVVGLDRMVEEQDLPKLEYLELVLKETFRLH  363

Query  715   PVAP-LIPNEAREDCMIEGFHIPKK  644
             PVA  L+P E+ ED +I G++IPK+
Sbjct  364   PVATLLVPRESMEDVVINGYYIPKR  388


 Score =   151 bits (381),  Expect(2) = 6e-114, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            K+SR++ N WA+ HDP +W+ N E+F+PERF G NID RG  F L+PFG GRR CPG+ L
Sbjct  387  KRSRVMTNCWALGHDPKIWSDNVEEFVPERFIGKNIDLRGHAFHLLPFGYGRRSCPGMNL  446

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            G+  V+L+VAQL+HCF+W+ P  M   +LDMTE+FGL   RA +L+VIP YRLH
Sbjct  447  GLITVKLIVAQLVHCFNWDLPEGMLPGDLDMTEKFGLAAPRAQNLLVIPTYRLH  500



>ref|XP_004291274.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=505

 Score =   278 bits (712),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 147/333 (44%), Positives = 217/333 (65%), Gaps = 14/333 (4%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM +R G    IV SSP+AAELFLK HD  FASRP  +A++Y+SYG   +    YGP WR
Sbjct  66    IMSIRLGNVPAIVISSPKAAELFLKIHDTNFASRPKIQASEYLSYGSKGMVFSEYGPCWR  125

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             ++RK+C L+L    K+ +F  +R+EEL  L+  LK+AA +   VD+S K+ E+  DI+ R
Sbjct  126   HVRKICKLQLFCPAKLEAFAPLRKEELGGLVGKLKRAAEEGEVVDVSEKIGEMNEDITYR  185

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MV G K +    +    + +++E + L G  N+ D+ P LS  D+QGLT+R+K +++  D
Sbjct  186   MVLGCKRD----NRFDLKAIVEEVVFLIGAFNISDFIPSLSAFDIQGLTKRLKKVSRMVD  241

Query  1069  KFFERILDDHEQSGQS---GSSDQTKDFVDTMLSI----MKSGEAEFQF-NREHIKPTLS  914
             +  ++I+DDHEQ  ++   G   Q ++FVD +LS     +   + +  F +RE+ K  L 
Sbjct  242   QLLDKIIDDHEQDAETKSGGKQGQHENFVDVLLSFTNQSLNLNDEQVHFLDRENAKAILL  301

Query  913   DLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVV  737
             ++  GA +  T  I W ++EL+RHP IMK++QEEL++ +G+DRMVEESDL  L YL +VV
Sbjct  302   EMITGAFDTSTTTIIWSLAELMRHPRIMKRLQEELQTVVGMDRMVEESDLPKLDYLNLVV  361

Query  736   KESLRLHPVAP-LIPNEAREDCMIEGFHIPKKI  641
             KES RLHPVAP L+P E+ +D  I+G+ IPKK+
Sbjct  362   KESFRLHPVAPLLVPRESIKDITIDGYDIPKKL  394


 Score =   160 bits (406),  Expect(2) = 1e-113, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KK R+I+N+W+I  DPNVW+ N E+F PERF  SNID RG  ++LIPFG+GRR CPG+QL
Sbjct  392  KKLRLIVNLWSIGRDPNVWSENVEEFCPERFTNSNIDLRGHDYQLIPFGTGRRGCPGMQL  451

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VRLV+AQL+HCF+WE PN M  ++LDMTEQFGL +S+A HL+  P YRL
Sbjct  452  GLTTVRLVLAQLVHCFNWELPNGMLPQDLDMTEQFGLSMSKAKHLLAKPTYRL  504



>ref|XP_010541895.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=512

 Score =   293 bits (751),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 214/330 (65%), Gaps = 9/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+AAELFLKTHD +FASRP  +A + +SYG   ++  PYGPYW
Sbjct  72    PIMSIRLGSVRTIVVSSPRAAELFLKTHDNIFASRPKAQAPEIMSYGTKAMALQPYGPYW  131

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RKLC + LLS  KI  F+ +R EE+  L+  LK AA     V++S  + EL+ ++  
Sbjct  132   RNVRKLCVVHLLSASKIEQFKPVRTEEIGLLMNHLKMAAEKNEVVNVSKILVELLENLLY  191

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             R++ G+     D D+   + +++E + L G  N+ DY P L+ LDLQGL RRM+ L+K+ 
Sbjct  192   RLILGRGK--NDDDDVKLKELVEEIVSLTGAFNISDYLPLLAPLDLQGLARRMRHLSKSM  249

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQ-----FNREHIKPTLSDL  908
             D   E I+++HEQ  +   S   KDFVD +LS++     E         R H+K  L D+
Sbjct  250   DIILENIIEEHEQQNRDHKSKDHKDFVDVLLSLLNQPMNEQDEHSEIIGRTHVKSILLDM  309

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               A+ E     IEWI SE+L++  IMKK+Q+ELK+ +G+DRMV E+DL  L YL+MV+KE
Sbjct  310   VAAALETSATAIEWIFSEILKNTRIMKKLQDELKNIVGMDRMVNETDLSKLTYLDMVIKE  369

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
               RLHPVAP LIP+E+ ED +++GF+IPKK
Sbjct  370   GFRLHPVAPLLIPHESVEDVVLDGFYIPKK  399


 Score =   144 bits (364),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVW-TNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            F   KKSR+++NVW+I  D +VW  N E+F PERFE  +ID  G  F LIPFGSGRR CP
Sbjct  394  FYIPKKSRVLVNVWSIGRDRDVWGDNNEEFNPERFENDDIDINGLDFRLIPFGSGRRRCP  453

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            G+Q+G+  +RLV+AQL+HCFDW  P  M  EELDM E+FGL V RAN++   P YRL+
Sbjct  454  GMQMGLLNLRLVIAQLVHCFDWVLPVGMVREELDMNEKFGLTVGRANNVFATPIYRLN  511



>ref|XP_010663579.1| PREDICTED: cytochrome P450 CYP736A12-like [Vitis vinifera]
Length=502

 Score =   288 bits (736),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 152/331 (46%), Positives = 221/331 (67%), Gaps = 14/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+AA+L +KTHD+VFASRP  +A +Y+SYG   ++   YGPYW
Sbjct  65    PIMFMRLGCVPTIVVSSPEAAKLVMKTHDVVFASRPKLQAYEYLSYGAKGIAFTEYGPYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLC L L S+ KINSF ++R+ E+  L++S+K+ A     VD+S+KV+ ++ D++ 
Sbjct  125   RHVRKLCALHLFSSAKINSFASVRKAEVGLLVKSVKEMASAGEVVDISAKVAGVVEDMAY  184

Query  1252  RMVFG-KKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             RMVFG  K  + DL     + +++E   L G  NL DY PFL  LDLQGLT+ ++   + 
Sbjct  185   RMVFGHNKDRIFDL-----KTLIREATRLAGTFNLADYVPFLGPLDLQGLTQLLRTNNEA  239

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIM-KSGEAE----FQFNREHIKPTLSD  911
              D+  ++I+D H Q       +   +F+D +LS+M KS   E    +  +R++ K  + D
Sbjct  240   IDEVLDKIIDKHIQDVSKDEVNHM-NFIDVVLSLMNKSNNFEDDPLYAIDRQNAKAIILD  298

Query  910   -LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
              L G  ++    IEW++SELLRHP +M+++QEELK+ +G+ RMVEESDLE+L YL MVVK
Sbjct  299   ILVGGIDSSITSIEWVISELLRHPRVMRRLQEELKNVVGMCRMVEESDLENLGYLNMVVK  358

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRLHP+ P L+P E+ ED +I G +IPKK
Sbjct  359   ETLRLHPIGPFLVPRESIEDIVINGHYIPKK  389


 Score =   149 bits (377),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNP-EKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSRI+IN W I  DPNVW+N  E+F PERF  +NID +G  FEL PFGSGRR CPG+QL
Sbjct  388  KKSRILINTWTIGRDPNVWSNNVEEFFPERFVENNIDLQGHDFELTPFGSGRRGCPGIQL  447

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  V+LVV+QL+HCF+W+ PN  P  EL+M E+FGL + R +HL+  P YRL
Sbjct  448  GLITVQLVVSQLVHCFNWKLPNDTPPSELNMKEKFGLTMPRVDHLLATPTYRL  500



>gb|KHN20714.1| Cytochrome P450 71D10 [Glycine soja]
Length=510

 Score =   280 bits (717),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 151/331 (46%), Positives = 213/331 (64%), Gaps = 12/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    IV SSP+ AELFLKTHD  FASRP   ++KYISYG   L    YGPYW
Sbjct  66    PIMSLKLGQVTTIVISSPETAELFLKTHDTTFASRPKSISSKYISYGGKGLVFSEYGPYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCT++LL   K+  F  +R ++L  L++ L++ A  R  VDLS  V +LI +I+ 
Sbjct  126   RNMRKLCTVQLLIASKVEMFSPLRSQQLQELVKCLRKTASSREVVDLSDMVGDLIENINF  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +M+FG     KD D    + +  E ++L G  N+ DY P+L   DLQ L RR+K ++K++
Sbjct  186   QMIFGCS---KD-DRFDVKNLAHEIVNLAGTFNVADYMPWLRVFDLQELVRRLKKVSKSF  241

Query  1072  DKFFERILDDHEQSGQSGSSDQ-TKDFVDTMLSIMK-----SGEAEFQFNREHIKPT-LS  914
             D+  E+I+ DHEQS  +    Q  KDFVD  L++M        E     +R ++K   ++
Sbjct  242   DEVLEQIIKDHEQSSDNKQKSQRQKDFVDIFLALMHQPLDPQDEHGHVLDRTNMKAIMMT  301

Query  913   DLFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
              +  A +     IEW MSELL+HP +MKK+Q+EL+S +G++R VEESD+E L YL++VVK
Sbjct  302   MIVAAIDTSATAIEWAMSELLKHPRVMKKLQDELESVVGMNRKVEESDMEKLPYLDLVVK  361

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRL+PVAP L+P E RE+  I+G+ I ++
Sbjct  362   ETLRLYPVAPLLVPRECREEITIDGYCIKER  392


 Score =   155 bits (392),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            +  +++SRII+N WAI  DP VW+ N E F PERF  SN+D RG  F L+PFGSGRR CP
Sbjct  387  YCIKERSRIIVNAWAIGRDPKVWSDNAEVFYPERFANSNVDMRGYDFRLLPFGSGRRGCP  446

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+ LG+T V++V+AQL+HCF+WE P  M  ++LDMTE+FGL + R+NHL+ +P YRL
Sbjct  447  GIHLGLTTVKIVLAQLVHCFNWELPLGMSPDDLDMTEKFGLTIPRSNHLLAVPTYRL  503



>gb|KEH27058.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=508

 Score =   285 bits (730),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 220/330 (67%), Gaps = 11/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM  + G    IV SSPQ AELFLKTHD +F+SRP   AA Y++YG+  +    YG YW
Sbjct  70    PIMSFKLGQVQTIVVSSPQIAELFLKTHDSIFSSRPKAFAADYMTYGKKGIIFTEYGDYW  129

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCT++LL + K+  F  +R+EE+  L++SL+++A     V++S  V+ELI +I+C
Sbjct  130   RNMRKLCTIQLLHSSKVEMFAPLRKEEVGLLVKSLRKSATLHEVVNVSKVVAELIENITC  189

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +M+ G+    KD D    +G++ + M L GK NL DY P+L   DLQG+ R++K   K Y
Sbjct  190   KMILGRS---KD-DRFDLKGIVHKAMLLTGKFNLSDYLPWLRPFDLQGIERQIKKTWKQY  245

Query  1072  DKFFERILDDHE-QSGQSGSSDQTKDFVDTMLSIMK----SGEAEFQFNREHIKPTLSDL  908
             D+  E+I+ + E QS +       KDFVD +LS+M     S + ++  +R +IK  L D+
Sbjct  246   DELLEQIIKERENQSIEEQKGHNNKDFVDILLSLMNQSIDSKDNKYDIDRTNIKAILIDM  305

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               A+ +  +++I+W++S+LL+HP  MKK+Q+EL++ +G++R VEE+ L  L YL MVVKE
Sbjct  306   ISAALDTTSVVIDWVLSQLLKHPYAMKKLQQELENVVGMNRQVEETHLAKLPYLTMVVKE  365

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +LRL PV P L+P+E  ED +++G++I KK
Sbjct  366   TLRLCPVGPLLVPHECLEDVVVDGYYIKKK  395


 Score =   150 bits (378),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            +  +KK+RI+IN W I  D NVW+ N E F PERFE S++D RG  F+LIPFG GRR CP
Sbjct  390  YYIKKKTRILINAWTIGRDTNVWSDNAETFYPERFEDSDVDIRGHDFQLIPFGFGRRSCP  449

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+Q+G+T V+LVVAQL+HCF+WE P++M  +ELDM+E+F L + R   L+ +P YRL
Sbjct  450  GIQMGLTSVKLVVAQLMHCFNWELPDAMSKDELDMSEKFELSMPRCQPLLAMPTYRL  506



>ref|XP_007152789.1| hypothetical protein PHAVU_004G159800g [Phaseolus vulgaris]
 gb|ESW24783.1| hypothetical protein PHAVU_004G159800g [Phaseolus vulgaris]
Length=499

 Score =   287 bits (734),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 153/329 (47%), Positives = 213/329 (65%), Gaps = 10/329 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    IV SSP+ AELFLKTHD VFASRP  +A++++S+G   L+   Y  YW
Sbjct  63    PIMSLKLGQIPAIVVSSPETAELFLKTHDTVFASRPKIQASEFLSHGSKGLAFSEYSAYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CT++LLS  ++  F  MRREEL  L++SLK +A     VDLS  + EL+  +  
Sbjct  123   RNMRKVCTVQLLSASRVEMFAPMRREELGVLVKSLKHSAASGEVVDLSELLGELMEKMVF  182

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +MV G   +    D    + +++E ++L G  NL DY P+L   DLQGLT+R+K  +K+ 
Sbjct  183   KMVLGCAKD----DRLDLKNLIQEALNLIGAFNLADYIPWLRVFDLQGLTKRLKKASKSL  238

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLS-IMKSGEAEFQFN---REHIKPTLSDLF  905
             DK FE+I+ D + +          DFV+ +LS I +  E     N   R +IK  + D+ 
Sbjct  239   DKGFEQIIQDKKSNPYDKDKKCNMDFVEVLLSLIHQPNEVHNNQNVIDRTNIKAIILDII  298

Query  904   -GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKES  728
              GA E  + ++EW MSELLRHP +MK++Q EL+  +G++R VEE+DLE+L YL MVVKE+
Sbjct  299   AGALETSSTMLEWAMSELLRHPSVMKRLQHELEHVVGMNRHVEENDLENLSYLNMVVKET  358

Query  727   LRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             LRLHPVAP L+P E RED +I+G+ I KK
Sbjct  359   LRLHPVAPLLVPRECREDVIIDGYFIKKK  387


 Score =   147 bits (372),  Expect(2) = 3e-112, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 79/113 (70%), Gaps = 0/113 (0%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            +KKSRII+N WAI  DP VW N   F P RFE  NID RG+ F ++PFGSGRR CPG+ L
Sbjct  385  KKKSRIIVNAWAIGRDPKVWNNAAIFDPTRFENDNIDIRGKDFRILPFGSGRRGCPGIHL  444

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T + LV+AQL+HCFDW  P  M   ELDM E FGL + R NHL+  P YRL
Sbjct  445  GLTTLSLVLAQLVHCFDWVLPLGMSSHELDMQEIFGLSIPRKNHLLTRPVYRL  497



>ref|XP_007152787.1| hypothetical protein PHAVU_004G159600g [Phaseolus vulgaris]
 gb|ESW24781.1| hypothetical protein PHAVU_004G159600g [Phaseolus vulgaris]
Length=499

 Score =   280 bits (717),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 148/329 (45%), Positives = 211/329 (64%), Gaps = 10/329 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L  G    IV SSP+ AELFLKTHD VFASRP  + ++ +S+G   L    Y  YW
Sbjct  63    PIMSLNLGQVPAIVVSSPETAELFLKTHDTVFASRPKIQVSETLSHGSKGLVFSEYSAYW  122

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RK+CT++LLS  K+  F  +RREEL  L+ESLK +A     VDLS  V+E++  +  
Sbjct  123   RNVRKVCTVQLLSASKVEMFGPLRREELGVLVESLKNSAASGEVVDLSELVAEVVEKMVF  182

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G+   +KD D+   + +++E ++L G  NL DY P+L   D QG+T+R+K  +K+ 
Sbjct  183   RMVLGR---VKD-DKLELKRLIQEALNLVGAFNLADYMPWLGLFDFQGITKRLKKTSKSI  238

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGE----AEFQFNREHIKPTLSDLF  905
             D+  E+I+ DHE +          DFV+ +LS+M   +     +   +R +IK  + D+ 
Sbjct  239   DERLEQIIQDHENNSYEKEKKYNIDFVEILLSLMHQPDDVHNHQNVIDRTNIKAIILDMI  298

Query  904   -GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKES  728
              GA E  +  +EW MSELLRHP +MK++Q EL+  +G+++ VEE+DL+ L YL MVVKE+
Sbjct  299   AGALETSSTTLEWAMSELLRHPSVMKRLQHELEHVVGMNKHVEENDLQKLSYLNMVVKET  358

Query  727   LRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             LRLHPV P L+P E RED +I+G+ I KK
Sbjct  359   LRLHPVGPLLVPRECREDVIIDGYLIKKK  387


 Score =   154 bits (388),  Expect(2) = 4e-112, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 83/116 (72%), Gaps = 0/116 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            +  +KKSRII+N WAI  DPNVW N E F P RFE  N+D RG+ F ++PFGSGRR CPG
Sbjct  382  YLIKKKSRIIVNAWAIGRDPNVWDNAEIFDPTRFENDNVDIRGKDFRILPFGSGRRGCPG  441

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            + LG+T V LV+AQL+HCFDW  P  M  +ELDM E FGL + R NHL+  P YRL
Sbjct  442  IHLGLTTVSLVLAQLVHCFDWMLPLGMSCDELDMQEIFGLSIPRKNHLLTRPVYRL  497



>emb|CBI21487.3| unnamed protein product [Vitis vinifera]
Length=608

 Score =   255 bits (652),  Expect(2) = 5e-112, Method: Compositional matrix adjust.
 Identities = 130/234 (56%), Positives = 167/234 (71%), Gaps = 4/234 (2%)
 Frame = -2

Query  1339  IESLKQAALDRVAVDLSSKVSELIADISCRMVFGKKYEMKDLDERGFRGVLKEEMDLFGK  1160
             +E   +AA    AVD+S+KV+ L AD+SCRMVFGKKY  KDLDERGF+ V++E M L   
Sbjct  265   MEDCTEAARAGAAVDVSAKVALLSADMSCRMVFGKKYMDKDLDERGFKAVIQEAMQLAAT  324

