BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c25435_g4_i2 len=164 path=[33343:0-41 21131:42-59 34401:60-78
30388:79-130 33735:131-163]

Length=164
                                                                      Score     E

emb|CDP05835.1|  unnamed protein product                              72.0    7e-13   
ref|XP_007013194.1|  Serine/threonine-protein kinase PBS1, putative   70.9    2e-12   
gb|EYU33571.1|  hypothetical protein MIMGU_mgv1a020014mg              70.9    2e-12   
ref|XP_007216724.1|  hypothetical protein PRUPE_ppa025712mg           70.9    2e-12   
ref|XP_002528881.1|  conserved hypothetical protein                   71.2    2e-12   Ricinus communis
ref|XP_008230110.1|  PREDICTED: receptor-like serine/threonine-pr...  70.9    2e-12   
ref|XP_008230109.1|  PREDICTED: receptor-like serine/threonine-pr...  70.9    2e-12   
ref|XP_006413572.1|  hypothetical protein EUTSA_v100246151mg          70.1    3e-12   
gb|KCW75432.1|  hypothetical protein EUGRSUZ_E04193                   70.1    3e-12   
ref|XP_006413573.1|  hypothetical protein EUTSA_v100246151mg          70.1    3e-12   
gb|KDO74353.1|  hypothetical protein CISIN_1g003272mg                 70.1    3e-12   
emb|CBI20423.3|  unnamed protein product                              69.7    4e-12   
ref|XP_006452080.1|  hypothetical protein CICLE_v10007464mg           70.1    4e-12   
gb|EYU33573.1|  hypothetical protein MIMGU_mgv1a024422mg              69.7    4e-12   
gb|KCW75396.1|  hypothetical protein EUGRSUZ_E04150                   69.3    5e-12   
gb|KDO74357.1|  hypothetical protein CISIN_1g004521mg                 69.7    5e-12   
ref|XP_010644274.1|  PREDICTED: receptor-like serine/threonine-pr...  70.1    5e-12   
emb|CBI20439.3|  unnamed protein product                              67.0    5e-12   
ref|XP_006452079.1|  hypothetical protein CICLE_v10007464mg           69.3    5e-12   
gb|ABK96679.1|  unknown                                               69.3    5e-12   Populus trichocarpa x Populus deltoides
ref|XP_006475274.1|  PREDICTED: uncharacterized protein LOC102626881  69.7    6e-12   
ref|XP_010059664.1|  PREDICTED: cysteine-rich receptor-like prote...  69.7    6e-12   
ref|XP_007216717.1|  hypothetical protein PRUPE_ppa026314mg           66.2    7e-12   
gb|KDO74347.1|  hypothetical protein CISIN_1g003391mg                 68.9    7e-12   
ref|XP_010928144.1|  PREDICTED: receptor-like serine/threonine-pr...  69.3    7e-12   
ref|XP_006282816.1|  hypothetical protein CARUB_v10006547mg           68.9    8e-12   
gb|KCW44888.1|  hypothetical protein EUGRSUZ_L01528                   68.9    8e-12   
gb|KCW44889.1|  hypothetical protein EUGRSUZ_L01528                   68.9    8e-12   
gb|EYU32317.1|  hypothetical protein MIMGU_mgv1a006448mg              68.2    8e-12   
ref|XP_006370398.1|  hypothetical protein POPTR_0001s42250g           68.9    9e-12   
gb|KCW44887.1|  hypothetical protein EUGRSUZ_L01528                   68.9    9e-12   
gb|EEC71606.1|  hypothetical protein OsI_04006                        66.2    9e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_010040817.1|  PREDICTED: receptor-like serine/threonine-pr...  68.9    9e-12   
ref|XP_008230175.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  69.3    9e-12   
ref|XP_010059143.1|  PREDICTED: putative cysteine-rich receptor-l...  68.6    9e-12   
ref|XP_010267891.1|  PREDICTED: cysteine-rich receptor-like prote...  68.6    1e-11   
ref|XP_010057745.1|  PREDICTED: cysteine-rich receptor-like prote...  68.6    1e-11   
ref|XP_009611412.1|  PREDICTED: G-type lectin S-receptor-like ser...  68.9    1e-11   
ref|XP_011002465.1|  PREDICTED: G-type lectin S-receptor-like ser...  68.9    1e-11   
ref|XP_006426989.1|  hypothetical protein CICLE_v10024887mg           68.9    1e-11   
gb|KCW75000.1|  hypothetical protein EUGRSUZ_E03762                   68.6    1e-11   
ref|XP_010529588.1|  PREDICTED: cysteine-rich receptor-like prote...  68.2    1e-11   
gb|KCW75001.1|  hypothetical protein EUGRSUZ_E03762                   68.2    1e-11   
gb|KDO74350.1|  hypothetical protein CISIN_1g005933mg                 68.6    1e-11   
gb|KDO74352.1|  hypothetical protein CISIN_1g038934mg                 68.6    1e-11   
ref|XP_006452078.1|  hypothetical protein CICLE_v10010587mg           68.6    1e-11   
ref|XP_009611413.1|  PREDICTED: G-type lectin S-receptor-like ser...  68.6    1e-11   
gb|KDO74346.1|  hypothetical protein CISIN_1g003391mg                 68.6    1e-11   
ref|XP_006452075.1|  hypothetical protein CICLE_v10007466mg           68.6    1e-11   
emb|CAN61487.1|  hypothetical protein VITISV_038128                   68.9    1e-11   Vitis vinifera
gb|KDO74351.1|  hypothetical protein CISIN_1g005933mg                 68.2    1e-11   
gb|KHN13685.1|  G-type lectin S-receptor-like serine/threonine-pr...  68.6    1e-11   
ref|XP_006465592.1|  PREDICTED: G-type lectin S-receptor-like ser...  68.6    1e-11   
ref|XP_007213167.1|  hypothetical protein PRUPE_ppa026828mg           68.2    1e-11   
gb|KDP26021.1|  hypothetical protein JCGZ_21054                       66.6    1e-11   
ref|XP_010644290.1|  PREDICTED: G-type lectin S-receptor-like ser...  68.2    1e-11   
gb|KCW74348.1|  hypothetical protein EUGRSUZ_E030241                  64.7    1e-11   
gb|KDO74363.1|  hypothetical protein CISIN_1g0467031mg                65.5    2e-11   
ref|XP_006475273.1|  PREDICTED: uncharacterized protein LOC102626595  68.6    2e-11   
emb|CDO99678.1|  unnamed protein product                              68.2    2e-11   
ref|XP_006475249.1|  PREDICTED: G-type lectin S-receptor-like ser...  68.2    2e-11   
emb|CAN72253.1|  hypothetical protein VITISV_034184                   67.8    2e-11   Vitis vinifera
ref|XP_002316947.1|  hypothetical protein POPTR_0011s12950g           68.2    2e-11   Populus trichocarpa [western balsam poplar]
emb|CAN70180.1|  hypothetical protein VITISV_000005                   65.5    2e-11   Vitis vinifera
ref|XP_004244166.2|  PREDICTED: uncharacterized protein LOC101262029  68.6    2e-11   
gb|KDO56869.1|  hypothetical protein CISIN_1g041345mg                 66.6    2e-11   
gb|KCW63307.1|  hypothetical protein EUGRSUZ_G00934                   67.8    2e-11   
ref|XP_006591161.1|  PREDICTED: G-type lectin S-receptor-like ser...  68.2    2e-11   
emb|CBI29180.3|  unnamed protein product                              67.4    2e-11   
emb|CBI14789.3|  unnamed protein product                              65.1    2e-11   
gb|KHN15821.1|  Cysteine-rich receptor-like protein kinase 25         67.8    2e-11   
ref|XP_006452085.1|  hypothetical protein CICLE_v10010368mg           67.8    2e-11   
ref|XP_010648190.1|  PREDICTED: cysteine-rich receptor-like prote...  67.8    2e-11   
ref|XP_010648189.1|  PREDICTED: cysteine-rich receptor-like prote...  67.8    2e-11   
ref|XP_011048516.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.8    2e-11   
ref|XP_006449083.1|  hypothetical protein CICLE_v10016609mg           65.1    2e-11   
ref|XP_006857314.1|  hypothetical protein AMTR_s00067p00069710        67.0    2e-11   
ref|XP_003556014.1|  PREDICTED: cysteine-rich receptor-like prote...  67.8    2e-11   
ref|XP_011048518.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.8    2e-11   
gb|KCW63316.1|  hypothetical protein EUGRSUZ_G00944                   66.2    2e-11   
gb|KCW63314.1|  hypothetical protein EUGRSUZ_G00941                   67.4    2e-11   
ref|XP_003556018.2|  PREDICTED: cysteine-rich receptor-like prote...  67.8    2e-11   
ref|XP_006356902.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-11   
gb|KDO74340.1|  hypothetical protein CISIN_1g003254mg                 67.8    2e-11   
ref|XP_010644341.1|  PREDICTED: cysteine-rich receptor-like prote...  67.4    2e-11   
gb|KCW63313.1|  hypothetical protein EUGRSUZ_G00941                   67.4    3e-11   
gb|KDO74342.1|  hypothetical protein CISIN_1g003254mg                 67.4    3e-11   
ref|XP_006370396.1|  hypothetical protein POPTR_0001s42220g           67.8    3e-11   
ref|XP_011030932.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.8    3e-11   
ref|XP_006356901.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    3e-11   
ref|XP_011030931.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.8    3e-11   
ref|XP_011030930.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.8    3e-11   
ref|XP_010065695.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.4    3e-11   
gb|KHN15822.1|  Cysteine-rich receptor-like protein kinase 25         67.8    3e-11   
ref|XP_011030955.1|  PREDICTED: uncharacterized protein LOC105130249  67.8    3e-11   
ref|XP_009778629.1|  PREDICTED: uncharacterized protein LOC104227947  67.8    3e-11   
ref|XP_011030933.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.4    3e-11   
ref|XP_010439199.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    3e-11   
ref|XP_010065693.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.4    3e-11   
ref|XP_010057269.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    3e-11   
ref|XP_007214500.1|  hypothetical protein PRUPE_ppa018064mg           67.4    3e-11   
gb|KCW63310.1|  hypothetical protein EUGRSUZ_G00936                   67.4    3e-11   
gb|KCW63311.1|  hypothetical protein EUGRSUZ_G00936                   67.4    3e-11   
ref|XP_002317544.2|  hypothetical protein POPTR_0011s13180g           67.4    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010067925.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.4    3e-11   
ref|XP_009605851.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    3e-11   
ref|XP_010327263.1|  PREDICTED: uncharacterized protein LOC101244232  67.8    3e-11   
gb|KDO74341.1|  hypothetical protein CISIN_1g003254mg                 67.4    3e-11   
ref|XP_010644348.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    3e-11   
ref|XP_010448733.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    3e-11   
ref|XP_006370395.1|  hypothetical protein POPTR_0001s42210g           67.4    3e-11   
ref|XP_011038914.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    3e-11   
ref|XP_007021188.1|  Serine/threonine kinases,protein kinases,ATP...  67.4    3e-11   
ref|XP_006475277.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.4    3e-11   
ref|XP_006283296.1|  hypothetical protein CARUB_v10004334mg           67.0    3e-11   
emb|CDX94171.1|  BnaC07g38050D                                        66.6    3e-11   
emb|CBI20448.3|  unnamed protein product                              65.9    3e-11   
ref|XP_006452099.1|  hypothetical protein CICLE_v10009316mg           64.7    4e-11   
gb|KCW69726.1|  hypothetical protein EUGRSUZ_F031112                  62.8    4e-11   
ref|XP_002516064.1|  Serine/threonine-protein kinase PBS1, putative   67.0    4e-11   Ricinus communis
ref|XP_006370400.1|  hypothetical protein POPTR_0001s42260g           67.0    4e-11   
ref|XP_002319396.1|  S-locus lectin protein kinase                    67.0    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_006370399.1|  hypothetical protein POPTR_0001s42260g           67.0    4e-11   
ref|XP_010448742.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    4e-11   
gb|EYU32850.1|  hypothetical protein MIMGU_mgv1a001388mg              67.0    4e-11   
gb|EYU32849.1|  hypothetical protein MIMGU_mgv1a001388mg              67.0    4e-11   
ref|XP_004153962.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    4e-11   
ref|XP_010433928.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    4e-11   
ref|XP_008384459.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    4e-11   
ref|XP_010448743.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    4e-11   
ref|XP_009357384.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    4e-11   
ref|XP_008345332.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    4e-11   
ref|XP_009340920.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    4e-11   
ref|XP_007024153.1|  Serine/threonine-protein kinase PBS1, putative   67.0    4e-11   
ref|XP_009417412.1|  PREDICTED: receptor-like serine/threonine-pr...  67.4    4e-11   
ref|XP_007214501.1|  hypothetical protein PRUPE_ppa018069mg           67.0    4e-11   
gb|KDO75662.1|  hypothetical protein CISIN_1g0030452mg                65.1    4e-11   
ref|XP_002317550.1|  hypothetical protein POPTR_0011s13250g           67.0    4e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010065691.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    4e-11   
ref|XP_011002460.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.0    4e-11   
ref|XP_010247617.1|  PREDICTED: cysteine-rich receptor-like prote...  67.0    4e-11   
ref|XP_006356864.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.0    5e-11   
ref|XP_006362969.1|  PREDICTED: G-type lectin S-receptor-like ser...  67.0    5e-11   
emb|CDY65509.1|  BnaA03g58780D                                        67.0    5e-11   
ref|XP_006452103.1|  hypothetical protein CICLE_v10010341mg           67.0    5e-11   
ref|XP_010040818.1|  PREDICTED: uncharacterized protein LOC104429679  67.0    5e-11   
gb|EYU19178.1|  hypothetical protein MIMGU_mgv1a020642mg              67.0    5e-11   
gb|KCW63320.1|  hypothetical protein EUGRSUZ_G00951                   66.6    5e-11   
ref|XP_008379572.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...  67.0    5e-11   
ref|NP_001044457.1|  Os01g0783800                                     67.0    5e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KDO74372.1|  hypothetical protein CISIN_1g0052361mg                66.6    5e-11   
ref|XP_010320283.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    5e-11   
ref|XP_003632790.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    5e-11   
ref|XP_002518553.1|  ATP binding protein, putative                    66.6    5e-11   Ricinus communis
ref|XP_006452105.1|  hypothetical protein CICLE_v10007572mg           66.6    5e-11   
ref|XP_006413094.1|  hypothetical protein EUTSA_v10027068mg           66.6    5e-11   
ref|XP_002317540.2|  hypothetical protein POPTR_0011s13130g           66.6    5e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010320284.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    5e-11   
gb|EEE55503.1|  hypothetical protein OsJ_03699                        67.0    5e-11   Oryza sativa Japonica Group [Japonica rice]
gb|KDP38982.1|  hypothetical protein JCGZ_00739                       66.6    5e-11   
ref|XP_009357102.1|  PREDICTED: receptor-like serine/threonine-pr...  66.6    5e-11   
ref|XP_010267800.1|  PREDICTED: putative receptor-like protein ki...  66.6    5e-11   
ref|XP_008358736.1|  PREDICTED: cysteine-rich receptor-like prote...  66.6    5e-11   
ref|XP_011002474.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    5e-11   
gb|KDO37968.1|  hypothetical protein CISIN_1g041793mg                 63.9    5e-11   
ref|XP_010247751.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    5e-11   
gb|KCW67068.1|  hypothetical protein EUGRSUZ_F008421                  64.7    6e-11   
ref|XP_010059683.1|  PREDICTED: putative cysteine-rich receptor-l...  66.6    6e-11   
ref|XP_011015607.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    6e-11   
ref|XP_004238057.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    6e-11   
ref|XP_010686952.1|  PREDICTED: putative receptor-like protein ki...  66.6    6e-11   
ref|XP_010647533.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    6e-11   
ref|XP_006370397.1|  hypothetical protein POPTR_0001s42230g           66.6    6e-11   
ref|XP_006356865.1|  PREDICTED: uncharacterized protein LOC102592491  67.0    6e-11   
ref|XP_007022738.1|  S-locus lectin protein kinase family protein     65.9    6e-11   
gb|KFK22701.1|  hypothetical protein AALP_AAs67984U000300             65.9    6e-11   
ref|XP_004231576.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    6e-11   
ref|XP_010448731.1|  PREDICTED: cysteine-rich receptor-like prote...  66.2    6e-11   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...  67.0    6e-11   
ref|XP_010026110.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    7e-11   
emb|CBI20430.3|  unnamed protein product                              66.6    7e-11   
gb|KDO74365.1|  hypothetical protein CISIN_1g043285mg                 65.5    7e-11   
ref|XP_006452072.1|  hypothetical protein CICLE_v10007451mg           66.6    7e-11   
ref|XP_006475244.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.6    7e-11   
ref|XP_006452097.1|  hypothetical protein CICLE_v10010721mg           64.3    7e-11   
emb|CBI20459.3|  unnamed protein product                              66.2    7e-11   
ref|XP_010049703.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    7e-11   
dbj|BAD53293.1|  putative serine/threonine kinase                     66.2    7e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006413566.1|  hypothetical protein EUTSA_v10024631mg           66.2    7e-11   
gb|KDO74358.1|  hypothetical protein CISIN_1g004521mg                 66.2    7e-11   
ref|XP_010049702.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    7e-11   
ref|XP_011030927.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    7e-11   
ref|XP_010439198.1|  PREDICTED: cysteine-rich receptor-like prote...  66.2    7e-11   
ref|XP_002317548.1|  hypothetical protein POPTR_0011s13230g           66.2    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_007214023.1|  hypothetical protein PRUPE_ppa016527mg           66.2    7e-11   
ref|XP_011002477.1|  PREDICTED: uncharacterized protein LOC105109453  66.6    7e-11   
emb|CBI18331.3|  unnamed protein product                              66.2    7e-11   
ref|XP_006449174.1|  hypothetical protein CICLE_v10014386mg           66.2    7e-11   
ref|XP_011015604.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    7e-11   
ref|XP_007213637.1|  hypothetical protein PRUPE_ppa001795mg           66.2    7e-11   
ref|XP_009109107.1|  PREDICTED: cysteine-rich receptor-like prote...  66.2    7e-11   
ref|XP_009109092.1|  PREDICTED: cysteine-rich receptor-like prote...  66.2    7e-11   
emb|CDY39507.1|  BnaA01g24810D                                        66.2    7e-11   
ref|XP_010041722.1|  PREDICTED: cysteine-rich receptor-like prote...  66.6    7e-11   
gb|KCW81429.1|  hypothetical protein EUGRSUZ_C02809                   64.3    7e-11   
ref|XP_007214794.1|  hypothetical protein PRUPE_ppa014934mg           66.2    7e-11   
emb|CDX92824.1|  BnaC07g40820D                                        66.2    8e-11   
gb|KCW82456.1|  hypothetical protein EUGRSUZ_C03848                   66.2    8e-11   
ref|XP_009109099.1|  PREDICTED: cysteine-rich receptor-like prote...  66.2    8e-11   
ref|XP_002317549.1|  hypothetical protein POPTR_0011s13240g           66.2    8e-11   Populus trichocarpa [western balsam poplar]
ref|XP_008226746.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    8e-11   
ref|XP_006475280.1|  PREDICTED: uncharacterized protein LOC102629172  66.6    8e-11   
ref|XP_011015606.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    8e-11   
gb|KCW74848.1|  hypothetical protein EUGRSUZ_E03585                   66.2    8e-11   
ref|XP_011015605.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    8e-11   
gb|KCW74373.1|  hypothetical protein EUGRSUZ_E03054                   66.2    8e-11   
ref|XP_006452106.1|  hypothetical protein CICLE_v10007528mg           66.2    8e-11   
ref|XP_010254130.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    8e-11   
ref|XP_010267801.1|  PREDICTED: cysteine-rich receptor-like prote...  65.9    8e-11   
ref|XP_008779560.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    8e-11   
ref|XP_002268342.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    8e-11   Vitis vinifera
ref|XP_006287218.1|  hypothetical protein CARUB_v10000395mg           66.2    8e-11   
ref|XP_010064357.1|  PREDICTED: receptor-like serine/threonine-pr...  66.2    8e-11   
ref|XP_008226741.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    8e-11   
ref|XP_010254131.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    8e-11   
ref|XP_010448732.1|  PREDICTED: cysteine-rich receptor-like prote...  65.9    8e-11   
gb|KCW44132.1|  hypothetical protein EUGRSUZ_L02458                   65.9    8e-11   
ref|XP_002867726.1|  kinase family protein                            65.9    9e-11   
gb|KCW74377.1|  hypothetical protein EUGRSUZ_E03056                   65.9    9e-11   
gb|KCW74376.1|  hypothetical protein EUGRSUZ_E030551                  64.3    9e-11   
ref|XP_008348276.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  63.9    9e-11   
ref|XP_010268932.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    9e-11   
emb|CBI39954.3|  unnamed protein product                              63.5    9e-11   
ref|XP_006356900.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    9e-11   
ref|XP_010057675.1|  PREDICTED: putative receptor-like protein ki...  65.9    9e-11   
ref|XP_010652595.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    9e-11   
ref|XP_006356899.1|  PREDICTED: G-type lectin S-receptor-like ser...  66.2    9e-11   
ref|XP_009357378.1|  PREDICTED: cysteine-rich receptor-like prote...  63.2    9e-11   
emb|CAN64778.1|  hypothetical protein VITISV_043229                   66.2    9e-11   Vitis vinifera