Query  1159  VNLGDYFPFLSTLDLQGLTRRMKALAKTYDKFFERILDDHEQSGQSGSSDQTKDFVDTML  980
              N+GDY P L  LDLQGLTRR+KA  K +D FFE+I+D+H    +     QTKD VD ML
Sbjct  325   PNIGDYIPCLLGLDLQGLTRRIKATGKVFDDFFEKIIDEHIH--KPKEEGQTKDLVDVML  382

Query  979   SIMKSGEAEFQFNREHIKPTLSDLFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSK  803
              +M S E E+   R +IK    D+  AS +    +IEW +SEL++HP +MKKV  EL+  
Sbjct  383   DLMGSEETEYNIQRANIKAISLDMMAASMDTSATMIEWALSELIKHPPMMKKVINELEKV  442

Query  802   IGLDRMVEESDLEDLKYLEMVVKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +G++RMVEESDLE L+YL MVVKE+LRLHPVAP LIP+E+ EDC ++GFHIP+K
Sbjct  443   VGMERMVEESDLESLEYLNMVVKETLRLHPVAPLLIPHESMEDCTVDGFHIPQK  496


 Score =   179 bits (453),  Expect(2) = 5e-112, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 96/117 (82%), Gaps = 0/117 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +KSR+I+NVWAI  DPN WT+ +KF+PERF  S+ID+RG+HF+ IPFGSGRR CPG
Sbjct  491  FHIPQKSRVIVNVWAIGRDPNAWTDADKFLPERFMESDIDFRGQHFQFIPFGSGRRGCPG  550

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            +QLG+T+VRLV+AQL+HCFDWE P++M   ELDMTE+FGL + RA HL+ IP  RLH
Sbjct  551  MQLGLTVVRLVLAQLVHCFDWELPDNMLPSELDMTEEFGLTLPRAKHLVAIPTCRLH  607


 Score =   259 bits (663),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 175/249 (70%), Gaps = 4/249 (2%)
 Frame = -2

Query  1414  CTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCRMVFGK  1235
             CTLELLS+ KINSF+ MRREE+   I+S ++AA    AVD+S+KV+ L AD+SCRMVFGK
Sbjct  22    CTLELLSSHKINSFKPMRREEVGLFIKSFEEAARAGAAVDVSAKVALLSADMSCRMVFGK  81

Query  1234  KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYDKFFER  1055
             KY  KDLDERGF+ + +E M L    N+GDY P L  LDLQGLTRR KA  K +D FFE+
Sbjct  82    KYMDKDLDERGFKAMFQEVMQLAATPNIGDYIPCLLGLDLQGLTRRTKATGKVFDDFFEK  141

Query  1054  ILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-GASEAITIL  878
             I+D+H  + +     QTKD VD ML +M S    +   R  IK    D+  G+ E  +  
Sbjct  142   IIDEHIHNPK--EEGQTKDLVDVMLVLMGSEGTGYNIERASIKAISFDMLAGSMETSSSS  199

Query  877   IEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHPVAP-L  701
             I+W ++EL+RHP +MKKVQ EL+  +G++RMVEESDLE L+YL MVVKE+LRL+P  P L
Sbjct  200   IDWAVAELIRHPRVMKKVQSELEKVVGMERMVEESDLESLEYLNMVVKETLRLYPAGPLL  259

Query  700   IPNEAREDC  674
             +P+E+ EDC
Sbjct  260   VPHESMEDC  268



>ref|XP_004512940.1| PREDICTED: cytochrome P450 71A1-like [Cicer arietinum]
Length=504

 Score =   281 bits (720),  Expect(2) = 7e-112, Method: Compositional matrix adjust.
 Identities = 154/331 (47%), Positives = 215/331 (65%), Gaps = 17/331 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR GL   I+ +SP+ AELFLKTH+  FASRP  EA+KYISYG   L    YGPYW
Sbjct  68    PIMSLRLGLVPTILVTSPELAELFLKTHESNFASRPKIEASKYISYGYKGLIFSQYGPYW  127

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CTL+LLS  K+ SF  +R+ E+  ++E +K+       V++S  V  ++ +I  
Sbjct  128   RNMRKVCTLQLLSTTKVESFAPLRKNEVERMVELVKKKERVGEVVNISEIVEGVLEEIVY  187

Query  1252  RMVFG-KKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             +MV G  K +M DL     +G++KE   L GKVN GDY P+   LDLQGL R  K  +K 
Sbjct  188   KMVLGCNKDDMFDL-----KGLIKEITTLGGKVNFGDYVPWFRILDLQGLRRSFKRTSKA  242

Query  1075  YDKFFERILDDHEQS--GQSGSSDQTKDFVDTMLSIMK-----SGEAEFQFNREHIKPTL  917
              DK  E+I+++ EQS   Q+GS    KDF+  +LS+M      + E     +R +IK  +
Sbjct  243   IDKMLEKIINEKEQSFNAQNGSH---KDFIVILLSMMDQPTDPNDEQNHIIDRTNIKAII  299

Query  916   SDLFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
              D+  A+ +  T +I W++SELLR+P++MKK+Q+EL + +G+ ++VEE DL  LKYL+MV
Sbjct  300   LDMISAAFDTSTTVILWVLSELLRNPKVMKKIQDELNNVVGVKKLVEEIDLVKLKYLDMV  359

Query  739   VKESLRLHPVAPLIPNEAREDCMIEGFHIPK  647
             +KES RLHPV PLI  E+ +D +I G+HI K
Sbjct  360   IKESFRLHPVIPLIARESIKDIIINGYHIEK  390


 Score =   152 bits (383),  Expect(2) = 7e-112, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 86/116 (74%), Gaps = 1/116 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            +K SRI+IN WAI  DP +W+ N + F PERF  +NID +G +FE++PFGSGRR C G+ 
Sbjct  389  EKNSRILINTWAIGRDPKIWSDNVDVFYPERFIDNNIDIKGYNFEILPFGSGRRGCSGMN  448

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            LG+  V+ ++AQL+HCF+WE P  M  EELDMTEQFGL V+RA HL  +P YRL I
Sbjct  449  LGLVSVKFIIAQLVHCFNWELPKGMSIEELDMTEQFGLTVTRATHLFAVPKYRLLI  504



>ref|XP_010045642.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW83846.1| hypothetical protein EUGRSUZ_B00716 [Eucalyptus grandis]
Length=508

 Score =   277 bits (709),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 211/330 (64%), Gaps = 11/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R GL   +V SSP+AA LFL THD VFASRP    A+   Y    L    YGPYW
Sbjct  70    PIMSIRLGLVPTVVVSSPEAARLFLGTHDAVFASRPRSPEAELDFYTTKGLVFTEYGPYW  129

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQ-AALDRVAVDLSSKVSELIADIS  1256
             R++RKLC   LLS  ++ SF+ +RREE   L+ SL++ AA  + AVDLS++V+  + +++
Sbjct  130   RSVRKLCNTHLLSGARVRSFEGVRREEAGELVASLREAAAACKAAVDLSARVARTMEEMA  189

Query  1255  CRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             CRM+ G+  +     E   +G+++E   + G  NL D+ PFL  LDLQG TRR KA+ ++
Sbjct  190   CRMILGRSTD----GEHDLKGIIQEAARVAGAFNLADFVPFLRPLDLQGSTRRFKAVRRS  245

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG----EAEFQFNREHIKPTLSDL  908
              DK  E+I+DDH +      S+  +DF+D +LS+M       E ++  +R +IK  + D+
Sbjct  246   VDKLLEKIIDDHVRDAAYYDSEHQEDFIDILLSMMNQPIDPREEKYIIDRTNIKAIILDM  305

Query  907   F-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               G+ E  +  I+W  SEL+R+P+ M ++QEEL++ +GL RMVEESDL  L YL+MV KE
Sbjct  306   ISGSFETSSTSIDWAFSELMRNPQAMARLQEELETVVGLTRMVEESDLSKLNYLDMVAKE  365

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             S+RLHPV P L+P E+ ED +I    IPKK
Sbjct  366   SMRLHPVIPLLVPRESMEDAIINERFIPKK  395


 Score =   155 bits (392),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKS+II+N+WAI  DP+VW+ N E+F+PERF  + ID +G HFEL+PFGSGRR CPG+QL
Sbjct  394  KKSQIIVNIWAIGRDPSVWSENAEEFVPERFADNGIDVKGHHFELLPFGSGRRGCPGIQL  453

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  V+ V+AQL HCF WE P  M   ++DM+E+FGL V RANHL  +P YRL
Sbjct  454  GLIQVKFVLAQLAHCFKWELPKGMVPSDIDMSERFGLSVPRANHLFAVPTYRL  506



>ref|XP_007152790.1| hypothetical protein PHAVU_004G159900g, partial [Phaseolus vulgaris]
 gb|ESW24784.1| hypothetical protein PHAVU_004G159900g, partial [Phaseolus vulgaris]
Length=507

 Score =   287 bits (735),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 149/329 (45%), Positives = 217/329 (66%), Gaps = 10/329 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    IV SSP+ AE FLKTHD VFASRP  +A++++S+G   L+   Y  YW
Sbjct  71    PIMSLKLGQVPAIVVSSPETAEPFLKTHDTVFASRPKIQASEFLSHGSKGLAFSEYSAYW  130

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK+CT++LLS  ++  F  MRREEL  L++SLK++A     VDLS  V+E++  +  
Sbjct  131   RNMRKVCTVQLLSVSRVEMFAPMRREELGVLVKSLKRSAASGEVVDLSELVAEVVEKMVF  190

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ G+   +KD D    + +++E M+L G  NL DY P+L   D QG+T+R+K  +K +
Sbjct  191   RMMLGR---VKD-DRLDLKKLIQEVMNLVGAFNLADYMPWLGFFDPQGITKRLKKASKLF  246

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG----EAEFQFNREHIKPTLSDLF  905
             D+  E+I+ DHE++     + +  DFV+ ++S+M         E   +R ++K  + D+ 
Sbjct  247   DEVLEQIIQDHERNSYDKDNKRNMDFVEILVSLMHQSNDVHNNENIIDRTNVKAIILDII  306

Query  904   GAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKES  728
              A+ +     IEW MSELLRHP +MK++Q EL+  +G++R VEE+DLE+L YL MVVKE+
Sbjct  307   TAALDTSYTTIEWAMSELLRHPSVMKRLQHELEHVVGMNRHVEENDLENLSYLNMVVKET  366

Query  727   LRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             LRLHPVAP L+P E RED +I+G+ I KK
Sbjct  367   LRLHPVAPLLVPRECREDVIIDGYFIKKK  395


 Score =   145 bits (367),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            +KKSRII+N WAI  DP VW N   F P RFE  NID RG+ F ++PFGSGRR CPG+ L
Sbjct  393  KKKSRIIVNAWAIGRDPKVWNNAAIFNPTRFENDNIDIRGKDFRILPFGSGRRGCPGIHL  452

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T   L++AQL+HCFDW  P  M  +ELDM E FGL   R  HL+V P YRL
Sbjct  453  GLTTFSLILAQLVHCFDWVLPLGMSCDELDMQEIFGLTTPRKKHLLVRPVYRL  505



>ref|XP_003534174.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=977

 Score =   285 bits (728),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 154/339 (45%), Positives = 216/339 (64%), Gaps = 25/339 (7%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    IV SSP+ AELFLKTHD VFASRP  +A++Y+S+G   L    Y  YW
Sbjct  62    PIMSLKLGQVQAIVVSSPETAELFLKTHDTVFASRPKIQASEYLSHGTKGLVFSEYSAYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R +RK+CTL+LLS  K++ F  +RR+EL  L++SL+ +A  R  VDLS  + EL+ +I  
Sbjct  122   RKVRKVCTLQLLSASKVDMFAPLRRQELGVLVKSLRNSAASREVVDLSEVLGELMENIVY  181

Query  1252  RMVFGK----KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKAL  1085
             +MV G+    ++E+K        G++ + M+L G  NL DY P+L   D QG+TRR+K  
Sbjct  182   KMVLGRARDHRFELK--------GLVHQVMNLVGAFNLADYMPWLGAFDPQGITRRLKKA  233

Query  1084  AKTYDKFFERILDDHEQSGQSGSSDQ-----TKDFVDTMLSIMK-----SGEAEFQFNRE  935
             +K  D+F E+I+ DHE +       Q      KDFVD +LS+M       G      +R 
Sbjct  234   SKEIDQFLEQIIQDHEHNQYDNYKVQKAPHNNKDFVDILLSLMNQPIDLQGHQNV-IDRT  292

Query  934   HIKPTLSDLFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDL  758
             +IK  + D+  A+ +  +  +EW MSELLRH  +MK++Q+EL++ +G++R VEE DLE L
Sbjct  293   NIKAIILDMIMAAFDTSSTTVEWAMSELLRHQSVMKRLQDELENVVGMNRHVEEIDLEKL  352

Query  757   KYLEMVVKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
              YL MVVKE+LRLHPVAP L+P E+RED  I+G+ I KK
Sbjct  353   AYLNMVVKETLRLHPVAPLLVPRESREDVTIDGYFIKKK  391


 Score =   148 bits (373),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            +KKSRII+N WAI  DP VW NP  F P+RFE  N+D RG  F +IPFGSGRR CPG+ +
Sbjct  389  KKKSRIIVNAWAIGRDPKVWHNPLMFDPKRFENCNVDIRGSDFRVIPFGSGRRGCPGIHM  448

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T V+LV+AQL+HCF+W  P  M  +ELDM E FGL   R+ HL+  P YRL
Sbjct  449  GLTTVKLVLAQLVHCFNWVLPLDMSPDELDMNEIFGLTTPRSKHLLATPVYRL  501


 Score =   276 bits (706),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 210/331 (63%), Gaps = 12/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ G    IV SSP+ AELFLKTHD VFASRP  +A++Y+SYG   L    YGPYW
Sbjct  536   PIMSIKLGQVPTIVVSSPETAELFLKTHDTVFASRPKTQASEYMSYGTKGLVFSEYGPYW  595

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK CT +LLS  K++ F  +RREEL   ++SL++AA  R  V++S +V EL+++I  
Sbjct  596   RNMRKFCTTQLLSASKVDMFAPLRREELGLFVKSLEKAASSRDVVNISEQVGELMSNIVY  655

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +M+ G+    KD D    +G+  E + L G  N+ DY P+    DLQGL R+ K   K +
Sbjct  656   KMILGRN---KD-DRFDLKGLTHEALHLSGVFNMADYVPWARAFDLQGLKRKFKKSKKAF  711

Query  1072  DKFFERILDDHEQSGQSG--SSDQTKDFVDTMLSIMK----SGEAEFQFNREHIKPTLSD  911
             D+  E+ + DHE    S   S   ++DFV  +LS+M       E +   +R ++K  + D
Sbjct  712   DQVLEQTIKDHEDPTDSDKKSVHNSEDFVAILLSLMHQPMDQHEQKHVIDRTNVKAIILD  771

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             + G S +  T  IEW M+ELLRHP +MK +Q+EL S +G+++ VEESDL  L YL MVVK
Sbjct  772   MIGGSFDTSTSAIEWAMTELLRHPRVMKTLQDELNSVVGINKKVEESDLAKLPYLNMVVK  831

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRL+PV P L+P E+ E+  I G++I KK
Sbjct  832   ETLRLYPVVPLLVPRESLENITINGYYIEKK  862


 Score =   147 bits (372),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVW-TNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            +  +KKSRI+IN WAI  DP VW  N E F PERF  +N+D RG  F+LIPFGSGRR CP
Sbjct  857  YYIEKKSRILINAWAIGRDPKVWCNNAEMFYPERFMNNNVDIRGHDFQLIPFGSGRRGCP  916

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+QLG+T V L++AQL+HCF+WE P  +  ++LDMTE+FG+ + R   L+ IP YRL
Sbjct  917  GIQLGLTSVGLILAQLVHCFNWELPLGISPDDLDMTEKFGITIPRCKPLLAIPTYRL  973



>ref|XP_004252382.1| PREDICTED: cytochrome P450 CYP736A12 [Solanum lycopersicum]
Length=493

 Score =   352 bits (902),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 176/332 (53%), Positives = 238/332 (72%), Gaps = 8/332 (2%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P  ++R GL    +ASS   AE FLKT+D +FA+RP  EAAKY+SYG  NL    YGPYW
Sbjct  62    PFFYIRLGLIPTYIASSVDTAEKFLKTYDHIFATRPHNEAAKYLSYGHKNLVFGTYGPYW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKL TL+LL++ KINSFQ++R E++  +I+SLK        VDLS++VS+L ADI+C
Sbjct  122   RNMRKLVTLDLLTHQKINSFQSVRTEQVDLMIQSLKNDG-GGCVVDLSARVSKLSADITC  180

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
              MVFGKKY  ++L +RGF+G+L+E + L    NLGD+FPFL  +DLQG+TR++K L+K +
Sbjct  181   LMVFGKKYMDEELGKRGFKGILQEVVHLGATPNLGDFFPFLGVIDLQGITRKLKELSKVF  240

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSD-LFGAS  896
             D F E+I+D+H    QS    Q+KDFVDTML IM S + EFQF+R +IK  L D L  A 
Sbjct  241   DAFLEKIIDEHV---QSRDQKQSKDFVDTMLDIMHSRDREFQFDRTNIKAILIDMLVAAI  297

Query  895   EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLH  716
             +     ++WI++ELLRHP +M K+Q+EL+  +GL+RMV+ESD E LKYL+MVVKE +RLH
Sbjct  298   DTSATSVDWIVTELLRHPHVMTKLQKELEEVVGLERMVKESDFEKLKYLDMVVKEGMRLH  357

Query  715   PVAPLIPNEAREDCMIEGFHIPKK---ITNHH  629
              V P+   EA EDC+++G+HI K    + NH+
Sbjct  358   SVVPVTQREAMEDCVVDGYHIRKGSRIMINHY  389


 Score =   158 bits (400),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 89/114 (78%), Gaps = 0/114 (0%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            +K SRI+IN +AI  DPNVW  PEKF PERF GS+ID RGR FEL+PF SGRR CP +QL
Sbjct  379  RKGSRIMINHYAIQRDPNVWPEPEKFFPERFVGSSIDIRGRDFELLPFSSGRRSCPAIQL  438

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            GI +VRL+VAQL+HCFD E PN M   +LD+ E FG++ S+ NHL+V+P YRL+
Sbjct  439  GIIVVRLMVAQLVHCFDLELPNGMQPCDLDVDEHFGIVTSKENHLMVVPKYRLN  492



>ref|XP_004490599.1| PREDICTED: uncharacterized protein LOC101502297 [Cicer arietinum]
Length=983

 Score =   286 bits (733),  Expect(2) = 5e-111, Method: Compositional matrix adjust.
 Identities = 154/331 (47%), Positives = 217/331 (66%), Gaps = 14/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+FG    IV SS +AAELFLKTHD+ FASRP  + ++ +SYG   ++   YGPYW
Sbjct  70    PIMSLQFGQIPFIVISSSKAAELFLKTHDIYFASRPKSQGSEIMSYGSKGMAISEYGPYW  129