ref|XP_010249750.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    9e-11   
ref|XP_008226745.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_008226744.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
gb|KDO56867.1|  hypothetical protein CISIN_1g039516mg                 64.7    1e-10   
ref|XP_010229650.1|  PREDICTED: uncharacterized protein LOC100827116  66.2    1e-10   
ref|XP_006452089.1|  hypothetical protein CICLE_v10008568mg           65.1    1e-10   
ref|XP_010249751.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_002460811.1|  hypothetical protein SORBIDRAFT_02g035360        65.9    1e-10   Sorghum bicolor [broomcorn]
ref|XP_008226747.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_010442801.1|  PREDICTED: putative cysteine-rich receptor-l...  65.9    1e-10   
ref|XP_010057674.1|  PREDICTED: putative receptor-like protein ki...  65.9    1e-10   
ref|XP_010456965.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_008390296.1|  PREDICTED: cysteine-rich receptor-like prote...  63.2    1e-10   
ref|XP_010422486.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_008653175.1|  PREDICTED: cysteine-rich receptor-like prote...  65.9    1e-10   
ref|XP_010422485.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_010646733.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    1e-10   
ref|XP_006467933.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_010522657.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
gb|KDO37835.1|  hypothetical protein CISIN_1g043872mg                 63.2    1e-10   
gb|KDP38980.1|  hypothetical protein JCGZ_00737                       65.9    1e-10   
emb|CAN61711.1|  hypothetical protein VITISV_034502                   65.9    1e-10   Vitis vinifera
ref|XP_002528889.1|  ATP binding protein, putative                    66.2    1e-10   Ricinus communis
ref|XP_010249749.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  65.9    1e-10   
gb|KCW74338.1|  hypothetical protein EUGRSUZ_E03010                   65.1    1e-10   
ref|XP_010522656.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
gb|KHN01561.1|  Cysteine-rich receptor-like protein kinase 29         65.9    1e-10   
ref|XP_007216127.1|  hypothetical protein PRUPE_ppa018966mg           65.9    1e-10   
ref|XP_006467932.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
emb|CBI20441.3|  unnamed protein product                              63.2    1e-10   
gb|KCW75406.1|  hypothetical protein EUGRSUZ_E04159                   65.5    1e-10   
ref|XP_006475248.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_006467934.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
emb|CBI20437.3|  unnamed protein product                              63.2    1e-10   
ref|XP_010522655.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_003562980.1|  PREDICTED: cysteine-rich receptor-like prote...  65.9    1e-10   
ref|XP_010422487.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_010522653.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|NP_192232.5|  G-type lectin S-receptor-like serine/threonine-...  65.9    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010522650.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_010059160.1|  PREDICTED: cysteine-rich receptor-like prote...  65.9    1e-10   
ref|XP_010522654.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
sp|Q9ZR08.3|Y4230_ARATH  RecName: Full=G-type lectin S-receptor-l...  65.9    1e-10   
ref|XP_007216455.1|  hypothetical protein PRUPE_ppa023202mg           65.5    1e-10   
gb|KCW75415.1|  hypothetical protein EUGRSUZ_E04174                   64.3    1e-10   
gb|KDP38985.1|  hypothetical protein JCGZ_00742                       65.5    1e-10   
ref|XP_008366485.1|  PREDICTED: receptor-like serine/threonine-pr...  65.9    1e-10   
ref|XP_006283266.1|  hypothetical protein CARUB_v10004297mg           65.5    1e-10   
emb|CDY29294.1|  BnaC01g19460D                                        65.9    1e-10   
gb|KCW73353.1|  hypothetical protein EUGRSUZ_E01822                   63.5    1e-10   
gb|EYU32848.1|  hypothetical protein MIMGU_mgv1a022873mg              65.5    1e-10   
ref|XP_010928165.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.9    1e-10   
ref|XP_010265668.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
ref|XP_003555314.1|  PREDICTED: cysteine-rich receptor-like prote...  65.5    1e-10   
ref|XP_010060465.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
ref|XP_009137320.1|  PREDICTED: cysteine-rich receptor-like prote...  65.5    1e-10   
ref|XP_009137319.1|  PREDICTED: cysteine-rich receptor-like prote...  65.5    1e-10   
ref|XP_002872790.1|  S-locus lectin protein kinase family protein     65.5    1e-10   
gb|KDP38975.1|  hypothetical protein JCGZ_00732                       65.5    1e-10   
ref|XP_010418086.1|  PREDICTED: cysteine-rich receptor-like prote...  65.5    1e-10   
ref|XP_006452189.1|  hypothetical protein CICLE_v10007468mg           65.5    1e-10   
ref|XP_010418085.1|  PREDICTED: cysteine-rich receptor-like prote...  65.5    1e-10   
gb|KDO38189.1|  hypothetical protein CISIN_1g027162mg                 62.8    1e-10   
gb|KDO52964.1|  hypothetical protein CISIN_1g041702mg                 65.5    1e-10   
ref|XP_010056929.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    1e-10   
ref|XP_010652589.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
ref|XP_010064917.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
ref|XP_010530411.1|  PREDICTED: putative cysteine-rich receptor-l...  65.5    1e-10   
gb|EEE67322.1|  hypothetical protein OsJ_24569                        65.5    1e-10   
ref|XP_010448728.1|  PREDICTED: cysteine-rich receptor-like prote...  65.5    1e-10   
ref|XP_006465595.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
ref|XP_006426981.1|  hypothetical protein CICLE_v10024927mg           65.5    1e-10   
ref|XP_010052297.1|  PREDICTED: cysteine-rich receptor-like prote...  65.5    1e-10   
ref|XP_008242619.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
gb|KCW73331.1|  hypothetical protein EUGRSUZ_E01789                   65.5    1e-10   
ref|XP_010268929.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
ref|XP_007043396.1|  S-locus lectin protein kinase family protein...  65.5    1e-10   
gb|EMT20487.1|  Cysteine-rich receptor-like protein kinase 10         64.3    1e-10   
gb|KCW76230.1|  hypothetical protein EUGRSUZ_D00611                   65.5    1e-10   
ref|XP_009340926.1|  PREDICTED: cysteine-rich receptor-like prote...  65.5    1e-10   
gb|KCW67236.1|  hypothetical protein EUGRSUZ_F01024                   65.5    1e-10   
ref|XP_010686953.1|  PREDICTED: cysteine-rich receptor-like prote...  65.5    1e-10   
ref|NP_001059870.1|  Os07g0535800                                     65.1    1e-10   
ref|XP_010064867.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
emb|CAN61538.1|  hypothetical protein VITISV_030742                   65.5    1e-10   
gb|KDO74360.1|  hypothetical protein CISIN_1g004521mg                 65.1    1e-10   
ref|XP_009143289.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
ref|XP_008340068.1|  PREDICTED: cysteine-rich receptor-like prote...  65.5    1e-10   
ref|XP_007215263.1|  hypothetical protein PRUPE_ppa004552mg           65.1    1e-10   
ref|XP_006360116.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    1e-10   
ref|XP_007021222.1|  Serine/threonine kinases,protein kinases,ATP...  65.9    1e-10   
gb|KDO43803.1|  hypothetical protein CISIN_1g040677mg                 60.8    2e-10   
ref|XP_006475206.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    2e-10   
ref|XP_008349286.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_010644397.1|  PREDICTED: uncharacterized protein LOC100262430  65.9    2e-10   
ref|XP_007021223.1|  Serine/threonine kinases,protein kinases,ATP...  65.9    2e-10   
gb|KCW58376.1|  hypothetical protein EUGRSUZ_H01060                   65.5    2e-10   
ref|XP_006378088.1|  hypothetical protein POPTR_0010s01990g           64.3    2e-10   
ref|XP_011014317.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    2e-10   
ref|XP_006283274.1|  hypothetical protein CARUB_v10004309mg           65.1    2e-10   
ref|NP_001238492.1|  cysteine-rich protein precursor                  65.1    2e-10   
gb|KHN30448.1|  Cysteine-rich receptor-like protein kinase 10         65.1    2e-10   
emb|CDX98619.1|  BnaA03g44040D                                        65.1    2e-10   
emb|CDX89261.1|  BnaA01g16320D                                        65.5    2e-10   
ref|XP_008228523.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    2e-10   
ref|XP_006396894.1|  hypothetical protein EUTSA_v10028517mg           65.1    2e-10   
ref|XP_009361847.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    2e-10   
ref|XP_006468233.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_011002473.1|  PREDICTED: uncharacterized protein LOC105109448  65.5    2e-10   
ref|XP_008364415.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    2e-10   
ref|XP_010056934.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_010065696.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    2e-10   
ref|XP_008364412.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    2e-10   
ref|XP_008368675.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    2e-10   
ref|XP_008347111.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.5    2e-10   
emb|CDY70908.1|  BnaAnng35520D                                        63.9    2e-10   
ref|XP_010433939.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
gb|KDO74359.1|  hypothetical protein CISIN_1g004521mg                 65.1    2e-10   
gb|KCW74362.1|  hypothetical protein EUGRSUZ_E03041                   65.1    2e-10   
ref|XP_007204265.1|  hypothetical protein PRUPE_ppa002027mg           65.1    2e-10   
ref|XP_010058609.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_007214384.1|  hypothetical protein PRUPE_ppb001660mg           65.1    2e-10   
dbj|BAK01780.1|  predicted protein                                    62.8    2e-10   
ref|XP_009136919.1|  PREDICTED: putative cysteine-rich receptor-l...  65.1    2e-10   
gb|EEC82187.1|  hypothetical protein OsI_26323                        65.1    2e-10   
gb|KDO36347.1|  hypothetical protein CISIN_1g028458mg                 62.4    2e-10   
ref|XP_007021189.1|  Serine/threonine kinases,protein kinases,ATP...  65.5    2e-10   
ref|XP_010106354.1|  G-type lectin S-receptor-like serine/threoni...  65.1    2e-10   
ref|XP_007021206.1|  S-locus lectin protein kinase family protein...  65.5    2e-10   
ref|XP_009357560.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
gb|KCW73854.1|  hypothetical protein EUGRSUZ_E02450                   65.1    2e-10   
ref|XP_010644396.1|  PREDICTED: uncharacterized protein LOC100260657  65.5    2e-10   
ref|XP_010433933.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    2e-10   
gb|KDO56866.1|  hypothetical protein CISIN_1g046791mg                 65.5    2e-10   
ref|XP_004295364.1|  PREDICTED: uncharacterized protein LOC101303888  65.5    2e-10   
ref|XP_006465272.1|  PREDICTED: receptor-like serine/threonine-pr...  63.2    2e-10   
gb|KCW73835.1|  hypothetical protein EUGRSUZ_E02436                   60.8    2e-10   
ref|XP_007212862.1|  hypothetical protein PRUPE_ppa021546mg           65.1    2e-10   
ref|XP_006388749.1|  hypothetical protein POPTR_0107s002301g          63.5    2e-10   
emb|CDY10923.1|  BnaA03g45820D                                        65.1    2e-10   
ref|XP_006287210.1|  hypothetical protein CARUB_v10000385mg           65.1    2e-10   
ref|XP_007025879.1|  S-locus lectin protein kinase family protein...  65.1    2e-10   
ref|XP_002522715.1|  serine-threonine protein kinase, plant-type,...  65.5    2e-10   
ref|XP_004145170.1|  PREDICTED: polygalacturonase-like                65.5    2e-10   
ref|XP_008793685.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_009137323.1|  PREDICTED: LOW QUALITY PROTEIN: putative cys...  63.9    2e-10   
ref|NP_001238568.1|  protein kinase                                   63.2    2e-10   
ref|XP_006378093.1|  hypothetical protein POPTR_0010s020302g          64.7    2e-10   
ref|XP_010439190.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_002304956.2|  hypothetical protein POPTR_0004s02490g           63.9    2e-10   
gb|KCW76231.1|  hypothetical protein EUGRSUZ_D00611                   64.7    2e-10   
ref|XP_010433938.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_010439222.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_010439220.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_011097955.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_010057979.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
emb|CDY10924.1|  BnaA03g45830D                                        64.7    2e-10   
ref|XP_010448755.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_010056938.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_010433940.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_006377802.1|  hypothetical protein POPTR_0011s13020g           62.4    2e-10   
ref|XP_010433937.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
ref|XP_007021202.1|  S-locus lectin protein kinase family protein...  65.1    2e-10   
gb|KCW73846.1|  hypothetical protein EUGRSUZ_E02444                   64.3    2e-10   
ref|XP_009108670.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  65.1    2e-10   
ref|XP_006427551.1|  hypothetical protein CICLE_v10026244mg           63.2    2e-10   
ref|XP_010644394.1|  PREDICTED: uncharacterized protein LOC100262308  65.5    2e-10   
ref|XP_010059514.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    2e-10   
gb|KCW73357.1|  hypothetical protein EUGRSUZ_E01828                   64.7    2e-10   
gb|KCW73852.1|  hypothetical protein EUGRSUZ_E02450                   65.1    2e-10   
ref|XP_009137321.1|  PREDICTED: cysteine-rich receptor-like prote...  65.1    2e-10   
emb|CBI20404.3|  unnamed protein product                              64.7    2e-10   
ref|XP_010059136.1|  PREDICTED: putative cysteine-rich receptor-l...  65.1    2e-10   
ref|XP_007025880.1|  S-locus lectin protein kinase family protein...  65.1    2e-10   
emb|CAN73738.1|  hypothetical protein VITISV_036172                   65.1    2e-10   
ref|XP_007021380.1|  S-locus lectin protein kinase family protein     65.1    2e-10   
gb|KCW74917.1|  hypothetical protein EUGRSUZ_E03663                   64.7    2e-10   
ref|XP_009355541.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_006389134.1|  hypothetical protein POPTR_0044s002802g          63.2    2e-10   
ref|XP_009350320.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_009350313.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_008341948.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
gb|KDO40578.1|  hypothetical protein CISIN_1g0058031mg                62.4    2e-10   
ref|XP_010058588.1|  PREDICTED: cysteine-rich receptor-like prote...  63.9    2e-10   
ref|XP_009355540.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_009355538.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
emb|CDX94176.1|  BnaC07g38100D                                        64.7    2e-10   
ref|XP_008226159.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_008365528.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_009143278.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_004308259.1|  PREDICTED: G-type lectin S-receptor-like ser...  65.1    2e-10   
ref|XP_007021379.1|  S-locus lectin protein kinase family protein     65.1    2e-10   
ref|XP_009397155.1|  PREDICTED: receptor-like serine/threonine-pr...  65.1    2e-10   
ref|XP_010540897.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    2e-10   
ref|XP_009787422.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    2e-10   
ref|XP_009137650.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    2e-10   
ref|XP_006433098.1|  hypothetical protein CICLE_v10000574mg           64.7    2e-10   
ref|XP_011095777.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    2e-10   
gb|KCW73844.1|  hypothetical protein EUGRSUZ_E02444                   64.7    2e-10   
gb|KCW74331.1|  hypothetical protein EUGRSUZ_E02999                   64.7    2e-10   
ref|XP_009780423.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    2e-10   
ref|XP_009587208.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    2e-10   
ref|XP_011016742.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.9    2e-10   
gb|KCW73359.1|  hypothetical protein EUGRSUZ_E01830                   64.7    2e-10   
ref|XP_008226792.1|  PREDICTED: uncharacterized protein LOC103326355  65.1    2e-10   
ref|XP_009338745.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    2e-10   
ref|XP_009338737.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    2e-10   
ref|XP_006283285.1|  hypothetical protein CARUB_v10004321mg           64.7    2e-10   
ref|XP_009587207.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    2e-10   
ref|XP_008341951.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    2e-10   
ref|XP_009338731.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    2e-10   
ref|XP_009136911.1|  PREDICTED: putative cysteine-rich receptor-l...  64.7    2e-10   
ref|XP_006471786.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    2e-10   
ref|XP_008341950.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    2e-10   
ref|XP_008341949.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    2e-10   
ref|XP_007217044.1|  hypothetical protein PRUPE_ppa001472mg           64.7    2e-10   
ref|XP_010529578.1|  PREDICTED: putative cysteine-rich receptor-l...  64.7    2e-10   
emb|CDY10848.1|  BnaC01g14630D                                        64.7    2e-10   
ref|XP_009607317.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    2e-10   
gb|KFK30804.1|  hypothetical protein AALP_AA6G028100                  64.7    3e-10   
ref|XP_010320276.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_008232167.1|  PREDICTED: LOW QUALITY PROTEIN: G-type lecti...  64.7    3e-10   
ref|XP_004295367.1|  PREDICTED: uncharacterized protein LOC101305644  65.1    3e-10   
ref|XP_007157184.1|  hypothetical protein PHAVU_002G049500g           64.7    3e-10   
ref|XP_008349189.1|  PREDICTED: cysteine-rich receptor-like prote...  63.2    3e-10   
ref|XP_010320275.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_008653174.1|  PREDICTED: putative cysteine-rich receptor-l...  64.7    3e-10   
ref|XP_009787420.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_010644298.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
emb|CDP05837.1|  unnamed protein product                              64.7    3e-10   
emb|CDX76339.1|  BnaA08g10610D                                        64.7    3e-10   
ref|XP_006283283.1|  hypothetical protein CARUB_v10004319mg           64.7    3e-10   
ref|XP_009353220.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_010412576.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine-ric...  64.7    3e-10   
ref|XP_006467963.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    3e-10   
ref|XP_010448753.1|  PREDICTED: cysteine-rich receptor-like prote...  64.7    3e-10   
ref|XP_009607319.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_009787421.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_006452092.1|  hypothetical protein CICLE_v10010321mg           64.3    3e-10   
gb|KDP30509.1|  hypothetical protein JCGZ_16689                       64.7    3e-10   
ref|XP_006851147.1|  hypothetical protein AMTR_s00043p00100060        64.7    3e-10   
ref|XP_010059687.1|  PREDICTED: cysteine-rich receptor-like prote...  63.5    3e-10   
emb|CAA20452.1|  serine/threonine kinase-like protein (fragment)      62.0    3e-10   
ref|XP_007214606.1|  hypothetical protein PRUPE_ppa001816mg           64.7    3e-10   
emb|CDY41245.1|  BnaA01g12940D                                        64.7    3e-10   
ref|XP_010529589.1|  PREDICTED: putative cysteine-rich receptor-l...  64.3    3e-10   
ref|XP_006377788.1|  hypothetical protein POPTR_0011s12840g           64.7    3e-10   
gb|KCW73360.1|  hypothetical protein EUGRSUZ_E01830                   64.3    3e-10   
gb|KFK29234.1|  hypothetical protein AALP_AA7G107000                  64.7    3e-10   
ref|XP_006475278.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.3    3e-10   
ref|XP_006350372.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
gb|EYU36706.1|  hypothetical protein MIMGU_mgv1a001937mg              64.7    3e-10   
ref|XP_008230172.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_009769962.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   
ref|XP_004511332.1|  PREDICTED: cysteine-rich receptor-like prote...  64.3    3e-10   
ref|XP_010059519.1|  PREDICTED: cysteine-rich receptor-like prote...  64.3    3e-10   
ref|XP_009341470.1|  PREDICTED: G-type lectin S-receptor-like ser...  63.9    3e-10   
gb|KCW58378.1|  hypothetical protein EUGRSUZ_H01063                   64.3    3e-10   
emb|CBI20457.3|  unnamed protein product                              64.3    3e-10   
ref|XP_004511333.1|  PREDICTED: cysteine-rich receptor-like prote...  64.3    3e-10   
ref|XP_009619490.1|  PREDICTED: G-type lectin S-receptor-like ser...  64.7    3e-10   



>emb|CDP05835.1| unnamed protein product [Coffea canephora]
Length=803

 Score = 72.0 bits (175),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LD DMNPKISDFG AR+ G NETGANTNRVVGT HG
Sbjct  609  IHRDLKASNILLDADMNPKISDFGTARSFGGNETGANTNRVVGT-HG  654



>ref|XP_007013194.1| Serine/threonine-protein kinase PBS1, putative [Theobroma cacao]
 gb|EOY30813.1| Serine/threonine-protein kinase PBS1, putative [Theobroma cacao]
Length=810

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDNDMNPKISDFG+AR  G NE+ ANTNRVVGT
Sbjct  616  IHRDLKASNILLDNDMNPKISDFGMARIFGHNESRANTNRVVGT  659



>gb|EYU33571.1| hypothetical protein MIMGU_mgv1a020014mg [Erythranthe guttata]
Length=808

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+DMNPKISDFGLAR  G NETGANT+RVVGT
Sbjct  613  IHRDLKASNILLDSDMNPKISDFGLARTFGGNETGANTSRVVGT  656



>ref|XP_007216724.1| hypothetical protein PRUPE_ppa025712mg [Prunus persica]
 gb|EMJ17923.1| hypothetical protein PRUPE_ppa025712mg [Prunus persica]
Length=800

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNFIE  150
            IHRDLKA   +LD  MNPKISDFG+AR  G+N+T ANTNRVVGT         L+G+F E
Sbjct  624  IHRDLKASNVLLDGSMNPKISDFGMARIFGMNQTEANTNRVVGTYGYMSPEYALYGHFSE  683

Query  151  MVD  159
             +D
Sbjct  684  KLD  686



>ref|XP_002528881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33505.1| conserved hypothetical protein [Ricinus communis]
Length=2428

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRDLK +  +LDNDMNPKISDFG+AR+ G NET ANTNRVVGT
Sbjct  1449  IHRDLKLSNILLDNDMNPKISDFGMARSFGGNETEANTNRVVGT  1492


 Score = 66.6 bits (161),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD +MNPKISDFGLAR+ G NET ANTN+VVGT
Sbjct  631  IHRDLKAGNILLDCEMNPKISDFGLARSFGGNETEANTNKVVGT  674


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRD+K +  +LDN+MNPKISDFG+AR+ G NET ANT RVVGT
Sbjct  2258  IHRDIKLSNILLDNEMNPKISDFGMARSFGGNETVANTKRVVGT  2301



>ref|XP_008230110.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
isoform X2 [Prunus mume]
Length=809

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNFIE  150
            IHRDLKA   +LD  MNPKISDFG+AR  G+N+T ANTNRVVGT         L+G+F E
Sbjct  612  IHRDLKASNVLLDGSMNPKISDFGMARIFGMNQTEANTNRVVGTYGYMSPEYALYGHFSE  671

Query  151  MVD  159
             +D
Sbjct  672  KLD  674



>ref|XP_008230109.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
isoform X1 [Prunus mume]
Length=841

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 44/63 (70%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNFIE  150
            IHRDLKA   +LD  MNPKISDFG+AR  G+N+T ANTNRVVGT         L+G+F E
Sbjct  644  IHRDLKASNVLLDGSMNPKISDFGMARIFGMNQTEANTNRVVGTYGYMSPEYALYGHFSE  703

Query  151  MVD  159
             +D
Sbjct  704  KLD  706



>ref|XP_006413572.1| hypothetical protein EUTSA_v100246151mg [Eutrema salsugineum]
 gb|ESQ55025.1| hypothetical protein EUTSA_v100246151mg [Eutrema salsugineum]
Length=647

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKAR  +LD DMNPKI+DFG+AR  G++++GANTNR+VGT
Sbjct  444  IHRDLKARNILLDADMNPKIADFGMARIFGMDQSGANTNRIVGT  487



>gb|KCW75432.1| hypothetical protein EUGRSUZ_E04193, partial [Eucalyptus grandis]
Length=596

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 44/63 (70%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNFIE  150
            IHRDLKA   +LDNDMNPKISDFG+AR  G+++T ANT+R+VGT         +HG F +
Sbjct  405  IHRDLKASNVLLDNDMNPKISDFGMARIFGVDQTKANTSRIVGTYGYMSPEYAMHGQFSQ  464

Query  151  MVD  159
              D
Sbjct  465  KSD  467



>ref|XP_006413573.1| hypothetical protein EUTSA_v100246151mg [Eutrema salsugineum]
 gb|ESQ55026.1| hypothetical protein EUTSA_v100246151mg [Eutrema salsugineum]
Length=665

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKAR  +LD DMNPKI+DFG+AR  G++++GANTNR+VGT
Sbjct  462  IHRDLKARNILLDADMNPKIADFGMARIFGMDQSGANTNRIVGT  505



>gb|KDO74353.1| hypothetical protein CISIN_1g003272mg [Citrus sinensis]
Length=834

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR  GL++T ANTNRVVGT
Sbjct  639  IHRDLKASNVLLDNEMNPKISDFGMARAFGLDQTEANTNRVVGT  682



>emb|CBI20423.3| unnamed protein product [Vitis vinifera]
Length=692

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDNDMNPKISDFG+AR  G NE+ ANTNR+VGT
Sbjct  497  IHRDLKASNILLDNDMNPKISDFGMARMFGGNESYANTNRIVGT  540



>ref|XP_006452080.1| hypothetical protein CICLE_v10007464mg [Citrus clementina]
 gb|ESR65320.1| hypothetical protein CICLE_v10007464mg [Citrus clementina]
Length=822

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR  GL++T ANTNRVVGT
Sbjct  627  IHRDLKASNVLLDNEMNPKISDFGMARAFGLDQTEANTNRVVGT  670



>gb|EYU33573.1| hypothetical protein MIMGU_mgv1a024422mg, partial [Erythranthe 
guttata]
Length=765

 Score = 69.7 bits (169),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            +HRDLKA   +LD+DMNPKISDFGLAR  G NETGANT+RVVGT
Sbjct  566  VHRDLKASNILLDSDMNPKISDFGLARTFGGNETGANTSRVVGT  609



>gb|KCW75396.1| hypothetical protein EUGRSUZ_E04150 [Eucalyptus grandis]
Length=570

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LDN+MNPKISDFG+AR +G+++T ANTN++VGT         +HG F
Sbjct  368  IHRDLKASNILLDNEMNPKISDFGMARIVGVDQTQANTNKIVGTFGYMSPEYAMHGQF  425



>gb|KDO74357.1| hypothetical protein CISIN_1g004521mg [Citrus sinensis]
Length=747

 Score = 69.7 bits (169),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 36/49 (73%), Gaps = 1/49 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHGNF  144
            IHRDLKA   +LD DMNPKISDFGL R  G +ET  NTNRVVGT  G F
Sbjct  564  IHRDLKASNVLLDQDMNPKISDFGLVRTFGGDETEGNTNRVVGTYDGQF  612



>ref|XP_010644274.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
[Vitis vinifera]
Length=1573

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDNDMNPKISDFG+AR  G NE+ ANTNR+VGT
Sbjct  650  IHRDLKASNILLDNDMNPKISDFGMARMFGGNESYANTNRIVGT  693


 Score = 52.0 bits (123),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRDLK +  +LD+++ PKISDFG+AR  G ++  A T RV+GT
Sbjct  1414  IHRDLKTSNILLDSELTPKISDFGIARIFGGDQIEAKTKRVIGT  1457



>emb|CBI20439.3| unnamed protein product [Vitis vinifera]
Length=233

 Score = 67.0 bits (162),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDNDMNPKISDFG+AR+ G NE GA+T RV GTL
Sbjct  45   IHRDLKAENVLLDNDMNPKISDFGIARSFGGNELGASTTRVAGTL  89