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL LLS LK+  F  +R+EEL  L++SL++A+L    V++S  V  LI DI  
Sbjct  130   RSVRKLCTLNLLSALKVEMFGPIRKEELGVLVKSLEKASLVGEVVNVSEAVENLIEDIMY  189

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             +M+ G+ KYE  DL     +G+++E M LFG  N+ DY P+LS  D+QGLTR  K ++K+
Sbjct  190   KMILGRSKYEQFDL-----KGLIQEAMVLFGSFNVADYVPWLSAFDIQGLTRACKKMSKS  244

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIM-----KSGEAEFQFNREHIKPTLSD  911
              D+  E I+ +HE+S     + + +DF+D +LSIM     K  E     +R +IK  L D
Sbjct  245   LDEVLEVIITEHEESTNVEKT-RHEDFIDILLSIMHHNIDKENEQSHAIDRTNIKAILLD  303

Query  910   -LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
              + GA +    +I W  SELLRHP++MK +Q E++ ++G  RMVEE DL+  KYL+MV+ 
Sbjct  304   VILGAIDTSANVIGWTFSELLRHPKVMKNLQNEIEKEVGNKRMVEEKDLKKFKYLDMVID  363

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             ESLRL+PV P L+P E RE   I+G+ I +K
Sbjct  364   ESLRLYPVGPLLLPRECRESVTIDGYFIKEK  394


 Score =   144 bits (363),  Expect(2) = 5e-111, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            ++K+R+I+N WAI  DPNVW+ N E+F PERF    ++Y+G+ FE IPFGSGRR CPG+ 
Sbjct  392  KEKTRLIVNAWAIGRDPNVWSENAEEFYPERFVDKTMNYQGQDFECIPFGSGRRRCPGIH  451

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LG+  VR V+AQL+HCF+WE P+++    L+M E+FGL + RA HL  IP+YRL
Sbjct  452  LGLVTVRFVIAQLVHCFNWELPSNITPSNLNMEEKFGLSIPRAQHLHAIPSYRL  505


 Score =   275 bits (702),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 147/331 (44%), Positives = 216/331 (65%), Gaps = 14/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    I+ SS +AAELFLKTHD+VFASRP  +  + ISY    L+   YGPYW
Sbjct  541   PIMSLQLGQVPTIIVSSSKAAELFLKTHDIVFASRPKIQGTELISYDSKALAFSEYGPYW  600

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LLS  K+  F+ +R+EEL  L++SL++A++    V++S  V  LI +I C
Sbjct  601   RSVRKLCTLKLLSPSKVEMFRPIRKEELGVLVKSLEKASMVGEVVNVSEVVGNLIEEIMC  660

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             +++ G+ KYE  DL     + +++E + L G  N+ DY P+L   DLQGLTR  K ++K+
Sbjct  661   KIILGRSKYEQFDL-----KKLVQEALALIGSFNMADYVPWLGAFDLQGLTRAFKRVSKS  715

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSD  911
              D+  E I+ +HEQ+ +   + + +DFV+ +LSIM        E     +R +IK  L D
Sbjct  716   LDEVLEVIITEHEQATKIDKTHR-EDFVNILLSIMHQPIDFENEHNHIIDRTNIKAFLLD  774

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             +  A  +  + +IEW +SEL+RHP +MK +Q+E+ +++G  RMVEE+DL  L YL+MVV 
Sbjct  775   MIVAGIDTSSTVIEWALSELIRHPRVMKNLQDEITNEVGNKRMVEENDLNKLNYLDMVVN  834

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRL+PV P L+P E RE   I+G+ I KK
Sbjct  835   ETLRLYPVGPLLLPRECRESITIDGYFIKKK  865


 Score =   144 bits (364),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            +KK+R++IN WAI  DPNVW+ N ++F PERF    ++Y+G+ F+ IPFGSGRR CPG+Q
Sbjct  863  KKKTRVMINAWAIGRDPNVWSENADEFYPERFIDKKMNYQGQEFDSIPFGSGRRRCPGIQ  922

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LG+  V+LV+AQL+HCF+W+ P +M    L+M E+FGL + RA HL  IP+YRL
Sbjct  923  LGLVTVKLVIAQLVHCFNWKLPYNMSPSNLNMEEKFGLTMPRAQHLYAIPSYRL  976



>ref|XP_008449122.1| PREDICTED: cytochrome P450 CYP736A12-like [Cucumis melo]
Length=432

 Score =   292 bits (748),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 141/322 (44%), Positives = 214/322 (66%), Gaps = 6/322 (2%)
 Frame = -2

Query  1606  MHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWRN  1427
             MH++ GL + I+ SSP  A+LFLKTH+  F++RP    +  +SY + N++    G YW+ 
Sbjct  1     MHMKLGLKSTIIVSSPNVAKLFLKTHEPNFSNRPIPLTSNQMSYNRKNIAFVDLGSYWQT  60

Query  1426  MRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCRM  1247
             MRK+C+  LL++ K+NSF ++RR+EL  L++ L++AA +   VDLSS+VS L  D+ C M
Sbjct  61    MRKICSSHLLTSSKVNSFSSIRRQELGLLVDRLQEAARNHAIVDLSSQVSSLTFDVICVM  120

Query  1246  VFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYDK  1067
             +FGKK+  K+L        ++E   L G  NLGD+ PF++ LDLQGL RR KA+ K  D 
Sbjct  121   LFGKKFVDKELTV-----AIREGTFLSGVPNLGDFIPFIAFLDLQGLCRRAKAINKVVDG  175

Query  1066  FFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDL-FGASEA  890
             F + I+++  +      +D+   FVD ML + +S E E Q +R ++K  L DL  G  ++
Sbjct  176   FLDMIIEERPEFKDQNKTDKGGFFVDVMLDLTRSQEIEHQIDRSNVKAVLFDLMIGGVDS  235

Query  889   ITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRLHPV  710
              +  I W +SE+++HP++MKK+QEEL+  +GL++MVEES L  LKYL+M +KE+LR+HP 
Sbjct  236   SSTTIIWALSEIIKHPQVMKKIQEELQQVVGLNKMVEESHLNQLKYLDMTIKETLRIHPP  295

Query  709   APLIPNEAREDCMIEGFHIPKK  644
              PLIP ++ +DC + G+HIPK 
Sbjct  296   IPLIPRKSIQDCNVNGYHIPKN  317


 Score =   135 bits (340),  Expect(2) = 5e-110, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 85/117 (73%), Gaps = 3/117 (3%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRH--FELIPFGSGRRICPGLQ  475
            K + I+IN WAI  DP+ WT P+KF P+RF  S ID+ G +  FE++PFG GRR CPG+Q
Sbjct  316  KNTDIMINDWAIGQDPSYWTEPQKFNPDRFVDSQIDFIGNNNNFEMLPFGFGRRGCPGMQ  375

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQ-FGLLVSRANHLIVIPNYRLHI  307
            LG+ +VRL+VAQL+HCFDWE PN +   ELDM+E+ FGL   RA +L V+P  R+ I
Sbjct  376  LGLVMVRLIVAQLVHCFDWELPNGVLPSELDMSEESFGLTCPRAQNLRVVPICRVCI  432



>ref|XP_007036499.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY21000.1| Cytochrome P450, putative [Theobroma cacao]
Length=511

 Score =   268 bits (686),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 149/331 (45%), Positives = 205/331 (62%), Gaps = 13/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M +R G    +V SSP+ AELFLKTHD +FA RP  +  +  SYG   ++   YG YW
Sbjct  70    PMMSIRLGTVPAVVISSPRFAELFLKTHDTIFAGRPRIQVVQVFSYGFKGMAFAGYGSYW  129

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKL  ++LLS  KI S   MRRE +  L+ESLK+ A  +  V+LS K+  LI D++ 
Sbjct  130   RSVRKLYNVQLLSASKIESLAPMRREMVSLLVESLKKDAAAQKVVNLSEKLGALIEDMTL  189

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             RMV G  KY+  +L E     +++E   L G  NL DY PFL  LDLQGL  R+KA +  
Sbjct  190   RMVIGHMKYDQFNLKE-----LVQEVTSLAGAFNLADYVPFLGALDLQGLRPRIKAASGA  244

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSD  911
              DK  E I+D+HE         Q +DFVD ML+++        +  +  +R  IK  + D
Sbjct  245   LDKALENIIDEHELKNIHEQQKQQRDFVDLMLTMLNQPMNPHDDPMYIVDRTTIKAIIVD  304

Query  910   LF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             L  G  +  T  IEW ++EL+R+P  M+ +Q EL+S +G+ R VEE DL  L YL+MVVK
Sbjct  305   LITGGLDTTTTTIEWAVTELIRNPRAMQHLQRELQSFVGIYRTVEEIDLPKLTYLDMVVK  364

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRLHPVAP L+P+E+ ED  I+G++IPKK
Sbjct  365   ETLRLHPVAPLLVPHESMEDTTIDGYYIPKK  395


 Score =   156 bits (395),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNP-EKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSRI++NVWAI  DP+VW+N  E+F PERF  SNID RG  FELIPFG+GRR+CPG++L
Sbjct  394  KKSRILVNVWAIGRDPDVWSNNVEEFFPERFIDSNIDLRGHDFELIPFGAGRRMCPGMKL  453

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T V+ V+AQL+HCFDWE P+ M  EELD +E+FGL + R++HL   P YRL
Sbjct  454  GLTTVKFVLAQLVHCFDWELPDGMLPEELDTSEKFGLSLPRSSHLYAKPIYRL  506



>gb|AFK79030.1| cytochrome P450 CYP736A53 [Bupleurum chinense]
Length=498

 Score =   271 bits (692),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 214/331 (65%), Gaps = 14/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G  + IV SSP+AA+LFLKTHD VFA RP  EA +++S+G  N  +   G +W
Sbjct  63    PIMSLRLGYVSTIVVSSPEAAKLFLKTHDSVFADRPKLEAVEHLSFGD-NGITFTNGTFW  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RK    ELL+  K+NS++ MRREEL  ++E +K+ A     VD+S+KV ++I +++ 
Sbjct  122   RHVRKFVVQELLAPAKVNSYEGMRREELGVVVEEIKKDAAAGEVVDVSAKVGDMIENMTY  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             R +FG+    KD D    +G++ E   L G+ N+ D+ PFL   DLQGL RR K  +K  
Sbjct  182   RYLFGRS---KD-DRFDLKGIMTEASFLAGQFNIVDFVPFLRPFDLQGLARRYKQKSKQL  237

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQ------FNREHIKPTLSD  911
             D+  E I+D+HEQ+  + S     D VD M+ + ++  ++         +R  IK  + D
Sbjct  238   DEMLELIIDEHEQN-LNDSHKGNPDVVDEMILLSRNDSSKNHHELAKLLDRPSIKSIVID  296

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             +  AS    +I I+WI++EL++HP  MKK QEEL S +GLDRMVEE DL  L+YL MV+K
Sbjct  297   IITASINTSSISIDWILTELMKHPTAMKKCQEELTSVVGLDRMVEEKDLPKLEYLYMVIK  356

Query  733   ESLRLHPVAPLI-PNEAREDCMIEGFHIPKK  644
             E LRL+P+APL+ P+EA+ED MI G+HI KK
Sbjct  357   EGLRLYPIAPLLGPHEAKEDIMINGYHIHKK  387


 Score =   154 bits (388),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            +   KKSRII+NVWAI  DP VW+ N E+FIPERF  S ID RGR FEL+PFGSGRR CP
Sbjct  382  YHIHKKSRIIVNVWAIGRDPKVWSDNAEEFIPERFADSKIDLRGRDFELLPFGSGRRGCP  441

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+QLG+  V+LV+AQLLHCF+WE P     E+LDMTE FGL + R  HL ++P  R+
Sbjct  442  GIQLGVLNVQLVLAQLLHCFEWELPAGKAPEDLDMTELFGLTIPRIEHLQLVPKIRI  498



>ref|XP_004301062.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=509

 Score =   274 bits (700),  Expect(2) = 6e-109, Method: Compositional matrix adjust.
 Identities = 150/334 (45%), Positives = 220/334 (66%), Gaps = 20/334 (6%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM LR G    IV SSP+AAE FLKTHD  FASRP  +A +Y  Y    ++   YGPYWR
Sbjct  72    IMSLRLGNVPAIVISSPKAAEPFLKTHDTNFASRPKIQATEYF-YCTKGMAFSEYGPYWR  130

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             ++RK+CTL+L    K+ +F  +R+EEL  L+  LK+AA +   VD+S K+ E+  DI+ R
Sbjct  131   HVRKICTLQLFCPAKLETFAPLRKEELGGLVGKLKRAAEEGEVVDVSEKIGEMNEDITYR  190

Query  1249  MVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             MV G K +    D    + +++E   L G  N+ D+ P LS  D+Q + +R+K ++KT D
Sbjct  191   MVLGCKRD----DRFDLKAIVEEIFFLVGAFNISDFIPSLSAFDIQRI-KRLKKVSKTAD  245

Query  1069  KFFERILDDHEQSGQS---GSSDQTKDFVDTMLSIMKS----GEAEFQF-NREHIKPTLS  914
             + +++I+DDHEQ+ ++   G   Q +DFVD +LS  K      + +  F +RE++K  L 
Sbjct  246   QLWDKIIDDHEQAAETKGGGKQGQHEDFVDVLLSFTKQLLNPNDEQVHFLDRENVKAILL  305

Query  913   DLFGA---SEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEM  743
             D+  A   + A TI+  W ++EL+RHP IMK++QEEL++ +G+DRMVEESDL +L YL++
Sbjct  306   DMITAAFDTSATTII--WSLAELMRHPRIMKRLQEELQTVVGMDRMVEESDLPNLDYLDL  363

Query  742   VVKESLRLHPVAPLI-PNEAREDCMIEGFHIPKK  644
             VVKES RLHPVAPL+ P+E+ +D  I+G+ +PKK
Sbjct  364   VVKESFRLHPVAPLLDPHESIKDITIDGYDVPKK  397


 Score =   150 bits (378),  Expect(2) = 6e-109, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSR+I+N W+I  DPNVW+ N E+F PERF   N+  +G H++LIPFG+GRR CPG+QL
Sbjct  396  KKSRLIVNFWSIARDPNVWSENVEEFCPERFTNINVYRQGHHYQLIPFGTGRRGCPGMQL  455

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+T VR+V+AQL+HCF+WE PN M   +LDMTE+FGL +S A HL+  P +RL
Sbjct  456  GLTTVRIVLAQLVHCFNWELPNGMLPLDLDMTEKFGLSMSMAKHLLAKPTFRL  508



>ref|XP_007152786.1| hypothetical protein PHAVU_004G159500g [Phaseolus vulgaris]
 gb|ESW24780.1| hypothetical protein PHAVU_004G159500g [Phaseolus vulgaris]
Length=511

 Score =   273 bits (697),  Expect(2) = 8e-109, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 203/330 (62%), Gaps = 12/330 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    IV SSP+  ELFLKTHD+ FASRP   ++ YISYG   L    YGPYW
Sbjct  69    PIMSLKLGQVPTIVISSPEIVELFLKTHDITFASRPKSISSNYISYGGKGLVFSEYGPYW  128

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRKLCT++LL   K+  F  +R E+L   +  L++ A  R  +DLS     +I +++ 
Sbjct  129   RNMRKLCTVQLLIASKVEMFSPLRSEQLAECVRFLQKTASSREVIDLSDTAGNIIENVTF  188

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +M+F      KD D    + +++E +DL G  N+ DY P+L   DLQGL RR+K ++K++
Sbjct  189   KMIFDCS---KD-DRFDVKNLVREVLDLAGTFNVADYLPWLRMFDLQGLVRRLKKVSKSF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSDL  908
             D   E+I+ DHEQ        Q KDFVD  L++M        E      R HIK  +  +
Sbjct  245   DVVLEQIIRDHEQYSDKEEKGQ-KDFVDIFLALMHQPLDPHDEHGPVVERTHIKAVVMTM  303

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               A  +  +  +EW MSELL+HP +MKK+Q+EL+S +G+ R VEE+D+E L YL++VVKE
Sbjct  304   IIAGIDTSSTSVEWAMSELLKHPRVMKKLQDELESVVGMKRKVEETDMEKLLYLDLVVKE  363

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +LRL+PV P L+P E RED  I+G+ I K 
Sbjct  364   TLRLYPVVPLLVPRECREDVTIDGYFIKKN  393


 Score =   150 bits (379),  Expect(2) = 8e-109, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            +K SR+I+N WA+  DP VW+ N E F PERF  +N+D +G  F LIPFGSGRR CPG+ 
Sbjct  391  KKNSRVIVNAWAVGRDPKVWSDNAEMFYPERFTNNNVDIKGFDFRLIPFGSGRRGCPGIH  450

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LG+T V++V++QL+HCF+WE P+ M  +ELDMTE+FGL + R+ HL+ +P YRL
Sbjct  451  LGLTTVKIVLSQLVHCFNWELPSGMSPDELDMTEKFGLTMPRSKHLLAVPTYRL  504



>gb|KHN32022.1| Cytochrome P450 71A1 [Glycine soja]
Length=511

 Score =   275 bits (704),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 210/331 (63%), Gaps = 12/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ G    IV SSP+ AELFLKTHD VFASRP  +A++Y+SYG   L    YGPYW
Sbjct  70    PIMSIKLGQVPTIVVSSPETAELFLKTHDTVFASRPKTQASEYMSYGTKGLVFSEYGPYW  129

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RNMRK CT +LLS  K++ F  +RREEL   ++SL++AA  R  V++S +V EL+++I  
Sbjct  130   RNMRKFCTTQLLSASKVDMFAPLRREELGLFVKSLEKAASSRDVVNISEQVGELMSNIVY  189

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +M+ G+    KD D    +G+  E + L G  N+ DY P+    DLQGL R+ K   K +
Sbjct  190   KMILGRN---KD-DRFDLKGLTHEALHLSGVFNMADYVPWARAFDLQGLKRKFKKSKKAF  245

Query  1072  DKFFERILDDHEQSGQSG--SSDQTKDFVDTMLSIMKSG----EAEFQFNREHIKPTLSD  911
             D+  E+ + DHE    S   S   ++DFV  +LS+M       E +   +R ++K  + D
Sbjct  246   DQVLEQTIKDHEDPTDSDKKSVHNSEDFVAILLSLMHQPMDQHEQKHVIDRTNVKAIILD  305

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             + G S +  T  IEW M+ELLRHP +MK +Q+EL S +G+++ VEESDL  L YL MVVK
Sbjct  306   MIGGSFDTSTSAIEWAMTELLRHPRVMKTLQDELNSVVGINKKVEESDLAKLPYLNMVVK  365

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRL+PV P L+P E+ E+  I G++I KK
Sbjct  366   ETLRLYPVLPLLVPRESLENITINGYYIEKK  396


 Score =   147 bits (372),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 86/117 (74%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVW-TNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            +  +KKSRI+IN WAI  DP VW  N E F PERF  +N+D RG  F+LIPFGSGRR CP
Sbjct  391  YYIEKKSRILINAWAIGRDPKVWCNNAEMFYPERFMNNNVDIRGHDFQLIPFGSGRRGCP  450