>ref|XP_006452079.1| hypothetical protein CICLE_v10007464mg [Citrus clementina]
 gb|ESR65319.1| hypothetical protein CICLE_v10007464mg [Citrus clementina]
Length=670

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR  GL++T ANTNRVVGT
Sbjct  627  IHRDLKASNVLLDNEMNPKISDFGMARAFGLDQTEANTNRVVGT  670



>gb|ABK96679.1| unknown [Populus trichocarpa x Populus deltoides]
Length=665

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFGLAR++G NET ANTN+VVGT
Sbjct  471  IHRDLKASNILLDHEMNPKISDFGLARSVGGNETEANTNKVVGT  514



>ref|XP_006475274.1| PREDICTED: uncharacterized protein LOC102626881 [Citrus sinensis]
Length=1681

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR  GL++T ANTNRVVGT
Sbjct  645  IHRDLKASNVLLDNEMNPKISDFGMARAFGLDQTEANTNRVVGT  688


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRDLKA   +LDN+MNPKISDFG+AR  G+++T ANTNRVVGT
Sbjct  1486  IHRDLKASNVLLDNEMNPKISDFGMARAFGVDQTEANTNRVVGT  1529



>ref|XP_010059664.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=1054

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LDN+MNPKISDFG+AR +G+++T ANTN++VGT         +HG F
Sbjct  852  IHRDLKASNILLDNEMNPKISDFGMARIVGVDQTQANTNKIVGTFGYMSPEYAMHGQF  909



>ref|XP_007216717.1| hypothetical protein PRUPE_ppa026314mg, partial [Prunus persica]
 gb|EMJ17916.1| hypothetical protein PRUPE_ppa026314mg, partial [Prunus persica]
Length=207

 Score = 66.2 bits (160),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 42/63 (67%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNFIE  150
            IHRDLKA   +LD DMNPKISDFG+AR  G+N+T ANT+RVV T         L GNF E
Sbjct  7    IHRDLKASNILLDGDMNPKISDFGMARIFGMNQTEANTDRVVRTYGYMSPEYALLGNFSE  66

Query  151  MVD  159
              D
Sbjct  67   KSD  69



>gb|KDO74347.1| hypothetical protein CISIN_1g003391mg [Citrus sinensis]
 gb|KDO74348.1| hypothetical protein CISIN_1g003391mg [Citrus sinensis]
Length=606

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR  G+++T ANTNRVVGT
Sbjct  411  IHRDLKASNVLLDNEMNPKISDFGMARAFGIDQTEANTNRVVGT  454



>ref|XP_010928144.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Elaeis guineensis]
Length=920

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR  G NET ANTNR+VGT
Sbjct  198  IHRDLKASNILLDADMNPKISDFGLARIFGSNETQANTNRIVGT  241


 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD ++NPKISDFG AR   +++   NTNRVVGT
Sbjct  732  IHRDLKASNILLDEELNPKISDFGTARIFKVDQIEENTNRVVGT  775



>ref|XP_006282816.1| hypothetical protein CARUB_v10006547mg [Capsella rubella]
 gb|EOA15714.1| hypothetical protein CARUB_v10006547mg [Capsella rubella]
Length=669

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKI+DFG+AR  G+++TGANTNR+VGT
Sbjct  464  IHRDLKASNILLDADMNPKIADFGMARIFGMDQTGANTNRIVGT  507



>gb|KCW44888.1| hypothetical protein EUGRSUZ_L01528 [Eucalyptus grandis]
Length=753

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            +HRDLKA   +LDNDMNPKISDFGLA+  G NE+ ANTNR+VGT
Sbjct  558  VHRDLKASNVLLDNDMNPKISDFGLAKMFGGNESEANTNRIVGT  601



>gb|KCW44889.1| hypothetical protein EUGRSUZ_L01528 [Eucalyptus grandis]
Length=620

 Score = 68.9 bits (167),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            +HRDLKA   +LDNDMNPKISDFGLA+  G NE+ ANTNR+VGT
Sbjct  577  VHRDLKASNVLLDNDMNPKISDFGLAKMFGGNESEANTNRIVGT  620



>gb|EYU32317.1| hypothetical protein MIMGU_mgv1a006448mg [Erythranthe guttata]
Length=444

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR+ G+NE  ANT+RVVGT
Sbjct  249  IHRDLKASNILLDTDMNPKISDFGLARSFGVNEIEANTSRVVGT  292



>ref|XP_006370398.1| hypothetical protein POPTR_0001s42250g [Populus trichocarpa]
 gb|ERP66967.1| hypothetical protein POPTR_0001s42250g [Populus trichocarpa]
Length=776

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFGLAR++G NET ANTN+VVGT
Sbjct  582  IHRDLKASNILLDHEMNPKISDFGLARSVGGNETEANTNKVVGT  625



>gb|KCW44887.1| hypothetical protein EUGRSUZ_L01528 [Eucalyptus grandis]
Length=772

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            +HRDLKA   +LDNDMNPKISDFGLA+  G NE+ ANTNR+VGT
Sbjct  577  VHRDLKASNVLLDNDMNPKISDFGLAKMFGGNESEANTNRIVGT  620



>gb|EEC71606.1| hypothetical protein OsI_04006 [Oryza sativa Indica Group]
Length=257

 Score = 66.2 bits (160),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFG+AR  G  ET ANTNRVVGT
Sbjct  85   IHRDLKASNILLDIDMNPKISDFGMARIFGSKETEANTNRVVGT  128



>ref|XP_010040817.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Eucalyptus grandis]
Length=852

 Score = 68.9 bits (167),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            +HRDLKA   +LDNDMNPKISDFGLA+  G NE+ ANTNR+VGT
Sbjct  657  VHRDLKASNVLLDNDMNPKISDFGLAKMFGGNESEANTNRIVGT  700



>ref|XP_008230175.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103329478 
[Prunus mume]
Length=1684

 Score = 69.3 bits (168),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNFIE  150
            IHRDLKA   +LD +MNPKISDFG+AR  G+N+T ANT+RVVGT         L GNF E
Sbjct  591  IHRDLKASNILLDGEMNPKISDFGMARIFGMNQTEANTDRVVGTYGYMSPEYALLGNFSE  650

Query  151  MVD  159
              D
Sbjct  651  KSD  653


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 42/63 (67%), Gaps = 10/63 (16%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL---------HGNFIE  150
             IHRDLKA   +LD  MNPKISDFG+A+   +N+T ANTNRVVGT          +G+F E
Sbjct  1488  IHRDLKASNVLLDGAMNPKISDFGMAKIFEINQTEANTNRVVGTYGYMSPEYARYGHFSE  1547

Query  151   MVD  159
              +D
Sbjct  1548  KLD  1550



>ref|XP_010059143.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Eucalyptus grandis]
Length=648

 Score = 68.6 bits (166),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNFIE  150
            IHRDLKA   +LDN+MNPKISDFG+AR  G+++T ANT R+VGT         +HG F +
Sbjct  458  IHRDLKASNILLDNNMNPKISDFGMARIFGVDQTNANTRRIVGTYGYMSPEYAMHGQFSQ  517

Query  151  MVD  159
              D
Sbjct  518  KSD  520



>ref|XP_010267891.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=673

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDNDMNPKISDFG+AR  G N++ ANTNRVVGT
Sbjct  476  IHRDLKASNVLLDNDMNPKISDFGMARIFGGNQSQANTNRVVGT  519



>ref|XP_010057745.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=644

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LDN+MNPKISDFG+AR +G+++T ANTN++VGT         +HG F
Sbjct  442  IHRDLKASNILLDNEMNPKISDFGMARIVGVDQTQANTNKIVGTFGYMSPEYAMHGQF  499



>ref|XP_009611412.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Nicotiana tomentosiformis]
Length=828

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR+ G +ETGANT RVVGT
Sbjct  633  IHRDLKASNVLLDNEMNPKISDFGMARSFGGDETGANTRRVVGT  676



>ref|XP_011002465.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=822

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFGLAR++G NET ANTN+VVGT
Sbjct  628  IHRDLKASNILLDHEMNPKISDFGLARSVGGNETEANTNKVVGT  671



>ref|XP_006426989.1| hypothetical protein CICLE_v10024887mg [Citrus clementina]
 gb|ESR40229.1| hypothetical protein CICLE_v10024887mg [Citrus clementina]
Length=846

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 2/47 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LD+ MNPKISDFG+AR  G+NE  ANTNR+VGT HG
Sbjct  648  IHRDLKASNILLDDQMNPKISDFGMARTFGMNELEANTNRIVGT-HG  693



>gb|KCW75000.1| hypothetical protein EUGRSUZ_E03762 [Eucalyptus grandis]
Length=665

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 43/58 (74%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LDN+MNPKISDFG+AR +G+++T ANTN++VGT         +HG F
Sbjct  463  IHRDLKASNILLDNEMNPKISDFGMARIVGVDQTQANTNKIVGTFGYMSPEYAMHGQF  520



>ref|XP_010529588.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 [Tarenaya 
hassleriana]
Length=527

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 38/45 (84%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LD D+NPKI+DFG+ARN G+++T ANT RVVGTL
Sbjct  483  IHRDLKASNILLDADLNPKIADFGMARNFGIDQTEANTRRVVGTL  527



>gb|KCW75001.1| hypothetical protein EUGRSUZ_E03762 [Eucalyptus grandis]
Length=507

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 40/45 (89%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+MNPKISDFG+AR +G+++T ANTN++VGTL
Sbjct  463  IHRDLKASNILLDNEMNPKISDFGMARIVGVDQTQANTNKIVGTL  507



>gb|KDO74350.1| hypothetical protein CISIN_1g005933mg [Citrus sinensis]
Length=669

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDNDMNPKISDFG+AR  G+++T ANT+RVVGT
Sbjct  474  IHRDLKASNVLLDNDMNPKISDFGMARAFGVDQTEANTDRVVGT  517



>gb|KDO74352.1| hypothetical protein CISIN_1g038934mg, partial [Citrus sinensis]
Length=751

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR  G+++T ANTNRVVGT
Sbjct  556  IHRDLKASNVLLDNEMNPKISDFGMARAFGVDQTEANTNRVVGT  599



>ref|XP_006452078.1| hypothetical protein CICLE_v10010587mg [Citrus clementina]
 gb|ESR65318.1| hypothetical protein CICLE_v10010587mg [Citrus clementina]
Length=808

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR  G+++T ANTNRVVGT
Sbjct  613  IHRDLKASNVLLDNEMNPKISDFGMARAFGVDQTEANTNRVVGT  656



>ref|XP_009611413.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Nicotiana tomentosiformis]
Length=797

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR+ G +ETGANT RVVGT
Sbjct  633  IHRDLKASNVLLDNEMNPKISDFGMARSFGGDETGANTRRVVGT  676



>gb|KDO74346.1| hypothetical protein CISIN_1g003391mg [Citrus sinensis]
Length=823

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR  G+++T ANTNRVVGT
Sbjct  628  IHRDLKASNVLLDNEMNPKISDFGMARAFGIDQTEANTNRVVGT  671



>ref|XP_006452075.1| hypothetical protein CICLE_v10007466mg [Citrus clementina]
 gb|ESR65315.1| hypothetical protein CICLE_v10007466mg [Citrus clementina]
Length=822

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR  G+++T ANTNRVVGT
Sbjct  627  IHRDLKASNVLLDNEMNPKISDFGMARAFGIDQTEANTNRVVGT  670



>emb|CAN61487.1| hypothetical protein VITISV_038128 [Vitis vinifera]
Length=2441

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDNDMNPKISDFGLAR  G ++T  NTNRV+GT
Sbjct  565  IHRDLKASNILLDNDMNPKISDFGLARTFGNDQTEVNTNRVIGT  608



>gb|KDO74351.1| hypothetical protein CISIN_1g005933mg [Citrus sinensis]
Length=517

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDNDMNPKISDFG+AR  G+++T ANT+RVVGT
Sbjct  474  IHRDLKASNVLLDNDMNPKISDFGMARAFGVDQTEANTDRVVGT  517



>gb|KHN13685.1| G-type lectin S-receptor-like serine/threonine-protein kinase 
[Glycine soja]
Length=816

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLK +  +LDNDMNPKISDFGLAR  G ++  ANTNRV+GT         LHG+F
Sbjct  619  IHRDLKVSNILLDNDMNPKISDFGLARTFGGDQAEANTNRVMGTYGYMPPEYALHGHF  676



>ref|XP_006465592.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101-like [Citrus sinensis]
Length=818

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 2/47 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LD+ MNPKISDFG+AR  G+NE  ANTNR+VGT HG
Sbjct  620  IHRDLKASNILLDDQMNPKISDFGMARTFGMNELEANTNRIVGT-HG  665



>ref|XP_007213167.1| hypothetical protein PRUPE_ppa026828mg [Prunus persica]
 gb|EMJ14366.1| hypothetical protein PRUPE_ppa026828mg [Prunus persica]
Length=682

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 39/48 (81%), Gaps = 2/48 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARN-IGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LDN+MNPKISDFGLAR  IG ++TG NTNRVVGT  G
Sbjct  508  IHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQTGGNTNRVVGTYFG  555



>gb|KDP26021.1| hypothetical protein JCGZ_21054 [Jatropha curcas]
Length=299

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK R  +LD DMNPKISDFGLAR  G ++T ANTNRVVGT
Sbjct  105  IHRDLKTRNILLDYDMNPKISDFGLARIFGESQTEANTNRVVGT  148



>ref|XP_010644290.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Vitis vinifera]
Length=819

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDNDMNPKISDFG+AR+ G NE GA+T RV GTL
Sbjct  631  IHRDLKAENVLLDNDMNPKISDFGIARSFGGNELGASTTRVAGTL  675



>gb|KCW74348.1| hypothetical protein EUGRSUZ_E030241, partial [Eucalyptus grandis]
Length=140

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNFIE  150
            IHRDLKA   +LDN+MNPKISDFG+AR  G+++T ANT R+VGT         +HG F +
Sbjct  33   IHRDLKASNILLDNNMNPKISDFGMARIFGVDQTNANTRRIVGTYGYMSPEYAMHGQFSQ  92

Query  151  MVD  159
              D
Sbjct  93   KSD  95



>gb|KDO74363.1| hypothetical protein CISIN_1g0467031mg, partial [Citrus sinensis]
Length=230

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR  G +ET  NT RVVGT
Sbjct  35   IHRDLKAGNVLLDQDMNPKISDFGLARTFGGDETEGNTTRVVGT  78



>ref|XP_006475273.1| PREDICTED: uncharacterized protein LOC102626595 [Citrus sinensis]
Length=1741

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRDLKA   +LDN+MNPKISDFG+AR  G+++T ANTNRVVGT
Sbjct  1546  IHRDLKASNVLLDNEMNPKISDFGMARAFGIDQTEANTNRVVGT  1589


 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDNDMNPKISDFG+AR  G+++T ANT+RVVGT
Sbjct  650  IHRDLKASNVLLDNDMNPKISDFGMARAFGVDQTEANTDRVVGT  693



>emb|CDO99678.1| unnamed protein product [Coffea canephora]
Length=639

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            +HRDLKA   +LD DM+PKISDFGLAR  GLNE  ANTNR+VGT
Sbjct  445  VHRDLKASNILLDGDMDPKISDFGLARIFGLNELQANTNRIVGT  488



>ref|XP_006475249.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Citrus sinensis]
Length=800

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/49 (69%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHGNF  144
            IHRDLKA   +LD+DMNPKISDFGLAR  G ++T  NTNRVVGT  G F
Sbjct  614  IHRDLKASNVLLDHDMNPKISDFGLARTCGGDKTEGNTNRVVGTYDGLF  662



>emb|CAN72253.1| hypothetical protein VITISV_034184 [Vitis vinifera]
Length=655

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD DMNPKISDFG+AR  G+++T  NTNRVVGT         +HG+F
Sbjct  451  IHRDLKASNVLLDGDMNPKISDFGMARIFGVDQTQGNTNRVVGTYGYMSPEYAMHGHF  508



>ref|XP_002316947.1| hypothetical protein POPTR_0011s12950g [Populus trichocarpa]
 gb|EEE97559.1| hypothetical protein POPTR_0011s12950g [Populus trichocarpa]
Length=768

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LDNDMNPKISDFG+AR+ G NET ANT RVVGT
Sbjct  577  IHRDLKLSNILLDNDMNPKISDFGMARSFGENETEANTRRVVGT  620



>emb|CAN70180.1| hypothetical protein VITISV_000005 [Vitis vinifera]
Length=229

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+M+PKISDFGLAR+ G NET ANT RV GTL
Sbjct  34   IHRDLKAENVLLDNEMSPKISDFGLARSFGGNETEANTTRVAGTL  78



>ref|XP_004244166.2| PREDICTED: uncharacterized protein LOC101262029 [Solanum lycopersicum]
Length=2499

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFG+AR+ G +ETGANT RVVGT
Sbjct  633  IHRDLKASNVLLDTDMNPKISDFGMARSFGGDETGANTRRVVGT  676


 Score = 60.1 bits (144),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = +1

Query  1     IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
             IHRDLKA   +LD DMNPKISDFGLA+    ++ GA TNRVVGT HG
Sbjct  2303  IHRDLKANNILLDKDMNPKISDFGLAKICEEDDVGAMTNRVVGT-HG  2348


 Score = 55.1 bits (131),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRDLKA   +LDNDMN KISDFG+AR    ++  A TNRV+GT
Sbjct  1474  IHRDLKANNILLDNDMNAKISDFGIARCYEEDDNEAMTNRVIGT  1517



>gb|KDO56869.1| hypothetical protein CISIN_1g041345mg [Citrus sinensis]
Length=340

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 2/47 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LD+ MNPKISDFG+AR  G+NE  ANTNR+VGT HG
Sbjct  142  IHRDLKASNILLDDQMNPKISDFGMARTFGMNELEANTNRIVGT-HG  187



>gb|KCW63307.1| hypothetical protein EUGRSUZ_G00934 [Eucalyptus grandis]
Length=614

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+MNPKISDFGLAR+ G NE+ ANT RVVGT 
Sbjct  418  IHRDLKAENILLDNEMNPKISDFGLARSFGGNESEANTKRVVGTF  462



>ref|XP_006591161.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Glycine max]
Length=819

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 40/58 (69%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLK +  +LDNDMNPKISDFGLAR  G ++  ANTNRV+GT         LHG F
Sbjct  622  IHRDLKVSNILLDNDMNPKISDFGLARTFGGDQAEANTNRVMGTYGYMPPEYALHGRF  679



>emb|CBI29180.3| unnamed protein product [Vitis vinifera]
Length=523

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 40/58 (69%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD DMNPKISDFG+AR  G+++T  NTNRVVGT         +HG F
Sbjct  319  IHRDLKASNVLLDGDMNPKISDFGMARIFGVDQTQGNTNRVVGTYGYMSPEYAMHGRF  376



>emb|CBI14789.3| unnamed protein product [Vitis vinifera]
Length=227

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+M+PKISDFGLAR+ G NET ANT RV GTL
Sbjct  53   IHRDLKAENVLLDNEMSPKISDFGLARSFGGNETEANTTRVAGTL  97



>gb|KHN15821.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=592

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFG+AR  G+++T ANTNR+VGT
Sbjct  389  IHRDLKASNVLLDGDMNPKISDFGMARIFGVDQTQANTNRIVGT  432



>ref|XP_006452085.1| hypothetical protein CICLE_v10010368mg, partial [Citrus clementina]
 gb|ESR65325.1| hypothetical protein CICLE_v10010368mg, partial [Citrus clementina]
Length=750

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR  G +ET  NTNRVVGT
Sbjct  555  IHRDLKASNVLLDQDMNPKISDFGLARTFGGDETEGNTNRVVGT  598



>ref|XP_010648190.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Vitis vinifera]
Length=681

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFG+AR +G+++T  NTNRVVGT
Sbjct  477  IHRDLKASNVLLDGDMNPKISDFGMARIVGVDQTQGNTNRVVGT  520



>ref|XP_010648189.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=682

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFG+AR +G+++T  NTNRVVGT
Sbjct  478  IHRDLKASNVLLDGDMNPKISDFGMARIVGVDQTQGNTNRVVGT  521



>ref|XP_011048516.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X1 [Populus euphratica]
Length=1022

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK+   +LD +MNPKISDFGLAR  G NET ANTNRVVGT
Sbjct  826  IHRDLKSSNILLDEEMNPKISDFGLARIFGGNETAANTNRVVGT  869



>ref|XP_006449083.1| hypothetical protein CICLE_v10016609mg [Citrus clementina]
 gb|ESR62323.1| hypothetical protein CICLE_v10016609mg [Citrus clementina]
Length=221

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFG+AR  G N++ ANTNRVVGT
Sbjct  34   IHRDLKASNVLLDHEMNPKISDFGMARIFGGNQSEANTNRVVGT  77



>ref|XP_006857314.1| hypothetical protein AMTR_s00067p00069710 [Amborella trichopoda]
 gb|ERN18781.1| hypothetical protein AMTR_s00067p00069710 [Amborella trichopoda]
Length=415

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD +MNPKISDFGLAR + LN+  ANTNRVVGT         +HG+F
Sbjct  274  IHRDLKASNILLDFEMNPKISDFGLARIVSLNQGQANTNRVVGTYGYLAPEYVMHGHF  331



>ref|XP_003556014.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
isoform 2 [Glycine max]
Length=666

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFG+AR  G+++T ANTNR+VGT
Sbjct  463  IHRDLKASNVLLDGDMNPKISDFGMARIFGVDQTQANTNRIVGT  506



>ref|XP_011048518.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 isoform X2 [Populus euphratica]
Length=1021

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK+   +LD +MNPKISDFGLAR  G NET ANTNRVVGT
Sbjct  825  IHRDLKSSNILLDEEMNPKISDFGLARIFGGNETAANTNRVVGT  868



>gb|KCW63316.1| hypothetical protein EUGRSUZ_G00944 [Eucalyptus grandis]
Length=332

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+MNPKISDFGLAR+ G NE+ ANT RVVGT 
Sbjct  136  IHRDLKAENILLDNEMNPKISDFGLARSFGGNESEANTKRVVGTF  180



>gb|KCW63314.1| hypothetical protein EUGRSUZ_G00941 [Eucalyptus grandis]
Length=531

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+MNPKISDFGLAR+ G NE+ ANT RVVGT 
Sbjct  420  IHRDLKAENILLDNEMNPKISDFGLARSFGGNESEANTKRVVGTF  464



>ref|XP_003556018.2| PREDICTED: cysteine-rich receptor-like protein kinase 25-like 
isoform 1 [Glycine max]
Length=707

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFG+AR  G+++T ANTNR+VGT
Sbjct  504  IHRDLKASNVLLDGDMNPKISDFGMARIFGVDQTQANTNRIVGT  547



>ref|XP_006356902.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1-like isoform X2 [Solanum tuberosum]
Length=247

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LD DMNPKISDFG+AR+ G NETGA T RVVGT
Sbjct  51   IHRDLKPSNVLLDTDMNPKISDFGMARSFGGNETGAMTKRVVGT  94



>gb|KDO74340.1| hypothetical protein CISIN_1g003254mg [Citrus sinensis]
Length=836

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN MNPKISDFGLAR+ GL++T ANT RVVGT
Sbjct  641  IHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKRVVGT  684



>ref|XP_010644341.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Vitis vinifera]
Length=660

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 40/58 (69%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD DMNPKISDFG+AR  G+++T  NTNRVVGT         +HG F
Sbjct  456  IHRDLKASNVLLDGDMNPKISDFGMARIFGVDQTQGNTNRVVGTYGYMSPEYAMHGRF  513



>gb|KCW63313.1| hypothetical protein EUGRSUZ_G00941 [Eucalyptus grandis]
Length=616

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+MNPKISDFGLAR+ G NE+ ANT RVVGT 
Sbjct  420  IHRDLKAENILLDNEMNPKISDFGLARSFGGNESEANTKRVVGTF  464



>gb|KDO74342.1| hypothetical protein CISIN_1g003254mg [Citrus sinensis]
Length=684

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN MNPKISDFGLAR+ GL++T ANT RVVGT
Sbjct  641  IHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKRVVGT  684



>ref|XP_006370396.1| hypothetical protein POPTR_0001s42220g [Populus trichocarpa]
 gb|ERP66965.1| hypothetical protein POPTR_0001s42220g [Populus trichocarpa]
Length=776

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR+ G N+T  NTNRVVGT
Sbjct  581  IHRDLKASNILLDNNMNPKISDFGLARSFGENQTEDNTNRVVGT  624



>ref|XP_011030932.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Populus euphratica]
Length=816

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LDNDMNPKISDFG+AR+ G NET ANT RVVGT
Sbjct  625  IHRDLKLSNILLDNDMNPKISDFGMARSFGGNETEANTRRVVGT  668



>ref|XP_006356901.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1-like isoform X1 [Solanum tuberosum]
Length=249

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LD DMNPKISDFG+AR+ G NETGA T RVVGT
Sbjct  53   IHRDLKPSNVLLDTDMNPKISDFGMARSFGGNETGAMTKRVVGT  96



>ref|XP_011030931.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Populus euphratica]
Length=818

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LDNDMNPKISDFG+AR+ G NET ANT RVVGT
Sbjct  627  IHRDLKLSNILLDNDMNPKISDFGMARSFGGNETEANTRRVVGT  670



>ref|XP_011030930.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Populus euphratica]
Length=819

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LDNDMNPKISDFG+AR+ G NET ANT RVVGT
Sbjct  628  IHRDLKLSNILLDNDMNPKISDFGMARSFGGNETEANTRRVVGT  671



>ref|XP_010065695.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Eucalyptus grandis]
Length=815

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+MNPKISDFGLAR+ G NE+ ANT RVVGT 
Sbjct  619  IHRDLKAENILLDNEMNPKISDFGLARSFGGNESEANTKRVVGTF  663



>gb|KHN15822.1| Cysteine-rich receptor-like protein kinase 25 [Glycine soja]
Length=855

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFG+AR  G+++T ANTNR+VGT
Sbjct  476  IHRDLKASNVLLDGDMNPKISDFGMARIFGVDQTQANTNRIVGT  519



>ref|XP_011030955.1| PREDICTED: uncharacterized protein LOC105130249 [Populus euphratica]
Length=1755

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRDLKA   +LDN MNPKISDFGLAR+ G NET ANT RVVGT
Sbjct  1560  IHRDLKASNILLDNSMNPKISDFGLARSFGENETEANTKRVVGT  1603


 Score = 55.5 bits (132),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD +M+PKISDFGLAR +  NET + T +VVGT
Sbjct  663  IHRDLKASNILLDYNMHPKISDFGLARGVEGNETESKTRKVVGT  706



>ref|XP_009778629.1| PREDICTED: uncharacterized protein LOC104227947 [Nicotiana sylvestris]
Length=1645

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD +MNPKISDFG+AR+ G NETGANT RVVGT
Sbjct  630  IHRDLKASNVLLDIEMNPKISDFGMARSFGGNETGANTRRVVGT  673


 Score = 48.9 bits (115),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRDLK +  +LD D+NP+ISDFGLA+    ++    T RV+GT
Sbjct  1450  IHRDLKTSNILLDTDLNPRISDFGLAKIFVGDQMEGKTKRVIGT  1493



>ref|XP_011030933.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X4 [Populus euphratica]
Length=768

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LDNDMNPKISDFG+AR+ G NET ANT RVVGT
Sbjct  577  IHRDLKLSNILLDNDMNPKISDFGMARSFGGNETEANTRRVVGT  620



>ref|XP_010439199.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 isoform 
X2 [Camelina sativa]
 ref|XP_010439200.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 isoform 
X3 [Camelina sativa]
Length=521

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            +HRDLKA   +LD DMNPKI+DFG+AR  G++++GANTNR+VGT  G
Sbjct  467  VHRDLKASNVLLDADMNPKIADFGMARIFGMDQSGANTNRIVGTRFG  513



>ref|XP_010065693.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Eucalyptus grandis]
 ref|XP_010065694.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Eucalyptus grandis]
 gb|KCW63309.1| hypothetical protein EUGRSUZ_G00936 [Eucalyptus grandis]
Length=815

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+MNPKISDFGLAR+ G NE+ ANT RVVGT 
Sbjct  619  IHRDLKAENILLDNEMNPKISDFGLARSFGGNESEANTKRVVGTF  663



>ref|XP_010057269.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Eucalyptus 
grandis]
Length=196

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/63 (51%), Positives = 42/63 (67%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNFIE  150
            IHRDLKA   +LDN+MNPKI DFG+A+  G+++T ANT R+VGT         +HG F +
Sbjct  13   IHRDLKASNILLDNNMNPKILDFGMAKIFGVDQTNANTRRIVGTYGYMSPEYAMHGQFSQ  72

Query  151  MVD  159
              D
Sbjct  73   KSD  75



>ref|XP_007214500.1| hypothetical protein PRUPE_ppa018064mg [Prunus persica]
 gb|EMJ15699.1| hypothetical protein PRUPE_ppa018064mg [Prunus persica]
Length=773

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/45 (76%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNI-GLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR + G N+TG NTNRVVGT
Sbjct  579  IHRDLKASNVLLDNEMNPKISDFGLARTLTGGNQTGGNTNRVVGT  623



>gb|KCW63310.1| hypothetical protein EUGRSUZ_G00936 [Eucalyptus grandis]
Length=775

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+MNPKISDFGLAR+ G NE+ ANT RVVGT 
Sbjct  579  IHRDLKAENILLDNEMNPKISDFGLARSFGGNESEANTKRVVGTF  623



>gb|KCW63311.1| hypothetical protein EUGRSUZ_G00936 [Eucalyptus grandis]
Length=737

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+MNPKISDFGLAR+ G NE+ ANT RVVGT 
Sbjct  619  IHRDLKAENILLDNEMNPKISDFGLARSFGGNESEANTKRVVGTF  663



>ref|XP_002317544.2| hypothetical protein POPTR_0011s13180g [Populus trichocarpa]
 gb|EEE98156.2| hypothetical protein POPTR_0011s13180g [Populus trichocarpa]
Length=832

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN MNPKISDFGLAR+ G NET ANT RVVGT
Sbjct  637  IHRDLKASNILLDNSMNPKISDFGLARSFGENETEANTKRVVGT  680



>ref|XP_010067925.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
Length=801

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+MNPKISDFGLAR+ G NE+ ANT RVVGT 
Sbjct  605  IHRDLKAENILLDNEMNPKISDFGLARSFGGNESEANTKRVVGTF  649



>ref|XP_009605851.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Nicotiana tomentosiformis]
Length=377

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD +MNPKISDFG+AR+ G NETGANT+RVVGT
Sbjct  182  IHRDLKASNVLLDIEMNPKISDFGMARSFGGNETGANTHRVVGT  225



>ref|XP_010327263.1| PREDICTED: uncharacterized protein LOC101244232 [Solanum lycopersicum]
Length=1630

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD +MNPKISDFG+AR+ G NETG NTNRVVGT
Sbjct  631  IHRDLKASNVLLDFEMNPKISDFGMARSFGGNETGDNTNRVVGT  674


 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRDLKA   +LD D+NP+ISDFGLA+  G ++    T RV+GT
Sbjct  1434  IHRDLKASNILLDTDLNPRISDFGLAKIFGADQMEGKTRRVIGT  1477



>gb|KDO74341.1| hypothetical protein CISIN_1g003254mg [Citrus sinensis]
Length=738

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN MNPKISDFGLAR+ GL++T ANT RVVGT
Sbjct  641  IHRDLKASNVLLDNTMNPKISDFGLARSFGLDQTEANTKRVVGT  684



>ref|XP_010644348.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Vitis vinifera]
Length=507

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LD DMNPKISDFG+AR  G+++T  NTNRVVGT + 
Sbjct  456  IHRDLKASNVLLDGDMNPKISDFGMARIFGVDQTQGNTNRVVGTYYA  502



>ref|XP_010448733.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 isoform 
X3 [Camelina sativa]
Length=521

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 39/47 (83%), Gaps = 1/47 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LD DMNPKI+DFG+AR  G++++GANTNR+VGT  G
Sbjct  467  IHRDLKASNVLLDADMNPKIADFGMARIFGMDQSGANTNRIVGTRFG  513