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+QLG+T V L++AQL+HCF+WE P  +  ++LDMTE+FG+ + R   L+ IP YRL
Sbjct  451  GIQLGLTSVGLILAQLVHCFNWELPLGISPDDLDMTEKFGITIPRCKPLLAIPTYRL  507



>ref|XP_010537441.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=509

 Score =   271 bits (693),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/331 (46%), Positives = 210/331 (63%), Gaps = 10/331 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+AAELFLKTHD VFASR   +AA+ +SYG   +   PY PYW
Sbjct  68    PIMSIRLGSVQTIVVSSPRAAELFLKTHDNVFASRAKDQAAEIMSYGTKAIILQPYSPYW  127

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLC + LLS  K+  F+ +  EE+  ++  LK AA  +  V++S  ++EL  +I  
Sbjct  128   RDVRKLCVVHLLSTSKMEQFKPIIPEEIGLMMSHLKNAAEKKEVVNVSEILAELFENIVY  187

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ G  Y   +      +  ++E M L G  N+ DY PFL+  DLQGL RRMK L+K+ 
Sbjct  188   RMILG--YSKNNDGGMKLKEHVEEMMSLAGAFNISDYLPFLAPFDLQGLARRMKELSKSM  245

Query  1072  DKFFERILDDHEQSGQSG-SSDQTKDFVDTMLSIMKSGEAEFQFN-----REHIKPTLSD  911
             D   E+I+++HE   +   S D  KDFVD +LS+M         N     R H+K  L D
Sbjct  246   DIILEKIIEEHEHQNEEHKSKDHHKDFVDVLLSLMNQSMNPLDKNSDIIGRIHVKAILVD  305

Query  910   L-FGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             L   A E   I+IEW  SE+L++  +MKK+QEEL++ IG+DR V+ESDL +L+YL+MV K
Sbjct  306   LVVAAVETSAIVIEWTFSEILKNSRVMKKLQEELETIIGMDRKVQESDLPELEYLDMVTK  365

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E  RLHPV P L+P+E+ ED +++GF+IP+K
Sbjct  366   EGFRLHPVGPFLVPHESMEDVVVDGFYIPRK  396


 Score =   150 bits (380),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 90/117 (77%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVW-TNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            F   +KSR+++NVW+I  DP+VW  N E+F PERFE  +ID RG  F LIPFGSGRR CP
Sbjct  391  FYIPRKSRVLVNVWSIGRDPDVWPKNTEEFYPERFENDDIDIRGLDFRLIPFGSGRRRCP  450

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+Q+G+ +V+LV+A L+HCFDW+ P+ M +E++DM E+FGL V RAN++I  P YRL
Sbjct  451  GMQIGLPIVKLVLAYLVHCFDWKMPDGMLFEKIDMDEKFGLSVGRANNVIARPIYRL  507



>ref|XP_003615667.1| Cytochrome P450 [Medicago truncatula]
Length=959

 Score =   277 bits (709),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 213/331 (64%), Gaps = 16/331 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    IV SS + AE FLKTHD+VFASRP  + ++ +SYG   L    YGPYW
Sbjct  520   PIMSLQLGQVPTIVISSSKGAESFLKTHDIVFASRPKIQGSELMSYGSKGLPFSEYGPYW  579

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRK CTL+LLS  K+     +R+EEL  L+ +LK+A+L    V++S  V  LI DI  
Sbjct  580   RSMRKFCTLKLLSASKVEKSGPIRKEELGVLVNTLKKASLVGEVVNVSEIVENLIEDIVY  639

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             +M+ G+ KYE  DL     + ++K+ + L G  NL DY P+L   DLQGLT+  K  +K 
Sbjct  640   KMILGRGKYEQFDL-----KKMIKDGLTLMGAFNLADYVPWLGIFDLQGLTQACKKTSKA  694

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSD  911
              D+  E I+ +HE   Q+ ++D  KDFVDT+LSIM       G  +   +R  IK  L D
Sbjct  695   LDEVLEMIITEHE---QTTNTDDPKDFVDTVLSIMHQTIDVEGGQDLVIDRTIIKAILLD  751

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             + GAS +  + +IEW +SELLRHP +MK +Q+E+++++G  RMVEE DL++  YL+MVV 
Sbjct  752   MIGASIDTSSNVIEWALSELLRHPRVMKILQDEIQNEVGNKRMVEEKDLKNFNYLDMVVD  811

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRL+PVAP LIP E RE+  I+ + I +K
Sbjct  812   ETLRLYPVAPLLIPRECRENITIDDYSIKEK  842


 Score =   143 bits (361),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            ++ ++K+R+I+N WAI  DP+VW+ N E+F PERF    ++Y G+ FE IPFGSGRR CP
Sbjct  837  YSIKEKTRVIVNAWAIGRDPDVWSENAEEFYPERFIEKKMNYLGQEFESIPFGSGRRRCP  896

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+QLG+  V+LV+AQ +HCF+WE P+++    L+M E+FGL + RA HL  IP+YRL
Sbjct  897  GIQLGMITVKLVIAQFVHCFNWELPHNISPSNLNMEEKFGLTIPRAQHLHAIPSYRL  953


 Score =   268 bits (685),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/331 (45%), Positives = 211/331 (64%), Gaps = 14/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    IV SS +AAE FLKTHD+VFA+RP    A+ ISYG   L+   Y PYW
Sbjct  70    PIMSLQLGQVPTIVISSSKAAESFLKTHDIVFANRPKLIGAEIISYGCKGLAFSKYDPYW  129

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+++KLCTL+LLS  K+     +R EEL  L+ +LK+A+L    V++S  V  +I DI  
Sbjct  130   RSVKKLCTLKLLSASKVEKSGPIRTEELGILVNTLKKASLVGEVVNVSEIVENVIEDIVY  189

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             +M+ G+ KYE  DL     + +++E + L G  NL DY P+L   DLQGLT+  K ++K 
Sbjct  190   KMILGRGKYEQFDL-----KKLVQEGLALIGAFNLADYVPWLGIFDLQGLTKSCKKVSKA  244

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSD  911
              D+  E IL +HEQ+     +   KDFVD +LSIM       GE     +R +IK  L D
Sbjct  245   IDEQLEVILTEHEQAANVNKTHH-KDFVDILLSIMHQTIDVEGEQNLVIDRTNIKAILLD  303

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             +  A+ +     IEW +SELLRHP +MKK+Q+E+++++G  R +EE D++ L YL+MVV 
Sbjct  304   MIVAAIDTSATSIEWALSELLRHPRVMKKLQDEIQNEVGNKRKIEEKDMKKLNYLDMVVD  363

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRL+PVAP L+P E+RE  +I+G+ I +K
Sbjct  364   ETLRLYPVAPLLVPRESRESTIIDGYFIKEK  394


 Score =   114 bits (285),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 72/113 (64%), Gaps = 19/113 (17%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            ++K+R+I+N WAI  DPNVW+                    +FE IPFGS RR CPG+QL
Sbjct  392  KEKTRLIVNAWAIGRDPNVWS-------------------ENFESIPFGSSRRRCPGIQL  432

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  ++LV+AQ +HCF+WE P+++    L+M E+FGL + R  HL  IP+YRL
Sbjct  433  GLITIKLVIAQFVHCFNWELPHNISSSSLNMEEKFGLTIPRTQHLHAIPSYRL  485



>ref|XP_004490596.1| PREDICTED: uncharacterized protein LOC101501242 [Cicer arietinum]
Length=965

 Score =   279 bits (714),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 217/331 (66%), Gaps = 14/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    I+ SS +AAELFLKTHD+VFASRP  +A+K ISY    L+   YGPYW
Sbjct  523   PIMSLQLGQVPTIIVSSSKAAELFLKTHDIVFASRPKIQASKLISYDSKGLAFSEYGPYW  582

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LLS  K+  F  +R+EEL  L++SL++A++    V++S  V  LI +I C
Sbjct  583   RSVRKLCTLKLLSPSKVEMFGPIRKEELGVLVKSLEKASMVGEVVNVSEVVGNLIEEIMC  642

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             +++ G+ KYE  DL     + +++E + L G  N+ DY P+L   DLQGLTR  K ++K+
Sbjct  643   KIILGRSKYEQFDL-----KKLIQEALALIGSFNMADYVPWLGAFDLQGLTRACKRVSKS  697

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSD  911
              D+  E I+ +HEQ+ +   + + +DFV+ +LSIM        E     +R +IK  L D
Sbjct  698   LDEVLEVIITEHEQATKIDKTHR-EDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLD  756

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             +  A  +  + +IEW +SEL+RHP +MK +Q+E+ +++G  RMVEE+DL  L YL+MVV 
Sbjct  757   MIVAGIDTSSTVIEWALSELIRHPRVMKNLQDEITNEVGNKRMVEENDLNKLNYLDMVVN  816

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRL+PV P LIP E RE   I+G+ I KK
Sbjct  817   ETLRLYPVGPLLIPRECRESRTIDGYFIKKK  847


 Score =   141 bits (355),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            +KK+R++IN WAI  D NVW+ N ++F PERF    ++Y+G+ F+ IPFGSGRR CPG+Q
Sbjct  845  KKKTRVMINAWAIGRDLNVWSENADEFYPERFIDKKMNYQGQEFDSIPFGSGRRRCPGIQ  904

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LG+  V+LV+AQL+HCF+W+ P +M    L+M E+FGL + RA HL  IP+YRL
Sbjct  905  LGLVTVKLVIAQLVHCFNWKLPYNMSPSNLNMEEKFGLTMPRAQHLYAIPSYRL  958


 Score =   279 bits (713),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 213/331 (64%), Gaps = 14/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    I+ SS +AAELFLKTHD+VFASRP  +  + ISYG   L    YGPYW
Sbjct  72    PIMSLQLGQVPTIIVSSSKAAELFLKTHDIVFASRPKIQGTELISYGSKGLGFAEYGPYW  131

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRKLCTL+LLS  K+  F  +R+EEL  L++SL++A++    V++S     LI D+  
Sbjct  132   RSMRKLCTLKLLSPSKVEMFGPIRKEELGVLVKSLEKASMVGEVVNVSEVAGNLIEDVIY  191

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             +M+ GK KYE  DL     + +++E M L G  N+ DY P+L   DLQGLTR  K ++K+
Sbjct  192   KMILGKSKYEQFDL-----KKLVQEAMALIGTFNMADYVPWLGAFDLQGLTRAFKRVSKS  246

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSD  911
              D+  E I+ +HEQ+ +   + + +DFV+ +LSIM        E     +R +IK  L D
Sbjct  247   LDEVLEVIITEHEQATKIDKTHR-EDFVNILLSIMHQPIEFENEHNLIIDRTNIKAILLD  305

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             +  A  +  + +IEW +SEL+RHP +MK +Q+E+ +++G  RMVEE+DL  L YL+MVV 
Sbjct  306   MIVAGIDTSSTVIEWALSELIRHPRVMKNLQDEITNEVGNKRMVEENDLNKLNYLDMVVN  365

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRL+PV P LIP E RE   I+G+ I +K
Sbjct  366   ETLRLYPVGPLLIPRECRESITIDGYFIKEK  396


 Score =   120 bits (300),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 75/113 (66%), Gaps = 19/113 (17%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            ++K+R++INVWAI  DPNVW+                    +F+ IPFGSGRR CPG+QL
Sbjct  394  KEKTRVMINVWAIGRDPNVWS-------------------ENFDSIPFGSGRRRCPGIQL  434

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  V+LV+AQL+HCF+WE P +M    L+M E+FGL + RA HL  IP+YRL
Sbjct  435  GLVTVKLVIAQLVHCFNWELPYNMSPSNLNMEEKFGLSMPRAQHLYAIPSYRL  487



>ref|XP_003525259.2| PREDICTED: cytochrome P450 750A1-like [Glycine max]
Length=468

 Score =   276 bits (706),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 145/334 (43%), Positives = 207/334 (62%), Gaps = 15/334 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    +V SS +AAE FLK HD VFASRP  EA+KY  YG   L+   YGPYW
Sbjct  19    PIMSLRLGQVPHVVVSSSEAAEDFLKAHDAVFASRPRLEASKYFGYGSKGLAFSEYGPYW  78

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDR---VAVDLSSKVSELIAD  1262
             R MRK+CTL LL+  K++SF  +R+ EL   ++SL+++A  +   V VDLS  V  ++ +
Sbjct  79    RYMRKVCTLRLLTASKVDSFAPLRKRELELAVKSLQESAAAKEGEVVVDLSEVVHNVVEE  138

Query  1261  ISCRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALA  1082
             I  +MV G        DE   +G+++  M+L G  NL DY P+L   DLQGL R  K ++
Sbjct  139   IVYKMVLGSSKH----DEFDLKGLIQNAMNLTGAFNLSDYVPWLRAFDLQGLNRSYKRIS  194

Query  1081  KTYDKFFERILDDHEQSG--QSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKP  923
             K  D+  E+I+ +HE     Q+    + +DF+D +LS+M        E     ++ +IK 
Sbjct  195   KALDEVMEKIIKEHEHGSDVQNEQHHRHRDFIDILLSLMHQPIDPYDEQNHIIDKTNIKA  254

Query  922   TLSDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLE  746
              L D+  GA E    ++EW  SELLRHP +MK +Q+EL + +G D+MVEE+DL  L YL+
Sbjct  255   ILLDMIAGAFETSATVVEWTFSELLRHPRVMKNLQDELDNVVGRDKMVEENDLAKLSYLD  314

Query  745   MVVKESLRLHPVAPLIPNEAREDCMIEGFHIPKK  644
             +V+KE+LRL+P  PL+P E+ ED M++G+ + KK
Sbjct  315   IVIKETLRLYPPGPLVPRESTEDAMVQGYFLKKK  348


 Score =   143 bits (361),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            +KKSRIIIN+WA+  D  +W+ N E F PERF   N+D+RG   + IPFG GRR CPG+ 
Sbjct  346  KKKSRIIINIWAMGRDSKIWSDNAEVFYPERFINKNLDFRGLDLQYIPFGFGRRGCPGIH  405

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LG+  V++VVAQL+HCF WE P  M   ELDM+E+FGL + R  HLI +P YRL
Sbjct  406  LGLATVKIVVAQLVHCFSWELPGGMTPGELDMSEKFGLSIPRVKHLIAVPKYRL  459



>gb|AES98625.2| cytochrome P450 family 71 protein [Medicago truncatula]
Length=508

 Score =   276 bits (707),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 213/331 (64%), Gaps = 16/331 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    IV SS + AE FLKTHD+VFASRP  + ++ +SYG   L    YGPYW
Sbjct  69    PIMSLQLGQVPTIVISSSKGAESFLKTHDIVFASRPKIQGSELMSYGSKGLPFSEYGPYW  128

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRK CTL+LLS  K+     +R+EEL  L+ +LK+A+L    V++S  V  LI DI  
Sbjct  129   RSMRKFCTLKLLSASKVEKSGPIRKEELGVLVNTLKKASLVGEVVNVSEIVENLIEDIVY  188

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             +M+ G+ KYE  DL     + ++K+ + L G  NL DY P+L   DLQGLT+  K  +K 
Sbjct  189   KMILGRGKYEQFDL-----KKMIKDGLTLMGAFNLADYVPWLGIFDLQGLTQACKKTSKA  243

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSD  911
              D+  E I+ +HE   Q+ ++D  KDFVDT+LSIM       G  +   +R  IK  L D
Sbjct  244   LDEVLEMIITEHE---QTTNTDDPKDFVDTVLSIMHQTIDVEGGQDLVIDRTIIKAILLD  300

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             + GAS +  + +IEW +SELLRHP +MK +Q+E+++++G  RMVEE DL++  YL+MVV 
Sbjct  301   MIGASIDTSSNVIEWALSELLRHPRVMKILQDEIQNEVGNKRMVEEKDLKNFNYLDMVVD  360

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRL+PVAP LIP E RE+  I+ + I +K
Sbjct  361   ETLRLYPVAPLLIPRECRENITIDDYSIKEK  391


 Score =   143 bits (360),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            ++ ++K+R+I+N WAI  DP+VW+ N E+F PERF    ++Y G+ FE IPFGSGRR CP
Sbjct  386  YSIKEKTRVIVNAWAIGRDPDVWSENAEEFYPERFIEKKMNYLGQEFESIPFGSGRRRCP  445

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+QLG+  V+LV+AQ +HCF+WE P+++    L+M E+FGL + RA HL  IP+YRL
Sbjct  446  GIQLGMITVKLVIAQFVHCFNWELPHNISPSNLNMEEKFGLTIPRAQHLHAIPSYRL  502



>gb|KHF97324.1| Cytochrome P450 [Gossypium arboreum]
 gb|KHG09556.1| Cytochrome P450 [Gossypium arboreum]
Length=519

 Score =   272 bits (696),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 139/331 (42%), Positives = 209/331 (63%), Gaps = 12/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +  G    IV SSP+AAELFLK HD+VFASRP  ++AKY +YG   ++   YG YW
Sbjct  80    PIMSIMLGKVPTIVVSSPEAAELFLKVHDVVFASRPKVQSAKYFAYGGKAMAFTQYGSYW  139

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R +RK   L  LS  K+  F ++R+ E+  L+ES+++ A     ++LS  V++++  +  
Sbjct  140   RTVRKWSILHFLSASKVQCFASIRKAEVGLLVESVRKVAAAGETINLSQAVAKVLEGMMS  199

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +++FG+  +    D+  F+ ++ E M L G  NL DY PFL+ LDLQG TRR+K ++   
Sbjct  200   KVLFGRSMD----DKIDFKPLVNEAMHLAGVFNLSDYVPFLAPLDLQGYTRRLKKVSSGL  255

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG------EAEFQFNREHIKPTLSD  911
              +FF++++D+++Q          ++F   M+S++ +       +  +   RE+IK  + D
Sbjct  256   HEFFDKMIDEYQQGINMDDQKPYRNFFQVMVSLLDTPINPNDEDQPYIVGRENIKAIMVD  315

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             +  AS +  T  IEW  SELLRHP +M  +Q+EL+S +G +RMVEESDL  L YL+MV+K
Sbjct  316   MVAASFDTTTTAIEWTFSELLRHPRVMVALQKELESVVGRNRMVEESDLPKLAYLDMVIK  375

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             ES RLHPVAP L+P+E+ ED  I G+ IPKK
Sbjct  376   ESFRLHPVAPLLVPHESTEDVTINGYFIPKK  406


 Score =   147 bits (371),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSR+++N W++  +P +W+ N E+F PERF+   ID RG  FELIPFG+GRR CPG+QL
Sbjct  405  KKSRLLVNTWSMGRNPKIWSSNAEEFFPERFKDRKIDLRGHDFELIPFGTGRRGCPGMQL  464

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
             +  +RL++AQ  HCFDWE P+ M   ELDMTE+FGL + RANHL+  P YRL
Sbjct  465  ALISMRLILAQSAHCFDWELPDGMLPNELDMTEKFGLTLPRANHLLAKPTYRL  517