>ref|XP_006370395.1| hypothetical protein POPTR_0001s42210g [Populus trichocarpa]
 gb|ERP66964.1| hypothetical protein POPTR_0001s42210g [Populus trichocarpa]
Length=828

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDNDMNPKISDFGLAR+ G NET A T+RVVGT
Sbjct  633  IHRDLKASNILLDNDMNPKISDFGLARSFGENETEAITSRVVGT  676



>ref|XP_011038914.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase B120 [Populus euphratica]
Length=313

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  1    IHRDLKARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK   +LD++MNPKISDFG+AR  G NET ANTNR+VGT
Sbjct  271  IHRDLKPSNILDSEMNPKISDFGMARIFGGNETQANTNRIVGT  313



>ref|XP_007021188.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding, putative [Theobroma cacao]
 gb|EOY12713.1| Serine/threonine kinases,protein kinases,ATP binding,sugar binding,kinases,carbohydrate 
binding, putative [Theobroma cacao]
Length=865

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR+ G  ET ANT +VVGT
Sbjct  670  IHRDLKASNVLLDNEMNPKISDFGLARSFGEKETAANTKKVVGT  713



>ref|XP_006475277.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Citrus sinensis]
Length=820

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR  G +ET  NTNRVVGT
Sbjct  625  IHRDLKASNVLLDQDMNPKISDFGLARAFGGDETEGNTNRVVGT  668



>ref|XP_006283296.1| hypothetical protein CARUB_v10004334mg [Capsella rubella]
 gb|EOA16194.1| hypothetical protein CARUB_v10004334mg [Capsella rubella]
Length=649

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKI+DFG+AR  G++++GANTN++VGT
Sbjct  456  IHRDLKASNILLDADMNPKIADFGMARIFGMDQSGANTNKIVGT  499



>emb|CDX94171.1| BnaC07g38050D [Brassica napus]
Length=487

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD DMNPKI+DFG+AR  G++++GANT+R+VGT         +HG F
Sbjct  282  IHRDLKASNILLDADMNPKIADFGMARIFGMDQSGANTSRIVGTHGYMPPEYLIHGQF  339



>emb|CBI20448.3| unnamed protein product [Vitis vinifera]
Length=344

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+M PKISDFG+AR+ G NET ANT RVVGTL
Sbjct  156  IHRDLKAENILLDNEMTPKISDFGIARSFGGNETEANTTRVVGTL  200



>ref|XP_006452099.1| hypothetical protein CICLE_v10009316mg [Citrus clementina]
 gb|ESR65339.1| hypothetical protein CICLE_v10009316mg [Citrus clementina]
Length=242

 Score = 64.7 bits (156),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR    +ET  NTNRVVGT
Sbjct  47   IHRDLKASNVLLDQDMNPKISDFGLARTFARDETEGNTNRVVGT  90



>gb|KCW69726.1| hypothetical protein EUGRSUZ_F031112, partial [Eucalyptus grandis]
Length=78

 Score = 62.8 bits (151),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRD+KA   +LD DMNPKISDFGLA+++  NET ANTNRVVGT
Sbjct  35   IHRDIKASNVLLDFDMNPKISDFGLAKSLAGNETRANTNRVVGT  78



>ref|XP_002516064.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
 gb|EEF46484.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis]
Length=795

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFG+AR  GL E+ ANTNR+VGT
Sbjct  599  IHRDLKASNILLDDEMNPKISDFGMARIFGLKESEANTNRIVGT  642



>ref|XP_006370400.1| hypothetical protein POPTR_0001s42260g [Populus trichocarpa]
 gb|ERP66969.1| hypothetical protein POPTR_0001s42260g [Populus trichocarpa]
Length=833

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LD++MNPKISDFG+AR+ G NETGANT RVVGT
Sbjct  638  IHRDLKPSNILLDDEMNPKISDFGMARSFGGNETGANTKRVVGT  681



>ref|XP_002319396.1| S-locus lectin protein kinase [Populus trichocarpa]
 gb|EEE95319.1| S-locus lectin protein kinase [Populus trichocarpa]
Length=853

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK+   +LD +MNPKISDFGLAR  G NET ANTNRVVGT
Sbjct  657  IHRDLKSSNILLDEEMNPKISDFGLARIFGGNETAANTNRVVGT  700



>ref|XP_006370399.1| hypothetical protein POPTR_0001s42260g [Populus trichocarpa]
 gb|ERP66968.1| hypothetical protein POPTR_0001s42260g [Populus trichocarpa]
Length=781

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LD++MNPKISDFG+AR+ G NETGANT RVVGT
Sbjct  586  IHRDLKPSNILLDDEMNPKISDFGMARSFGGNETGANTKRVVGT  629



>ref|XP_010448742.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 isoform 
X1 [Camelina sativa]
Length=654

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKI+DFG+AR  G++++GANTN++VGT
Sbjct  459  IHRDLKASNILLDADMNPKIADFGMARIFGMDQSGANTNKIVGT  502



>gb|EYU32850.1| hypothetical protein MIMGU_mgv1a001388mg [Erythranthe guttata]
Length=826

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR+ G NE  ANT+RVVGT
Sbjct  617  IHRDLKASNILLDTDMNPKISDFGLARSFGGNEIEANTSRVVGT  660



>gb|EYU32849.1| hypothetical protein MIMGU_mgv1a001388mg [Erythranthe guttata]
Length=827

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR+ G NE  ANT+RVVGT
Sbjct  617  IHRDLKASNILLDTDMNPKISDFGLARSFGGNEIEANTSRVVGT  660



>ref|XP_004153962.1| PREDICTED: cysteine-rich receptor-like protein kinase 25-like, 
partial [Cucumis sativus]
Length=633

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD +MNPKISDFGLAR + +++T  NTNR+VGT         +HGNF
Sbjct  433  IHRDLKASNILLDKNMNPKISDFGLARIVQVDQTQGNTNRIVGTYGYMAPEYAMHGNF  490



>ref|XP_010433928.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 [Camelina 
sativa]
Length=649

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKI+DFG+AR  G++++GANTN++VGT
Sbjct  456  IHRDLKASNILLDADMNPKIADFGMARIFGMDQSGANTNKIVGT  499



>ref|XP_008384459.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=658

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD DM+PKISDFG+AR  G+++T ANTNR+VGT         +HG F
Sbjct  455  IHRDLKASNILLDGDMHPKISDFGMARIFGVDQTQANTNRIVGTYGYMSXEYAMHGQF  512



>ref|XP_010448743.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 isoform 
X2 [Camelina sativa]
Length=652

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKI+DFG+AR  G++++GANTN++VGT
Sbjct  457  IHRDLKASNILLDADMNPKIADFGMARIFGMDQSGANTNKIVGT  500



>ref|XP_009357384.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=663

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD DM+PKISDFG+AR  G+++T ANTNR+VGT         +HG F
Sbjct  460  IHRDLKASNILLDGDMHPKISDFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGQF  517



>ref|XP_008345332.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD DM+PKISDFG+AR  G+++T ANTNR+VGT         +HG F
Sbjct  461  IHRDLKASNILLDGDMHPKISDFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGQF  518



>ref|XP_009340920.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=676

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD DM+PKISDFG+AR  G+++T ANTNR+VGT         +HG F
Sbjct  473  IHRDLKASNILLDGDMHPKISDFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGQF  530



>ref|XP_007024153.1| Serine/threonine-protein kinase PBS1, putative [Theobroma cacao]
 gb|EOY26775.1| Serine/threonine-protein kinase PBS1, putative [Theobroma cacao]
Length=789

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFG+AR  GLNE+ ANT RVVGT
Sbjct  593  IHRDLKAGNILLDDEMNPKISDFGMARIFGLNESEANTKRVVGT  636



>ref|XP_009417412.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-7 
[Musa acuminata subsp. malaccensis]
Length=1630

 Score = 67.4 bits (163),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD D+NPKISDFG+AR  G NET ANTNRVVGT
Sbjct  644  IHRDLKASNILLDADVNPKISDFGMARIFGSNETQANTNRVVGT  687


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 32/44 (73%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRDLKA   +LD++MNPKISDFG AR     +T  NT RVVGT
Sbjct  1442  IHRDLKASNILLDHEMNPKISDFGTARTFRAGQTEGNTKRVVGT  1485



>ref|XP_007214501.1| hypothetical protein PRUPE_ppa018069mg [Prunus persica]
 gb|EMJ15700.1| hypothetical protein PRUPE_ppa018069mg [Prunus persica]
Length=731

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARN-IGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR  +G ++TG NTNRVVGT
Sbjct  537  IHRDLKASNVLLDNEMNPKISDFGLARKLVGGDQTGGNTNRVVGT  581



>gb|KDO75662.1| hypothetical protein CISIN_1g0030452mg, partial [Citrus sinensis]
Length=301

 Score = 65.1 bits (157),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFG+AR  G N+  ANTNRVVGT
Sbjct  106  IHRDLKASNILLDEDMNPKISDFGMARIFGFNQNEANTNRVVGT  149



>ref|XP_002317550.1| hypothetical protein POPTR_0011s13250g [Populus trichocarpa]
 gb|EEE98162.1| hypothetical protein POPTR_0011s13250g [Populus trichocarpa]
Length=775

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 39/44 (89%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFGLAR++G +ET ANTN+VVGT
Sbjct  581  IHRDLKASNILLDDEMNPKISDFGLARSVGGSETEANTNKVVGT  624



>ref|XP_010065691.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 [Eucalyptus grandis]
Length=254

 Score = 64.7 bits (156),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+MNPKISDFGLAR+ G NE+ ANT RVVGT 
Sbjct  136  IHRDLKAENILLDNEMNPKISDFGLARSFGGNESEANTKRVVGTF  180



>ref|XP_011002460.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD1-1 [Populus euphratica]
Length=833

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LD++MNPKISDFG+AR+ G NETGANT RVVGT
Sbjct  638  IHRDLKPSNILLDDEMNPKISDFGMARSFGGNETGANTKRVVGT  681



>ref|XP_010247617.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Nelumbo 
nucifera]
Length=690

 Score = 67.0 bits (162),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD DMNPKISDFG+AR  G++++ ANTNR+VGT         +HG F
Sbjct  481  IHRDLKASNILLDGDMNPKISDFGMARIFGVDQSQANTNRIVGTYGYMSPEYAMHGQF  538



>ref|XP_006356864.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=862

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LD DMNPKISDFG+AR++  NETGANT+ VVGT HG
Sbjct  670  IHRDLKASNILLDADMNPKISDFGIARSVIGNETGANTHHVVGT-HG  715



>ref|XP_006362969.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Solanum tuberosum]
Length=871

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD +MNPKISDFG+AR+ G NETG NTNRVVGT
Sbjct  675  IHRDLKASNVLLDFEMNPKISDFGMARSFGGNETGDNTNRVVGT  718



>emb|CDY65509.1| BnaA03g58780D [Brassica napus]
Length=825

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+DMNPKISDFGLAR +G +ET ANT RVVGT
Sbjct  629  IHRDLKASNVLLDSDMNPKISDFGLARTLGGDETEANTTRVVGT  672



>ref|XP_006452103.1| hypothetical protein CICLE_v10010341mg [Citrus clementina]
 gb|ESR65343.1| hypothetical protein CICLE_v10010341mg [Citrus clementina]
Length=776

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            +HRDLKA   +LD DMNPKISDFGLAR  G +ET  NTNRVVGT
Sbjct  581  VHRDLKASNVLLDQDMNPKISDFGLARAFGGDETEGNTNRVVGT  624



>ref|XP_010040818.1| PREDICTED: uncharacterized protein LOC104429679 [Eucalyptus grandis]
Length=1667

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             +HRDLKA   +LD+DMNPKISDFGLA+  G NE+ ANTNR+VGT
Sbjct  1472  VHRDLKASNILLDSDMNPKISDFGLAKMFGGNESEANTNRIVGT  1515


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            +HRDLKA   +LD++MNPKI+DFGLA+  G NE+ ANTNR+VGT
Sbjct  675  VHRDLKASNILLDSEMNPKIADFGLAKIFGGNESEANTNRIVGT  718



>gb|EYU19178.1| hypothetical protein MIMGU_mgv1a020642mg [Erythranthe guttata]
Length=820

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LD++MNPKISDFG+AR+ G NET ANTNRVVGT
Sbjct  624  IHRDLKVSNILLDSEMNPKISDFGMARSFGGNETEANTNRVVGT  667



>gb|KCW63320.1| hypothetical protein EUGRSUZ_G00951 [Eucalyptus grandis]
Length=773

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR+ G NE+ ANT RVVGT
Sbjct  577  IHRDLKAENILLDNEMNPKISDFGLARSFGGNESEANTKRVVGT  620



>ref|XP_008379572.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like serine/threonine-protein 
kinase SD1-8 [Malus domestica]
Length=834

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL---------HGNFIE  150
            IHRDLKA   +LD  +NPKISDFG+AR  G+N+T ANTNRVVGT          +G+F E
Sbjct  638  IHRDLKASNILLDEALNPKISDFGMARIFGINQTEANTNRVVGTYGYMSPEYARYGHFSE  697

Query  151  MVD  159
             +D
Sbjct  698  KLD  700



>ref|NP_001044457.1| Os01g0783800 [Oryza sativa Japonica Group]
 dbj|BAD53292.1| putative serine/threonine kinase [Oryza sativa Japonica Group]
 dbj|BAF06371.1| Os01g0783800 [Oryza sativa Japonica Group]
Length=827

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR  G  ET ANTNRVVGT
Sbjct  634  IHRDLKASNILLDIDMNPKISDFGLARIFGSKETQANTNRVVGT  677



>gb|KDO74372.1| hypothetical protein CISIN_1g0052361mg, partial [Citrus sinensis]
Length=695

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR  G +ET  NTNRVVGT
Sbjct  500  IHRDLKASNVLLDQDMNPKISDFGLARAFGGDETEGNTNRVVGT  543



>ref|XP_010320283.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Solanum lycopersicum]
Length=818

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LD DMNPKISDFG+AR++  NETGANT+ VVGT HG
Sbjct  626  IHRDLKASNILLDADMNPKISDFGIARSVIGNETGANTHHVVGT-HG  671



>ref|XP_003632790.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 [Vitis vinifera]
Length=789

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR  G +E  ANTNRVVGT
Sbjct  592  IHRDLKASNILLDNEMNPKISDFGMARIFGQDECEANTNRVVGT  635



>ref|XP_002518553.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43940.1| ATP binding protein, putative [Ricinus communis]
Length=674

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLK +  +LD DMNPKISDFG+AR  G+++T  NTNR+VGT         +HG+F
Sbjct  470  IHRDLKVSNILLDKDMNPKISDFGMARIFGVDQTQGNTNRIVGTYGYMSPEYAMHGHF  527



>ref|XP_006452105.1| hypothetical protein CICLE_v10007572mg [Citrus clementina]
 gb|ESR65345.1| hypothetical protein CICLE_v10007572mg [Citrus clementina]
Length=740

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR  G +ET  NTNRVVGT
Sbjct  545  IHRDLKASNVLLDQDMNPKISDFGLARAFGGDETEGNTNRVVGT  588



>ref|XP_006413094.1| hypothetical protein EUTSA_v10027068mg [Eutrema salsugineum]
 gb|ESQ54547.1| hypothetical protein EUTSA_v10027068mg [Eutrema salsugineum]
Length=826

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+DMNPKISDFGLAR +G +ET ANT RVVGT
Sbjct  630  IHRDLKASNVLLDSDMNPKISDFGLARTLGGDETEANTTRVVGT  673



>ref|XP_002317540.2| hypothetical protein POPTR_0011s13130g [Populus trichocarpa]
 gb|EEE98152.2| hypothetical protein POPTR_0011s13130g [Populus trichocarpa]
Length=666

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD +MNPKISDFGLAR++G NET ANTN+VVGT
Sbjct  469  IHRDLKASNVLLDYEMNPKISDFGLARSLGGNETEANTNKVVGT  512



>ref|XP_010320284.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Solanum lycopersicum]
Length=794

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LD DMNPKISDFG+AR++  NETGANT+ VVGT HG
Sbjct  602  IHRDLKASNILLDADMNPKISDFGIARSVIGNETGANTHHVVGT-HG  647