>ref|XP_003615678.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98636.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=510

 Score =   276 bits (705),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 214/331 (65%), Gaps = 15/331 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    IV SS +AAE FLKTHD+VFASRP  + ++ +SYG   ++ C YGPYW
Sbjct  70    PIMSLQLGQVPAIVISSSKAAESFLKTHDIVFASRPKIQGSELMSYGSKGMAFCEYGPYW  129

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RK CTL+LLS  K+     +R+EEL  L+ +LK+AAL    V++S  V  LI DI  
Sbjct  130   RSVRKFCTLKLLSASKVEMSGPIRKEELSILVNTLKKAALVGEVVNVSEVVENLIEDIVY  189

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             +++FG+ KYE  DL     + +++E + L G  NL DY P+L   DLQGLT+  K ++K 
Sbjct  190   KLMFGRSKYEQFDL-----KSLVQEGLALIGAFNLADYVPWLGIFDLQGLTKSCKKVSKA  244

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSD  911
              D+  E IL +HEQ+     +   KDFVD +LSIM       GE     +R +IK  L D
Sbjct  245   LDEVLEVILTEHEQAANVNKTQ--KDFVDILLSIMHQTIDIEGEQNLVIDRTNIKAILLD  302

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             +  A+ +     IEW +SELLRHP +MKK+Q+E+++++G  RMV E DL+ L YL+MVV 
Sbjct  303   MIVAAIDTSATSIEWALSELLRHPRVMKKLQDEIQNEVGNKRMVNEKDLKKLNYLDMVVD  362

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRL+PVAP L+P E+RE   I+G+ I +K
Sbjct  363   ETLRLYPVAPLLVPRESRESTTIDGYFIKEK  393


 Score =   142 bits (358),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            ++K+R+I+N WAI  DPNVW+ N ++F PERF    ++Y G+ FE IPFGSGRR CPG+Q
Sbjct  391  KEKTRLIVNAWAIGRDPNVWSENAKEFYPERFVEKKMNYLGQEFESIPFGSGRRRCPGIQ  450

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            LG+  V+LV+AQ +HCF+WE P+++    L+M E+FGL + RA HL  IP+YRL+
Sbjct  451  LGLITVKLVIAQFIHCFNWELPHNISPSNLNMEEKFGLTIPRAQHLHAIPSYRLN  505



>gb|KHG07950.1| Cytochrome P450 [Gossypium arboreum]
Length=519

 Score =   273 bits (697),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 139/331 (42%), Positives = 209/331 (63%), Gaps = 12/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +  G    IV SSP+AAELFLK HD+VFASRP  ++AKY +YG   ++   YG YW
Sbjct  80    PIMSIMLGKVPTIVVSSPEAAELFLKVHDVVFASRPKVQSAKYFAYGGKAMAFTQYGSYW  139

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R +RK   L  LS  K+  F ++R+ E+  L+ES+++ A     ++LS  V++++  +  
Sbjct  140   RTVRKWSILHFLSASKVQCFASIRKAEVGLLVESVRKVAAAGETINLSQAVAKVLEGMMS  199

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +++FG+  +    D+  F+ ++ E M L G  NL DY PFL+ LDLQG TRR+K ++   
Sbjct  200   KVLFGRSMD----DKIDFKPLVNEAMHLAGVFNLSDYVPFLAPLDLQGYTRRLKKVSSGL  255

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG------EAEFQFNREHIKPTLSD  911
              +FF++++D+++Q          ++F   M+S++ +       +  +   RE+IK  + D
Sbjct  256   HEFFDKMIDEYQQGINMDDQKPYRNFFQVMVSLLDTPINPNDEDQPYIVGRENIKAIMVD  315

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             +  AS +  T  IEW  SELLRHP +M  +Q+EL+S +G +RMVEESDL  L YL+MV+K
Sbjct  316   MVAASFDTTTTAIEWTFSELLRHPRVMVALQKELESVVGRNRMVEESDLPKLAYLDMVIK  375

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             ES RLHPVAP L+P+E+ ED  I G+ IPKK
Sbjct  376   ESFRLHPVAPLLVPHESTEDVTINGYFIPKK  406


 Score =   143 bits (361),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSR+++N W++  +P +W+ N E+F PERF+   ID RG  FELIPFG+GRR CPG+QL
Sbjct  405  KKSRLLVNTWSMGRNPKIWSSNAEEFFPERFKDRKIDLRGHDFELIPFGTGRRGCPGMQL  464

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
             +  +RL++AQL HCFDWE P+ M   ELDM+E+FGL + RANHL+    YRL
Sbjct  465  VLISMRLILAQLAHCFDWELPDGMLPNELDMSEKFGLSLPRANHLLAKSTYRL  517



>emb|CBI15434.3| unnamed protein product [Vitis vinifera]
Length=1049

 Score =   271 bits (694),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 146/333 (44%), Positives = 208/333 (62%), Gaps = 37/333 (11%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM++R G    ++ SS QA +LFLKTHD+VFASRP  +A ++++YG   ++   YGPYW
Sbjct  593   PIMYMRLGCVPTVIVSSAQATKLFLKTHDVVFASRPKLQAFEHLTYGTKGIAFSEYGPYW  652

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RKL  L                      ++SLK+ A     VD+S+KV++++ DIS 
Sbjct  653   RNVRKLWML----------------------VQSLKEMAAAGEVVDISTKVAQVVEDISY  690

Query  1252  RMVFGKKYE-MKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             RMVFG+  + M DL     + +++E   L G  NLGDYFPFL  LDLQGL +R KA+ K 
Sbjct  691   RMVFGRNKDGMIDL-----KTLVREGTRLAGTFNLGDYFPFLGPLDLQGLVQRFKAINKA  745

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSD  911
              D+  E+I+D   Q G  G      +F+D MLS+M +      E+ +  +R ++K  L D
Sbjct  746   ADEVLEKIIDRRIQDG--GKDHNHSNFIDIMLSLMSNFSNLRSESSYIIDRTNVKAILLD  803

Query  910   -LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
              L G  ++ +  IEW+ SELLRHP +M+++Q EL++ + +DRMV+ESDLE+L YL MVVK
Sbjct  804   MLVGGIDSSSTTIEWVFSELLRHPRVMRQLQHELQNVVKMDRMVDESDLENLVYLNMVVK  863

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKKIT  638
             E LRLHP+ P L+P+ + ED  IEG  IPK+ T
Sbjct  864   EVLRLHPIGPFLVPHASTEDITIEGHFIPKRST  896


 Score =   144 bits (363),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = -3

Query  648   KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
             K+S I+IN WAI  DPN W+ N ++F+PERF  SNID +GR FELIPFGSGRR CPG+QL
Sbjct  893   KRSTILINTWAIGRDPNFWSDNVDEFLPERFINSNIDLQGRDFELIPFGSGRRGCPGIQL  952

Query  471   GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
             G+  VRLV+AQLLHCF+WE PN M  ++LDM+E+FGL + R    + + N  L++
Sbjct  953   GLRTVRLVLAQLLHCFNWELPNDMSSDDLDMSEKFGLTMPRNGVSLNVNNNFLYV  1007


 Score =   171 bits (433),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 138/210 (66%), Gaps = 14/210 (7%)
 Frame = -2

Query  1246  VFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTYD  1070
             VFG+ K ++ DL     + +++E   L G  NL DY PFL  LDLQG T+ ++  ++  D
Sbjct  43    VFGRNKVQIIDL-----KTLIREFTRLAGTFNLADYVPFLGPLDLQGPTQLLRTNSEAID  97

Query  1069  KFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG-----EAEFQFNREHIKPTLSD-L  908
             +F E+I+D H Q       +   +F+D +LS+M        E+ +  +R+++K  + D L
Sbjct  98    EFLEKIIDKHIQDVSKDEVNHM-NFIDVVLSLMNKSNNYEDESLYAIDRKNVKAIILDAL  156

Query  907   FGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKES  728
              G ++     IEWI+SELLRHP +M+++QEELK+ +G+ RMVEESDLE+L YL MVVKE+
Sbjct  157   AGGTDTSITSIEWILSELLRHPRVMRQLQEELKNVVGMRRMVEESDLENLDYLNMVVKET  216

Query  727   LRLHPVAP-LIPNEAREDCMIEGFHIPKKI  641
             LRLHP  P LIP+E+ ED +I G++IPKK+
Sbjct  217   LRLHPTTPLLIPHESMEDIVINGYYIPKKL  246


 Score = 37.4 bits (85),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 19/30 (63%), Gaps = 0/30 (0%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNPEKFIPERF  559
            KK RI+IN W I  DPNVW+N  + I   +
Sbjct  244  KKLRILINAWTIRRDPNVWSNNHEIIENTY  273


 Score =   108 bits (270),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 61/161 (38%), Positives = 96/161 (60%), Gaps = 14/161 (9%)
 Frame = -2

Query  1303  AVDLSSKVSELIADISCRMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLS  1127
              VD+S++V+E+I D++ RMVFG  K EM DL     + ++ E   L G  N+ DY PFL 
Sbjct  358   VVDISTRVAEVIEDMAYRMVFGHDKDEMIDL-----KTLIGEATSLAGTFNIADYLPFLG  412

Query  1126  TLDLQGLTRRMKALAKTYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG-----  962
             + DLQGLTRR +A ++  D+  E+I+D H +  + G +    +F+D MLS+M        
Sbjct  413   SFDLQGLTRRFQAASEAIDEVLEKIIDKHTKDARDGVNHM--NFMDIMLSLMSKSNDFKD  470

Query  961   EAEFQFNREHIKPTLSD-LFGASEAITILIEWIMSELLRHP  842
             E  +  +R ++K  + D L G  ++  I ++W ++ELLRHP
Sbjct  471   EPLYAIDRTNVKAIILDILVGGIDSSLISVDWALAELLRHP  511



>gb|KCW79058.1| hypothetical protein EUGRSUZ_C00484 [Eucalyptus grandis]
Length=502

 Score =   270 bits (691),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/331 (44%), Positives = 207/331 (63%), Gaps = 16/331 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    +V SSP+AAEL LKT+D +F+SRP  +A +++SYG   ++    G YW
Sbjct  65    PIMFLRLGNKPTVVVSSPEAAELVLKTYDGIFSSRPSVDAMRHLSYGNKGMAFAESGAYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R MRKLC L+LLS  K+ SF  MRREEL  ++  ++  A +  AVD+S++V +LIAD++C
Sbjct  125   RGMRKLCKLQLLSPAKVESFAPMRREELGRVVRRVRAVATEHEAVDVSAEVGQLIADLAC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ G        D+   + V+ E ++L G  NL DY P L  LDLQG+TRR KA+ +  
Sbjct  185   RMILGCSTR----DKFNLKPVIHEGLNLVGAFNLADYVPLLGALDLQGITRRAKAVNRAV  240

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIM-------KSGEAEFQFNREHIKPTLS  914
             DK  E I+ +HE   +  +     DF+DT+L+ M          E     +R +IK    
Sbjct  241   DKVLEDIIREHE---EDTTGKYEGDFIDTLLAGMGHPINGSPQDEPVHVLDRTNIKALAL  297

Query  913   DLFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVV  737
             D+  AS E+ +  IEW MSEL+RHP  MK++Q EL++ +GL R VEE+DL  L Y++MVV
Sbjct  298   DMIAASYESSSTAIEWAMSELIRHPHAMKRLQRELEAAVGLGRTVEEADLPKLNYMDMVV  357

Query  736   KESLRLHPVAP-LIPNEAREDCMIEGFHIPK  647
             KES RL+P  P LIP+E+ E   + G++IPK
Sbjct  358   KESFRLYPPGPLLIPHESTEGIEMGGYYIPK  388


 Score =   145 bits (365),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            K +R+I+N WA+  D   W  +PE+F PERF    +D +GR F+LIPFGSGRR CPG+ L
Sbjct  388  KGTRVIVNAWALGRDAGTWAEDPEEFRPERFADGGVDVKGRDFQLIPFGSGRRGCPGMHL  447

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  VRLV+AQL+HCFDWE P     +ELDM+E FGL + RA HLI+ P+YRL
Sbjct  448  GLVNVRLVLAQLVHCFDWELPAGTSPKELDMSEDFGLAMPRAKHLILRPSYRL  500



>ref|XP_010047217.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=531

 Score =   270 bits (691),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/331 (44%), Positives = 207/331 (63%), Gaps = 16/331 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    +V SSP+AAEL LKT+D +F+SRP  +A +++SYG   ++    G YW
Sbjct  94    PIMFLRLGNKPTVVVSSPEAAELVLKTYDGIFSSRPSVDAMRHLSYGNKGMAFAESGAYW  153

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R MRKLC L+LLS  K+ SF  MRREEL  ++  ++  A +  AVD+S++V +LIAD++C
Sbjct  154   RGMRKLCKLQLLSPAKVESFAPMRREELGRVVRRVRAVATEHEAVDVSAEVGQLIADLAC  213

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ G        D+   + V+ E ++L G  NL DY P L  LDLQG+TRR KA+ +  
Sbjct  214   RMILGCSTR----DKFNLKPVIHEGLNLVGAFNLADYVPLLGALDLQGITRRAKAVNRAV  269

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIM-------KSGEAEFQFNREHIKPTLS  914
             DK  E I+ +HE   +  +     DF+DT+L+ M          E     +R +IK    
Sbjct  270   DKVLEDIIREHE---EDTTGKYEGDFIDTLLAGMGHPINGSPQDEPVHVLDRTNIKALAL  326

Query  913   DLFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVV  737
             D+  AS E+ +  IEW MSEL+RHP  MK++Q EL++ +GL R VEE+DL  L Y++MVV
Sbjct  327   DMIAASYESSSTAIEWAMSELIRHPHAMKRLQRELEAAVGLGRTVEEADLPKLNYMDMVV  386

Query  736   KESLRLHPVAP-LIPNEAREDCMIEGFHIPK  647
             KES RL+P  P LIP+E+ E   + G++IPK
Sbjct  387   KESFRLYPPGPLLIPHESTEGIEMGGYYIPK  417


 Score =   145 bits (365),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            K +R+I+N WA+  D   W  +PE+F PERF    +D +GR F+LIPFGSGRR CPG+ L
Sbjct  417  KGTRVIVNAWALGRDAGTWAEDPEEFRPERFADGGVDVKGRDFQLIPFGSGRRGCPGMHL  476

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  VRLV+AQL+HCFDWE P     +ELDM+E FGL + RA HLI+ P+YRL
Sbjct  477  GLVNVRLVLAQLVHCFDWELPAGTSPKELDMSEDFGLAMPRAKHLILRPSYRL  529



>ref|XP_006350392.1| PREDICTED: cytochrome P450 71A1-like [Solanum tuberosum]
Length=507

 Score =   266 bits (680),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 139/326 (43%), Positives = 203/326 (62%), Gaps = 9/326 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+M L+ G    ++ SSP+ AEL LKTHD +FASRP  +A  Y+  G   L+  P GP W
Sbjct  73    PLMFLKLGNIPTVIISSPETAELILKTHDAIFASRPKLKAINYMVDGTKGLAFAPSGPRW  132

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN RK CT ELL+  KI     MR+EE+  L+E +K    + V VDL  ++ +LI +++ 
Sbjct  133   RNNRKFCTQELLTAEKIGYSAGMRKEEIGVLVEKVKGFGGELVVVDLGERIGDLIGNMTY  192

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             RM+FG+   E  DL     + ++KE + L G  N+ DY PFL   D+QGL +++K   K 
Sbjct  193   RMLFGEGNSERFDL-----KNIVKEMVRLSGTFNVADYVPFLEPFDIQGLNKQLKETGKR  247

Query  1075  YDKFFERILDDHEQSGQSGS-SDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-G  902
               + F+ I+++HEQ   + +   + KD VD MLS   +  + +  +R  +K  LSD+  G
Sbjct  248   VQEIFDTIINEHEQDANNYTHKSKNKDLVDIMLSYQDNPNSSYSIDRATMKAILSDMIVG  307

Query  901   ASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLR  722
             A +     IEW+ +E+++HP +M K+Q+EL S +GLDRMVEE DL  L+YLE+V+KE+ R
Sbjct  308   AIDTSHTWIEWVFAEIIKHPTVMNKLQDELTSIVGLDRMVEEDDLPKLEYLELVLKETFR  367

Query  721   LHPVAP-LIPNEAREDCMIEGFHIPK  647
             LHPVAP L+P E+ ED +I   +IPK
Sbjct  368   LHPVAPLLVPRESIEDVVINECYIPK  393


 Score =   148 bits (374),  Expect(2) = 3e-106, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 87/113 (77%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            K SR++IN WA+ HDP +W+ N EKFIPERF G NI+ RG  F L+PFG GRR CPG+ L
Sbjct  393  KGSRVMINCWALGHDPKIWSDNVEKFIPERFIGKNINLRGHDFHLLPFGYGRRSCPGINL  452

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  V+L+VAQL+HCF+W+ P+ +  ++LDMTE+FGL   RA +L+VIP YRL
Sbjct  453  GLITVKLIVAQLVHCFNWDLPDGILPDDLDMTEKFGLAAPRAQNLLVIPTYRL  505



>ref|XP_007160365.1| hypothetical protein PHAVU_002G315400g [Phaseolus vulgaris]
 gb|ESW32359.1| hypothetical protein PHAVU_002G315400g [Phaseolus vulgaris]
Length=517

 Score =   272 bits (696),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 140/329 (43%), Positives = 206/329 (63%), Gaps = 10/329 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G   ++V SS +AA+ FLK HD VFASRP  EA+KY  YG   L+   YGPYW
Sbjct  73    PIMSLRLGQVPIVVVSSSEAAQHFLKPHDAVFASRPILEASKYFGYGSKGLAFSEYGPYW  132

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+MRK+CTL+LLS  K+ SF  +R+ E+   ++ +++ A     +DLS  V +++ DI  
Sbjct  133   RHMRKVCTLQLLSASKVESFAPLRKREVELAVKLVEERAARGEVLDLSRVVHDVVEDIVY  192

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +MV G        DE   +G+++  M++ G  N+ DY P+L  LDLQGL R  K ++   
Sbjct  193   KMVLG----CSKHDEFDLKGLIQNGMNIAGAFNITDYVPWLRPLDLQGLNRSYKKISAAL  248

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLS-----IMKSGEAEFQFNREHIKPTLSDL  908
             D+  E+I+ +HEQ     +    KDF+D +LS     I    E     +  +IK  L D+
Sbjct  249   DQVLEKIIKEHEQGSDVQNEKHHKDFIDILLSLKHQPIDPQDEQSHVIDETNIKAILLDM  308

Query  907   F-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               GA E    ++EW +SELLRHP +MKK+Q+EL + +G +++VEE+DL  LKYL++V+KE
Sbjct  309   IAGAFETSATVVEWTLSELLRHPRVMKKLQDELDNLVGRNKLVEENDLAKLKYLDIVIKE  368

Query  730   SLRLHPVAPLIPNEAREDCMIEGFHIPKK  644
             +LRL+P  PL+P E+ ED ++EG+ + KK
Sbjct  369   TLRLYPPGPLVPRESTEDVIVEGYFLEKK  397


 Score =   139 bits (349),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 63/116 (54%), Positives = 81/116 (70%), Gaps = 1/116 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            +  +KKSRIIIN+WA+  D N+W+ N E F PERF  +N+D+RG   + IPFG GRR CP
Sbjct  392  YFLEKKSRIIINLWAMGRDCNIWSDNAEVFYPERFINNNLDFRGYDLQYIPFGFGRRGCP  451

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYR  316
            G+ LG+  V+LVVAQL+HCF WE P  M  +ELDM E+FGL + R  HL  +P  R
Sbjct  452  GIHLGLATVKLVVAQLVHCFSWELPEGMTPDELDMNERFGLTIPRVKHLFAVPRNR  507



>ref|XP_010694276.1| PREDICTED: cytochrome P450 CYP736A12-like [Beta vulgaris subsp. 
vulgaris]
Length=505

 Score =   269 bits (687),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 147/332 (44%), Positives = 207/332 (62%), Gaps = 15/332 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIMHLR G+    + SSP+AAEL LK HDL+F SR P  A  Y+ YG       PYG YW
Sbjct  64    PIMHLRLGILPTTIISSPEAAELILKQHDLIFCSRAPTLATFYMWYGTKGFGLTPYGDYW  123

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R  R++ TL + +  K+   Q +R+ E+  ++  LK+AA  R  VDLS KV ELI +I  
Sbjct  124   RRARRISTLHVFTTTKVVESQGLRKREIEGVVRWLKRAAESREVVDLSKKVGELIEEIMF  183

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEM----DLFGKVNLGDYFPFLSTLDLQGLTRRMKAL  1085
             +M+ GK  E+  ++++  RG LKE M    ++ G  NLGD+ PFL+ LDLQGLTR+MK L
Sbjct  184   KMLLGKNNEV--VEDQNMRGDLKELMEEVVNVGGTFNLGDFLPFLAPLDLQGLTRKMKNL  241

Query  1084  AKTYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEF---QFNREHIKPTLS  914
              K  DK F++I++DH +   +    Q KD +  +LSIM +   EF    F R+++K  + 
Sbjct  242   TKRVDKIFDKIIEDHLKEDIA----QKKDVLSNLLSIMSNPNNEFFLDSFGRDNVKAIML  297

Query  913   DLFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVV  737
             DLF A  +  +  + W +S LL HP +M  +QEEL + +  +RMV+ESDL +L YL+MVV
Sbjct  298   DLFTAGIDTSSHTLVWALSALLSHPRVMNLLQEELDAIVTKNRMVKESDLPNLPYLDMVV  357

Query  736   KESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             KE+LRL+P  P L+P E  ED +++GF I K 
Sbjct  358   KETLRLYPTVPLLLPRECLEDVVVDGFTIRKN  389


 Score =   142 bits (357),  Expect(2) = 5e-105, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 87/119 (73%), Gaps = 1/119 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            FT +K +RI+IN WAI  D  +W+ N E+F PERF  S+I  RG  F LIPFG+GRR CP
Sbjct  384  FTIRKNTRILINYWAIARDTKLWSKNSEEFFPERFINSDIHIRGPDFMLIPFGAGRRGCP  443

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            G+QLG+  V++V+AQ++HCF+WE P+ +  EE+DMTE+FG  + R   L+ IP+YRL I
Sbjct  444  GMQLGLATVKIVLAQMVHCFNWELPDGVVPEEMDMTERFGFTMPRTKKLLAIPSYRLPI  502



>ref|XP_004308347.1| PREDICTED: cytochrome P450 71A1-like [Fragaria vesca subsp. vesca]
Length=504

 Score =   261 bits (666),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/335 (44%), Positives = 203/335 (61%), Gaps = 20/335 (6%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    IV SSP+AAELFLKTHD  FA RP  +A  ++S G   +    YGPY 
Sbjct  65    PIMSLRLGNIPTIVVSSPEAAELFLKTHDANFAGRPRFQALDFMSSG---VGLAEYGPYQ  121

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLC+L LL   K+  F  +RREE+  +++S+K A      VD++ K+ EL  DI  
Sbjct  122   RHVRKLCSLHLLCPSKLQVFAPLRREEIGLMVQSMKNAGEKGELVDVNEKIFELNEDIMY  181

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G K +    D    +G+LKE     G  NL D+FP+L +LD+QGL+RR K  +K  
Sbjct  182   RMVLGCKTD----DRFDLKGILKETFLALGAFNLADFFPYLCSLDIQGLSRRFKRNSKRI  237

Query  1072  DKFFERILDDHEQSGQ----SGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPT  920
             D   E I+ DHEQ+ +    SG      DFVD +LS+M       G+     +R ++K  
Sbjct  238   DLLLETIIQDHEQANKTEMRSGQRGHDHDFVDMLLSLMNQPLNFDGQVHL-MDRTNMKAI  296

Query  919   LSDLFGASEAIT-ILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEE-SDLEDLKYLE  746
             + D+  AS   + +++ WI SEL+RHP +MK +Q+EL S IG DRMV+E +DL  L YL 
Sbjct  297   IFDMIVASTHTSAVMVVWIFSELMRHPRVMKNLQQELDSVIGKDRMVQEVTDLPKLGYLN  356

Query  745   MVVKESLRLHPVAPLI-PNEAREDCMIEGFHIPKK  644
             MVVKE+ RLHP  PL+ P+E+  D  ++GF I KK
Sbjct  357   MVVKETFRLHPAGPLLFPHESINDTTVQGFKIAKK  391


 Score =   149 bits (375),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (75%), Gaps = 1/119 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            F   KKSRI+INVW+I  DP +W+ N E+F PERF  S ID +G+ F+LIPFGSGRR CP
Sbjct  386  FKIAKKSRILINVWSIGRDPKLWSENVEEFYPERFLDSKIDLQGQDFQLIPFGSGRRGCP  445

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            G++LG+T V+LVVA L HCFDWE P  +  ++LDM+E+F + + +A H++  P YRLHI
Sbjct  446  GMKLGLTTVQLVVAHLAHCFDWELPGGLQPQDLDMSEKFEMSLEKAVHVLAKPTYRLHI  504



>ref|XP_003615666.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98624.1| cytochrome P450 family 71 protein [Medicago truncatula]
 gb|AFK39835.1| unknown [Medicago truncatula]
Length=511

 Score =   265 bits (678),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 150/331 (45%), Positives = 209/331 (63%), Gaps = 14/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    I+ SS +AAE FLKTHD+VFASRP  + +  +SYG   ++   YGPYW
Sbjct  70    PIMSLQLGQVPTIIISSSKAAESFLKTHDIVFASRPKVQGSDLMSYGSKGMAFSEYGPYW  129

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RK CTL+L S  K+  F  +R+E+L  L+ SL++AAL+   V++S  V  LI DI  
Sbjct  130   RSVRKFCTLKLFSASKVEMFGPIRKEKLDVLVISLEKAALEGEVVNVSEVVENLIEDIVY  189

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             +M+FG+ KYE  D+++     ++ E M L G  NL DY P+L   DLQGLTR  K  +K 
Sbjct  190   KMMFGRSKYEQFDMNK-----LVLEAMALMGAFNLADYVPWLGVFDLQGLTRACKKTSKA  244

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSD  911
              D+  E I+ +HEQ+  +  + + +DFVD +LSIM       GE     +R +IK  L D
Sbjct  245   LDEVLEMIITEHEQTTNTDKT-RNEDFVDILLSIMHQTIDVEGEQNLVIDRTNIKAILLD  303

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             +  AS       IEW +SELLRH  +MK +Q+E+++++G  RMVEE DL+   YL+MVV 
Sbjct  304   MIAASVHTSATTIEWALSELLRHSRVMKILQDEIQNEVGNKRMVEEKDLKKFNYLDMVVD  363

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E+LRL+PV P LIP E RE   I+G+ I KK
Sbjct  364   ETLRLYPVGPLLIPRECRESITIDGYFITKK  394


 Score =   141 bits (356),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 85/113 (75%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KK+R+I+N WAI  D NVW+ N ++F PERF    ++Y+G  FE IPFGSGRR CPG+QL
Sbjct  393  KKTRVIVNAWAIGRDCNVWSENADEFYPERFIDKKMNYQGHEFESIPFGSGRRRCPGIQL  452

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+ +V+LV+AQ +HCF+WE P+++    L+M E+FGL + RA HL  IP+YRL
Sbjct  453  GLIIVKLVIAQFVHCFNWELPHNISPSNLNMEEKFGLSIPRAQHLQAIPSYRL  505



>ref|XP_007152783.1| hypothetical protein PHAVU_004G159300g [Phaseolus vulgaris]
 ref|XP_007152784.1| hypothetical protein PHAVU_004G159300g [Phaseolus vulgaris]
 gb|ESW24777.1| hypothetical protein PHAVU_004G159300g [Phaseolus vulgaris]
 gb|ESW24778.1| hypothetical protein PHAVU_004G159300g [Phaseolus vulgaris]
Length=511

 Score =   258 bits (660),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 143/330 (43%), Positives = 201/330 (61%), Gaps = 12/330 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    IV SSP+ AELFLKTHD+ FA R    ++  ISYG   L     GPYW
Sbjct  69    PIMSLKLGQVPTIVISSPEIAELFLKTHDITFAFRSKSISSNSISYGGKGLIFSENGPYW  128

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R MRKLCT++LL   K+  F  +R E+L   +  L++ A  R  +DLS     +I +++ 
Sbjct  129   RIMRKLCTVQLLIASKVEMFSPLRNEQLAEFVRFLQKIASSREVIDLSDTAGNIIENVTF  188

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             +M+FG     KD D    + +++E +DL G  N+ DY P+L   DLQGL RR+K ++K++
Sbjct  189   KMIFGCS---KD-DRFDVKNLVRELLDLVGTFNVADYLPWLRMFDLQGLVRRLKKVSKSF  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKP-TLSD  911
             D   E+I+ DHEQ        Q KDFVD +L+++        E      R HIK   ++ 
Sbjct  245   DVVLEQIIRDHEQYSDKEDKGQ-KDFVDILLALIHQPMDPHDEHGPVVERTHIKAVVMTM  303

Query  910   LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
             +       +I +EW MSELL+HP +MKKVQ+EL+S +G+ R VEE+D+E L YL++VVKE
Sbjct  304   IITGINTSSITVEWAMSELLKHPRVMKKVQDELESVVGMKRKVEETDMEKLPYLDLVVKE  363

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +LRL+PV P L+P E RED  I+G+ I K 
Sbjct  364   TLRLYPVVPLLVPRECREDVTIDGYFIKKN  393


 Score =   149 bits (375),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            +K SR+I+N WA+  DP VW+ N E F PERF  +N+D +G  F LIPFGSGRR CPG+ 
Sbjct  391  KKNSRLIVNAWALGRDPKVWSDNAEMFYPERFTNNNVDIKGFDFRLIPFGSGRRGCPGIH  450

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LG+  V++V+AQL+HCF+WE P+ M  +ELDMTE+FGL + R+ HL+ +P YRL
Sbjct  451  LGLATVKIVLAQLVHCFNWELPSGMSPDELDMTEKFGLTMPRSKHLLAVPTYRL  504



>ref|XP_007211074.1| hypothetical protein PRUPE_ppa017688mg [Prunus persica]
 gb|EMJ12273.1| hypothetical protein PRUPE_ppa017688mg [Prunus persica]
Length=462

 Score =   281 bits (719),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 146/306 (48%), Positives = 202/306 (66%), Gaps = 13/306 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    IV SSP+AAELFLK+HD +FASRP  +++ Y+ YG  +++   YGPYW
Sbjct  61    PIMSMRLGTKTTIVVSSPEAAELFLKSHDTIFASRPKVQSSDYLLYGSKDMAFSEYGPYW  120

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCTL+LL   KI +F  +RREE+  L+ESLK+AA +   VDLS KV EL+ DI+ 
Sbjct  121   RHIRKLCTLQLLCPSKIETFAPLRREEVGSLVESLKKAAAEGQVVDLSEKVGELLEDITN  180

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RMV G K +    D    +G+++E + L G VN+ D  PFLS  D QGLT+RM  L+K  
Sbjct  181   RMVLGSKTD----DTCDMKGIIEELVLLMGAVNISDCLPFLSPFDFQGLTKRMTRLSKRI  236

Query  1072  DKFFERILDDHEQSGQSGSSDQT---KDFVDTMLSIMK-----SGEAEFQFNREHIKPTL  917
             D+  E+I+ +H++  +SG + Q    KDFVD MLS+M      + E  +  +R ++K  +
Sbjct  237   DQLLEKIIGEHQEVSKSGQAHQGHRHKDFVDVMLSLMHQPLNPNDEQVYMIDRTNVKAII  296

Query  916   SDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
              D+  GA +  T  I W ++ELLRHP +MK +Q+EL+S IG D+MVEESD   L YL MV
Sbjct  297   LDMISGAFDTSTTAIVWTLAELLRHPRVMKHLQQELQSVIGTDQMVEESDFSKLGYLNMV  356

Query  739   VKESLR  722
             +KES R
Sbjct  357   LKESFR  362


 Score =   124 bits (312),  Expect(2) = 1e-103, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 76/99 (77%), Gaps = 1/99 (1%)
 Frame = -3

Query  606  DPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQLGITLVRLVVAQLLH  430
            DPNVW+ N E+F PERF   N+D RG  F+L+PFGSGRR CP +QLG+T VRLV+A L+H
Sbjct  363  DPNVWSENVEEFYPERFIDGNVDLRGYDFQLLPFGSGRRGCPAMQLGLTTVRLVLANLVH  422

Query  429  CFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
             F+W+ P+ +  E++DMTE FGL +++  HL+V+P YRL
Sbjct  423  FFNWDLPSGLKPEDVDMTETFGLSLTKTEHLLVMPIYRL  461



>gb|KHG22812.1| Cytochrome P450 [Gossypium arboreum]
Length=493

 Score =   256 bits (655),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/334 (44%), Positives = 206/334 (62%), Gaps = 29/334 (9%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +R G    +V SSP  AE+FLKTHD+VFASRP  +  + I  G+  ++   +GPYW
Sbjct  67    PIMSIRLGSVPTVVVSSPPVAEMFLKTHDVVFASRPKVQVLQSIYNGKKGIAFTEHGPYW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RK C  +L +  KI SF   R+E L + IE LK+AA+++  V++S KV +L   ++ 
Sbjct  127   RSVRKFCNQQLFNASKIESFAPSRKEVLAHFIEFLKEAAVEKEVVNISKKVGDLNEKMNL  186

Query  1252  RMVFG--KKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAK  1079
             +M+ G  KKYE  +L E     +++E  +L G  NL D+ PFL   DLQGL  R + L +
Sbjct  187   KMILGSVKKYEEFNLKE-----LIEELTNLAGAFNLADFVPFLGAFDLQGLKSRTRTLGE  241

Query  1078  TYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFN-------REHIKP-  923
               D+  E I++DH+Q  Q        DFV TML+     E   Q N       R  IK  
Sbjct  242   KLDEALETIINDHQQQKQD-------DFVGTMLT-----ELNKQMNPDGDIMDRNSIKAI  289

Query  922   TLSDLFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEM  743
             T+  + G+ +     +EW +SEL+RHP +M K Q+EL+S IG  RMVEE+DL  L+YL+M
Sbjct  290   TIDMIVGSLDTSAATLEWALSELIRHPRVMLKFQQELESVIG-KRMVEENDLPKLEYLDM  348

Query  742   VVKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             VV+E+LRLHPVAP L+P E+ ED +I+G +IPKK
Sbjct  349   VVRETLRLHPVAPLLVPRESMEDIVIDGCYIPKK  382


 Score =   145 bits (367),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 82/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNP-EKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSR+++NVWAI  DPNVW+N  E F PERF  SNI+  G  FELIPFGSGRR+CPG +L
Sbjct  381  KKSRVLVNVWAIGRDPNVWSNNVEDFFPERFINSNIELHGHDFELIPFGSGRRVCPGKKL  440

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  V+L++AQL+HCFDWE P  M   ELDMTE FG  + R  +L   P YR+
Sbjct  441  GLITVKLILAQLVHCFDWELPTGMSPNELDMTENFGSSLPRKTNLCAKPIYRM  493



>ref|XP_010036876.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
Length=531

 Score =   255 bits (652),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 143/331 (43%), Positives = 202/331 (61%), Gaps = 16/331 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    +V SSP+AAEL LKT+D +F+SRP  +A  ++SYG   ++    G YW
Sbjct  94    PIMFLRLGNKPTVVVSSPEAAELVLKTYDGIFSSRPSVDALHHLSYGNKGMAFAESGAYW  153

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R MRKLCTL+LLS  K+ SF  MRREEL  ++  ++ AA    AVD+S++V +LI D++C
Sbjct  154   RGMRKLCTLQLLSPAKVESFAPMRREELGRVVRRVRVAAAAHEAVDVSAEVGQLIGDLAC  213

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ G        D+   +  + E ++L G  NL DY P L  LDLQG+TRR KA+ +  
Sbjct  214   RMILGCSTR----DKFNLKPGIHEALNLAGAFNLADYVPLLGALDLQGITRRAKAVNRVV  269

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIM-------KSGEAEFQFNREHIKPTLS  914
             DK  E I+ +HE   +  +     DF+D +L+ M          E      R +IK    
Sbjct  270   DKVLEDIIREHE---EDTTGKYEGDFIDALLAGMGHPINGSPQDEPVHVLGRTNIKALAL  326

Query  913   DLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVV  737
             D+   + E+ +  IEW MSEL+RHP  +K++Q EL++ +GL R VEE+DL  L Y++MVV
Sbjct  327   DMIAASYESSSAAIEWAMSELIRHPHALKRLQRELEAAVGLGRTVEEADLPKLNYMDMVV  386

Query  736   KESLRLHPVAP-LIPNEAREDCMIEGFHIPK  647
             KES RL+P  P LIP+E+ E   + G++IPK
Sbjct  387   KESFRLYPPGPLLIPHESTEGIEMGGYYIPK  417


 Score =   146 bits (368),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            K +R+I+N WA+  D + W  +PE+F PERF  S +D +GR F+LIPFGSGRR CPG+ L
Sbjct  417  KGTRVIVNAWALGRDADTWAEDPEEFRPERFANSGVDVKGRDFQLIPFGSGRRGCPGMHL  476

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  VRLV+AQL+HCFDWE P      ELDM+E FGL + RA HLI+ P+YRL
Sbjct  477  GLVNVRLVLAQLVHCFDWELPAGTSPSELDMSEDFGLSMPRAKHLILRPSYRL  529



>gb|KCW48536.1| hypothetical protein EUGRSUZ_K02211 [Eucalyptus grandis]
Length=502