>gb|EEE55503.1| hypothetical protein OsJ_03699 [Oryza sativa Japonica Group]
Length=1568

 Score = 67.0 bits (162),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR  G  ET ANTNRVVGT
Sbjct  711  IHRDLKASNILLDIDMNPKISDFGLARIFGSKETQANTNRVVGT  754


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRDLKA   +LD DMNPKISDFG+AR  G  ET ANTNRVVGT
Sbjct  1396  IHRDLKASNILLDIDMNPKISDFGMARIFGSKETEANTNRVVGT  1439



>gb|KDP38982.1| hypothetical protein JCGZ_00739 [Jatropha curcas]
Length=800

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR+ G +ET ANTN+VVGT
Sbjct  605  IHRDLKASNILLDNEMNPKISDFGLARSFGGSETEANTNKVVGT  648



>ref|XP_009357102.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Pyrus x bretschneideri]
Length=834

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL---------HGNFIE  150
            IHRDLKA   +LD  +NPKISDFG+AR  G+N+T ANTNRVVGT          +G+F E
Sbjct  638  IHRDLKASNILLDGALNPKISDFGMARIFGINQTEANTNRVVGTYGYMSPEYARYGHFSE  697

Query  151  MVD  159
             +D
Sbjct  698  KLD  700



>ref|XP_010267800.1| PREDICTED: putative receptor-like protein kinase At4g00960 isoform 
X1 [Nelumbo nucifera]
Length=650

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LD DMNPKISDFG+AR  G++++ ANTNRVVGT 
Sbjct  456  IHRDLKASNVLLDGDMNPKISDFGMARIFGMDQSQANTNRVVGTF  500



>ref|XP_008358736.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Malus 
domestica]
Length=664

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD DM+PKISDFG+AR  G+++T ANTNR+VGT         +HG F
Sbjct  461  IHRDLKASNILLDGDMHPKISDFGMARIFGVDQTQANTNRIVGTYGYMSPEYAMHGXF  518



>ref|XP_011002474.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=735

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 34/44 (77%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDNDMNPKISDFGLAR+ G NET A T+RVVGT
Sbjct  629  IHRDLKASNILLDNDMNPKISDFGLARSFGENETEAITSRVVGT  672



>gb|KDO37968.1| hypothetical protein CISIN_1g041793mg, partial [Citrus sinensis]
Length=224

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR  G +E   NTNRV+GT
Sbjct  35   IHRDLKASNVLLDQDMNPKISDFGLARAFGGDEIEGNTNRVIGT  78



>ref|XP_010247751.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase RKS1 isoform X1 [Nelumbo nucifera]
Length=849

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+DMNPKISDFG+AR  G ++T ANTNRVVGT
Sbjct  651  IHRDLKASNILLDSDMNPKISDFGMARIFGRSQTEANTNRVVGT  694



>gb|KCW67068.1| hypothetical protein EUGRSUZ_F008421, partial [Eucalyptus grandis]
Length=287

 Score = 64.7 bits (156),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR  G +ET  NTNRVVGT
Sbjct  97   IHRDLKASNVLLDNEMNPKISDFGMARIFGGDETEGNTNRVVGT  140



>ref|XP_010059683.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
35 [Eucalyptus grandis]
Length=703

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 43/63 (68%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNFIE  150
            IHRDLKA   +LDN+MNPKISDFG+AR  G+++T A+T R+VGT         +HG F +
Sbjct  497  IHRDLKASNILLDNNMNPKISDFGMARIFGVDQTNASTRRIVGTYGYMSPEYAMHGQFSQ  556

Query  151  MVD  159
              D
Sbjct  557  KSD  559



>ref|XP_011015607.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X5 [Populus euphratica]
Length=691

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+D+NPKISDFGLAR+ G NET ANTN+V GT
Sbjct  631  IHRDLKASNILLDDDLNPKISDFGLARSFGGNETEANTNKVAGT  674



>ref|XP_004238057.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Solanum lycopersicum]
Length=799

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LD DMNPKISDFG+AR++  NETGANT+ VVGT HG
Sbjct  608  IHRDLKASNILLDADMNPKISDFGIARSVVGNETGANTHHVVGT-HG  653



>ref|XP_010686952.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Beta 
vulgaris subsp. vulgaris]
Length=665

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 40/58 (69%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD DMNPKISDFGLAR   +++T ANTNRVVGT         +HG F
Sbjct  465  IHRDLKAGNVLLDEDMNPKISDFGLARIFEVDQTQANTNRVVGTYGYMSPEYAMHGKF  522



>ref|XP_010647533.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Vitis vinifera]
Length=824

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+M+PKISDFGLAR+ G NET ANT RV GTL
Sbjct  629  IHRDLKAENVLLDNEMSPKISDFGLARSFGGNETEANTTRVAGTL  673



>ref|XP_006370397.1| hypothetical protein POPTR_0001s42230g [Populus trichocarpa]
 gb|ERP66966.1| hypothetical protein POPTR_0001s42230g [Populus trichocarpa]
Length=777

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR  G NET ANTN+V GT
Sbjct  582  IHRDLKASNVLLDNEMNPKISDFGLARCFGGNETEANTNKVAGT  625



>ref|XP_006356865.1| PREDICTED: uncharacterized protein LOC102592491 [Solanum tuberosum]
Length=1670

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LD DMNPKISDFG+AR++  NETGANT+ VVGT HG
Sbjct  608  IHRDLKASNILLDADMNPKISDFGIARSVVGNETGANTHHVVGT-HG  653


 Score = 67.0 bits (162),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
             IHRDLKA   +LD DMNPKISDFG+AR++  NETGANT+ VVGT HG
Sbjct  1479  IHRDLKASNILLDADMNPKISDFGIARSVVGNETGANTHHVVGT-HG  1524



>ref|XP_007022738.1| S-locus lectin protein kinase family protein [Theobroma cacao]
 gb|EOY14263.1| S-locus lectin protein kinase family protein [Theobroma cacao]
Length=425

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD +MNPKISDFGLAR+ G +ET ANTNRVVGT
Sbjct  327  IHRDLKAGNVLLDYEMNPKISDFGLARSFGGDETEANTNRVVGT  370



>gb|KFK22701.1| hypothetical protein AALP_AAs67984U000300 [Arabis alpina]
Length=409

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/58 (55%), Positives = 42/58 (72%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD DMNPKI+DFG+AR  G++++GANT+R+VGT         +HG F
Sbjct  203  IHRDLKASNILLDADMNPKIADFGMARIFGMDQSGANTSRIVGTYGYMSPEYMIHGQF  260



>ref|XP_004231576.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Solanum lycopersicum]
Length=842

 Score = 66.6 bits (161),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LD DMNPKISDFG+AR+ G NETGA T RVVGT
Sbjct  644  IHRDLKPSNVLLDTDMNPKISDFGMARSFGGNETGAMTKRVVGT  687



>ref|XP_010448731.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 isoform 
X1 [Camelina sativa]
Length=672

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKI+DFG+AR  G++++GANTNR+VGT
Sbjct  467  IHRDLKASNVLLDADMNPKIADFGMARIFGMDQSGANTNRIVGT  510



>ref|XP_004158053.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonase-like [Cucumis 
sativus]
Length=2882

 Score = 67.0 bits (162),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 33/58 (57%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD +MNPKISDFGLAR + +++T  NTNR+VGT         +HGNF
Sbjct  440  IHRDLKASNILLDKNMNPKISDFGLARIVQVDQTQGNTNRIVGTYGYMAPEYAMHGNF  497


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 39/63 (62%), Gaps = 10/63 (16%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNFIE  150
             IHRDLKA   +LD DMNPKISDFG+AR  G NE  ANT RVVGT         + G F E
Sbjct  2686  IHRDLKASNILLDKDMNPKISDFGMARIFGSNEVEANTIRVVGTYGYMSPEYAMQGQFSE  2745

Query  151   MVD  159
               D
Sbjct  2746  KSD  2748



>ref|XP_010026110.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Eucalyptus grandis]
Length=1028

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRD+KA   +LDN+MNPKISDFGLA++   NET ANTNRVVGT
Sbjct  625  IHRDVKASNVLLDNEMNPKISDFGLAKSFTGNETRANTNRVVGT  668



>emb|CBI20430.3| unnamed protein product [Vitis vinifera]
Length=820

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+M+PKISDFG+AR+ G NET ANT RV GTL
Sbjct  471  IHRDLKAENVLLDNEMSPKISDFGIARSFGGNETEANTTRVAGTL  515



>gb|KDO74365.1| hypothetical protein CISIN_1g043285mg [Citrus sinensis]
Length=414

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR  G +ET  NTNRVVGT
Sbjct  219  IHRDLKASNVLLDQDMNPKISDFGLARAFGGDETEGNTNRVVGT  262



>ref|XP_006452072.1| hypothetical protein CICLE_v10007451mg [Citrus clementina]
 gb|ESR65312.1| hypothetical protein CICLE_v10007451mg [Citrus clementina]
Length=836

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN MNPKISDFGLAR+ G+++T ANT RVVGT
Sbjct  641  IHRDLKASNVLLDNTMNPKISDFGLARSFGVDQTEANTKRVVGT  684



>ref|XP_006475244.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like [Citrus sinensis]
Length=841

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN MNPKISDFGLAR+ G+++T ANT RVVGT
Sbjct  646  IHRDLKASNVLLDNTMNPKISDFGLARSFGVDQTEANTKRVVGT  689



>ref|XP_006452097.1| hypothetical protein CICLE_v10010721mg [Citrus clementina]
 gb|ESR65337.1| hypothetical protein CICLE_v10010721mg [Citrus clementina]
Length=284

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+DMNPKISDFGLAR  G +ET  NT RVVGT
Sbjct  110  IHRDLKASNVLLDHDMNPKISDFGLARAFGGDETEGNTYRVVGT  153



>emb|CBI20459.3| unnamed protein product [Vitis vinifera]
Length=569

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LDN+M+PKISDFG+AR+ G NET ANT RV GTL
Sbjct  381  IHRDLKAENILLDNEMSPKISDFGIARSFGGNETEANTTRVAGTL  425



>ref|XP_010049703.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Eucalyptus grandis]
Length=803

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFG+AR  G NE+ ANTNRVVGT
Sbjct  609  IHRDLKASNILLDDNMNPKISDFGMARIFGQNESRANTNRVVGT  652



>dbj|BAD53293.1| putative serine/threonine kinase [Oryza sativa Japonica Group]
 dbj|BAD53356.1| putative serine/threonine kinase [Oryza sativa Japonica Group]
Length=809

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFG+AR  G  ET ANTNRVVGT
Sbjct  616  IHRDLKASNILLDIDMNPKISDFGMARIFGSKETEANTNRVVGT  659



>ref|XP_006413566.1| hypothetical protein EUTSA_v10024631mg [Eutrema salsugineum]
 gb|ESQ55019.1| hypothetical protein EUTSA_v10024631mg [Eutrema salsugineum]
Length=657

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPK++DFG+AR  G+++T ANTNRVVGT
Sbjct  457  IHRDLKAGNVLLDADMNPKVADFGMARIFGMDQTEANTNRVVGT  500



>gb|KDO74358.1| hypothetical protein CISIN_1g004521mg [Citrus sinensis]
Length=617

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
            IHRDLKA   +LD DMNPKISDFGL R  G +ET  NTNRVVGT  G
Sbjct  564  IHRDLKASNVLLDQDMNPKISDFGLVRTFGGDETEGNTNRVVGTYCG  610



>ref|XP_010049702.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X1 [Eucalyptus grandis]
Length=804

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFG+AR  G NE+ ANTNRVVGT
Sbjct  610  IHRDLKASNILLDDNMNPKISDFGMARIFGQNESRANTNRVVGT  653



>ref|XP_011030927.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Populus euphratica]
Length=824

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFGLAR+ G NET ANTN+VVGT
Sbjct  629  IHRDLKASNVLLDHEMNPKISDFGLARSFGGNETEANTNKVVGT  672



>ref|XP_010439198.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 isoform 
X1 [Camelina sativa]
Length=672

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            +HRDLKA   +LD DMNPKI+DFG+AR  G++++GANTNR+VGT
Sbjct  467  VHRDLKASNVLLDADMNPKIADFGMARIFGMDQSGANTNRIVGT  510



>ref|XP_002317548.1| hypothetical protein POPTR_0011s13230g [Populus trichocarpa]
 gb|EEE98160.1| hypothetical protein POPTR_0011s13230g [Populus trichocarpa]
Length=777

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFGLAR+ G NET ANTN+V+GT
Sbjct  582  IHRDLKASNVLLDHEMNPKISDFGLARSFGGNETEANTNKVMGT  625



>ref|XP_007214023.1| hypothetical protein PRUPE_ppa016527mg [Prunus persica]
 gb|EMJ15222.1| hypothetical protein PRUPE_ppa016527mg [Prunus persica]
Length=859

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARN-IGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR  IG +++G NTNRVVGT
Sbjct  665  IHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGT  709



>ref|XP_011002477.1| PREDICTED: uncharacterized protein LOC105109453 [Populus euphratica]
Length=1802

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRDLKA   +LD+D+NPKISDFGLAR+ G NET ANTN+V GT
Sbjct  1607  IHRDLKASNILLDDDLNPKISDFGLARSFGGNETEANTNKVAGT  1650


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD ++NPKISDFGLAR+ G NE  ANTN+VVGT
Sbjct  634  IHRDLKASNILLDYELNPKISDFGLARSFGGNEIEANTNKVVGT  677



>emb|CBI18331.3| unnamed protein product [Vitis vinifera]
Length=657

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+D+NPKISDFG+AR  G N + ANTNR+VGT
Sbjct  453  IHRDLKASNILLDHDLNPKISDFGMARTFGRNASEANTNRIVGT  496



>ref|XP_006449174.1| hypothetical protein CICLE_v10014386mg [Citrus clementina]
 gb|ESR62414.1| hypothetical protein CICLE_v10014386mg [Citrus clementina]
Length=748

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFG+AR  G N+  ANTNRVVGT
Sbjct  553  IHRDLKASNILLDEDMNPKISDFGMARIFGFNQNEANTNRVVGT  596



>ref|XP_011015604.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Populus euphratica]
Length=826

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+D+NPKISDFGLAR+ G NET ANTN+V GT
Sbjct  631  IHRDLKASNILLDDDLNPKISDFGLARSFGGNETEANTNKVAGT  674



>ref|XP_007213637.1| hypothetical protein PRUPE_ppa001795mg [Prunus persica]
 gb|EMJ14836.1| hypothetical protein PRUPE_ppa001795mg [Prunus persica]
Length=763

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARN-IGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR  IG +++G NTNRVVGT
Sbjct  568  IHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGT  612



>ref|XP_009109107.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X3 [Brassica rapa]
Length=658

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKI+DFG+AR  GL++T  NTNR+VGT
Sbjct  469  IHRDLKASNILLDTDMNPKIADFGMARIFGLDQTQQNTNRIVGT  512



>ref|XP_009109092.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X1 [Brassica rapa]
Length=659

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKI+DFG+AR  GL++T  NTNR+VGT
Sbjct  470  IHRDLKASNILLDTDMNPKIADFGMARIFGLDQTQQNTNRIVGT  513



>emb|CDY39507.1| BnaA01g24810D [Brassica napus]
Length=660

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKI+DFG+AR  GL++T  NTNR+VGT
Sbjct  471  IHRDLKASNILLDTDMNPKIADFGMARIFGLDQTQQNTNRIVGT  514



>ref|XP_010041722.1| PREDICTED: cysteine-rich receptor-like protein kinase 26, partial 
[Eucalyptus grandis]
Length=1020

 Score = 66.6 bits (161),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD+DMNPKISDFG+AR   L++T A TNR+VGT         +HGNF
Sbjct  811  IHRDLKASNILLDSDMNPKISDFGMARLFELDQTQAETNRIVGTYGYMAPEYVMHGNF  868


 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            ++ DLKA   +LD+DM+ KI DFG+AR   L++T A TNRVVGT         +HGNF
Sbjct  263  VYMDLKASNILLDSDMHAKILDFGMARLFELDQTQAETNRVVGTYGYMALEYAMHGNF  320



>gb|KCW81429.1| hypothetical protein EUGRSUZ_C02809 [Eucalyptus grandis]
Length=281

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 36/63 (57%), Positives = 41/63 (65%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNFIE  150
            IHRDLK +  +LD+DMNPKISDFG+AR  G NET A T RVVGT         + G F E
Sbjct  90   IHRDLKTSNILLDSDMNPKISDFGMARIFGENETQAKTIRVVGTCGYMSPEYAMDGLFSE  149

Query  151  MVD  159
            M D
Sbjct  150  MSD  152



>ref|XP_007214794.1| hypothetical protein PRUPE_ppa014934mg [Prunus persica]
 gb|EMJ15993.1| hypothetical protein PRUPE_ppa014934mg [Prunus persica]
Length=797

 Score = 66.2 bits (160),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARN-IGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR  IG +++G NTNRVVGT
Sbjct  602  IHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGT  646



>emb|CDX92824.1| BnaC07g40820D [Brassica napus]
Length=825

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+DMNPK+SDFGLAR +G +ET ANT RVVGT
Sbjct  629  IHRDLKASNVLLDSDMNPKVSDFGLARTLGGDETEANTTRVVGT  672



>gb|KCW82456.1| hypothetical protein EUGRSUZ_C03848 [Eucalyptus grandis]
Length=656

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFG+AR  G NE+ ANTNRVVGT
Sbjct  462  IHRDLKASNILLDDNMNPKISDFGMARIFGQNESRANTNRVVGT  505



>ref|XP_009109099.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Brassica rapa]
Length=658

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKI+DFG+AR  GL++T  NTNR+VGT
Sbjct  469  IHRDLKASNILLDTDMNPKIADFGMARIFGLDQTQQNTNRIVGT  512



>ref|XP_002317549.1| hypothetical protein POPTR_0011s13240g [Populus trichocarpa]
 gb|EEE98161.1| hypothetical protein POPTR_0011s13240g [Populus trichocarpa]
Length=780

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD++MNPKISDFGLAR+ G NET ANTN+VVGT
Sbjct  585  IHRDLKASNVLLDHEMNPKISDFGLARSFGGNETEANTNKVVGT  628



>ref|XP_008226746.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Prunus mume]
Length=813

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARN-IGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR  IG +++G NTNRVVGT
Sbjct  620  IHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGT  664



>ref|XP_006475280.1| PREDICTED: uncharacterized protein LOC102629172 [Citrus sinensis]
Length=1625

 Score = 66.6 bits (161),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR  G +ET  NTNRV+GT
Sbjct  617  IHRDLKASNVLLDQDMNPKISDFGLARAFGGDETEGNTNRVIGT  660


 Score = 55.8 bits (133),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 1/44 (2%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
             IHRDLKA   +LD++MNPKISDFGLAR    +E   +T RVVGT
Sbjct  1430  IHRDLKASNVLLDHEMNPKISDFGLARTFVGDEIEGSTKRVVGT  1473



>ref|XP_011015606.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X4 [Populus euphratica]
Length=822

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+D+NPKISDFGLAR+ G NET ANTN+V GT
Sbjct  627  IHRDLKASNILLDDDLNPKISDFGLARSFGGNETEANTNKVAGT  670



>gb|KCW74848.1| hypothetical protein EUGRSUZ_E03585, partial [Eucalyptus grandis]
Length=642

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD+DMNPKISDFG+AR   L++T A TNR+VGT         +HGNF
Sbjct  460  IHRDLKASNILLDSDMNPKISDFGMARLFELDQTQAETNRIVGTYGYMAPEYVMHGNF  517



>ref|XP_011015605.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X3 [Populus euphratica]
Length=824

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+D+NPKISDFGLAR+ G NET ANTN+V GT
Sbjct  629  IHRDLKASNILLDDDLNPKISDFGLARSFGGNETEANTNKVAGT  672



>gb|KCW74373.1| hypothetical protein EUGRSUZ_E03054 [Eucalyptus grandis]
Length=662

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD+DMNPKISDFG+AR   L++T A TNRVVGT         +HGNF
Sbjct  452  IHRDLKASNILLDSDMNPKISDFGMARLFELDQTHAETNRVVGTYGYMAPEYAMHGNF  509



>ref|XP_006452106.1| hypothetical protein CICLE_v10007528mg [Citrus clementina]
 gb|ESR65346.1| hypothetical protein CICLE_v10007528mg [Citrus clementina]
Length=769

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFGLAR  G +ET  NTNRV+GT
Sbjct  574  IHRDLKASNVLLDQDMNPKISDFGLARAFGGDETEGNTNRVIGT  617



>ref|XP_010254130.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X1 [Nelumbo nucifera]
Length=824

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+++NPKISDFG+AR  G NE+ ANTNRVVGT
Sbjct  627  IHRDLKASNILLDDELNPKISDFGMARIFGRNESEANTNRVVGT  670



>ref|XP_010267801.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 isoform 
X2 [Nelumbo nucifera]
Length=608

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/45 (69%), Positives = 37/45 (82%), Gaps = 1/45 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL  132
            IHRDLKA   +LD DMNPKISDFG+AR  G++++ ANTNRVVGT 
Sbjct  414  IHRDLKASNVLLDGDMNPKISDFGMARIFGMDQSQANTNRVVGTF  458



>ref|XP_008779560.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g11330 [Phoenix dactylifera]
Length=686

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRD+KA   +LD DMNPKISDFGLAR    NET ANTNR+VGT
Sbjct  490  IHRDMKASNILLDADMNPKISDFGLARIFASNETQANTNRIVGT  533



>ref|XP_002268342.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 isoform X1 [Vitis vinifera]
Length=795

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+D+NPKISDFG+AR  G N + ANTNR+VGT
Sbjct  598  IHRDLKASNILLDHDLNPKISDFGMARTFGRNASEANTNRIVGT  641



>ref|XP_006287218.1| hypothetical protein CARUB_v10000395mg [Capsella rubella]
 gb|EOA20116.1| hypothetical protein CARUB_v10000395mg [Capsella rubella]
Length=669

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD+DMNPKI+DFG+AR  G+ +TGANT+++ GT         +HG F
Sbjct  467  IHRDLKASNILLDDDMNPKIADFGMARIFGIEQTGANTSKIAGTFGYMAPEYVMHGQF  524



>ref|XP_010064357.1| PREDICTED: receptor-like serine/threonine-protein kinase SD1-8 
[Eucalyptus grandis]
Length=776

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFG+AR  G +ET  NTNRVVGT
Sbjct  586  IHRDLKASNVLLDNEMNPKISDFGMARIFGGDETEGNTNRVVGT  629



>ref|XP_008226741.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 [Prunus mume]
Length=668

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNI-GLNETGANTNRVVGT  129
            IHRDLK +  +LDN+MNPKISDFGLAR + G N+TG NTNRVVGT
Sbjct  624  IHRDLKVSNVLLDNEMNPKISDFGLARTLTGGNQTGGNTNRVVGT  668



>ref|XP_010254131.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Nelumbo nucifera]
Length=823

 Score = 66.2 bits (160),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+++NPKISDFG+AR  G NE+ ANTNRVVGT
Sbjct  626  IHRDLKASNILLDDELNPKISDFGMARIFGRNESEANTNRVVGT  669



>ref|XP_010448732.1| PREDICTED: cysteine-rich receptor-like protein kinase 11 isoform 
X2 [Camelina sativa]
Length=648

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 38/44 (86%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKI+DFG+AR  G++++GANTNR+VGT
Sbjct  443  IHRDLKASNVLLDADMNPKIADFGMARIFGMDQSGANTNRIVGT  486



>gb|KCW44132.1| hypothetical protein EUGRSUZ_L02458 [Eucalyptus grandis]
Length=539

 Score = 65.9 bits (159),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD+DMNPKISDFG+AR   L++T A TNR+VGT         +HGNF
Sbjct  330  IHRDLKASNILLDSDMNPKISDFGMARLFELDQTQAETNRIVGTYGYMAPEYVMHGNF  387



>ref|XP_002867726.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43985.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=539

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKAR-FMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKISDFG+AR  G+++T ANT R+VGT
Sbjct  495  IHRDLKAENILLDGDMNPKISDFGMARIFGMDQTRANTRRIVGT  538



>gb|KCW74377.1| hypothetical protein EUGRSUZ_E03056 [Eucalyptus grandis]
Length=666

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD+DMNPKISDFG+AR   L++T A TNR+VGT         +HGNF
Sbjct  457  IHRDLKASNILLDSDMNPKISDFGMARLFELDQTQAETNRIVGTYGYMAPEYAMHGNF  514



>gb|KCW74376.1| hypothetical protein EUGRSUZ_E030551, partial [Eucalyptus grandis]
Length=298

 Score = 64.3 bits (155),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD+DMNPKISDFG+AR   L++T A TNRVVGT         +HGNF
Sbjct  89   IHRDLKASNILLDSDMNPKISDFGMARLFELDQTQAETNRVVGTYGYMAPEYAMHGNF  146



>ref|XP_008348276.1| PREDICTED: LOW QUALITY PROTEIN: G-type lectin S-receptor-like 
serine/threonine-protein kinase B120 [Malus domestica]
Length=257

 Score = 63.9 bits (154),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 35/63 (56%), Positives = 43/63 (68%), Gaps = 10/63 (16%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTL---------HGNFIE  150
            IHRDLKA   +LD  +NPKISDFG+AR  G+N+T ANTNRVVGT          +G+F E
Sbjct  156  IHRDLKASNILLDGXLNPKISDFGMARIFGINQTEANTNRVVGTYGYMSPEYARYGHFSE  215

Query  151  MVD  159
             +D
Sbjct  216  KLD  218



>ref|XP_010268932.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g03230 [Nelumbo nucifera]
Length=487

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+DM PKISDFG+AR  G NE+ ANTNR+VGT
Sbjct  292  IHRDLKASNILLDSDMTPKISDFGMARIFGGNESQANTNRIVGT  335



>emb|CBI39954.3| unnamed protein product [Vitis vinifera]
Length=249

 Score = 63.5 bits (153),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNP ISDFG+AR  G+++T  NTNRVVGT
Sbjct  206  IHRDLKAGNVLLDGDMNPNISDFGMARIFGVDQTQGNTNRVVGT  249



>ref|XP_006356900.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X2 [Solanum tuberosum]
Length=817

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LD DMNPKISDFG+AR+ G NETGA T RVVGT
Sbjct  621  IHRDLKPSNVLLDTDMNPKISDFGMARSFGGNETGAMTKRVVGT  664



>ref|XP_010057675.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
Length=669

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD+DMNPKISDFG+AR   L++T A TNR+VGT         +HGNF
Sbjct  460  IHRDLKASNILLDSDMNPKISDFGMARLFELDQTQAETNRIVGTYGYMAPEYVMHGNF  517



>ref|XP_010652595.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At1g67520 [Vitis vinifera]
Length=789

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+D+NPKISDFG+AR  G N + ANTNR+VGT
Sbjct  592  IHRDLKASNILLDHDLNPKISDFGMARTFGRNASEANTNRIVGT  635



>ref|XP_006356899.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290-like isoform X1 [Solanum tuberosum]
Length=819

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLK-ARFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLK +  +LD DMNPKISDFG+AR+ G NETGA T RVVGT
Sbjct  623  IHRDLKPSNVLLDTDMNPKISDFGMARSFGGNETGAMTKRVVGT  666



>ref|XP_009357378.1| PREDICTED: cysteine-rich receptor-like protein kinase 10 [Pyrus 
x bretschneideri]
Length=215

 Score = 63.2 bits (152),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/58 (53%), Positives = 42/58 (72%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD +M+PKISDFG+AR  G+++T A+TNR+VGT         +HG+F
Sbjct  12   IHRDLKASNILLDGEMHPKISDFGMARIFGVDQTQASTNRIVGTYGYMSPEYAMHGHF  69



>emb|CAN64778.1| hypothetical protein VITISV_043229 [Vitis vinifera]
Length=1091

 Score = 66.2 bits (160),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+D+NPKISDFG+AR  G N + ANTNR+VGT
Sbjct  528  IHRDLKASNILLDHDLNPKISDFGMARTFGRNASEANTNRIVGT  571



>ref|XP_010249750.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X1 [Nelumbo nucifera]
Length=836

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+++NPKISDFG+AR  G NE+ ANTNRVVGT
Sbjct  639  IHRDLKASNILLDDELNPKISDFGMARIFGQNESEANTNRVVGT  682



>ref|XP_008226745.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X2 [Prunus mume]
Length=813

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARN-IGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR  IG +++G NTNRVVGT
Sbjct  618  IHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGT  662



>ref|XP_008226744.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X1 [Prunus mume]
Length=815

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARN-IGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR  IG +++G NTNRVVGT
Sbjct  620  IHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGT  664



>gb|KDO56867.1| hypothetical protein CISIN_1g039516mg [Citrus sinensis]
Length=345

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+ +N KISDFG+AR  G+NE+GANTNR+VGT
Sbjct  130  IHRDLKASNILLDDQLNTKISDFGMARIFGVNESGANTNRIVGT  173



>ref|XP_010229650.1| PREDICTED: uncharacterized protein LOC100827116 [Brachypodium 
distachyon]
Length=1437

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = +1

Query  1     IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGTLHG  138
             IHRDLKA   +LD++MNPKISDFGLAR  G NET ANT+RV+GT HG
Sbjct  1245  IHRDLKASNILLDDNMNPKISDFGLARIFGSNETHANTSRVMGT-HG  1290


 Score = 64.7 bits (156),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD D+NPKISDFG+AR  G N T ANTNRVVGT
Sbjct  504  IHRDLKASNILLDRDLNPKISDFGMARIFGSNMTEANTNRVVGT  547



>ref|XP_006452089.1| hypothetical protein CICLE_v10008568mg [Citrus clementina]
 gb|ESR65329.1| hypothetical protein CICLE_v10008568mg [Citrus clementina]
Length=391

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+DMNPKISDFGLAR  G +ET  NTNRVVGT
Sbjct  196  IHRDLKASNVLLDHDMNPKISDFGLARTCGGDETEGNTNRVVGT  239



>ref|XP_010249751.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase CES101 isoform X2 [Nelumbo nucifera]
Length=835

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD+++NPKISDFG+AR  G NE+ ANTNRVVGT
Sbjct  638  IHRDLKASNILLDDELNPKISDFGMARIFGQNESEANTNRVVGT  681



>ref|XP_002460811.1| hypothetical protein SORBIDRAFT_02g035360 [Sorghum bicolor]
 gb|EER97332.1| hypothetical protein SORBIDRAFT_02g035360 [Sorghum bicolor]
Length=662

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD D+NPKISDFG+AR  G N T ANTNRVVGT
Sbjct  452  IHRDLKASNILLDKDLNPKISDFGMARIFGSNMTEANTNRVVGT  495



>ref|XP_008226747.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase At4g27290 isoform X4 [Prunus mume]
Length=716

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 2/45 (4%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARN-IGLNETGANTNRVVGT  129
            IHRDLKA   +LDN+MNPKISDFGLAR  IG +++G NTNRVVGT
Sbjct  521  IHRDLKASNVLLDNEMNPKISDFGLARTLIGGDQSGGNTNRVVGT  565



>ref|XP_010442801.1| PREDICTED: putative cysteine-rich receptor-like protein kinase 
12 [Camelina sativa]
Length=690

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 1/44 (2%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT  129
            IHRDLKA   +LD DMNPKI+DFG+AR  G++++GANT R+VGT
Sbjct  484  IHRDLKASNILLDADMNPKIADFGMARIFGMDQSGANTTRIVGT  527



>ref|XP_010057674.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Eucalyptus 
grandis]
 gb|KCW74849.1| hypothetical protein EUGRSUZ_E03586 [Eucalyptus grandis]
Length=671

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 10/58 (17%)
 Frame = +1

Query  1    IHRDLKA-RFMLDNDMNPKISDFGLARNIGLNETGANTNRVVGT---------LHGNF  144
            IHRDLKA   +LD+DMNPKISDFG+AR   L++T A TNRVVGT         +HGNF
Sbjct  462  IHRDLKASNILLDSDMNPKISDFGMARLFELDQTQAETNRVVGTYGYMAPEYAMHGNF  519



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517806786618