 Score =   255 bits (652),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 143/331 (43%), Positives = 202/331 (61%), Gaps = 16/331 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    +V SSP+AAEL LKT+D +F+SRP  +A  ++SYG   ++    G YW
Sbjct  65    PIMFLRLGNKPTVVVSSPEAAELVLKTYDGIFSSRPSVDALHHLSYGNKGMAFAESGAYW  124

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R MRKLCTL+LLS  K+ SF  MRREEL  ++  ++ AA    AVD+S++V +LI D++C
Sbjct  125   RGMRKLCTLQLLSPAKVESFAPMRREELGRVVRRVRVAAAAHEAVDVSAEVGQLIGDLAC  184

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ G        D+   +  + E ++L G  NL DY P L  LDLQG+TRR KA+ +  
Sbjct  185   RMILGCSTR----DKFNLKPGIHEALNLAGAFNLADYVPLLGALDLQGITRRAKAVNRVV  240

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIM-------KSGEAEFQFNREHIKPTLS  914
             DK  E I+ +HE   +  +     DF+D +L+ M          E      R +IK    
Sbjct  241   DKVLEDIIREHE---EDTTGKYEGDFIDALLAGMGHPINGSPQDEPVHVLGRTNIKALAL  297

Query  913   DLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVV  737
             D+   + E+ +  IEW MSEL+RHP  +K++Q EL++ +GL R VEE+DL  L Y++MVV
Sbjct  298   DMIAASYESSSAAIEWAMSELIRHPHALKRLQRELEAAVGLGRTVEEADLPKLNYMDMVV  357

Query  736   KESLRLHPVAP-LIPNEAREDCMIEGFHIPK  647
             KES RL+P  P LIP+E+ E   + G++IPK
Sbjct  358   KESFRLYPPGPLLIPHESTEGIEMGGYYIPK  388


 Score =   146 bits (368),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            K +R+I+N WA+  D + W  +PE+F PERF  S +D +GR F+LIPFGSGRR CPG+ L
Sbjct  388  KGTRVIVNAWALGRDADTWAEDPEEFRPERFANSGVDVKGRDFQLIPFGSGRRGCPGMHL  447

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            G+  VRLV+AQL+HCFDWE P      ELDM+E FGL + RA HLI+ P+YRL
Sbjct  448  GLVNVRLVLAQLVHCFDWELPAGTSPSELDMSEDFGLSMPRAKHLILRPSYRL  500



>ref|XP_008346791.1| PREDICTED: cytochrome P450 CYP736A12-like isoform X2 [Malus domestica]
Length=399

 Score =   260 bits (664),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 190/288 (66%), Gaps = 12/288 (4%)
 Frame = -2

Query  1483  ISYGQMNLSSCPYGPYWRNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRV  1304
             ++YG   ++   YGPYWR +RKLCTL+LL   KI  F  +RREE+  L++SLK AA    
Sbjct  1     MAYGTKAMALTEYGPYWRRIRKLCTLQLLCPSKIEGFAPLRREEVGLLVQSLKVAAEAGE  60

Query  1303  AVDLSSKVSELIADISCRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLST  1124
              VD S KV EL+  I+ RMV G+K +    D    +G+++E + L G  N+ DY PFLS 
Sbjct  61    VVDFSEKVGELVEGITYRMVLGRKND----DMFDLKGIIEEALFLTGAFNISDYVPFLSP  116

Query  1123  LDLQGLTRRMKALAKTYDKFFERILDDHEQSGQSG-SSDQTKDFVDTMLS-----IMKSG  962
             LDLQGLT+RMK ++K  D+  E+I+ DHEQ  +S    +  KDFVD +LS     +  + 
Sbjct  117   LDLQGLTKRMKRVSKXVDQLLEKIIQDHEQVSRSEVQGNHHKDFVDVLLSSIHQPLNPND  176

Query  961   EAEFQFNREHIKPTLSDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRM  785
             E  +   R + K  L D+  GA +     I W ++ELLRHP++MK++QEEL+S IG+DRM
Sbjct  177   EEVYMLERTNAKAILLDMIAGAFDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMDRM  236

Query  784   VEESDLEDLKYLEMVVKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             VEESDL  L YL MVVKESLRL+PVAP L+P+++ ED  ++G+HIPKK
Sbjct  237   VEESDLPKLDYLSMVVKESLRLNPVAPLLVPHQSMEDITVDGYHIPKK  284


 Score =   141 bits (356),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSR+  N+W I  DP+VW+ N E+F PE F  +N+D RG  F+LIPFGSGRR CP +QL
Sbjct  283  KKSRVFXNIWTIGRDPSVWSDNVEEFYPEXFMNNNVDLRGHDFQLIPFGSGRRGCPAMQL  342

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            G+T VR V+  LLHCF+WE P+ M  ++LDMTE+FGL +S+A HL+ +   RL+
Sbjct  343  GLTTVRXVLGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMXTCRLY  396



>ref|XP_008346790.1| PREDICTED: cytochrome P450 CYP736A12-like isoform X1 [Malus domestica]
Length=399

 Score =   259 bits (663),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 139/288 (48%), Positives = 190/288 (66%), Gaps = 12/288 (4%)
 Frame = -2

Query  1483  ISYGQMNLSSCPYGPYWRNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRV  1304
             ++YG   ++   YGPYWR +RKLCTL+LL   KI  F  +RREE+  L++SLK AA    
Sbjct  1     MAYGTKAMALTEYGPYWRRIRKLCTLQLLCPSKIEGFAPLRREEVGLLVQSLKVAAEAGE  60

Query  1303  AVDLSSKVSELIADISCRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLST  1124
              VD S KV EL+  I+ RMV G+K +    D    +G+++E + L G  N+ DY PFLS 
Sbjct  61    VVDFSEKVGELVEGITYRMVLGRKND----DMFDLKGIIEEALFLTGAFNISDYVPFLSP  116

Query  1123  LDLQGLTRRMKALAKTYDKFFERILDDHEQSGQSG-SSDQTKDFVDTMLS-----IMKSG  962
             LDLQGLT+RMK ++K  D+  E+I+ DHEQ  +S    +  KDFVD +LS     +  + 
Sbjct  117   LDLQGLTKRMKRVSKXVDQLLEKIIKDHEQVSRSEVQGNHHKDFVDVLLSSIHQPLNPND  176

Query  961   EAEFQFNREHIKPTLSDLF-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRM  785
             E  +   R + K  L D+  GA +     I W ++ELLRHP++MK++QEEL+S IG+DRM
Sbjct  177   EEVYMLERTNAKAILLDMIAGAFDTSATAIVWTLAELLRHPKVMKRLQEELQSVIGMDRM  236

Query  784   VEESDLEDLKYLEMVVKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             VEESDL  L YL MVVKESLRL+PVAP L+P+++ ED  ++G+HIPKK
Sbjct  237   VEESDLPKLDYLSMVVKESLRLNPVAPLLVPHQSMEDITVDGYHIPKK  284


 Score =   141 bits (356),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            KKSR+  N+W I  DP+VW+ N E+F PE F  +N+D RG  F+LIPFGSGRR CP +QL
Sbjct  283  KKSRVFXNIWTIGRDPSVWSDNVEEFYPEXFMNNNVDLRGHDFQLIPFGSGRRGCPAMQL  342

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            G+T VR V+  LLHCF+WE P+ M  ++LDMTE+FGL +S+A HL+ +   RL+
Sbjct  343  GLTTVRXVLGNLLHCFNWELPSGMLPKDLDMTEKFGLSLSKAKHLLAMXTCRLY  396



>ref|XP_002310009.2| hypothetical protein POPTR_0007s06300g [Populus trichocarpa]
 gb|EEE90459.2| hypothetical protein POPTR_0007s06300g [Populus trichocarpa]
Length=371

 Score =   239 bits (611),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 121/216 (56%), Positives = 157/216 (73%), Gaps = 5/216 (2%)
 Frame = -2

Query  1285  KVSELIADISCRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGL  1106
             KVS L ADISCRMV GKKY  K+  E+GF+ V+ E M L    N GDY P ++ LDLQGL
Sbjct  47    KVSSLSADISCRMVLGKKYMEKEFHEKGFKPVIHEGMRLAASFNFGDYIPPIAPLDLQGL  106

Query  1105  TRRMKALAKTYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIK  926
             T+RMKA+ K +D FFE+I+D+H    Q    ++TKDFVD ML  + S E E++  R++IK
Sbjct  107   TKRMKAVGKVFDDFFEKIIDEHI---QFKDENRTKDFVDVMLDFLGSEETEYRIVRDNIK  163

Query  925   PTLSD-LFGASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYL  749
               + D L G+ +     IEW +SEL++HP +MKKVQ+EL+ KIG+DRMVEESDLE L+YL
Sbjct  164   AIIMDMLVGSMDTSATAIEWTLSELIKHPRVMKKVQKELEEKIGMDRMVEESDLEGLEYL  223

Query  748   EMVVKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
              MV+KE+ RLHPVAP LIP+E+ EDC I+GF IP+K
Sbjct  224   HMVIKEAFRLHPVAPLLIPHESMEDCTIDGFLIPQK  259


 Score =   161 bits (408),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 89/118 (75%), Gaps = 0/118 (0%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPG  481
            F   +K+R+I+NVWAI  + + WT+  KFIPERF GSNID RGR F+L+PFG+GRR CPG
Sbjct  254  FLIPQKTRVIVNVWAIGREQSAWTDSNKFIPERFAGSNIDVRGRDFQLLPFGAGRRGCPG  313

Query  480  LQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLHI  307
            + LG+T+   +VAQL+HCFDWE   +M  EE+DMTE FGL+  RANHL   P YRLH+
Sbjct  314  MHLGLTMDLQIVAQLVHCFDWELRKNMLREEVDMTEAFGLVTPRANHLCATPTYRLHL  371


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -2

Query  1606  MHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISY  1475
             M++R GL   +V SSP+AAEL LKTHDLVFA+RPP EAAK+ISY
Sbjct  1     MYMRLGLVPAVVVSSPRAAELILKTHDLVFANRPPNEAAKHISY  44



>ref|XP_010537440.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=507

 Score =   261 bits (667),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 145/331 (44%), Positives = 211/331 (64%), Gaps = 13/331 (4%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ G    IV SSP+AAELFLKT+D VFASRP  +AA     G   ++  PYG +W
Sbjct  69    PIMSIKLGTVRTIVVSSPRAAELFLKTYDHVFASRPKTQAAGIFFNGSKAVTLTPYGTHW  128

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RKL  + LL+  KI  F+ +R EE+  +I+ +K AA     V++S  + EL  ++  
Sbjct  129   RNVRKLYVVHLLNTSKIIQFKPIRTEEIGRVIDRVKTAAEKNEVVNVSKILLELFENLVY  188

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+ G+    K+ D+   + +++E + L G  N+ DY P L+ LDLQGL RRMK L K+ 
Sbjct  189   RMILGRS---KNDDDVKLKELVEEMVSLAGAFNISDYLPLLAPLDLQGLFRRMKQLRKSM  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG------EAEFQFNREHIKPTLSD  911
             D   ++I+++HE   +   S   KDFVD +LS++          +E   +R H+   L D
Sbjct  246   DIILDKIIEEHEHQ-KDYKSKDDKDFVDVLLSLLNQSIDPQDKNSEI-IDRNHVIVILLD  303

Query  910   LFGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVK  734
             + GAS E     IEWI SE+L++P +MKK+Q+EL++ IG DRMV+ESDL  L YL+MV+K
Sbjct  304   MVGASLETSVKAIEWIFSEILKNPRVMKKLQDELETIIGKDRMVQESDLSKLTYLDMVIK  363

Query  733   ESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             E LRLHPV P L+P+E+ ED +++GF+IP+ 
Sbjct  364   EGLRLHPVGPFLVPHESMEDVVVDGFYIPRN  394


 Score =   137 bits (346),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 85/118 (72%), Gaps = 1/118 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVW-TNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            F   + SRI+INVW+I  D +VW  N E+F PERFE  +ID +G  F+LIPFGSGRR CP
Sbjct  389  FYIPRNSRILINVWSIGRDRDVWGDNVEEFYPERFENEDIDIQGLDFKLIPFGSGRRRCP  448

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            G+ +GI  VRLV+AQL+H F W+ P+ M  E++DM E+FGL V RAN++  IP YR +
Sbjct  449  GMHMGILNVRLVLAQLVHSFYWKMPHGMALEDIDMDEKFGLTVGRANNVFAIPIYRFN  506



>ref|XP_010036875.1| PREDICTED: cytochrome P450 CYP736A12-like [Eucalyptus grandis]
 gb|KCW48537.1| hypothetical protein EUGRSUZ_K02212 [Eucalyptus grandis]
Length=504

 Score =   258 bits (658),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 203/330 (62%), Gaps = 11/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM LR G    +V SSP+ AEL LKTHD VF  RP      +++YG   ++    G YW
Sbjct  66    PIMFLRLGSKPTVVISSPETAELVLKTHDDVFLGRPKGRVTHHLTYGDRGMAFTEGGEYW  125

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R+ RKLC L LLS  K+ S+   R+EEL  ++E ++ AA     VD+S++V EL+ ++SC
Sbjct  126   RSARKLCALRLLSPAKVESYAPARKEELGGMVERVRAAAAAHKVVDVSAEVGELMGNLSC  185

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             R++ G      + DE   + ++ E + L G  NL DY P L   DLQGL RR K + +  
Sbjct  186   RLILGYCSSSGE-DEFDLKKLIHEVLSLAGSFNLADYVPLLGPFDLQGLARRAKVVHQAI  244

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQ-----FNREHIKPTLSDL  908
             DK  E ++ +H+   Q  +     DF+DT+LS+ +    + Q      +R ++K  + DL
Sbjct  245   DKVLEGVIKEHQ---QDTTGKYKGDFLDTILSVTQHPMTDSQDKPDMLDRTNVKAIVLDL  301

Query  907   F-GASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               G+ E+ + +I+W  SEL+R P +MKK+Q+EL++ +G++RMVEESDL  L YL+MV+KE
Sbjct  302   ISGSYESSSTIIDWAFSELMRSPHVMKKLQQELRAIVGMNRMVEESDLPKLNYLDMVIKE  361

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             + RL+P  P LIP+E+ ED  I+G +IPK+
Sbjct  362   TFRLYPPGPLLIPHESTEDIEIDGHYIPKR  391


 Score =   139 bits (351),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWTNP-EKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQL  472
            K++R+I+N WA+  D + W +  E+F PERF  S++D +GR F+LIPFGSGRR CPG+ L
Sbjct  390  KRTRVIVNAWALGRDIDAWGDDVEEFKPERFANSSVDVKGRDFQLIPFGSGRRSCPGMNL  449

Query  471  GITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
             +   RL +AQ++HCFDWE P+ M   +LDMTE+ GL +S+A HL ++P YRL
Sbjct  450  ALINTRLFLAQMVHCFDWELPDGMSPSDLDMTEEVGLSLSKAKHLSLVPTYRL  502



>ref|XP_004237368.1| PREDICTED: cytochrome P450 CYP736A12-like [Solanum lycopersicum]
Length=502

 Score =   256 bits (653),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 202/326 (62%), Gaps = 11/326 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    ++ SSP+ AEL L+THD  FASRP  +A  Y+S G   L+   YGP W
Sbjct  69    PIMFLKLGNIPTVIISSPETAELVLRTHDAAFASRPKLKAIHYMSDGTKGLAFAAYGPQW  128

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN RK CT ELL+  KI     MR+EE+  L++ +K    +   V+L  K+ +LI +++ 
Sbjct  129   RNNRKFCTQELLTAEKIGYSAGMRKEEIGVLVDEVKGFGGE--LVNLGKKIGDLIGNMTY  186

Query  1252  RMVFG-KKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             RM+FG    E  DL+      ++KE + L G  N+ DY PFL   D+QGL +++K   K 
Sbjct  187   RMLFGDGNSERFDLEN-----IVKEMVRLAGIFNVADYVPFLEPFDIQGLNKQLKEAGKR  241

Query  1075  YDKFFERILDDHEQSGQSGS-SDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLF-G  902
               + F+ I+++HEQ  ++ +   + KD VD MLS   +  + +  +R  +K  LSD+  G
Sbjct  242   VQEVFDTIINEHEQDARNYTHKSKNKDLVDIMLSYQDNPNSSYSIDRATMKAILSDMIVG  301

Query  901   ASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLR  722
             A +     IEW+ +E+++HP +M K+Q+EL S +GLDRMVEE DL  L+YLE+V+KE+ R
Sbjct  302   AIDTSHTWIEWVFAEIIKHPTVMNKLQDELTSIVGLDRMVEEDDLLKLEYLELVLKETFR  361

Query  721   LHPVAP-LIPNEAREDCMIEGFHIPK  647
             LHPVAP L+P E+ ED +I   +IPK
Sbjct  362   LHPVAPLLVPRESIEDVVISECYIPK  387


 Score =   140 bits (353),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 84/114 (74%), Gaps = 2/114 (2%)
 Frame = -3

Query  648  KKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSN-IDYRGRHFELIPFGSGRRICPGLQ  475
            K SR++IN WA+ HDPN+W+ N E+FIPERF G    D RG  F L+PFG GRR CPG+ 
Sbjct  387  KGSRVMINCWALGHDPNIWSDNVEEFIPERFIGKKKTDLRGHDFHLLPFGYGRRSCPGIN  446

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            LG+  V+L+VAQL+HCF+W+ P+ +   +LDMTE+FGL   RA  L+VIP YRL
Sbjct  447  LGLITVKLIVAQLVHCFNWDLPDGIFPVDLDMTEKFGLAAPRAQDLLVIPTYRL  500



>ref|XP_006427642.1| hypothetical protein CICLE_v10025377mg [Citrus clementina]
 gb|ESR40882.1| hypothetical protein CICLE_v10025377mg [Citrus clementina]
Length=516

 Score =   268 bits (685),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/327 (43%), Positives = 204/327 (62%), Gaps = 10/327 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             P+MHL++GL+ ++V SS + AEL LKTHD+ FASRP   A KY +Y    +S+ PYGPYW
Sbjct  71    PLMHLKYGLSPVVVGSSAEVAELLLKTHDISFASRPALLAGKYTTYNYSAMSTAPYGPYW  130

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREEL-CYLIESLKQAALDRVAVDLSSKVSELIADIS  1256
             R  RK+C +ELLS  +++ F+ +R EE   +L E  K A+     V L  ++  L   + 
Sbjct  131   RQARKICLMELLSAKRLDQFEYIRVEERNAFLSELFKSAS---TPVHLKDRLYTLNLTLI  187

Query  1255  CRMVFGKKY----EMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKA  1088
             CRMV GK+Y    E   +  + F  +++E   L G +++GD  P+L++ DLQG  +RMK 
Sbjct  188   CRMVLGKRYTDEAEKNTVTPKDFTEMIEELFLLIGILDIGDSIPWLASFDLQGHVKRMKD  247

Query  1087  LAKTYDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDL  908
             ++K  DKF+E ILD+H +  +S       D VD ++ +      E +  REHIK  + DL
Sbjct  248   VSKKLDKFYEGILDEHHERRKSVKGYGVHDMVDVLMQLADDPSLEVKLEREHIKALIQDL  307

Query  907   FGA-SEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               A ++   I +EW MSELL++PE ++K  EEL   IG DR VEE D+ +L Y+E +VKE
Sbjct  308   LTAGTDTSAISVEWAMSELLKNPEAIQKATEELDRVIGKDRWVEEKDIVNLPYIEAIVKE  367

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHI  653
             ++RLHPVAP L+P  AR+DC + G+ I
Sbjct  368   TMRLHPVAPLLLPRVARDDCRVAGYDI  394


 Score =   127 bits (318),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 55/117 (47%), Positives = 80/117 (68%), Gaps = 2/117 (2%)
 Frame = -3

Query  666  RVFTYQ--KKSRIIINVWAITHDPNVWTNPEKFIPERFEGSNIDYRGRHFELIPFGSGRR  493
            RV  Y   + +R+++NVWAI  DP +W  P +F P RF   NID +G  F+L+PFGSGRR
Sbjct  388  RVAGYDILRNTRVVVNVWAIGRDPTMWEKPNEFRPHRFIDKNIDVKGHDFQLLPFGSGRR  447

Query  492  ICPGLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPN  322
            ICPG  LG+ +++  +A LL+ F+W+ P  M  E+LDM ++FGL +SR   L+V+P+
Sbjct  448  ICPGYALGLKVIQSTLANLLYGFEWKLPGDMKNEDLDMEDRFGLTMSRKTPLVVVPS  504



>gb|ABR18406.1| unknown [Picea sitchensis]
Length=512

 Score =   280 bits (717),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/325 (45%), Positives = 207/325 (64%), Gaps = 11/325 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANM-IVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPY  1436
             P+M LR G + + +V SS   A+ FLK +D +FA RP   AAKY+SY   N+   PYG Y
Sbjct  78    PLMSLRLGSSALTLVVSSADMAKEFLKNNDRLFAGRPQSMAAKYLSYNFSNVGYAPYGAY  137

Query  1435  WRNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADIS  1256
             WR MRK+C L+LLS+ ++ SF+ +R EE+  +I S+       + V +S  VS L   I 
Sbjct  138   WRQMRKICVLQLLSSKRLESFRFIREEEVSTMIRSIISDTEGSLPVSISKAVSTLATSII  197

Query  1255  CRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             CRM FG+KY  + L E      +KE   L G  N+GDY P+L+ LDLQGL RR K + KT
Sbjct  198   CRMAFGRKYSDQQLIES-----IKESFLLAGTFNIGDYIPYLAWLDLQGLKRRFKKIHKT  252

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGA-  899
              D FF+ ++++H         + T D VD +L+I    + EFQ  R+HIK  ++D+F A 
Sbjct  253   VDHFFDNVIEEHIARND---PNATPDLVDVLLAICADKDTEFQIKRKHIKGVIADMFAAG  309

Query  898   SEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
             ++  +I IEW MSE+LR+P ++KK+Q+EL+  +G+ RMV+ESDL  L YL+ VVKE+LRL
Sbjct  310   TDTSSIGIEWAMSEVLRNPPVLKKLQDELERVVGMGRMVQESDLPSLVYLQAVVKEALRL  369

Query  718   HPVAPL-IPNEAREDCMIEGFHIPK  647
             HP  PL IP+ + EDC + G+ IP+
Sbjct  370   HPPGPLAIPHLSVEDCTVLGYEIPR  394


 Score =   114 bits (286),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 4/114 (4%)
 Frame = -3

Query  636  IIINVWAITHDPNVWTNPEKFIPERF---EGSNIDYRGRHFELIPFGSGRRICPGLQLGI  466
            +++N+WAI  +P  W + E F PERF    GS +D + ++ E IPFG+GRR CPG QLG+
Sbjct  398  VLLNLWAIGRNPKSWEDAESFEPERFIEATGSELDAKVQNLEWIPFGAGRRGCPGQQLGM  457

Query  465  TLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQF-GLLVSRANHLIVIPNYRLHI  307
             +V   +AQLLHCF+W+ P+ +  +ELDM E+F GL + RA+ L+ +P  RL +
Sbjct  458  IVVEFGMAQLLHCFNWKLPDEINGQELDMVERFNGLTLPRAHELLAVPTPRLSL  511



>ref|XP_010537439.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=505

 Score =   266 bits (679),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 146/330 (44%), Positives = 210/330 (64%), Gaps = 11/330 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM +  G    IV SSP+AAELFLKTHD VFASRP  + A+ +  G   +   P+G  W
Sbjct  67    PIMSINLGTVPTIVVSSPRAAELFLKTHDHVFASRPKSQVAEILFNGYKGVVLTPHGTRW  126

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             RN+RKL  + LL++ KI  F+ +R EE+  +++ LK AA     V++S  V EL  ++  
Sbjct  127   RNVRKLYAVHLLNSSKIEQFKLIRTEEIGVVMDHLKSAAEKSEVVNISKIVVELFENMVY  186

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+FG+    K+  ++  +  +++   + G  N+ DYFP L+ LDLQG  RR K L K+ 
Sbjct  187   RMIFGRG---KNDGDQKLKDFVEDMSSITGAFNISDYFPLLAPLDLQGFARRTKQLRKSI  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIM-KSGEAEFQ----FNREHIKPTLSDL  908
             D  FE+I+ +HE      S D  KDFVD +LS++ +S +++ +      R  I   L DL
Sbjct  244   DIIFEKIIHEHEHQKDHKSKDH-KDFVDVLLSLLDQSIDSQDKNSEIIGRSEINAILLDL  302

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               AS E  T  I+W  SE+L+ P +MKK+Q+EL++ IG+DRMV+ESDL  L YL+MV+KE
Sbjct  303   VAASLETSTKAIDWTFSEILKDPRVMKKLQKELETNIGMDRMVQESDLPKLTYLDMVIKE  362

Query  730   SLRLHPVAPLI-PNEAREDCMIEGFHIPKK  644
              LRLHPV PL+ P+E+ ED +++GF+IPKK
Sbjct  363   GLRLHPVIPLLAPHESMEDVVLDGFYIPKK  392


 Score =   129 bits (323),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 83/118 (70%), Gaps = 1/118 (1%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVWTNP-EKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            F   KKSR++INVW++  DP++W +  E+F PERFE  +ID +G  F LIPFGSGRR C 
Sbjct  387  FYIPKKSRVLINVWSMGRDPDIWGDTTEEFYPERFENDDIDMQGLDFRLIPFGSGRRKCL  446

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            G+ + +  +R V+AQL+H FDW+ P+ M  E++DM E+ GL V RAN++   P YRL+
Sbjct  447  GMHMAMLNLRQVLAQLVHSFDWKMPDGMIPEDIDMDEKQGLAVGRANNVFARPIYRLN  504



>ref|XP_003615665.1| Cytochrome P450 [Medicago truncatula]
 ref|XP_003615670.1| Cytochrome P450 [Medicago truncatula]
 gb|AES98623.1| cytochrome P450 family 71 protein [Medicago truncatula]
 gb|AES98628.1| cytochrome P450 family 71 protein [Medicago truncatula]
Length=510

 Score =   253 bits (645),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 145/330 (44%), Positives = 205/330 (62%), Gaps = 14/330 (4%)
 Frame = -2

Query  1609  IMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYWR  1430
             IM L+ G    IV SS +AAE FLKTHD+ FASRP  +A++ I YG   L+   YGPYWR
Sbjct  69    IMSLQLGQVPTIVISSSKAAESFLKTHDINFASRPKTQASQLIFYGSKGLAFSEYGPYWR  128

Query  1429  NMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISCR  1250
             +++KLCTL+LLS  K+  F  +R++EL  L++SL++  L    V++S  V  LI DI  +
Sbjct  129   SVKKLCTLKLLSASKVEMFGPIRKKELDVLVKSLEKVVLVGEVVNVSEIVENLIEDIVYK  188

Query  1249  MVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             M+ G+ KYE  DL     + +++E M + G  NL DY  +L   DLQG TR  K   K  
Sbjct  189   MILGRGKYEQFDL-----KKLVQEGMAMLGAFNLADYVSWLGPFDLQGFTRTCKKTGKAL  243

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKS-----GEAEFQFNREHIKPTLSDL  908
             D+  E I+ +HEQS       + +DF+D +LSI+        E     +R +IK  L D+
Sbjct  244   DEVLEMIITEHEQSTNVDKV-RHEDFIDILLSIVHQTVDPENEQSGVIDRTNIKAILLDM  302

Query  907   FGAS-EAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
               A  +  T  IEW +SEL RHP +MKK+Q+E+++++G  RMVEE+DL+ L YL+MVV E
Sbjct  303   IVAGIDTATTTIEWALSELFRHPRVMKKLQDEIQNEVGNKRMVEENDLKKLNYLDMVVDE  362

Query  730   SLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             +LRL+PV P L+P E RE   I+G+ I +K
Sbjct  363   TLRLYPVGPLLLPRECRESITIDGYFIKEK  392


 Score =   142 bits (357),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 85/115 (74%), Gaps = 1/115 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVW-TNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            ++K+R+I+N WAI  D N+W  N ++F PERF    ++Y+G+ FE IPFGSGRR CPG+Q
Sbjct  390  KEKTRVIVNAWAIGRDSNIWLENADEFYPERFSDKKMNYQGQQFESIPFGSGRRRCPGIQ  449

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRLH  310
            LG+  VR VVAQL+HCF+WE P+++    L+M E+FG+ + RA HL  IP+YRL 
Sbjct  450  LGLVTVRFVVAQLVHCFNWELPHNISPSNLNMEEKFGVTIPRAQHLHAIPSYRLE  504



>ref|XP_010537437.1| PREDICTED: cytochrome P450 CYP736A12-like [Tarenaya hassleriana]
Length=509

 Score =   280 bits (715),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 151/332 (45%), Positives = 213/332 (64%), Gaps = 11/332 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM ++ G    IV SSP+AAELFLKTHDLVFASRP  +A +    G   +   PY  YW
Sbjct  69    PIMSIKLGTVRTIVVSSPRAAELFLKTHDLVFASRPKTQAGEIFFNGSKAVVLTPYSKYW  128

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKL  + LL+  KI  F+ +R EE+  ++  LK AA     V++S+ + EL+ ++  
Sbjct  129   RDVRKLYAVHLLNPSKIEQFKPIRTEEIGVVMNHLKNAAEKDEVVNVSNIMVELLENLVY  188

Query  1252  RMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKTY  1073
             RM+FG+     D D++  + +L+E     G  N+ DYFP L+ LDLQGL RRMK   K+ 
Sbjct  189   RMIFGRG--KNDADDK-LKELLEEIASTTGAFNISDYFPLLAPLDLQGLARRMKTQRKSI  245

Query  1072  DKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSG-----EAEFQFNREHIKPTLSDL  908
             D  F++I+++HEQ     S D  KDFVD +LS++        E     +R HIK  L D+
Sbjct  246   DVIFDKIIEEHEQQKHHRSKDH-KDFVDVLLSLLDQSIDPQDEKSEIISRTHIKAILLDI  304

Query  907   FG-ASEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKE  731
              G ASE     IEW  SE+L++P +MKK++EEL++ IG+D+MV+ESDL  L YL+MV+KE
Sbjct  305   VGVASETSAKAIEWTFSEILKNPRVMKKLREELETVIGMDKMVQESDLPKLTYLDMVIKE  364

Query  730   SLRLHPVAPL-IPNEAREDCMIEGFHIPKKIT  638
              LRLHPV PL +P+E+ ED  ++GF+IP+K T
Sbjct  365   GLRLHPVGPLSVPHESMEDVWVDGFYIPRKST  396


 Score =   114 bits (286),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 81/120 (68%), Gaps = 3/120 (3%)
 Frame = -3

Query  660  FTYQKKSRIIINVWAITHDPNVW-TNPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICP  484
            F   +KS ++IN+W++  D +VW  N E+F PER+E  + D +G  F+ IPFGSGRR CP
Sbjct  389  FYIPRKSTVLINMWSMGRDRDVWGDNTEEFYPERYENEDSDIQGLDFKFIPFGSGRRRCP  448

Query  483  GLQLGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQF--GLLVSRANHLIVIPNYRLH  310
            G+Q+ +  +RLV+AQ++H FDW+ P  M  E++DM E+    + V RAN++   P YRL+
Sbjct  449  GMQMAMLNLRLVLAQMVHSFDWKMPYGMVSEDIDMDEEHIAYVTVGRANNVFARPIYRLN  508



>gb|ABR18060.1| unknown [Picea sitchensis]
Length=512

 Score =   279 bits (713),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 146/324 (45%), Positives = 207/324 (64%), Gaps = 11/324 (3%)
 Frame = -2

Query  1612  PIMHLRFGLANM-IVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPY  1436
             P+M LR G + + +V SS   A+ FLK +D +FA RP   AAKY+SY   N+   PYG Y
Sbjct  78    PLMSLRLGSSALTLVVSSADMAKEFLKNNDRLFAGRPQSMAAKYLSYNFSNVGYAPYGAY  137

Query  1435  WRNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADIS  1256
             WR MRK+C L+LLS+ ++ SF+ +R EE+  +I S+   +   + V +S  VS L   I 
Sbjct  138   WRQMRKICVLQLLSSKRLESFRFIREEEVSTMIRSIISDSEGSLPVSISKAVSTLATSII  197

Query  1255  CRMVFGKKYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             CRM FG+KY  + L E      +KE   L G  N+GDY P+L+ LDLQGL RR K + KT
Sbjct  198   CRMAFGRKYSDQQLIES-----IKESFLLAGTFNIGDYIPYLAWLDLQGLKRRFKKIHKT  252

Query  1075  YDKFFERILDDHEQSGQSGSSDQTKDFVDTMLSIMKSGEAEFQFNREHIKPTLSDLFGA-  899
              D FF+ ++++H         + T D VD +L+I    + EFQ  R+HIK  ++D+F A 
Sbjct  253   VDHFFDNVIEEHIARND---PNVTPDLVDVLLAICADKDTEFQIKRKHIKGVIADMFAAG  309

Query  898   SEAITILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMVVKESLRL  719
             ++  +I IEW MSE+LR+P ++KK+Q+EL+  +G+ RMV+ESDL  L YL+ VVKE+LRL
Sbjct  310   TDTSSIGIEWAMSEVLRNPPVLKKLQDELERVVGMGRMVQESDLPSLVYLQAVVKEALRL  369

Query  718   HPVAPL-IPNEAREDCMIEGFHIP  650
             HP  PL IP+ + EDC + G+ IP
Sbjct  370   HPPGPLAIPHLSVEDCTVLGYEIP  393


 Score =   115 bits (287),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 78/114 (68%), Gaps = 4/114 (4%)
 Frame = -3

Query  636  IIINVWAITHDPNVWTNPEKFIPERF---EGSNIDYRGRHFELIPFGSGRRICPGLQLGI  466
            +++N+WAI  +P  W + E F PERF    GS +D + ++ E IPFG+GRR CPG QLG+
Sbjct  398  VLLNLWAIGRNPKSWEDAESFKPERFMEATGSELDAKVQNLEWIPFGAGRRGCPGQQLGM  457

Query  465  TLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQF-GLLVSRANHLIVIPNYRLHI  307
             +V   +AQLLHCF+W+ P+ +  +ELDM E+F GL + RA+ L+ +P  RL +
Sbjct  458  LVVEFGMAQLLHCFNWKLPDEINGQELDMVERFNGLTLPRAHELLAVPTPRLSL  511



>ref|XP_003615674.1| Cytochrome P450 [Medicago truncatula]
Length=574

 Score =   261 bits (666),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/333 (44%), Positives = 214/333 (64%), Gaps = 18/333 (5%)
 Frame = -2

Query  1612  PIMHLRFGLANMIVASSPQAAELFLKTHDLVFASRPPQEAAKYISYGQMNLSSCPYGPYW  1433
             PIM L+ G    IV SS +AAE F+KTHD+VFA+RP    A+ +SYG   L+   Y  YW
Sbjct  70    PIMSLQLGQVPAIVISSSKAAESFVKTHDIVFANRPELVGAQIMSYGCKGLAFSKYDSYW  129

Query  1432  RNMRKLCTLELLSNLKINSFQAMRREELCYLIESLKQAALDRVAVDLSSKVSELIADISC  1253
             R++RKLCT +LLS  K+  F  +R+E+L  L++SL++AAL+   V++S  V  +I DI  
Sbjct  130   RSVRKLCTSKLLSASKVEMFGPIRKEKLDVLVKSLEKAALEGEVVNVSEAVENVIEDIVY  189

Query  1252  RMVFGK-KYEMKDLDERGFRGVLKEEMDLFGKVNLGDYFPFLSTLDLQGLTRRMKALAKT  1076
             +MV G+ KY+  DL     + ++++ M L G  N+ DY P+L T DLQGLTR  K   K 
Sbjct  190   KMVLGRSKYDHIDL-----KRLVQDVMALIGAFNMADYVPWLGTFDLQGLTRACKRTNKA  244

Query  1075  YDKFFERILDDHEQSGQSGSSDQTK--DFVDTMLS-----IMKSGEAEFQFNREHIKPTL  917
              D+  E I+ +HE   Q+ ++D+T+  DFVD +L+     I    E     +R +IK  L
Sbjct  245   LDEVLEMIISEHE---QTTNTDKTRHEDFVDILLTFKHQNIDHGSEQNHVIDRTNIKAIL  301

Query  916   SDLFGASEAIT-ILIEWIMSELLRHPEIMKKVQEELKSKIGLDRMVEESDLEDLKYLEMV  740
              D+  AS + +   IEW +SELLRHP +MK +Q+E+++++G  RMVEE DL++  YL+MV
Sbjct  302   LDMVVASFSTSATTIEWALSELLRHPRVMKNLQDEIQNEVGNKRMVEEKDLKNFNYLDMV  361

Query  739   VKESLRLHPVAP-LIPNEAREDCMIEGFHIPKK  644
             V E+LRLHPV+P L+P E RE+  I+G+ + +K
Sbjct  362   VDETLRLHPVSPFLLPRECRENITIDGYFVKEK  394


 Score =   132 bits (332),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = -3

Query  651  QKKSRIIINVWAITHDPNVWT-NPEKFIPERFEGSNIDYRGRHFELIPFGSGRRICPGLQ  475
            ++K+R+I+N + I  DPNVW+ N E+F PERF    ++Y G+ FE IPFG GRR CPG+Q
Sbjct  392  KEKTRVIVNAFTIARDPNVWSENAEEFCPERFINKKLNYEGQEFESIPFGFGRRRCPGIQ  451

Query  474  LGITLVRLVVAQLLHCFDWEFPNSMPYEELDMTEQFGLLVSRANHLIVIPNYRL  313
            L +  VRL +AQL+HCF+W+ P ++    L+M E+FG  + RA HL  IP+YRL
Sbjct  452  LALRTVRLSIAQLVHCFNWKLPYNISPSNLNMDEKFGQSIHRAQHLHAIPSYRL  505



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4531252235272